WorldWideScience

Sample records for antimony 106

  1. Antimony Toxicity

    Directory of Open Access Journals (Sweden)

    Shyam Sundar

    2010-12-01

    Full Text Available Antimony toxicity occurs either due to occupational exposure or during therapy. Occupational exposure may cause respiratory irritation, pneumoconiosis, antimony spots on the skin and gastrointestinal symptoms. In addition antimony trioxide is possibly carcinogenic to humans. Improvements in working conditions have remarkably decreased the incidence of antimony toxicity in the workplace. As a therapeutic, antimony has been mostly used for the treatment of leishmaniasis and schistosomiasis. The major toxic side-effects of antimonials as a result of therapy are cardiotoxicity (~9% of patients and pancreatitis, which is seen commonly in HIV and visceral leishmaniasis co-infections. Quality control of each batch of drugs produced and regular monitoring for toxicity is required when antimonials are used therapeutically.

  2. Vapor pressures of dimethylcadmium, trimethylbismuth, and tris(dimethylamino)antimony

    Czech Academy of Sciences Publication Activity Database

    Morávek, Pavel; Fulem, Michal; Pangrác, Jiří; Hulicius, Eduard; Růžička, K.

    2013-01-01

    Roč. 360, Dec (2013), s. 106-110. ISSN 0378-3812 R&D Projects: GA ČR GA13-15286S; GA MŠk(CZ) LM2011026 Institutional support: RVO:68378271 Keywords : vapor pressure * dimethylcadmium * trimethylbismuth * tris(dimethylamino)antimony * sublimation and vaporization enthalpy Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 2.241, year: 2013

  3. Pentavalent Antimonials: New Perspectives for Old Drugs

    OpenAIRE

    Ribeiro, Raul R.; Cynthia Demicheli; Frédéric Frézard

    2009-01-01

    Pentavalent antimonials, including meglumine antimoniate and sodium stibogluconate, have been used for more than half a century in the therapy of the parasitic disease leishmaniasis. Even though antimonials are still the first-line drugs, they exhibit several limitations, including severe side effects, the need for daily parenteral administration and drug resistance. The molecular structure of antimonials, their metabolism and mechanism of action are still being investigated. Some recent stud...

  4. Pentavalent Antimonials: New Perspectives for Old Drugs

    Directory of Open Access Journals (Sweden)

    Raul R. Ribeiro

    2009-06-01

    Full Text Available Pentavalent antimonials, including meglumine antimoniate and sodium stibogluconate, have been used for more than half a century in the therapy of the parasitic disease leishmaniasis. Even though antimonials are still the first-line drugs, they exhibit several limitations, including severe side effects, the need for daily parenteral administration and drug resistance. The molecular structure of antimonials, their metabolism and mechanism of action are still being investigated. Some recent studies suggest that pentavalent antimony acts as a prodrug that is converted to active and more toxic trivalent antimony. Other works support the direct involvement of pentavalent antimony. Recent data suggest that the biomolecules, thiols and ribonucleosides, may mediate the actions of these drugs. This review will summarize the progress to date on the chemistry and biochemistry of pentavalent antimony. It will also present the most recent works being done to improve antimonial chemotherapy. These works include the development of simple synthetic methods for pentavalent antimonials, liposome-based formulations for targeting the Leishmania parasites responsible for visceral leishmaniasis and cyclodextrin-based formulations to promote the oral delivery of antimony.

  5. FIRST REPORT ON OTOTOXICITY OF MEGLUMINE ANTIMONIATE

    Directory of Open Access Journals (Sweden)

    Cláudia Maria Valete-Rosalino

    2014-09-01

    Full Text Available Introduction: Pentavalent antimonials are the first drug of choice in the treatment of tegumentary leishmaniasis. Data on ototoxicity related with such drugs is scarcely available in literature, leading us to develop a study on cochleovestibular functions. Case Report: A case of a tegumentary leishmaniasis patient, a 78-year-old man who presented a substantial increase in auditory threshold with tinnitus and severe rotatory dizziness during the treatment with meglumine antimoniate, is reported. These symptoms worsened in two weeks after treatment was interrupted. Conclusion: Dizziness and tinnitus had already been related to meglumine antimoniate. However, this is the first well documented case of cochlear-vestibular toxicity related to meglumine antimoniate.

  6. Antimony bioavailability in mine soils

    International Nuclear Information System (INIS)

    Antimony has low bioavailability in mining and smelting contaminated soils and bacterial biosensors are not suitable for its detection. - Five British former mining and smelting sites were investigated and found to have levels of total Sb of up to 700 mg kg-1, indicating high levels of contamination which could be potentially harmful. However, this level of Sb was found to be biologically unavailable over a wide range of pH values, indicating that Sb is relatively unreactive and immobile in the surface layers of the soil, remaining where it is deposited rather than leaching into lower horizons and contaminating ground water. Sb, sparingly soluble in water, was unavailable to the bacterial biosensors tested. The bioluminescence responses were correlated to levels of co-contaminants such as arsenic and copper, rather than to Sb concentrations. This suggests that soil contamination by Sb due to mining and smelting operations is not a severe risk to the environment or human health provided that it is present as immobile species and contaminated sites are not used for purposes which increase the threat of exposure to identified receptors. Co-contaminants such as arsenic and copper are more bioavailable and may therefore be seen as a more significant risk

  7. Perspectives of antimony compounds in oncology

    Institute of Scientific and Technical Information of China (English)

    Pankaj SHARMA; Diego PEREZ; Armando CABRERA; Nee ROSAS; Jose Luis ARIAS

    2008-01-01

    Antimony, a natural element that has been used as a drug for over more than 100 years, has remarkable therapeutic efficacy in patients with acute promyelocytic leukemia. This review focuses on recent advances in developing antimony anti- cancer agents with an emphasis on antimony coordination complexes, Sb (Ⅲ) and Sb (V). These complexes, which include many organometallic complexes, may provide a broader spectrum of antitumoral activity. They were compared with classical platinum anticancer drugs. The review covers the literature data pub- lished up to 2007. A number of antimonials with different antitumoral activities are known and have diverse applications, even though little research has been done on their possibilities. It might be feasible to develop more specific and effective inhibitors for phosphatase-targeted, anticancer therapeutics through the screen- ing of sodium stibogluconate (SSG) and potassium antimonyltartrate-related compounds, which are comprised of antimony conjugated to different organic moieties. For example, SSG appears to be a better inhibitor than suramin which is a compound known for its antineoplastic activity against several types of cancers.

  8. Preparation of nanosized antimony by mechanochemical reduction of antimony sulphide Sb2S3

    International Nuclear Information System (INIS)

    The preparation of nanosized antimony (grain size 19 nm) by high-energy milling of antimony sulphide Sb2S3 with elemental Fe as reducing element is reported. The mechanochemical reduction was performed in a planetary ball mill for 10-180 min. The process is rather straightforward with elemental antimony and iron sulphide (pyrrhotite-4H) being the only solid-state products. The process kinetics as described by X-ray diffraction (XRD) and vibrating sample magnetometer (VSM) magnetometry shows that most of the reduction is complete after 60 min of milling

  9. The Membrane Electrowinning Separation of Antimony from a Stibnite Concentrate

    Science.gov (United States)

    Yang, Jian-Guang; Yang, Sheng-Hai; Tang, Chao-Bo

    2010-06-01

    The main purpose of this study was to characterize and to extract antimony from a stibnite concentrate through electrowinning. This article reports an account of a study conducted on the optimization of the process parameters for antimony pentachloride circular leaching, purification, and electrowinning of antimony from antimony trichloride solution. The effect of electrowinning parameters, such as antimony and sodium chloride concentration in the catholyte, temperature, current density, polar distance, etc., on the voltage requirement and the current efficiency (CE) of antimony electrodeposition was explored. A maximum CE of more than 97 pct was attained with a catholyte composition of 70-g/L antimony, 25-g/L NaCl, 4.5-mol/L hydrogen ion concentration, with an anolyte composition of 40-g/L antimony trichloride at a temperature of 328 K (55 °C), a 4-cm polar distance, and a cathode current density of 200 A/m2. Under the optimized conditions, the CE was more than 97 pct, and a 99.98 pct antimony plate was obtained on the cathode. The chemical content analysis of the resulting anolyte was indicated to be 97 pct antimony pentachloride and 3 pct antimony trichloride, which could be recycled to leaching tank as the leaching agent.

  10. Synthesis and application of antimony pent(isooctyl thioglycollate)

    Institute of Scientific and Technical Information of China (English)

    LIU You-nian; LI Hong-bing; SHU Wan-gen; CHEN Qi-yuan

    2005-01-01

    A new type of thermal stabilizer, antimony pent(isooctyl thioglycollate)(Sb(SCH2COOC8H17)5), was synthesized by using antimony trioxide, isooctanol and thioglycolic acid in 2 steps. Firstly, antimony trioxide was oxidized into colloidal antimony peroxide. Then antimony peroxide and isooctyl thioglycollate reacted stoichiometrically for 2 h with the yield of 87%. This compound was used as thermal stabilizer for polyvinyl chloride(PVC). The results show that the thermal stability time is 52 min at 200 ℃ by heat-ageing oven test when adding 2.5% thermal stabilizer to PVC resin. Compared with antimony tris(isooctyl thiolycollate), the initial thermal stability of antimony pent(isooctyl thioglycollate) is better than that of antimony tris(isooctyl thioglycollate), while the long-term thermal stability time is shorter than that of antimony tris(isooctyl thioglycollate). Meanwhile, the synergism of antimony pent(isooctyl thioglycollate) with calcium stearate was studied, indicating that when the mass ratio of antimony pent(isooctyl thioglycollate) to calcium stearate is 2:1, the thermal stability time of PVC is 58 min.

  11. Novel methods for the encapsulation of meglumine antimoniate into liposomes

    Directory of Open Access Journals (Sweden)

    F. Frézard

    2000-07-01

    Full Text Available The antimonial drug, meglumine antimoniate, was successfully encapsulated in dehydration-rehydration vesicles and in freeze-dried empty liposomes (FDELs. High encapsulation efficiencies (from 28 to 58% and low weight ratios of lipids to encapsulated antimony (from 1:0.15 to 1:0.3 were achieved. These formulations, contrary to those obtained by conventional methods, can be stored as intermediate lyophilized forms and reconstituted just before use. The efficacy of FDEL-encapsulated meglumine antimoniate was evaluated in hamsters experimentally infected with Leishmania chagasi. A significant reduction of liver parasite burdens was observed in animals treated with this preparation, when compared to control animals treated with empty liposomes. In contrast, free meglumine antimoniate was found to be inefficient when administered at a comparable dose of antimony. This novel liposome-based meglumine antimoniate formulation appears to be promising as a pharmaceutical product for the treatment of visceral leishmaniasis.

  12. Microbial antimony biogeochemistry: Enzymes, regulation, and related metabolic pathways

    Science.gov (United States)

    Li, Jingxin; Qian Wang; Oremland, Ronald S.; Kulp, Thomas R.; Rensing, Christopher; Wang, Gejiao

    2016-01-01

    Antimony (Sb) is a toxic metalloid that occurs widely at trace concentrations in soil, aquatic systems, and the atmosphere. Nowadays, with the development of its new industrial applications and the corresponding expansion of antimony mining activities, the phenomenon of antimony pollution has become an increasingly serious concern. In recent years, research interest in Sb has been growing and reflects a fundamental scientific concern regarding Sb in the environment. In this review, we summarize the recent research on bacterial antimony transformations, especially those regarding antimony uptake, efflux, antimonite oxidation, and antimonate reduction. We conclude that our current understanding of antimony biochemistry and biogeochemistry is roughly equivalent to where that of arsenic was some 20 years ago. This portends the possibility of future discoveries with regard to the ability of microorganisms to conserve energy for their growth from antimony redox reactions and the isolation of new species of “antimonotrophs.”

  13. Vacuum Evaporation Technology for Treating Antimony-Rich Anode Slime

    Science.gov (United States)

    Qiu, Keqiang; Lin, Deqiang; Yang, Xuelin

    2012-11-01

    A vacuum evaporation technology for treating antimony-rich anode slime was developed in this work. Experiments were carried out at temperatures from 873 K to 1073 K and residual gas pressures from 50 Pa to 600 Pa. During vacuum evaporation, silver from the antimony-rich anode slime was left behind in the distilland in a silver alloy containing antimony and lead, and antimony trioxide was evaporated. The experimental results showed that 92% by weight of antimony can be removed, and the silver content in the alloy was up to 12.84%. The antimony trioxide content in the distillate was more than 99.7%, and the distillate can be used directly as zero-grade antimony trioxide (China standard).

  14. In vitro antileishmanial properties of neutron-irradiated meglumine antimoniate

    International Nuclear Information System (INIS)

    Pentavalent antimony, as meglumine antimoniate (Glucantime) or sodium stibogluconate (Pentostam), is the main treatment for leishmaniasis, a complex of diseases caused by the protozoan Leishmania, and an endemic and neglected threat in Brazil. Despite over half a century of clinical use, their mechanism of action, toxicity and pharmacokinetic data remain unknown. The analytical methods for determination of antimony in biological systems remain complex and have low sensitivity. Radiotracer studies have a potential in pharmaceutical development. The aim of this study was to obtain a radiotracer for antimony, with suitable physical and biological properties. Meglumine antimoniate was neutron irradiated inside the IEA-R1 nuclear reactor, producing two radioisotopes 122 Sb and 124 Sb, with high radionuclidic purity and good specific activity. This compound showed the same antileishmanial activity as the native compound. The use of the radiotracers, easily created by neutron irradiation, could be an interesting tool to solve important questions in antimonial pharmacology. (author)

  15. In vitro antileishmanial properties of neutron-irradiated meglumine antimoniate

    Energy Technology Data Exchange (ETDEWEB)

    Borborema, Samanta Etel Treiger; Nascimento, Nanci do [Instituto de Pesquisas Energeticas e Nucleares (IPEN-CNEN/SP), SP (Brazil). Lab. de Biologia Molecular]. E-mail: samanta@usp.br; Osso Junior, Joao Alberto [Instituto de Pesquisas Energeticas e Nucleares (IPEN-CNEN/SP), SP (Brazil). Centro de Radiofarmacia]. E-mail: jaosso@ipen.br; Andrade Junior, Heitor Franco de [Instituto de Medicina Tropical de Sao Paulo (IMT-SP), SP (Brazil). Lab. de Protozoologia]. E-mail:hfandrad@usp.br

    2005-10-15

    Pentavalent antimony, as meglumine antimoniate (Glucantime) or sodium stibogluconate (Pentostam), is the main treatment for leishmaniasis, a complex of diseases caused by the protozoan Leishmania, and an endemic and neglected threat in Brazil. Despite over half a century of clinical use, their mechanism of action, toxicity and pharmacokinetic data remain unknown. The analytical methods for determination of antimony in biological systems remain complex and have low sensitivity. Radiotracer studies have a potential in pharmaceutical development. The aim of this study was to obtain a radiotracer for antimony, with suitable physical and biological properties. Meglumine antimoniate was neutron irradiated inside the IEA-R1 nuclear reactor, producing two radioisotopes {sup 122} Sb and {sup 124} Sb, with high radionuclidic purity and good specific activity. This compound showed the same antileishmanial activity as the native compound. The use of the radiotracers, easily created by neutron irradiation, could be an interesting tool to solve important questions in antimonial pharmacology. (author)

  16. In Vitro antileishmanial properties of neutron-irradiated meglumine antimoniate

    OpenAIRE

    Samanta Etel Treiger Borborema; Heitor Franco de Andrade Junior; João Alberto Osso Junior; Nanci do Nascimento

    2005-01-01

    Pentavalent antimony, as meglumine antimoniate (Glucantime® ) or sodium stibogluconate (Pentostam® ), is the main treatment for leishmaniasis, a complex of diseases caused by the protozoan Leishmania, and an endemic and neglected threat in Brazil. Despite over half a century of clinical use, their mechanism of action, toxicity and pharmacokinetic data remain unknown. The analytical methods for determination of antimony in biological systems remain complex and have low sensitivity. Radiotracer...

  17. The exposure to and health effects of antimony

    DEFF Research Database (Denmark)

    Cooper, Ross G.; Harrison, Adrian Paul

    2009-01-01

    . Antimony toxicity is dependent on the exposure dose, duration, route (breathing, eating, drinking, or skin contact), other chemical exposures, age, sex, nutritional status, family traits, life style, and state of health. Chronic exposure to antimony in the air at levels of 9 mg/m3 may exacerbate irritation...

  18. The presence of antimony in various dental filling materials

    International Nuclear Information System (INIS)

    Antimony was determined in a number of non-metallic dental materials currently used for tooth restoration. The method applied was instrumental neutron activation analysis. The concentration of antimony in some of the brands tested was found to be as high as 900 fold that in the normal hard dental tissues. (author)

  19. Pharmacokinetic of antimony in mice with cutaneous Leishmaniasis

    International Nuclear Information System (INIS)

    Cutaneous Leishmaniasis (CL) remains a major world health problem, with about 1.5 million new cases each year. Caused by protozoa Leishmania, in South America, this infection can vary from a chronic skin ulcer, to an erosive mucosal disease and severe facial disfigurement. Pentavalent antimony (Sb+5) as sodium stibogluconate (Pentostam) or meglumine antimoniate (Glucantime) are main drugs for treating most forms of human leishmaniasis. For six decades, despite the recent developments, the effective therapy to cutaneous leishmaniasis has been based on long parenteral courses of such drugs, even though these are fairly costly, toxic and inconvenient to use, without adequate knowledge on their pharmacokinetics or mechanism of action. Pharmacokinetics studies could be based on bioactive traceable drugs, usually with radioactive isotopes, but antimony radioisotopes are unavailable commercially. Neutron irradiation is a powerful tool in the analysis of mineral content of samples, for antimony, there are at least two main isotopes that could be formed after neutron irradiation in nuclear reactor. The aim of the present study was to construct antimony salts with those radioisotopes to obtain tracers to compare the pharmacokinetic and the tissue distribution of neutron irradiated meglumine antimoniate in healthy and cutaneous leishmaniasis experimentally infected mice. Meglumine antimoniate, (Glucantime, Aventis, S.P, Brazil), was neutron irradiated inside the IEA-R1 nuclear reactor (IPEN/CNEN-SP), producing two radioisotopes 122Sb and 124Sb. Its biodistribution was verified in BALB/c mice experimentally infected with Leishmania (Leishmania) Amazonensis, which received a single intraperitoneal dose of the drug. At different times after injection, the tissues and blood were excised and activity measured in a NaI (Tl) scintillation counter. Compared with the healthy mice, experimentally infected mice had significantly lower maximum concentration of antimony and high uptake in

  20. Pharmacokinetic of antimony in mice with cutaneous Leishmaniasis

    Energy Technology Data Exchange (ETDEWEB)

    Borborema, Samanta E.T.; Nascimento, Nanci do [Instituto de Pesquisas Energeticas e Nucleares IPEN/CNEN-SP, Sao Paulo, SP (Brazil). Lab. de Biologia Molecular]. E-mails: samanta@usp.br; nnascime@ipen.br; Andrade Junior, Heitor F. de [Instituto de Pesquisas Energeticas e Nucleares IPEN/CNEN-SP, Sao Paulo, SP (Brazil). Lab. de Biologia Molecular; Instituto de Medicina Tropical de Sao Paulo, Sao Paulo, SP (Brazil); E-mail: hfandrad@usp.br; Osso Junior, Joao A. [Instituto de Pesquisas Energeticas e Nucleares IPEN/CNEN-SP, Sao Paulo, SP (Brazil). Centro de Radiofarmacia]. E-mail: jaosso@ipen.br

    2007-07-01

    Cutaneous Leishmaniasis (CL) remains a major world health problem, with about 1.5 million new cases each year. Caused by protozoa Leishmania, in South America, this infection can vary from a chronic skin ulcer, to an erosive mucosal disease and severe facial disfigurement. Pentavalent antimony (Sb{sup +5}) as sodium stibogluconate (Pentostam) or meglumine antimoniate (Glucantime) are main drugs for treating most forms of human leishmaniasis. For six decades, despite the recent developments, the effective therapy to cutaneous leishmaniasis has been based on long parenteral courses of such drugs, even though these are fairly costly, toxic and inconvenient to use, without adequate knowledge on their pharmacokinetics or mechanism of action. Pharmacokinetics studies could be based on bioactive traceable drugs, usually with radioactive isotopes, but antimony radioisotopes are unavailable commercially. Neutron irradiation is a powerful tool in the analysis of mineral content of samples, for antimony, there are at least two main isotopes that could be formed after neutron irradiation in nuclear reactor. The aim of the present study was to construct antimony salts with those radioisotopes to obtain tracers to compare the pharmacokinetic and the tissue distribution of neutron irradiated meglumine antimoniate in healthy and cutaneous leishmaniasis experimentally infected mice. Meglumine antimoniate, (Glucantime, Aventis, S.P, Brazil), was neutron irradiated inside the IEA-R1 nuclear reactor (IPEN/CNEN-SP), producing two radioisotopes {sup 122}Sb and {sup 124}Sb. Its biodistribution was verified in BALB/c mice experimentally infected with Leishmania (Leishmania) Amazonensis, which received a single intraperitoneal dose of the drug. At different times after injection, the tissues and blood were excised and activity measured in a NaI (Tl) scintillation counter. Compared with the healthy mice, experimentally infected mice had significantly lower maximum concentration of antimony

  1. Separation of traffic related antimony compounds

    International Nuclear Information System (INIS)

    Complete text of publication follows. It is known that most of the brake pads contain Sb2S3 as lubricant to achieve better friction stability. Due to braking the brake lining crumbles away and its Sb content gets into the air. As a result of the temperature increase accompanying the braking a part of the antimony may oxidize to oxides, as Sb2O3 or even to the more stable form, Sb2O4. Since Sb2O3 more readily soluble than the others, its absorption from the lung so its environmental impact effect is more harmful. After a systematic investigation involving solubilization of the solid compounds, citric and tartaric acid as well as 6 mol/dm3 HCl were tested for leaching of trace antimony compounds from natural matrix. To prepare reference material related to these species, soil and activated charcoal was spiked in 10 μg/g concentration with all the three material (Sb2S3, Sb2O3,Sb2O4). separately. Recovery of the different forms was checked by graphite furnace atomic absorption spectrometric (GFAAS) analysis of the leachates. The soil was confirmed to oxidize the sulfide content while the activated charcoal was established to enrich antimony from HCl solution as ion association complex. It was concluded, that Sb2S3 is leached only in slight amount in 4 hours by 0.1-0.5 mol/dm3 citric acid, while leaching of Sb2O3 is quantitative. On the other side, it was proved that Sb2O3 as well as Sb2S3 traces are soluble in 6 HCl solution in 60 min, whilst Sb2O4 is not destroyed. So, the Sb2O3 and Sb2S3 content of a flying dust can be determined. The GFAAS temperature program had to be modified in order to be capable to analyze high organic matrix as citric or tartaric acid even in 0.5 mol/dm3 concentration. Concerning their decomposition temperature an additional step was inserted into the temperature program, pyrolysis on 300 and 400 deg C, respectively. The antimony concentration of the highly acidic leachates were determined by hydride generation GFAAS. The reproducibility of

  2. Reducing NOx emissions with antimony additive

    International Nuclear Information System (INIS)

    This paper describes improvement in a process for the catalytic cracking of a heavy hydrocarbon feed containing Ni and nitrogen compounds by contact with a circulating inventory of catalytic cracking catalyst to produce catalytically cracked products and spent catalyst. It comprises: Ni or Ni compounds and coke comprising nitrogen compounds, and wherein the spent catalyst is regenerated by contact with oxygen or an oxygen-containing gas in a catalyst regeneration zone operating at catalyst regeneration conditions to produce hot regenerated catalyst comprising Ni or Ni compounds which is recycled to catalytically crack the heavy feed and the catalyst regeneration zone produces a flue gas comprising CO, CO2 and oxides of nitrogen, NOx. The improvement comprises: adding to the circulating catalyst inventory CO combustion promoter in an amount equivalent to 0.01 to 50 wt ppm Pt to reduce the CO content of the flue gas and reducing the NOx content of the flue gas by adding to the circulating catalyst inventory a separate particle additive comprising antimony. The additive being added in an amount sufficient to reduce the production of NOx relative to operation without the additive, and wherein the additive comprises a compound of antimony which does not substantially passivate the Ni or Ni compounds present on the cracking catalyst, nor deactivate the CO combustion promoter

  3. Investigation into antimony mobility in sewage sludge fermentation.

    Science.gov (United States)

    Wehmeier, Silvia; Feldmann, Jörg

    2005-12-01

    Antimony is distributed in the environment in inorganic and organic species with different solubility and mobility characters. Here we investigate the transformation of antimony in view of biomethylation during sewage sludge fermentation as a case study for an anaerobic environment. Our approach was to identify if antimony methylation follows the Challenger pathway by using isotopically enriched antimonite (123Sb(v)). The antimony source was subjected to methylation in sewage sludge, an anaerobic dominant methanogenic Archaea community. The antimony species were determined in the gas phase using cryotrapping (CT)-GC-ICP-MS, and in the medium (sewage slude) by hydride generation (HG) prior CT-GC-ICP-MS. The determined 123/121Sb isotope ratios in the volatile trimethylstibine and non-volatile methylantimony species indicated that the methylation follows the proposed methylation pathway. With this approach we were able to quantify 123Sb incorporation into monomethyl-, dimethyl- and trimethylantimony, respectively. The incorporation decreased with further methylation from 91% to 82% and 73%. Volatilisation as trimethystibine was generally lower than 0.1%, however, up to 0.8% of added antimony was found methylated to methylantimony species and mainly accumulated in the cell. Moreover, antimony biomethylation was enhanced by stimulation of the anaerobic communities of methanogenic Archaea and sulfate reducing bacteria (SRB), with the methanogens showing a higher activity. PMID:16307071

  4. Antimony film sensor for sensitive rare earth metal analysis in environmental samples.

    Science.gov (United States)

    Makombe, Martin; van der Horst, Charlton; Silwana, Bongiwe; Iwuoha, Emmanuel; Somerset, Vernon

    2016-07-01

    A sensor for the adsorptive stripping voltammetric determination of rare earth elements has been developed. The electrochemical procedure is based on the oxidation of the rare earth elements complexed with alizarin complexone at a glassy carbon electrode that was in situ modified with an antimony film, during an anodic scan from -0.2 V to 1.1 V (vs. Ag/AgCl) and deposition potential of -0.1 V (vs. Ag/AgCl). The factors influencing the adsorptive stripping capability were optimised, including the complexing agent concentration, plating concentration of antimony and deposition time. The detection of rare earth elements (La, Ce and Pr) were realised in 0.08 M sodium acetate (pH = 5.8) solution as supporting electrolyte, with 2 × 10(-6) M alizarin complexone and 1.0 mg L(-1) antimony solution. Under the optimised conditions, a deposition time of 360 s was obtained and a linear response was observed between 1 and 25 µg L(-1). The reproducibility of the voltammetric measurements was found to be within 5.0% RSD for 12 replicate measurements of cerium(III) concentration of 5 µg L(-1) using the same electrode surface. The detection limits obtained using stripping analysis was 0.06, 0.42 and 0.71 μg L(-1) for Ce(III), La(III) and Pr(III), respectively. The developed sensor has been successfully applied for the determination of cerium, lanthanum and praseodymium in municipal tap water samples. PMID:27065049

  5. Structural and electrical characterization of zinc oxide doped with antimony

    Directory of Open Access Journals (Sweden)

    G. Juárez Díaz

    2014-08-01

    Full Text Available In this work we report the results of structural and electrical characterization realized on zinc oxide single crystal samples with (001 orientation, which were doped with antimony. Doping was carried out by antimony thermal diffusion at 1000 °C for periods of 1 and 2 hours under nitrogen environment from a solid source formed by antimony oxide. Electrical characterization by I-V curves and Hall effect shown an increase in acceptor concentration which demonstrates that doping is effective and create holes in zinc oxide samples.

  6. Nanometric Antimony Powder Synthesis by Activated Alkaline Hydride Reduction of Antimony Pentachloride

    International Nuclear Information System (INIS)

    A novel chemical reduction method using an activated alkaline hydride (LiH or NaH-t-BuONa) in tetrahydrofuran solvent has been applied to antimony salt reduction. X-ray diffraction and transmission electron microscopy studies have been carried out to characterize the morphology and structure of the materials. Alkali hydride nature influence has been proved. In both cases the process allows to prepare antimony particles in nanometer range from few nanometers to about 20nm which could be used as anodic materials for lithium-ion batteries. With lithium hydride well-crystallized particles inclined to agglomeration were observed whereas finely dispersed amorphous particles were pointing out after activated sodium hydride reduction

  7. Deposition of rod-shaped antimony sulfide thin films from single-source antimony thiosemicarbazone precursors

    Energy Technology Data Exchange (ETDEWEB)

    Biswal, Jasmine B.; Sawant, Narayan V. [Department of Chemistry, University of Mumbai, Vidyanagari, Santacruz (East), Mumbai - 400 098 (India); Garje, Shivram S., E-mail: ssgarje@chem.mu.ac.i [Department of Chemistry, University of Mumbai, Vidyanagari, Santacruz (East), Mumbai - 400 098 (India)

    2010-04-02

    Antimony sulfide thin films were deposited on glass substrates by aerosol assisted chemical vapour deposition technique using single source precursors, namely, antimony(III) thiosemicarbazones, SbCl{sub 3}(L) (L = thiosemicarbazones of thiophene-2-carboxaldehyde (1) and cinnamaldehyde (2)). The deposited films were characterized by X-ray diffraction, scanning electron microscopy, energy dispersive X-ray analysis and UV-visible spectroscopy in order to identify their phases, morphologies, compositions and optical properties respectively. These characterizations revealed that the films were comprised of rod-shaped particles of orthorhombic stibnite (Sb{sub 2}S{sub 3}) with a Sb:S stoichiometry of {approx} 1:1.3. The calculated optical band gap from UV-vis absorption spectrum is found to be 3.48 eV.

  8. Antimony mobility in Japanese agricultural soils and the factors affecting antimony sorption behavior

    International Nuclear Information System (INIS)

    The mobility of antimony (Sb) in Japanese agricultural soils was studied by radiotracer experiments using 124Sb tracer. The soil-solution distribution coefficients (K d) of Sb were measured for 110 soil samples. These K ds ranged from 1 to 2065 L kg-1; the geometric mean was 62 L kg-1 excluding one extremely high value, 2065 L kg-1. Experimental measurement of K d showed a decrease with both increasing pH and increasing phosphate concentration. The latter suggested that one aspect of the Sb sorption phenomena in Japanese soil was influenced by specific adsorption of anions such as phosphate. However, other aspects could not be explained by this specific adsorption mechanism, because only 20-40% of soil-sorbed Sb could be extracted by phosphate solution. - Antimony mobility in tested Japanese agricultural soils was generally low and was affected by pH and phosphate concentration

  9. Selective determination of antimony(III) and antimony(V) with ammonium pyrrolidinedithiocarbamate, sodium diethyldithiocarbamate and dithizone by atomic-absorption spectrometry with a carbon-tube atomizer.

    Science.gov (United States)

    Kamada, T; Yamamoto, Y

    1977-05-01

    The extraction behaviour of antimony(III) and antimony(V) with ammonium pyrrolidinedithiocarbamate, sodium diethyldithiocarbamate and dithizone in organic solvents has been investigated by means of frameless atomic-absorption spectrophotometry with a carbon-tube atomizer. The selective extraction of antimony(III) and differential determination of antimony(III) and antimony(V) have been developed. With ammonium pyrrolidinedithiocarbamate and methyl isobutyl ketone, when the aqueous phase/solvent volume ratio is 50 ml/10 ml and the injection volume in the carbon tube is 20 mul, the sensitivity for antimony is 0.2 ng/ml for 1% absorption. The relative standard deviations are ca. 2%. Interferences by many metal ions can be prevented by masking with EDTA. The proposed methods have been applied satisfactorily to determination of antimony(III) and antimony(V) in various types of water. PMID:18962096

  10. Antimony distribution and environmental mobility at an historic antimony smelter site, New Zealand

    International Nuclear Information System (INIS)

    A historic antimony smelter site at Endeavour Inlet, New Zealand has smelter residues with up to 17 wt.% antimony. Residues include coarse tailings (cm scale particles, poorly sorted), sand tailings (well sorted) and smelter slag (blocks up to 30 cm across). All of this material has oxidised to some degree over the ca. 100 years since the site was abandoned. Oxidation has resulted in acidification of the residues down to pH 2-5. Smelter slag contains pyrrhotite (FeS) and metallic antimony, and oxidation is restricted to surfaces only. The coarse tailings are the most oxidised, and few sulfide grains persist. Unoxidised sand tailings contain 10-20 vol.% stibnite (Sb2S3) containing up to 5% As, with subordinate arsenopyrite (FeAsS), and minor pyrite (FeS2). The sand tailings are variably oxidised on a scale of 2-10 cm, but original depositional layering is preserved during oxidation and formation of senarmontite (Sb2O3). Oxidation of sand tailings has resulted in localised mobility of both Sb and As on the cm scale, resulting in redistribution of these metalloids with iron oxyhydroxide around sand grain boundaries. Experiments demonstrate that Sb mobility decreases with time on a scale of days. Attenuation of both As and Sb occurs due to adsorption on to iron oxyhydroxides which are formed during oxidation of the smelter residues. There is no detectable loss of Sb or As from the smelter site into the adjacent river, <50 m away, which has elevated Sb (ca. 20 μg/l) and As (ca. 7 μg /l) from mineralised rocks upstream. Despite the high concentrations of Sb and As in the smelter residues, these metalloids are not being released into the environment. - High levels of antimony in primitive smelter soils remain largely immobile on the metre scale

  11. Tissue distribution of residual antimony in rats treated with multiple doses of meglumine antimoniate

    Directory of Open Access Journals (Sweden)

    Deise Riba Coelho

    2014-07-01

    Full Text Available Meglumine antimoniate (MA and sodium stibogluconate are pentavalent antimony (SbV drugs used since the mid-1940s. Notwithstanding the fact that they are first-choice drugs for the treatment of leishmaniases, there are gaps in our knowledge of their toxicological profile, mode of action and kinetics. Little is known about the distribution of antimony in tissues after SbV administration. In this study, we evaluated the Sb content of tissues from male rats 24 h and three weeks after a 21-day course of treatment with MA (300 mg SbV/kg body wt/d, subcutaneous. Sb concentrations in the blood and organs were determined by inductively coupled plasma-mass spectrometry. In rats, as with in humans, the Sb blood levels after MA dosing can be described by a two-compartment model with a fast (t1/2 = 0.6 h and a slow (t1/2 >> 24 h elimination phase. The spleen was the organ that accumulated the highest amount of Sb, while bone and thyroid ranked second in descending order of tissues according to Sb levels (spleen >> bone, thyroid, kidneys > liver, epididymis, lungs, adrenals > prostate > thymus, pancreas, heart, small intestines > skeletal muscle, testes, stomach > brain. The pathophysiological consequences of Sb accumulation in the thyroid and Sb speciation in the liver, thyroid, spleen and bone warrant further studies.

  12. One-step synthesis of antimony-doped tin dioxide nanocrystallites and their property

    Institute of Scientific and Technical Information of China (English)

    ZHENG Min; WANG Bao

    2009-01-01

    Antimony-doped tin dioxide(ATO) nanoparticles with primary diameter in the range of 9-10 nm were rapidly synthesized via a novel combustion technique, starting with antimony trichloride and tin tetrachloride as metal sources and self-assembly compounds as fuels. The combustion phenomena and characteristics of products were controlled by assembling components in fuel compounds according to appropriate molar ratio. The as-synthesized products were characterized by XRD, SEM, TEM and XPS, respectively. The electrical conductivity was evaluated through measuring the antistatic property of polyester fiber treated by the as-synthesized products. The results show that a mild combustion phenomena without release of smoke can be taken on and perfect azury rutile ATO crystal with complete substitution can be formed rapidly under the appropriate synthetic conditions. The antistatic property of the polyester fiber treated by the as-synthesized ATO products is enhanced remarkably. The triboelectricity voltage below 1.0 kV, half life below 1.0 s and surface resistance below 1.0×106 Ω can be attained.

  13. How can we adapt to geological scarcity of antimony? Investigation of antimony's substitutability and of other measures to achieve a sustainable use

    NARCIS (Netherlands)

    Henckens, M.L.C.M.; Driessen, P.P.J.; Worrell, E.

    2016-01-01

    Abstract Antimony is an element that is applied in many useful applications for mankind. However, antimony resources are very scarce, when comparing the current extraction rates with the availability of antimony containing ores. From an inter-temporal sustainability perspective, current generations

  14. Cloud point extraction combined with electrothermal atomic absorption spectrometry for the speciation of antimony(III) and antimony(V) in food packaging materials

    International Nuclear Information System (INIS)

    A simple, sensitive method for the speciation of inorganic antimony by cloud point extraction combined with electrothermal atomic absorption spectrometry (ETAAS) is presented and evaluated. The method based on the fact that formation of a hydrophobic complex of antimony(III) with ammonium pyrrolidine dithiocarbamate (APDC) at pH 5.0 and subsequently the hydrophobic complex enter into surfactant-rich phase, whereas antimony(V) remained in aqueous solutions. Antimony(III) in surfactant-rich phase was analyzed by ETAAS after dilution by 0.2 mL nitric acid in methanol (0.1 M), and antimony(V) was calculated by subtracting antimony(III) from the total antimony after reducing antimony(V) to antimony(III) by L-cysteine. The main factors affecting the cloud point extraction, such as pH, concentration of APDC and Triton X-114, equilibrium temperature and incubation time, sample volume were investigated in detail. Under the optimum conditions, the detection limit (3σ) of the proposed method was 0.02 ng mL-1 for antimony(III), and the relative standard deviation was 7.8% (c = 1.0 ng mL-1, n = 7). The proposed method was successfully applied to speciation of inorganic antimony in the leaching solutions of different food packaging materials with satisfactory results.

  15. Cloud point extraction combined with electrothermal atomic absorption spectrometry for the speciation of antimony(III) and antimony(V) in food packaging materials.

    Science.gov (United States)

    Jiang, Xiuming; Wen, Shengping; Xiang, Guoqiang

    2010-03-15

    A simple, sensitive method for the speciation of inorganic antimony by cloud point extraction combined with electrothermal atomic absorption spectrometry (ETAAS) is presented and evaluated. The method based on the fact that formation of a hydrophobic complex of antimony(III) with ammonium pyrrolidine dithiocarbamate (APDC) at pH 5.0 and subsequently the hydrophobic complex enter into surfactant-rich phase, whereas antimony(V) remained in aqueous solutions. Antimony(III) in surfactant-rich phase was analyzed by ETAAS after dilution by 0.2 mL nitric acid in methanol (0.1M), and antimony(V) was calculated by subtracting antimony(III) from the total antimony after reducing antimony(V) to antimony(III) by l-cysteine. The main factors affecting the cloud point extraction, such as pH, concentration of APDC and Triton X-114, equilibrium temperature and incubation time, sample volume were investigated in detail. Under the optimum conditions, the detection limit (3 sigma) of the proposed method was 0.02 ng mL(-1) for antimony(III), and the relative standard deviation was 7.8% (c=1.0 ng mL(-1), n=7). The proposed method was successfully applied to speciation of inorganic antimony in the leaching solutions of different food packaging materials with satisfactory results. PMID:19853991

  16. Antimony distribution and environmental mobility at an historic antimony smelter site, New Zealand.

    Science.gov (United States)

    Wilson, N J; Craw, D; Hunter, K

    2004-05-01

    A historic antimony smelter site at Endeavour Inlet, New Zealand has smelter residues with up to 17 wt.% antimony. Residues include coarse tailings (cm scale particles, poorly sorted), sand tailings (well sorted) and smelter slag (blocks up to 30 cm across). All of this material has oxidised to some degree over the ca. 100 years since the site was abandoned. Oxidation has resulted in acidification of the residues down to pH 2-5. Smelter slag contains pyrrhotite (FeS) and metallic antimony, and oxidation is restricted to surfaces only. The coarse tailings are the most oxidised, and few sulfide grains persist. Unoxidised sand tailings contain 10-20 vol.% stibnite (Sb2S3) containing up to 5% As, with subordinate arsenopyrite (FeAsS), and minor pyrite (FeS2). The sand tailings are variably oxidised on a scale of 2-10 cm, but original depositional layering is preserved during oxidation and formation of senarmontite (Sb2O3). Oxidation of sand tailings has resulted in localised mobility of both Sb and As on the cm scale, resulting in redistribution of these metalloids with iron oxyhydroxide around sand grain boundaries. Experiments demonstrate that Sb mobility decreases with time on a scale of days. Attenuation of both As and Sb occurs due to adsorption on to iron oxyhydroxides which are formed during oxidation of the smelter residues. There is no detectable loss of Sb or As from the smelter site into the adjacent river, <50 m away, which has elevated Sb (ca. 20 microg/l) and As (ca. 7 microg/l) from mineralised rocks upstream. Despite the high concentrations of Sb and As in the smelter residues, these metalloids are not being released into the environment. PMID:14987811

  17. Heat-treated Saccharomyces cerevisiae for antimony speciation and antimony(III) preconcentration in water samples

    International Nuclear Information System (INIS)

    An analytical method was developed for antimony speciation and antimony(III) preconcentration in water samples. The method is based on the selective retention of Sb(III) by modified Saccharomyces cerevisiae in the presence of Sb(V). Heat, caustic and solvent pretreatments of the biomass were investigated to improve the kinetics and thermodynamics of Sb(III) uptake process at room temperature. Heating for 30 min at 80 deg. C was defined as the optimal treatment. Antimony accumulation by the cells was independent of pH (5-10) and ionic strength (0.01-0.1 mol L-1). 140 mg of yeast and 2 h of contact were necessary to ensure quantitative sequestration of Sb(III) up to 750 μg L-1. In these conditions, Sb(V) was not retained. Sb(V) was quantified in sorption supernatant by inductively coupled plasma mass spectrometry (ICP-MS) or inductively coupled plasma optical emission spectrometry (ICP-OES). Sb(III) was determined after elution with 40 mmol L-1 thioglycolic acid at pH 10. A preconcentration factor close to nine was achieved for Sb(III) when 100 mL of sample was processed. After preconcentration, the detection limits for Sb(III) and Sb(V) were 2 and 5 ng L-1, respectively, using ICP-MS, 7 and 0.9 μg L-1 using ICP-OES. The proposed method was successfully applied to the determination of Sb(III) and Sb(V) in spiked river and mineral water samples. The relative standard deviations (n = 3) were in the 2-5% range at the tenth μg L-1 level and less than 10% at the lowest Sb(III) and Sb(V) tested concentration (0.1 μg L-1). Corrected recoveries were in all cases close to 100%

  18. Characterization of Antimony exchanged Hydrous Zirconium oxide

    International Nuclear Information System (INIS)

    Pentavalent 125Sb bearing species are persistent even after chemical treatment in low level liquid waste effluents. It was found that Hydrous Zirconium Oxide (HZO) had an efficiency better that 80% for Sb pick in a wide pH range of 1-13 for concentrations up to 150 mg/l. HZO coated on poly urethane foam was used in WMD Trombay for removal for 125Sb from waste effluent. The exchange capacity of HZO with 40% moisture content ranged between 0.7-0.9 meq/g for removal of Sb(V). In order to understand the mechanism of Sb uptake by HZO, freshly prepared HZO exchanged with trivalent and pentavalent Sb from aqueous solutions was characterized with FTIR and XRD. The FTIR analysis confirmed presence of surface hydroxyl groups. Sb exchanged HZO samples showed modification in characteristic frequencies of -OH group when compared with unexchanged HZO. The broadening of -OH stretching frequency at 3400 cm-1 in Sb exchanged HZO-B indicated of ingress of disorderliness or weakening of -OH bond. The spectral shift was towards lower frequencies indicating clustering of low frequency bonds around -OH groups and weakening of -O-H bond. This change in -OH profile shows it to be the site of exchange/sorption. The XRD analysis showed HZO to be amorphous. Both pentavalent and trivalent antimony was exchanged with HZO, heat treated at 600℃ and analysed with XRD. Hydrous Zirconium Oxide (Heated up to 600℃) had an X-Ray diffraction pattern identical to Aldrich make pure Zirconia (Monoclinic) (PCPDF-371484). Pentavalent Sb loaded HZO and trivalent Sb loaded HZO showed different crystalline structures on heat treatment. Sb(V) loaded HZO shows Orthorhombic structure (PCCPDF-371413) and Sb(III) exchanged Zirconia shows tetragonal structure (PCPDF-501089). Cubic Sb2O5 antimony oxide crystals were also detected in the sample. From the above analysis it could be understood that the surface hydroxyl group helped in sorption of Sb species. But this was not purely surface phenomenon. Sb after

  19. Noninferiority of Miltefosine Versus Meglumine Antimoniate for Cutaneous Leishmaniasis in Children

    OpenAIRE

    Rubiano, Luisa Consuelo; Miranda, María Consuelo; Muvdi Arenas, Sandra; Montero, Luz Mery; Rodríguez-Barraquer, Isabel; Garcerant, Daniel; Prager, Martín; Osorio, Lyda; Rojas, Maria Ximena; Pérez, Mauricio; Nicholls, Ruben Santiago; Gore Saravia, Nancy

    2012-01-01

    Background. Children have a lower response rate to antimonial drugs and higher elimination rate of antimony (Sb) than adults. Oral miltefosine has not been evaluated for pediatric cutaneous leishmaniasis.

  20. Martensite transformation in antimony implanted stainless steel

    International Nuclear Information System (INIS)

    The authors have used Rutherford backscattering analysis (RBS) and transmission electron microscopy (TEM) and diffraction to investigate austenitic stainless steel crystals implanted at room temperature with 80 keV Sb+ ions to a fluence of 5 x 1020 ions/m2, thus providing implantation with a heavy group V element. RBS channeling spectra from implanted crystals show a damage peak which approaches the height of the random level and therefore indicates a very high degree of disorder in the implanted layers. The distribution of the disorder extends to a depth 3-5 times the depth of the primary radiation damage. The Sb peaks under channeling as well as random conditions are indistinguishable, confirming that substitutionality during implantation is negligible. To establish the nature of the disorder which cannot be assessed from the RBS analysis alone, and in particular to assess whether an amorphous alloy is formed in the implanted layer as indicated from the RBS spectra, samples implanted under similar conditions were investigated in the TEM. Significant extra spots in the patterns can be ascribed to the presence of a radiation induced b.c.c. phase of martensitic origin. The result that a significant amount of martensite can be induced by antimony implantation seems to indicate that the main driving force for the transition is due to damage induced stress concentrations. (Auth.)

  1. Recovery of antimony-125 from tin-124 irradiated by neutrons

    International Nuclear Information System (INIS)

    Currently, antimony-125 is produced by recovery from tin-124 irradiated by neutrons in nuclear reactors. The radionuclide builds up following the pathway: Sn-124 (n,γ) → Sn-125 (β-) (9.6 days) → Sb-125 ((β-) (2.77 years) The cross-section of the (n,γ) reaction is low (0.2 barn), therefore tin metal enriched with tin-124 is used. It should be noted that the use of an enriched target decreases the build-up of other radionuclides as compared to the natural mixture of tin isotopes. Published data showed that ion exchange on anion exchangers is one of the most promising procedures of recovery of antimony-125 from irradiated tin-124. We irradiated tin metal enriched with tin-124 (approximately 96%). After cooling and storage, the specific activity was 5 μCi per g of metal. The irradiated sample was dissolved in concentrated hydrochloric acid containing hydrogen peroxide or bromine in order to convert tin to the tetravalent state and antimony to the pentavalent state. We used tin-119m as a mark for an express gamma-spectrometric determination of the distribution coefficients. We studied the separation of Sb-125 and tin on strongly basic (Dowex-50 and AV-17), moderately basic (AN-2FN), and weakly basic (AN-31) ion exchangers. Hydrochloric acid, a mixture of hydrochloric and hydrobromic acids, and nitric acid were used as the elutriating agents. The samples from chromatography were subjected to gamma-spectrometric analysis using Si(Li) and Ge(Li) semiconductor detectors. In experiments examining the separation on strongly basic anion exchangers, the attained decontamination factor for removal of tin from antimony-125 was approximately 104-105 in one cycle. In the experiments devoted to the separation on moderately basic and weakly basic anion exchangers, tin was eluted before antimony-125. This should improve reasonably the regeneration of the enriched tin samples. The most interesting and significant results were obtained in the study of separation of antimony-125

  2. Oral Delivery of Meglumine Antimoniate-β-Cyclodextrin Complex for Treatment of Leishmaniasis

    OpenAIRE

    Demicheli, Cynthia; Ochoa, Rosemary; da Silva, José B. B.; Falcão, Camila A. B.; Rossi-Bergmann, Bartira; Melo, Alan L.; Sinisterra, Ruben D.; Frézard, Frédéric

    2004-01-01

    The need for daily parenteral administration represents one of the most serious limitations in the clinical use of pentavalent antimonials against leishmaniasis. In this work, we investigated the ability of β-cyclodextrin to enhance the oral absorption of antimony and to promote the oral efficacy of meglumine antimoniate against experimental cutaneous leishmaniasis. The occurrence of interactions between β-cyclodextrin and meglumine antimoniate was demonstrated through the changes induced in ...

  3. The influence of pet containers on antimony concentration in bottled drinking water

    OpenAIRE

    Perić-Grujić Aleksandra A.; Radmanovac Aleksandar R.; Stojanov Aleksander M.; Pocajt Viktor V.; Ristić Mirjana Đ.

    2010-01-01

    Antimony trioxide (Sb2O3) is the most frequently used catalyst in the polyethylene terephthalate (PET) manufacture. As a result, antimony is incorporated into PET bottles at concentration level of 100-300 mg/kg. PET containers are used for drinking water and beverages, as well as food packaging and in the pharmaceutical industry. Thus, it is important to understand the factors that may influence the release of antimony from the catalysts into water and other products, since antimony is potent...

  4. The influence of pet containers on antimony concentration in bottled drinking water

    Directory of Open Access Journals (Sweden)

    Perić-Grujić Aleksandra A.

    2010-01-01

    Full Text Available Antimony trioxide (Sb2O3 is the most frequently used catalyst in the polyethylene terephthalate (PET manufacture. As a result, antimony is incorporated into PET bottles at concentration level of 100-300 mg/kg. PET containers are used for drinking water and beverages, as well as food packaging and in the pharmaceutical industry. Thus, it is important to understand the factors that may influence the release of antimony from the catalysts into water and other products, since antimony is potentially toxic trace element. In this paper, the antimony content in nine brands of bottled mineral and spring water from Serbia, and seven brands of bottled mineral and spring water from EU countries was analyzed. The measurements were conducted using the inductively coupled plasma-mass spectrometry (ICP-MS technique. In the all examined samples the antimony concentration was bellow the maximum contaminant level of 5 μg/L prescribed by the Serbian and EU regulations. Comparison of the content of antimony in PET bottled waters with the content of antimony in water bottled commercially in glass and the natural content of antimony in pristine groundwaters, provides explicit evidence of antimony leaching from PET containers. Since waters bottled in PET have much greater concentration ratio of Sb to Pb than corresponding pristine groundwaters, it can be assumed that bottled waters cannot be used as the relavant source for the study of the natural antimony content in groundwaters. There is a clear relation between the quality of water in bottles (composition, ion strength and antimony leaching rate. Moreover, while the rate of antimony leaching is slow at temperatures below 60 oC, at the temperature range of 60-80 oC antimony release occurs and reaches maximum contaminant level rapidly. As antimony can cause both acute and chronic health problems, factors that promote the increase of antimony concentration should be avoided.

  5. Antimony Doped Tin Oxide Thin Films: Co Gas Sensor

    Directory of Open Access Journals (Sweden)

    P.S. Joshi

    2011-01-01

    Full Text Available Tin dioxide (SnO2 serves as an important base material in a variety of resistive type gas sensors. The widespread applicability of this semicoducting oxide is related both to its range of conductance variability and to the fact that it responds to both oxidising and reducing gases. The antimony doped tin-oxide films were prepared by spray pyrolysis method. The as-deposited films are blackish in colour. Addition of antimony impurity showed little increase in the thickness. The X-ray diffraction pattern shows characteristic tin oxide peaks with tetragonal structure. As the doping concentration of antimony was increased, new peak corresponding to Sb was observed. The intensity of this peak found to be increased when the Sb concentration was increased from 0.01 % to the 1 % which indicates the antimony was incorporated into the tin oxide. For gas sensing studies ohmic contacts were preferred to ensure the changes in resistance of sensor is due to only adsorption of gas molecule. The graph of I-V shows a straight line in nature which indicates the ohmic contact. The sensitivity of the sensor for CO gas was tested. The sensitivity of antimony doped tin oxide found to be increased with increasing Sb concentration. The maximum sensitivity was observed for Sb = 1 % at a working temperature of 250 °C.

  6. Behavior of arsenic impurity at antimony electric precipitation

    International Nuclear Information System (INIS)

    In the paper the arsenic impurity electrochemical behavior and it purification from antimony by electric precipitation out of fluoride solutions was studied. For this the arsenic sample with mass 0.003-0.006 g has been irradiated at the WWR-SM nuclear reactor during 3-5 hour in the thermal neutron flux 1013 n/cm2 s, after 24 h keeping the sample has being dissolved in the concentrated nitric acid, and then it has been evaporated several times with distillation water addition up to wet precipitation state. It is shown, that arsenic impurity behavior character in the antimony electric precipitation out to fluoride electrolyte depends on the electrolyte content, electrolysis conditions, arsenic valency state in arsenic impurity existence in the five-valency state its joint electric reduction with antimony is practically not observing. In the case the arsenic being in three-valency state, it joint electric reduction with antimony is taking place. In this time the electrolytic antimony contents arsenic impurities less in dozen time than initial material

  7. Antimony Resistance in Leishmania, Focusing on Experimental Research

    Directory of Open Access Journals (Sweden)

    Fakhri Jeddi

    2011-01-01

    Full Text Available Leishmaniases are parasitic diseases that spread in many countries with a prevalence of 12 million cases. There are few available treatments and antimonials are still of major importance in the therapeutic strategies used in most endemic regions. However, resistance toward these compounds has recently emerged in areas where the replacement of these drugs is mainly limited by the cost of alternative molecules. In this paper, we reviewed the studies carried out on antimonial resistance in Leishmania. Several common limitations of these works are presented before prevalent approaches to evidence antimonial resistance are related. Afterwards, phenotypic determination of resistance is described, then confronted to clinical outcome. Finally, we detail molecular mechanisms and targets involved in resistance and already identified in vitro within selected mutant strains or in clinical isolates.

  8. Lattice dynamics of femtosecond laser-excited antimony

    Science.gov (United States)

    Abdel-Fattah, Mahmoud Hanafy; Bugayev, Aleksey; Elsayed-Ali, Hani E.

    2016-07-01

    Ultrafast electron diffraction is used to probe the lattice dynamics of femtosecond laser-excited antimony thin film. The temporal hierarchies of the intensity and position of diffraction orders are monitored. The femtosecond laser excitation of antimony film was found to lead to initial compression after the laser pulse, which gives way to tension vibrating at new equilibrium displacement. A damped harmonic oscillator model, in which the hot electron-blast force contributes to the driving force of oscillations in lattice spacing, is used to interpret the data. The electron-phonon energy-exchange rate and the electronic Grüneisen parameter were obtained.

  9. Self-standing nanoribbons of antimony selenide and antimony sulfide with well-defined size and band gap

    Energy Technology Data Exchange (ETDEWEB)

    Vadapoo, Rajasekarakumar; Krishnan, Sridevi; Yilmaz, Hulusi [Department of Physics, University of Puerto Rico, San Juan, PR 00936 (Puerto Rico); Marin, Carlos [Institute for Functional Nanomaterials, University of Puerto Rico, San Juan, PR 00936 (United States)

    2011-04-29

    Sub-10 nm semiconducting nanostructures are crucial for the realization of nanoscale devices. Fabrication of nanostructures at this scale with homogeneous properties is challenging. Using ab initio calculations, we show that self-standing ribbons of antimony selenide and antimony sulfide of width 1.1 nm exhibit well-defined bandgaps of 1.66 and 2.16 eV, respectively. Molecular dynamics studies show that these ribbons are stable at 500 K. The one-dimensional (1D) heterostructure of these nanoribbons (Sb{sub 2}Se{sub 3}/Sb{sub 2}S{sub 3}) along the [001] direction shows a straddling type behavior.

  10. Selective oxidation of propene on bismuth molybdate and mixed oxides of tin and antimony and of uranium and antimony

    International Nuclear Information System (INIS)

    Propene + 1802 reactions have been studied in a static reaction system on bismuth molybdate and mixed oxides of tin and antimony and of uranium and antimony. The [160] acrolein content of the total acrolein formed and the proportion of 160 in the oxygen of the carbon dioxide by-product have been determined. The results indicate that for each catalyst the lattice is the only direct source of the oxygen in the aldehyde, and that lattice and/or gas phase oxygen is used in carbon dioxide formation. Oxygen anion mobility appears to be greater in the molybdate catalyst than in the other two. (author)

  11. Antimony to Cure Visceral Leishmaniasis Unresponsive to Liposomal Amphotericin B

    Science.gov (United States)

    Morizot, Gloria; Jouffroy, Romain; Faye, Albert; Chabert, Paul; Belhouari, Katia; Calin, Ruxandra; Charlier, Caroline; Miailhes, Patrick; Siriez, Jean-Yves; Mouri, Oussama; Yera, Hélène; Gilquin, Jacques; Tubiana, Roland; Lanternier, Fanny; Mamzer, Marie-France; Legendre, Christophe; Peyramond, Dominique; Caumes, Eric; Lortholary, Olivier; Buffet, Pierre

    2016-01-01

    We report on 4 patients (1 immunocompetent, 3 immunosuppressed) in whom visceral leishmaniasis had become unresponsive to (or had relapsed after) treatment with appropriate doses of liposomal amphotericin B. Under close follow-up, full courses of pentavalent antimony were administered without life-threatening adverse events and resulted in rapid and sustained clinical and parasitological cure. PMID:26735920

  12. Discovery of palladium, antimony, tellurium, iodine, and xenon isotopes

    OpenAIRE

    Kathawa, J.; Fry, C; Thoennessen, M

    2012-01-01

    Currently, thirty-eight palladium, thirty-eight antimony, thirty-nine tellurium, thirty-eight iodine, and forty xenon isotopes have been observed and the discovery of these isotopes is discussed here. For each isotope a brief synopsis of the first refereed publication, including the production and identification method, is presented.

  13. Vacuum distillation of antimony-mercury gold containing concentrates

    International Nuclear Information System (INIS)

    Results of researches on vacuum distillation of mercury from gold containing antimony-mercury concentrates are considered in this article. It is shown that at vacuum of 20-50 mm Hg and temperature 300 deg C mercury is sublimated and gold remain in a cinder. (author)

  14. Antimony content of macrofungi from clean and polluted areas

    Czech Academy of Sciences Publication Activity Database

    Borovička, J.; Řanda, Zdeněk; Jelínek, E.

    2006-01-01

    Roč. 64, č. 11 (2006), s. 1837-1844. ISSN 0045-6535 Institutional research plan: CEZ:AV0Z10480505 Keywords : mushrooms * antimony pollution * bioaccumulation Subject RIV: CB - Analytical Chemistry, Separation Impact factor: 2.442, year: 2006

  15. 106Ruthenium Brachytherapy for Retinoblastoma

    International Nuclear Information System (INIS)

    Purpose: To evaluate the efficacy of 106Ru plaque brachytherapy for the treatment of retinoblastoma. Methods and Materials: We reviewed a retrospective, noncomparative case series of 39 children with retinoblastoma treated with 106Ru plaques at the Jules-Gonin Eye Hospital between October 1992 and July 2006, with 12 months of follow-up. Results: A total of 63 tumors were treated with 106Ru brachytherapy in 41 eyes. The median patient age was 27 months. 106Ru brachytherapy was the first-line treatment for 3 tumors (4.8%), second-line treatment for 13 (20.6%), and salvage treatment for 47 tumors (74.6%) resistant to other treatment modalities. Overall tumor control was achieved in 73% at 1 year. Tumor recurrence at 12 months was observed in 2 (12.5%) of 16 tumors for which 106Ru brachytherapy was used as the first- or second-line treatment and in 15 (31.9%) of 47 tumors for which 106Ru brachytherapy was used as salvage treatment. Eye retention was achieved in 76% of cases (31 of 41 eyes). Univariate and multivariate analyses revealed no statistically significant risk factors for tumor recurrence. Radiation complications included retinal detachment in 7 (17.1%), proliferative retinopathy in 1 (2.4%), and subcapsular cataract in 4 (9.7%) of 41 eyes. Conclusion: 106Ru brachytherapy is an effective treatment for retinoblastoma, with few secondary complications. Local vitreous seeding can be successfully treated with 106Ru brachytherapy

  16. Antimony and arsenic biogeochemistry in the East China Sea

    Science.gov (United States)

    Ren, Jing-Ling; Zhang, Xu-Zhou; Sun, You-Xu; Liu, Su-Mei; Huang, Daji; Zhang, Jing

    2016-02-01

    The biogeochemical cycles of the metalloid elements arsenic and antimony in the East China Sea (ECS), one of the most important marginal seas for western Pacific, were examined in May 2011. Dissolved inorganic arsenic (As(V) and As(III)) and antimony (Sb(V) and Sb(III)) species were determined by selective hydride generation-atomic fluorescence spectrometry (HG-AFS). Results show that total dissolved inorganic arsenic (TDIAs; [TDIAs]=[As(V)]+[As(III)]) were moderately depleted in the surface water and enriched in the deep water. Arsenite (As(III)) showed different vertical profiles with that of TDIAs, with significant surface enrichment in the middle shelf region where the concentrations of phosphate were extremely low. Speciation of dissolved arsenic was subtly controlled by the stoichiometric molar ratio of arsenate (As(V)) to phosphate. The average As(V)/P ratio for the ECS in spring 2011 was 10.8×10-3, which is higher than previous results and indicates the arsenate stress. The concentrations of total dissolved inorganic antimony (TDISb; [TDISb]=[Sb(V)]+[Sb(III)]) were high near the Changjiang Estuary and the coastal area of Hangzhou Bay and decreased moderately off the coast. TDISb displayed moderate conservative behavior in the ECS that confirms by the correlations with salinity and dissolved aluminum. Different with that of As(III), antimonite (Sb(III)) concentrations were extremely lower in the ECS, with relative higher concentration appeared at the bottom layer which indicates the contribution from sediment-water interface. A preliminary box model was established to estimate the water-mass balance and antimony budgets for the ECS. Compared with other areas in the world, the concentrations of dissolved inorganic arsenic and antimony in the ECS remain at natural levels.

  17. The determination of the thermodynamic activity of antimony in alpha-iron

    International Nuclear Information System (INIS)

    In this paper a method is suggested for determining the thermodynamic activity of antimony dissolved in alpha-iron, based on the study of antimony distribution between the two phases: liquid lead and solid iron. By this method, it was found that solid solutions of antimony in alpha-iron can be distinguished by positive divergences from the ideal state. Over a fairly wide range of concentrations, solutions of antimony in iron obey Henry's law. Special experiments on the distribution of antimony between lead and liquid iron showed that in the liquid state also the iron-antimony system is marked by positive divergences from the ideal state when small concentrations of antimony are present. The heat required for the solution of antimony in alpha-iron, and the excess partial molar entropy, were calculated from the activity temperature. The results were used for accurately locating the line showing the solubility limit of antimony in alpha-iron. Since alloys of antimony with iron were obtained by diffusion saturation and not by cooling from the liquid state, there was no liquefaction. Thus the lattice constant of the alloys and its relation to the alloy concentration could be reliably determined. The solubility limit established from X-ray data agrees with that obtained with Sb124. (author)

  18. In Vitro antileishmanial properties of neutron-irradiated meglumine antimoniate

    Directory of Open Access Journals (Sweden)

    Samanta Etel Treiger Borborema

    2005-10-01

    Full Text Available Pentavalent antimony, as meglumine antimoniate (Glucantime® or sodium stibogluconate (Pentostam® , is the main treatment for leishmaniasis, a complex of diseases caused by the protozoan Leishmania, and an endemic and neglected threat in Brazil. Despite over half a century of clinical use, their mechanism of action, toxicity and pharmacokinetic data remain unknown. The analytical methods for determination of antimony in biological systems remain complex and have low sensitivity. Radiotracer studies have a potential in pharmaceutical development. The aim of this study was to obtain a radiotracer for antimony, with suitable physical and biological properties. Meglumine antimoniate was neutron irradiated inside the IEA-R1 nuclear reactor, producing two radioisotopes 122Sb and 124Sb, with high radionuclidic purity and good specific activity. This compound showed the same antileishmanial activity as the native compound. The use of the radiotracers, easily created by neutron irradiation, could be an interesting tool to solve important questions in antimonial pharmacology.Os antimoniais pentavalentes, como o antimoniato de meglumina (Glucantime® ou estibogluconato de sódio (Pentostam® , são o principal tratamento para a leishmaniose, um complexo de doenças causadas pelo protozoário parasita Leishmania, uma doença endêmica e negligenciada no Brasil. Apesar do seu uso clínico por mais de meio século, seu mecanismo de ação, toxicidade e dados de farmacocinética permanecem desconhecidos. Os métodos analíticos para determinação de antimônio em sistemas biológicos são complexos e apresentam baixa sensibilidade. Estudos utilizando radiotraçadores têm papel potencial no desenvolvimento farmacológico. O objetivo deste estudo foi desenvolver um radiotraçador de antimônio, com propriedades físicas e biológicas adequadas. O antimoniato de meglumina foi irradiado por nêutrons no reator nuclear IEA-R1, produzindo dois radioisótopos: 122

  19. Main: PPC106 [AT Atlas

    Lifescience Database Archive (English)

    Full Text Available PPC106 PPC1 Synthesis of membrane protein that uses liposome coexistent wheat cell-free protein ... rter and confirmed its high transport activity. To test ... whether co-translational association with liposome ...

  20. States of antimony and tin atoms in lead chalcogenides

    International Nuclear Information System (INIS)

    It is shown by Mössbauer spectroscopy of the 119Sb(119mSn) isotope that impurity antimony atoms in PbS, PbSe, and PbTe lattices are distributed between cation and anion sublattices. In n-type samples, the greatest part of antimony is located in the anion sublattice; in hole ones, in the cation sublattice. The tin atoms formed as a result of radioactive decay of 119Sb (antisite state) are electrically inactive in the anion sub-lattice of PbS and PbSe, while, in the cation sublattice, they form donor U− centers. Electron exchange between the neutral and doubly ionized tin U− centers via the allowed band states is observed. The tin atoms formed after radioactive decay of 119Sb are electrically inactive in the anion and cation sublattices of PbTe.

  1. Resistance to Arsenic- and Antimony-Based Drugs

    OpenAIRE

    Milena Salerno; Arlette Garnier-Suillerot

    2003-01-01

    Organic arsenicals were the first antimicrobial agents specifically synthesized for the treatment of infectious diseases such as syphilis and sleeping sickness. For the treatment of diseases caused by trypanosomatid parasites, organic derivatives of arsenic and the related metalloid antimony are still the drugs of choice. Arsenic trioxide, As203, has been used for a long time in traditional Chinese medicines for treatment of various diseases, and it has recently been shown to be clinically ac...

  2. Crystallization of antimony orthotantalate and its physical properties

    International Nuclear Information System (INIS)

    Physicochemical conditions of monophase synthesis of antimony orthoniobate monocrystals in the system SbO3-Ta2O5-KHF2-H2O2-H2O were investigated. In the area of monophase synthesis of SbTaO4 monocrystals kinetic studies of its growth conditions for inoculation, depending on solvent concentration, temperature, pyroelectric properties of the monocrystal grown were studied and conclusion was made on their practical use

  3. Correlation of CsK2Sb photocathode lifetime with antimony thickness

    Energy Technology Data Exchange (ETDEWEB)

    Mamun, M. A. [Department of Mechanical and Aerospace Engineering, Old Dominion University, Norfolk, Virginia 23529, USA; The Applied Research Center, Thomas Jefferson National Accelerator Facility, Newport News, Virginia 23606, USA; Hernandez-Garcia, C. [Thomas Jefferson National Accelerator Facility, Newport News, Virginia 23606, USA; Poelker, M. [Thomas Jefferson National Accelerator Facility, Newport News, Virginia 23606, USA; Elmustafa, A. A. [Department of Mechanical and Aerospace Engineering, Old Dominion University, Norfolk, Virginia 23529, USA; The Applied Research Center, Thomas Jefferson National Accelerator Facility, Newport News, Virginia 23606, USA

    2015-06-01

    CsK2Sb photocathodes with quantum efficiency on the order of 10% at 532 nm, and lifetime greater than 90 days at low voltage, were successfully manufactured via co-deposition of alkali species emanating from an effusion source. Photocathodes were characterized as a function of antimony layer thickness and alkali consumption, inside a vacuum chamber that was initially baked, but frequently vented without re-baking. Photocathode lifetime measured at low voltage is correlated with the antimony layer thickness. Photocathodes manufactured with comparatively thick antimony layers exhibited the best lifetime. We speculate that the antimony layer serves as a reservoir, or sponge, for the alkali.

  4. Correlation of CsK{sub 2}Sb photocathode lifetime with antimony thickness

    Energy Technology Data Exchange (ETDEWEB)

    Mamun, M. A., E-mail: mmamu001@odu.edu; Elmustafa, A. A. [Department of Mechanical and Aerospace Engineering, Old Dominion University, Norfolk, Virginia 23529 (United States); The Applied Research Center, Thomas Jefferson National Accelerator Facility, Newport News, Virginia 23606 (United States); Hernandez-Garcia, C.; Poelker, M. [Thomas Jefferson National Accelerator Facility, Newport News, Virginia 23606 (United States)

    2015-06-01

    CsK{sub 2}Sb photocathodes with quantum efficiency on the order of 10% at 532 nm, and lifetime greater than 90 days at low voltage, were successfully manufactured via co-deposition of alkali species emanating from an effusion source. Photocathodes were characterized as a function of antimony layer thickness and alkali consumption, inside a vacuum chamber that was initially baked, but frequently vented without re-baking. Photocathode lifetime measured at low voltage is correlated with the antimony layer thickness. Photocathodes manufactured with comparatively thick antimony layers exhibited the best lifetime. We speculate that the antimony layer serves as a reservoir, or sponge, for the alkali.

  5. Correlation of CsK2Sb photocathode lifetime with antimony thickness

    Directory of Open Access Journals (Sweden)

    M. A. Mamun

    2015-06-01

    Full Text Available CsK2Sb photocathodes with quantum efficiency on the order of 10% at 532 nm, and lifetime greater than 90 days at low voltage, were successfully manufactured via co-deposition of alkali species emanating from an effusion source. Photocathodes were characterized as a function of antimony layer thickness and alkali consumption, inside a vacuum chamber that was initially baked, but frequently vented without re-baking. Photocathode lifetime measured at low voltage is correlated with the antimony layer thickness. Photocathodes manufactured with comparatively thick antimony layers exhibited the best lifetime. We speculate that the antimony layer serves as a reservoir, or sponge, for the alkali.

  6. Removal of lead from crude antimony by using NaPo3 as lead elimination reagent

    OpenAIRE

    Ye L.G.; Tang C.B.; Yang S.H.; Chen Y.M.; Zhang W.H.

    2015-01-01

    In order to solve the shortcomings when removing lead from crude antimony in the traditional antimony smelting, a new process was provided using NaPO3 as lead elimination reagent to yield phosphate slag, and it was removed by floating on the surface of the liquid antimony. Reaction mechanism was clarified by using the TG-DTA and XRD techniques and single factor experiments of removal lead from crude antimony were engaged. The results show that PbO and NaPO3...

  7. 48 CFR 3028.106 - Administration.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 7 2010-10-01 2010-10-01 false Administration. 3028.106 Section 3028.106 Federal Acquisition Regulations System DEPARTMENT OF HOMELAND SECURITY, HOMELAND SECURITY... 3028.106 Administration....

  8. Recent advances on antimony(III/V) compounds with potential activity against tumor cells.

    Science.gov (United States)

    Hadjikakou, S K; Ozturk, I I; Banti, C N; Kourkoumelis, N; Hadjiliadis, N

    2015-12-01

    Antimony one of the heavier pnictogens, has been in medical use against microbes and parasites as well. Antimony-based drugs have been prescribed against leishmaniasis since the parasitic transmission of the tropical disease was understood in the beginning of the 20th century. The activity of arsenic against visceral leishmaniasis led to the synthesis of an array of arsenic-containing parasitic agents, among them the less toxic pentavalent antimonials: Stibosan, Neostibosan, and Ureastibamine. Other antimony drugs followed: sodium stibogluconate (Pentostam) and melglumine antimoniate (Glucantim or Glucantime); both continue to be in use today despite their toxic side effects and increasing loss in potency due to the growing resistance of the parasite against antimony. Antimony compounds and their therapeutic potentials are under consideration from many research groups, while a number of early reviews recording advances of antimony biomedical applications are also available. However, there are only few reports on the screening for antitumor potential of antimony compounds. This review focuses upon results obtained on the anti-proliferative activity of antimony compounds in the past years. This survey shows that antimony(III/V) complexes containing various types of ligands such as thiones, thiosemicarbazones, dithiocarbamates, carboxylic acids, or ketones, nitrogen donor ligands, exhibit selectivity against a variety of cancer cells. The role of the ligand type of the complex is elucidated within this review. The complexes and their biological activity are already reported elsewhere. However quantitative structure-activity relationship (QSAR) modeling studies have been carried out and they are reported for the first time here. PMID:26092367

  9. Complexation of HSA with different forms of antimony (Sb): An application of fluorescence spectroscopy

    International Nuclear Information System (INIS)

    Antimony (Sb) pollution has been of a great environmental concern in some areas in China. Sb enters human body via drinking water, inhalation and food chain, unavoidably interacts with human serum albumin (HSA) in blood plasma, and consequently does harm to human health. The harmful effects of Sb on human health depend on the Sb species and their binding ability to HSA. In the present study, binding of three forms of Sb with HSA was investigated by excitation-emission matrix (EEM) spectroscopy. All of antimony potassium tartrate, antimony trichloride and potassium pyroantimonate quenched fluorescence of HSA. Values of conditional stability constant Ka (×105/M) for Sb and HSA systems were 8.13–9.12 for antimony potassium tartrate, 2.51–4.27 for antimony trichloride and 3.63–9.77 for potassium pyroantimonate. The binding constant Kb (×104/M) values of HSA with antimony potassium tartrate, antimony trichloride and potassium pyroantimonate were 0.02–0.07, 3.55–5.01, and 0.07–1.08, respectively. There was one independent class of binding site for antimony trichloride towards HSA. There was more than one Sb binding site and negative cooperativity between multiple binding sites for potassium pyroantimonate and antimony potassium tartrate towards HSA. The binding ability of HSA to complex Sb followed the order: antimony trichloride>potassium pyroantimonate>antimony potassium tartrate. -- Highlights: ► The first study reporting interaction of Sb with HSA. ► Sb can effectively quench the fluorescence of HSA. ► The binding ability of HSA to Sb was dependent on the form of Sb. ► Binding differences indicate differences in toxicity of various forms Sb to human. ► HAS-Sb binding parameters are important for understanding toxicity of Sb

  10. Leishmania donovani isolates with antimony-resistant but not -sensitive phenotype inhibit sodium antimony gluconate-induced dendritic cell activation.

    Directory of Open Access Journals (Sweden)

    Arun Kumar Haldar

    2010-05-01

    Full Text Available The inability of sodium antimony gluconate (SAG-unresponsive kala-azar patients to clear Leishmania donovani (LD infection despite SAG therapy is partly due to an ill-defined immune-dysfunction. Since dendritic cells (DCs typically initiate anti-leishmanial immunity, a role for DCs in aberrant LD clearance was investigated. Accordingly, regulation of SAG-induced activation of murine DCs following infection with LD isolates exhibiting two distinct phenotypes such as antimony-resistant (Sb(RLD and antimony-sensitive (Sb(SLD was compared in vitro. Unlike Sb(SLD, infection of DCs with Sb(RLD induced more IL-10 production and inhibited SAG-induced secretion of proinflammatory cytokines, up-regulation of co-stimulatory molecules and leishmanicidal effects. Sb(RLD inhibited these effects of SAG by blocking activation of PI3K/AKT and NF-kappaB pathways. In contrast, Sb(SLD failed to block activation of SAG (20 microg/ml-induced PI3K/AKT pathway; which continued to stimulate NF-kappaB signaling, induce leishmanicidal effects and promote DC activation. Notably, prolonged incubation of DCs with Sb(SLD also inhibited SAG (20 microg/ml-induced activation of PI3K/AKT and NF-kappaB pathways and leishmanicidal effects, which was restored by increasing the dose of SAG to 40 microg/ml. In contrast, Sb(RLD inhibited these SAG-induced events regardless of duration of DC exposure to Sb(RLD or dose of SAG. Interestingly, the inhibitory effects of isogenic Sb(SLD expressing ATP-binding cassette (ABC transporter MRPA on SAG-induced leishmanicidal effects mimicked that of Sb(RLD to some extent, although antimony resistance in clinical LD isolates is known to be multifactorial. Furthermore, NF-kappaB was found to transcriptionally regulate expression of murine gammaglutamylcysteine synthetase heavy-chain (mgammaGCS(hc gene, presumably an important regulator of antimony resistance. Importantly, Sb(RLD but not Sb(SLD blocked SAG-induced mgammaGCS expression in DCs by

  11. Oxidation and mobilization of metallic antimony in aqueous systems with simulated groundwater

    Science.gov (United States)

    Ilgen, A. G.; Majs, F.; Barker, A. J.; Douglas, T. A.; Trainor, T. P.

    2014-05-01

    Antimony (Sb) is a contaminant of concern that can be present in elevated concentrations in shooting range soils due to mobilization from spent lead/antimony bullets. Antimony in shooting range soils has been observed as either metallic Sb(0) or as Sb(V) immobilized by iron (hydr)oxides. The absence of Sb(III) in soils is indicative of rapid Sb(III) oxidation to Sb(V) under surface soil conditions. However, the major controls on antimony oxidation and mobility are poorly understood. To better understand these controls we performed multiple batch experiments under oxic conditions to quantify the oxidation and dissolution of antimony in systems where Sb(0) is oxidized to Sb(III) and further to Sb(V). We also tested how variations in the aqueous matrix composition and the presence of metallic lead (Pb) affect the dissolution, solid phase speciation, and oxidation of antimony. We monitored changes in the aqueous antimony speciation using liquid chromatography inductively coupled plasma mass spectrometry (LC-ICP-MS). To test which solid phases form as a result of Sb(0) oxidation, and therefore potentially limit the mobility of antimony in our studied systems, we characterized the partially oxidized Sb(0) powders by means of extended X-ray absorption fine structure (EXAFS) spectroscopy and powder X-ray diffraction (XRD).

  12. Tin dioxide sol-gel derived films doped with platinum and antimony deposited on porous silicon

    NARCIS (Netherlands)

    Savaniu, C.; Arnautu, A.; Cobianu, C.; Craciun, G.; Flueraru, C.; Zaharescu, M.; Parlog, C.; Paszti, F.; Berg, van den A.

    1999-01-01

    SnO2 sol-gel derived thin films doped simultaneously with Pt and Sb are obtained and reported for the first time. The Sn sources were tin(IV) ethoxide or tin(II) ethylhexanoate, while hexachloroplatinic acid (H2PtCl6) and antimony chloride (SbCl3) were used as platinum and antimony sources, respecti

  13. Comparison of modification with strontium and the refining with antimony in A 356 aluminium alloys

    International Nuclear Information System (INIS)

    Strontium and Antimony treated A356 aluminium alloy samples were metallographically characterized in the as cast and solution and aged conditions. Antimony treated alloy has shown slower spheroidizing kinetics of the Silicon particles during solution treatment, lower porosity level and higher tensile strength and elongation than Strontium treated one. (author)

  14. Leishmania donovani: an in vitro study of antimony-resistant amphotericin B-sensitive isolates

    DEFF Research Database (Denmark)

    Sharief, Abdalla Hassan; Gasim Khalil, Eltahir Awad; Theander, Thor G;

    2006-01-01

    Drug sensitivity of clinically antimony-unresponsive Leishmania donovani isolates from Eastern Sudan was evaluated in an in vitro culture system against sodium stibogluconate (Pentostam) and Amphotericin B. Eight isolates, six from antimony-resistant and two from clinically responsive patients were...

  15. Waste treatment as applied to the problem of recovery of antimony-125

    International Nuclear Information System (INIS)

    In the report we present the average radionuclide and chemical composition of processing solutions in various stages of treatment of spent nuclear fuel. The behavior of antimony-125 during sorption from these solutions was studied. A series of oxide and phosphate compounds was used as sorbents. The best results on recovery of antimony were reached on silica gel. A necessary condition for prolonged high-cycle operation of silica gel in actual practice is its rather complete regeneration. In this connection, we studied completeness of antimony desorption from various sorbents. The best results were obtained with aqueous hydrochloric and oxalic acids. Our study showed the possibility of recovery of antimony-125 from spent nuclear fuel wastes by adsorption on silica gel from processing solutions with subsequent desorption of the target product. In the average the yield of antimony-125 is 85%. (authors)

  16. Testing of antimony selective media for treatment of liquid radwaste

    International Nuclear Information System (INIS)

    Nuclear power plants have sought radiation source term reduction and reduced discharge of radioactive constituents for many years. In the case of pressurized water reactors (PWRs), the latter efforts have been directed toward capture and immobilization of recalcitrant (ubiquitous radionuclides with long half-lives) species such as Cs-134 and Cs-137 and Co-58 and Co-60. As these plants resolved, or at least mitigated, the problems with radiocesium and radio-cobalt, antimony radionuclides (Sb-122, Sb-124, and Sb-125) have become a primary concern in liquid liquid radwaste systems Graver Technologies developed a granular composite metal oxide media with good selectivity for radio-antimony. Initial laboratory data were collected using non-radioactive salts of antimony, cesium, and cobalt to judge efficacy of selective removal of antimony. Based on success of those trials, the media, designated Gravex GX187, was tested in partnership with Energy Solutions (nee Duratek) using actual liquid liquid radwaste in two PWR plants. One of these plants performed extensive slip-stream trials comparing the GX187 with strong base anion resins. With more than 2500 bed volumes of throughput, the GX187 outperformed the other competitors by reducing both Sb-124 and Sb-125 radionuclides below minimum detectable activity (MDA) with average decontamination factors (DF's) of 170, even when subjected to high levels of borate. Based on these favorable results, Energy Solutions installed the GX187 in a layered bed in their ALPS liquid radwaste processing system at this plant in August 2005. After one year of intermittent, batchwise operation including an outage, the GX187 processed more than 2.25 million liters (>600,000 gallons) of liquid liquid radwaste while reducing the Sb-125 activity to 2.9 E-08 Bq/L (DF=111) on average. This evaluation is ongoing and will continue at least until the fall 2006 outage at this plant. Concurrently, Graver developed a second generation antimony selective

  17. Behavior of ruthenium, cesium and antimony during simulated HLLW vitrification

    International Nuclear Information System (INIS)

    The behavior of ruthenium, cesium, and antimony during the vitrification of simulated high-level radioactive liquid wastes (HLLW) in a liquid fed melter was studied on a laboratory scale and on a semi-pilot scale. In the laboratory melter of a 2.5 kg capacity, a series of tests with the simulate traced with 103Ru, 134Cs and 124Sb, has shown that the Ru and Cs losses to the melter effluent are generally higher than 10% whereas the antimony losses remain lower than 0.4%. A wet purification system comprising in series, a dust scrubber, a condenser, an ejector venturi and an NOx washing column retains most of the activity present in the off-gas so that the release fractions for Ru at the absolute filter inlet ranges between 5.10-3 to 5.10-5% of the Ru fed, for Cs the corresponding release fraction ranges between 3.10-3 to 10-4% and for Sb the release fraction ranges between 1.7 10-4 to 1.7 10-5%. The same experiments were performed at a throughput of 1 to 2 1 h-1 of simulated solution in the semi-pilot scale unit RUFUS. The RUFUS unit comprises a glass melter with a 50 kg molten glass capacity and the wet purification train comprises in series a dust scrubber, a condenser, an ejector venturi and an NOx washing column. The tracer tests were restricted to 103Ru and 134Cs since the laboratory tests had shown that the antimony losses were very low. The results of the tests are presented

  18. Metabolism of antimony-124 in lactating dairy cows

    International Nuclear Information System (INIS)

    Lactating cows received oral and intravenous administrations of radioactive antimony (III) chloride to study its intestinal and urinary excretion, secretion into milk and organ distribution. Milk samples were taken twice a day and the milk, feces and urine assayed using gamma spectroscopy. Cows administered orally were sacrificed at 102 days and those injected intravenously at 70 days. Distribution of 124 Sb in the organs was determined at the time of sacrifice. Excretion of 124Sb occurs mainly via urine, little is secreted into milk. Highest organ concentrations are in the spleen, liver and bone. (U.K.)

  19. Electrostatically defined silicon quantum dots with counted antimony donor implants

    Energy Technology Data Exchange (ETDEWEB)

    Singh, M., E-mail: msingh@sandia.gov; Luhman, D. R.; Lilly, M. P. [Sandia National Laboratories, Albuquerque, New Mexico 87185 (United States); Center for Integrated Nanotechnologies, Sandia National Laboratories, Albuquerque, New Mexico 87175 (United States); Pacheco, J. L.; Perry, D.; Garratt, E.; Ten Eyck, G.; Bishop, N. C.; Wendt, J. R.; Manginell, R. P.; Dominguez, J.; Pluym, T.; Bielejec, E.; Carroll, M. S. [Sandia National Laboratories, Albuquerque, New Mexico 87185 (United States)

    2016-02-08

    Deterministic control over the location and number of donors is crucial to donor spin quantum bits (qubits) in semiconductor based quantum computing. In this work, a focused ion beam is used to implant antimony donors in 100 nm × 150 nm windows straddling quantum dots. Ion detectors are integrated next to the quantum dots to sense the implants. The numbers of donors implanted can be counted to a precision of a single ion. In low-temperature transport measurements, regular Coulomb blockade is observed from the quantum dots. Charge offsets indicative of donor ionization are also observed in devices with counted donor implants.

  20. Electrostatically defined silicon quantum dots with counted antimony donor implants

    International Nuclear Information System (INIS)

    Deterministic control over the location and number of donors is crucial to donor spin quantum bits (qubits) in semiconductor based quantum computing. In this work, a focused ion beam is used to implant antimony donors in 100 nm × 150 nm windows straddling quantum dots. Ion detectors are integrated next to the quantum dots to sense the implants. The numbers of donors implanted can be counted to a precision of a single ion. In low-temperature transport measurements, regular Coulomb blockade is observed from the quantum dots. Charge offsets indicative of donor ionization are also observed in devices with counted donor implants

  1. Antimony implanted strained Si for nMOSFET applications

    OpenAIRE

    Zamani, Atieh

    2009-01-01

    Incorporation of implanted antimony (Sb) in strained-silicon (s-Si) formed on relaxed-SiGe virtual substrates (10 and 30% Ge) has been studied. The implantation doses were 5×1013- 5×1014 cm-2 with an energy of 20 keV. The activation of dopant was performed by an rapid thermal annealing (RTA) treatment at 700 and 800 °C for 30 sec. Projected range of this implantation is about 20 nm which was also confirmed by different techniques. The layers were analyzed in terms of strain relaxation, sheet ...

  2. Solubility behaviour of antimony(III) and antimony(V) solids in basic aqueous solutions at 300{sup o}C

    Energy Technology Data Exchange (ETDEWEB)

    Lemire, R.J.; Tosello, N.B.; Halliday, J.D

    1999-12-01

    The major contributions of the isotopes {sup 122}Sb and {sup 124}Sb to activity transport in a CANDU reactor primary heat transport system (HTS), have been associated with oxygen ingress during reactor shutdown. As part of a program to minimize the release and redeposition of these isotopes, the solubilities of antimony(III) and (V) oxides and salts have been measured in basic solutions at temperatures from 25 to 300{sup o}C. The results provide information on the charge and the stability as a function of temperature of antimony solution species and, hence, a guide to the trends in the temperature dependence of the solubilities of antimony solids. In solutions in which oxidation of antimony(III) to antimony(V) is minimized, the solubility of Sb{sub 2}O{sub 3} increases by about two orders of magnitude between 25 and 200{sup o}C, and then levels out or decreases slightly. At 250{sup o}C, in oxidizing solutions, Sb{sub 2}O{sub 5}{center_dot}xH{sub 2}O and simple sodium antimonate(V) were found to be unstable in sodium hydroxide solutions with respect to the solid, Na{sub 2{alpha}}[H(H{sub 2}O)]{sub 2-2{alpha}}Sb{sub 2}O{sub 6}, which has a pyrochlore structure. The solubility of this partially protonated sodium antimonate increases from 25 to 200{sup o}C and decreases at temperatures above 250{sup o}C. These solubility changes for the antimony (V) solids reflect changes in the stability of the anionic antimony solution species (SbO{sub 3}{sup -} or Sb(OH){sub 6}{sup -}), even though the compositions of antimony-containing solids in basic oxidizing solutions are strongly dependent on the cations and their aqueous phase concentrations. All solids used in the present experiments would be expected to generate total solution antimony concentrations {>=} 0.00005 mol{center_dot}dm{sup -3} in any neutral or basic aqueous solutions (assuming no added sodium salts). Therefore, under HTS conditions, precipitation of any antimony oxides or mixed oxides is unlikely. It cannot be

  3. Thermal decomposition kinetics of antimony oxychloride in air

    Institute of Scientific and Technical Information of China (English)

    阳卫军; 唐谟堂; 金胜明

    2002-01-01

    The DTA and XRD techniques were employed to study thermal decomposition mechanism of antimony oxychloride SbOCl in the air. The thermal decomposition reaction occurs in four steps, and the former three steps as: SbOCl(s)→Sb4O5Cl2(s)+SbCl3(g)→Sb8O11Cl2(s)+SbCl3(g)→Sb2O3(s)+SbCl3(g). The forth step is the oxidation of Sb2O3 by air, Sb2O3(s)+O2→Sb2O4(s). The activation energy and the order of the thermal decomposition reaction of antimony oxychloride in three steps presented in DTA curves were calculated according to Kinssinger methods from DTA curves. The values of activation energy and the order are respectively 91.97kJ/mol, 0.73 in the first step, 131.14kJ/mol, 0.63 in the second step and 146.94kJ/mol, 1.58 in the third step.

  4. Alkali oxide-tantalum, niobium and antimony oxide ionic conductors

    Science.gov (United States)

    Roth, R. S.; Brower, W. S.; Parker, H. S.; Minor, D. B.; Waring, J. L.

    1975-01-01

    The phase equilibrium relations of four systems were investigated in detail. These consisted of sodium and potassium antimonates with antimony oxide and tantalum and niobium oxide with rubidium oxide as far as the ratio 4Rb2O:llB2O5 (B=Nb, Ta). The ternary system NaSbO3-Sb2O4-NaF was investigated extensively to determine the actual composition of the body centered cubic sodium antimonate. Various other binary and ternary oxide systems involving alkali oxides were examined in lesser detail. The phases synthesized were screened by ion exchange methods to determine mobility of the mobility of the alkali ion within the niobium, tantalum or antimony oxide (fluoride) structural framework. Five structure types warranted further investigation; these structure types are (1) hexagonal tungsten bronze (HTB), (2) pyrochlore, (3) the hybrid HTB-pyrochlore hexagonal ordered phases, (4) body centered cubic antimonates and (5) 2K2O:3Nb2O5. Although all of these phases exhibit good ion exchange properties only the pyrochlore was prepared with Na(+) ions as an equilibrium phase and as a low porosity ceramic. Sb(+3) in the channel interferes with ionic conductivity in this case, although relatively good ionic conductivity was found for the metastable Na(+) ion exchanged analogs of RbTa2O5F and KTaWO6 pyrochlore phases.

  5. Antimony removal from the polyethylene terephthalate manufacture wastewater

    Directory of Open Access Journals (Sweden)

    Tomas Vengris

    2010-04-01

    Full Text Available In this study, antimony removal by coagulation from polyethylene terephthalate resin production wastewater of „Orion Global PET“ factory in Klaipėda city was investigated, with regard to the dependence of coagulant type and dosage, pH and presence of organics. FeCl3 ∙6H2O, FeSO4 ∙7H2O, AlCl3∙6H2O and TiCl4 salts were used as coagulants. Ti(IV and Fe(III revealed oneself to be the most effective coagulants. Antimony removal effectiveness is moderate and low using FeSO4 ∙7H2O and AlCl3∙6H2O coagulants, respectively. The addition of 10 mg dm-3 Ti(IV and 30 mg dm-3 Fe(III reduces by ~98% of the Sb, when the initial amount of Sb in wastewater is about 1200 mkg/l. The action of Fe(III is practically independent in the pH range 4-9, and that of Ti(IV slightly decreases in the same pH interval. The Sb amount in wastewater can be reduced to 13-20 mkg dm-3, while the initial Sb concentration is 1200 mkg dm-3. The presence of organic compounds in wastewater determines the reduction of Sb removal by coagulation.

  6. Antimony contamination and its effect on Trifolium plants

    Science.gov (United States)

    Corrales, Isabel; Barceló, Juan; Bech, Jaume; Poschenrieder, Charlotte

    2014-05-01

    Antimony is not an essential element and soil Sb contents usually are low.However, soil contamination by Sb has increased in the last years due to the human activities (combustion of fossil fuels, mining, waste incineration, smelting, shooting and road traffic). The main objective of this work was to study the effect of different concentrations of antimony (KSb(OH)6) in order to evaluate the effect on growth and Sb uptake on Trifolium pratense cv. Milvus and Trifolium repens. Our results show that Sb accumulated both in roots and shoots of clover without any negative effect on root growth, cellular viability and lipid peroxidation. This absence of toxicity sympthoms in clover plants could be very dangerous because Sb can be inadvertedly incorporated into the trophic chain causing toxic effects both in animals and humans. The absence of toxic effects on plants does not seem to be due to detoxification by phytochelatins because the use of the gamma-glutamylcysteine synthetase inhibitor, L-buthionine-[S,R]-sulphoximine (BSO) did not enhance Sb toxicity to plants. (Supported by the Spanish MICINN project BFU2010-14873)

  7. Segregation of antimony in InP in MOVPE

    Energy Technology Data Exchange (ETDEWEB)

    Weeke, Stefan

    2008-07-01

    In this work the segregation of antimony in indium phosphide in metal organic vapour phase epitaxy (MOVPE)was systematically investigated. Therefore phosphine stabilized InP surfaces were treated with tri-methyl-antimony (TMSb) in MOVPE. An antimony rich Sb/InP surface was established, showing a typical spectra for the antimonides observed in reflectance anisotropy spectroscopy (RAS).Adsorption and desorption of antimony are investigated, as well as the incorporation of Sb during overgrowth of the Sb/InP surface with InP. Therefore the growth parameters temperature, TMSb partial pressure and treatment time are varied and their influence investigated. The experiments are monitored in-situ with RAS, the achieved data is correlated with ex-situ characterisation such as X-ray diffraction (XRD) and secondary ion mass spectroscopy (SIMS). It is shown that under treatment with TMSb a stable Sb/InP surface is formed within seconds, which does not change under further TMSb treatment. This process is rarely influenced by the TMSb partial pressure. On the contrary, the desorption of Sb is a very slow process. Two main processes can be distinguished: The desorption of excess Sb from the surface and the formation of the MOVPE prepared InP (2 x 1) surface. The reaction velocity of adsorption and desorption increases with temperature. Above a critical value the increase of TMSb partial pressure has no influence on the time for desorption. During overgrowth of the Sb/InP surface the opposite temperature dependence is observed: with increasing growth temperature the typical spectra for antimonides is observed longer. An analysis of the grown samples with XRD and SIMS showed the formation of an InPSb double quantum well. One layer is formed at the interface, the second one 50 nm-120 nm deep in the InP. The location of the 2nd InPSb layer can be correlated with the vanishing of the Sb signature in RAS. The distance between the quantum wells increases with growth temperature, until it

  8. Leaching Mechanism of Complicated Antimony-Lead Concentrate and Sulfur Formation in Slurry Electrolysis

    Institute of Scientific and Technical Information of China (English)

    WangChengyan; QiuDingfan; JiangPeihai

    2004-01-01

    Anodic reaction mechanism of complicated antimony-lead concentrate in slurry electrolysis was investigated by the anodic polarization curves determined under various conditions. The main reactions on the anode are the oxidations of FeCln(2-n) . Though the oxidation of jamesonite particle on the anode can occur during the whole process, it is less. With the help of mineralogy studies and relevant tests, the leaching reaction mechanism of jameson[to and gudmundite during slurry electrolysis was ascertained. Because of the oxidation reaction of FeCl3 produced by antimony-lead concentrate itself, the non-oxidation complex acid dissolution of jameson[re, the oxidation complex acid dissolution of gudmundite, and the oxidation of air carried by stirring, the leaching ratio of antimony reaches about 35% when HCl-NH4Cl solution is used to leach antimony-lead concentrate directly. So when the theoretical electric quantity is given to oxidation of antimony in slurry electrolysis, all of antimony, lead and iron containing in antimony-lead concentrate, are leached. The formation of sulfur is through the directly redox reaction of Fe3+ and jameson[re. The S2- in jamesonite is oxidized into S0 , and forms the crystals of sulfur again on the spot. The redox reaction of Fe3+ and H2S formed by non-oxidative acid dissolution of jamesonite is less.

  9. Behaviour of antimony during thermal treatment of Sb-rich halogenated waste

    International Nuclear Information System (INIS)

    Antimony compounds have a wide range of industrial applications, particularly as additives in flame retardants. To ensure environmentally friendly waste incineration of Sb-rich wastes, it is essential to strengthen the knowledge about the fate of antimony and the potential formation of harmful species. Investigations should be conducted particularly in relation with the main operational parameters controlling the process, chiefly temperature, residence time and air supply in the oven and in the post-combustion zone, prior final adapted cleaning of the flue-gas stream. Experimental studies focusing on antimony behaviour were undertaken through laboratory-scale thermal treatment at 850 deg. C and 1100 deg. C of a Sb-rich halogenated waste, originating from the sector of flame retardants formulation. The configuration of our laboratory experimental device allowed to achieve only low oxidative conditions in the waste bed, but high oxidative strength coupled with high temperature and sufficient gas residence time in the post-combustion zone, as prescribed during the incineration of hazardous wastes. Atomic absorption spectroscopy was used to assess the partition of antimony in the different compartments of the process. The oxidation degree of antimony in the gas-phase was determined by the use of electrochemical techniques, namely polarography coupled with anodic stripping voltamperometry. The partition of antimony between the residual ash and the gas-phase under moderate oxidative conditions in the waste bed was constant, whatever the temperature: the volatilization rate for antimony was ∼64%, while a ∼36% fraction remained in the residual bottom ashes. But interestingly, while at 850 oC, antimony was mainly present in the gas-phase at a +III oxidation degree, an increase in temperature of 250 oC favoured the presence of antimony to its highest oxidation degree +V in the flue-gas stream, a valence known to be involved in less toxic species.

  10. Antimony powder-modified carbon paste electrodes for electrochemical stripping determination of trace heavy metals

    International Nuclear Information System (INIS)

    Highlights: → New antimony powder-modified carbon paste electrode. → Combination of specific properties of carbon paste substrate and metallic antimony. → No requirement of using toxic antimony(III) salts. → Electrochemical stripping determination of trace heavy metals at ppb levels. → Anodic stripping voltammetric and stripping chronopotentiometric measurements. - Abstract: A new type of the antimony electrode based on a carbon paste bulk-modified with antimony powder (Sb-CPE) is presented for the determination of cadmium(II) and lead(II) ions at the microgram-per-liter concentration level, when using square-wave anodic stripping voltammetric or stripping chronopotentiometric protocol. The Sb-CPE was prepared by mixing fine antimony powder, carbon powder, and silicon oil, thus combining typical features of the carbon paste material with specific electrochemical properties of antimony. Key-operational parameters, including the amount of antimony powder in the carbon paste mixture, effect of the deposition potential and deposition time, were optimized and electroanalytical performance of the Sb-CPE in nondeaerated solution of 0.01 M hydrochloric acid (pH 2) was compared with related bismuth powder-modified carbon paste electrode (Bi-CPE) and with in situ prepared antimony film carbon paste electrode (SbF-CPE). The electrode of interest exhibited well-developed signals and highly linear calibration plots for both metal ions tested. In addition, favorable limits of detection were achieved; namely: 1.4 μg L-1 for Cd(II) and 0.9 μg L-1 for Pb(II). The applicability of the new electrode was demonstrated on the analysis of tap water (spiked sample). Besides voltammetric measurements, the Sb-CPE was preliminary tested also under chronopotentiometric stripping mode in deoxygenated solutions, revealing also an excellent electroanalytical performance.

  11. Development of a non-chromatographic method for the speciation analysis of inorganic antimony in mushroom samples by hydride generation atomic fluorescence spectrometry

    Science.gov (United States)

    Sousa Ferreira, Hadla; Costa Ferreira, Sergio Luis; Cervera, M. Luisa; de la Guardia, Miguel

    2009-06-01

    A simple and sensitive method has been developed for the direct determination of toxic species of antimony in mushroom samples by hydride generation atomic fluorescence spectrometry (HG AFS). The determination of Sb(III) and Sb(V) was based on the efficiency of hydride generation employing NaBH 4, with and without a previous KI reduction, using proportional equations corresponding to the two different measurement conditions. The extraction efficiency of total antimony and the stability of Sb(III) and Sb(V) in different extraction media (nitric, sulfuric, hydrochloric, acetic acid, methanol and ethanol) were evaluated. Results demonstrated that, based on the extraction yield and the stability of extracts, 0.5 mol L - 1 H 2SO 4 proved to be the best extracting solution for the speciation analysis of antimony in mushroom samples. The limits of detection of the developed methodology were 0.6 and 1.1 ng g - 1 for Sb(III) and Sb(V), respectively. The relative standard derivation was 3.8% (14.7 ng g - 1 ) for Sb(V) and 5.1% (4.6 ng g - 1 ) for Sb(III). The recovery values obtained for Sb(III) and Sb(V) varied from 94 to 106% and from 98 to 105%, respectively. The method has been applied to determine Sb(III), Sb(V) and total Sb in five different mushroom samples; the Sb(III) content varied from 4.6 to 11.4 ng g - 1 and Sb(V) from 14.7 to 21.2 ng g - 1 . The accuracy of the method was confirmed by the analysis of a certified reference material of tomato leaves.

  12. Structural and optical characterization of thermally evaporated bismuth and antimony films for photovoltaic applications

    Science.gov (United States)

    Srimathy, N.; Ruban Kumar, A.

    2016-05-01

    In this present study, the thin film of bismuth and antimony is coated by thermal evaporation system equipped with the inbuilt ultra high vacuum system. XRD analysis confirmed the rhombohedral structure of Bismuth and Antimony on the prepared film. The surface roughness and physical appearance is analyzed by Atomic force microscopy. The results of Raman Spectroscopy show the wave functions and the spectrum of electrons. The preparation technique and conditions strongly influence the crystalline structure and the phase composition of bismuth and antimony thin films. The electrical and optical properties for the prepared film are analyzed. The results show a great interest and promising applications in Photovoltaic devices.

  13. Varicella zoster virus reactivation during or immediately following treatment of tegumentary leishmaniasis with antimony compounds

    Directory of Open Access Journals (Sweden)

    Andrea Barbieri Barros

    2014-07-01

    Full Text Available Antimony compounds are the cornerstone treatments for tegumentary leishmaniasis. The reactivation of herpes virus is a side effect described in few reports. We conducted an observational study to describe the incidence of herpes zoster reactivation during treatment with antimony compounds. The global incidence of herpes zoster is approximately 2.5 cases per 1,000 persons per month (or 30 cases per 1,000 persons per year. The estimated incidence of herpes zoster in patients undergoing antimony therapy is higher than previously reported.

  14. Coordination- and Redox-Noninnocent Behavior of Ambiphilic Ligands Containing Antimony.

    Science.gov (United States)

    Jones, J Stuart; Gabbaï, François P

    2016-05-17

    Stimulated by applications in catalysis, the chemistry of ambiphilic ligands featuring both donor and acceptor functionalities has experienced substantial growth in the past several years. The unique opportunities in catalysis offered by ambiphilic ligands stem from the ability of their acceptor functionalities to play key roles via metal-ligand cooperation or modulation of the reactivity of the metal center. Ligands featuring group 13 centers, most notably boranes, as their acceptor functionalities have undoubtedly spearheaded these developments, with remarkable results having been achieved in catalytic hydrogenation and hydrosilylation. Motivated by these developments as well as by our fundamental interest in the chemistry of heavy group 15 elements, we became fascinated by the possibility of employing antimony centers as Lewis acids within ambiphilic ligands. The chemistry of antimony-based ligands, most often encountered as trivalent stibines, has historically been considered to mirror that of their lighter phosphorus-based congeners. There is growing evidence, however, that antimony-based ligands may display unique coordination behavior and reactivity. Additionally, despite the diverse Lewis acid and redox chemistry that antimony exhibits, there have been only limited efforts to explore this chemistry within the coordination sphere of a transition metal. By incorporation of antimony into the framework of polydentate ligands in order to enforce the main group metal-transition metal interaction, the effect of redox and coordination events at the antimony center on the structure, electronics, and reactivity of the metal complex may be investigated. This Account describes our group's continuing efforts to probe the coordination behavior, reactivity, and application of ambiphilic ligands incorporating antimony centers. Structural and theoretical studies have established that both Sb(III) and Sb(V) centers in polydentate ligands may act as Z-type ligands toward late

  15. 48 CFR 745.106 - Contract clauses.

    Science.gov (United States)

    2010-10-01

    ... required in (48 CFR) FAR 45.106 in all contracts under which the contractor will acquire property with... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false Contract clauses. 745.106 Section 745.106 Federal Acquisition Regulations System AGENCY FOR INTERNATIONAL DEVELOPMENT...

  16. 34 CFR 106.32 - Housing.

    Science.gov (United States)

    2010-07-01

    ... 34 Education 1 2010-07-01 2010-07-01 false Housing. 106.32 Section 106.32 Education Regulations of... Discrimination on the Basis of Sex in Education Programs or Activities Prohibited § 106.32 Housing. (a) Generally... fees or requirements, or offer different services or benefits related to housing, except as provided...

  17. 42 CFR 411.106 - Aggregation rules.

    Science.gov (United States)

    2010-10-01

    ... 42 Public Health 2 2010-10-01 2010-10-01 false Aggregation rules. 411.106 Section 411.106 Public Health CENTERS FOR MEDICARE & MEDICAID SERVICES, DEPARTMENT OF HEALTH AND HUMAN SERVICES MEDICARE PROGRAM... Under Group Health Plans: General Provisions § 411.106 Aggregation rules. The following rules apply...

  18. 48 CFR 2828.106 - Administration.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 6 2010-10-01 2010-10-01 true Administration. 2828.106 Section 2828.106 Federal Acquisition Regulations System DEPARTMENT OF JUSTICE General Contracting Requirements BONDS AND INSURANCE Bonds 2828.106 Administration....

  19. 48 CFR 1228.106 - Administration.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false Administration. 1228.106 Section 1228.106 Federal Acquisition Regulations System DEPARTMENT OF TRANSPORTATION GENERAL CONTRACTING REQUIREMENTS BONDS AND INSURANCE Bonds and Other Financial Protections 1228.106 Administration....

  20. 48 CFR 428.106 - Administration.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 4 2010-10-01 2010-10-01 false Administration. 428.106 Section 428.106 Federal Acquisition Regulations System DEPARTMENT OF AGRICULTURE GENERAL CONTRACTING REQUIREMENTS BONDS AND INSURANCE Bonds and Other Financial Protections 428.106 Administration....

  1. 48 CFR 1028.106 - Administration.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false Administration. 1028.106 Section 1028.106 Federal Acquisition Regulations System DEPARTMENT OF THE TREASURY GENERAL CONTRACTING REQUIREMENTS BONDS AND INSURANCE Bonds 1028.106 Administration....

  2. 48 CFR 828.106 - Administration.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false Administration. 828.106 Section 828.106 Federal Acquisition Regulations System DEPARTMENT OF VETERANS AFFAIRS GENERAL CONTRACTING REQUIREMENTS BONDS AND INSURANCE Bonds and Other Financial Protections 828.106 Administration....

  3. 48 CFR 1328.106 - Administration.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false Administration. 1328.106 Section 1328.106 Federal Acquisition Regulations System DEPARTMENT OF COMMERCE GENERAL CONTRACTING REQUIREMENTS BONDS AND INSURANCE Bonds and Other Financial Protections 1328.106 Administration....

  4. 48 CFR 228.106 - Administration.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Administration. 228.106 Section 228.106 Federal Acquisition Regulations System DEFENSE ACQUISITION REGULATIONS SYSTEM, DEPARTMENT OF DEFENSE GENERAL CONTRACTING REQUIREMENTS BONDS AND INSURANCE Bonds 228.106 Administration....

  5. 34 CFR 106.51 - Employment.

    Science.gov (United States)

    2010-07-01

    ... 34 Education 1 2010-07-01 2010-07-01 false Employment. 106.51 Section 106.51 Education Regulations... Discrimination on the Basis of Sex in Employment in Education Programs or Activities Prohibited § 106.51... employment decisions in any education program or activity operated by such recipient in a...

  6. 48 CFR 28.106 - Administration.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 1 2010-10-01 2010-10-01 false Administration. 28.106 Section 28.106 Federal Acquisition Regulations System FEDERAL ACQUISITION REGULATION GENERAL CONTRACTING REQUIREMENTS BONDS AND INSURANCE Bonds and Other Financial Protections 28.106 Administration....

  7. 19 CFR 360.106 - Fees.

    Science.gov (United States)

    2010-04-01

    ... 19 Customs Duties 3 2010-04-01 2010-04-01 false Fees. 360.106 Section 360.106 Customs Duties INTERNATIONAL TRADE ADMINISTRATION, DEPARTMENT OF COMMERCE STEEL IMPORT MONITORING AND ANALYSIS SYSTEM § 360.106 Fees. No fees will be charged for obtaining a user identification number, issuing a steel...

  8. 7 CFR 330.106 - Emergency measures.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 5 2010-01-01 2010-01-01 false Emergency measures. 330.106 Section 330.106... QUARRY PRODUCTS; GARBAGE General Provisions § 330.106 Emergency measures. (a) Procedures to prevent pest.... Unloading or landing of any product or article shall not be permitted pending compliance with the...

  9. 34 CFR 106.23 - Recruitment.

    Science.gov (United States)

    2010-07-01

    ... 34 Education 1 2010-07-01 2010-07-01 false Recruitment. 106.23 Section 106.23 Education... Discrimination on the Basis of Sex in Admission and Recruitment Prohibited § 106.23 Recruitment. (a) Nondiscriminatory recruitment. A recipient to which this subpart applies shall not discriminate on the basis of...

  10. 21 CFR 314.106 - Foreign data.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 5 2010-04-01 2010-04-01 false Foreign data. 314.106 Section 314.106 Food and... Applications § 314.106 Foreign data. (a) General. The acceptance of foreign data in an application generally is... solely on foreign clinical data meeting U.S. criteria for marketing approval may be approved if: (1)...

  11. 19 CFR 357.106 - Time limits.

    Science.gov (United States)

    2010-04-01

    ... 19 Customs Duties 3 2010-04-01 2010-04-01 false Time limits. 357.106 Section 357.106 Customs Duties INTERNATIONAL TRADE ADMINISTRATION, DEPARTMENT OF COMMERCE SHORT SUPPLY PROCEDURES § 357.106 Time limits. (a) The Secretary will determine, no later than the day specified in paragraph (b) of...

  12. 7 CFR 1400.106 - Payment limits.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 10 2010-01-01 2010-01-01 false Payment limits. 1400.106 Section 1400.106 Agriculture Regulations of the Department of Agriculture (Continued) COMMODITY CREDIT CORPORATION, DEPARTMENT OF... SUBSEQUENT CROP, PROGRAM, OR FISCAL YEARS Payment Limitation § 1400.106 Payment limits. (a) Payments made...

  13. 9 CFR 3.106 - Water quality.

    Science.gov (United States)

    2010-01-01

    ... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Water quality. 3.106 Section 3.106... Mammals Animal Health and Husbandry Standards § 3.106 Water quality. (a) General. The primary enclosure... additives (e.g. chlorine and copper) that are added to the water to maintain water quality...

  14. 5 CFR 581.106 - Future payments.

    Science.gov (United States)

    2010-01-01

    ... 5 Administrative Personnel 1 2010-01-01 2010-01-01 false Future payments. 581.106 Section 581.106... FOR CHILD SUPPORT AND/OR ALIMONY Purpose and Definitions § 581.106 Future payments. Moneys paid by a governmental entity which may be due and payable to an individual at some future date, shall not be...

  15. 40 CFR 59.106 - Variance.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 5 2010-07-01 2010-07-01 false Variance. 59.106 Section 59.106... Compound Emission Standards for Automobile Refinish Coatings § 59.106 Variance. (a) Any regulated entity... control may apply in writing to the Administrator for a temporary variance. The variance application...

  16. 20 CFR 718.106 - Autopsy; biopsy.

    Science.gov (United States)

    2010-04-01

    ... 20 Employees' Benefits 3 2010-04-01 2010-04-01 false Autopsy; biopsy. 718.106 Section 718.106... PNEUMOCONIOSIS Criteria for the Development of Medical Evidence § 718.106 Autopsy; biopsy. (a) A report of an autopsy or biopsy submitted in connection with a claim shall include a detailed gross macroscopic...

  17. 5 CFR 960.106 - OPM leadership.

    Science.gov (United States)

    2010-01-01

    ... 5 Administrative Personnel 2 2010-01-01 2010-01-01 false OPM leadership. 960.106 Section 960.106 Administrative Personnel OFFICE OF PERSONNEL MANAGEMENT (CONTINUED) CIVIL SERVICE REGULATIONS (CONTINUED) FEDERAL EXECUTIVE BOARDS § 960.106 OPM leadership. (a) Role of the Director. The Director is responsible to...

  18. 7 CFR 1150.106 - United States.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 9 2010-01-01 2009-01-01 true United States. 1150.106 Section 1150.106 Agriculture... Order Definitions § 1150.106 United States. United States means the 48 contiguous States in the continental United States....

  19. 40 CFR 57.106 - Expiration date.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 5 2010-07-01 2010-07-01 false Expiration date. 57.106 Section 57.106 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) AIR PROGRAMS (CONTINUED) PRIMARY NONFERROUS SMELTER ORDERS General § 57.106 Expiration date. Each NSO shall state its expiration date. No...

  20. Crystal structure and thermodynamic properties of potassium antimony tungsten oxide

    Energy Technology Data Exchange (ETDEWEB)

    Knyazev, Aleksandr V., E-mail: knav@uic.nnov.ru [Nizhny Novgorod State University, Gagarin Prospekt 23/2, Nizhny Novgorod, 603950 (Russian Federation); Tananaev, Ivan G. [Institute of Physical Chemistry and Electrochemistry, Russian Academy of Sciences, 31 Leninsky prospect, Moscow GSP-1, 119991 (Russian Federation); Kuznetsova, Nataliya Yu.; Smirnova, Nataliya N.; Letyanina, Irene A.; Ladenkov, Igor V. [Nizhny Novgorod State University, Gagarin Prospekt 23/2, Nizhny Novgorod, 603950 (Russian Federation)

    2010-02-20

    In the present work potassium antimony tungsten oxide with pyrochlore structure is refined by the Rietveld method (space group Fd3m, Z = 8). The temperature dependences of heat capacity have been measured for the first time in the range from 7 to 370 K for this compound. The experimental data were used to calculate standard thermodynamic functions, namely the heat capacity C{sub p}{sup o}(T), enthalpy H{sup o}(T) - H{sup o}(0), entropy S{sup o}(T) - S{sup o}(0) and Gibbs function G{sup o}(T) - H{sup o}(0), for the range from T {yields} 0 to 370 K. The differential scanning calorimetry was applied to measure the incongruent melting temperature of compound under study. The high-temperature X-ray diffraction was used for the determining thermal expansion coefficients.

  1. Atomistic mechanisms governing structural stability change of zinc antimony thermoelectrics

    Energy Technology Data Exchange (ETDEWEB)

    Yang, Xiaolong [Frontier Institute of Science and Technology, Xi' an Jiaotong University, Xi' an 710054 (China); Lin, Jianping, E-mail: jaredlin@163.com [School of Materials Science and Engineering, Xiamen University of Technology, Xiamen 361024 (China); Qiao, Guanjun [State Key Laboratory for Mechanical Behavior of Materials, Xi' an Jiaotong University, Xi' an 710049 (China); Wang, Zhao, E-mail: zwangzhao@gmail.com [Frontier Institute of Science and Technology, Xi' an Jiaotong University, Xi' an 710054 (China); State Key Laboratory for Mechanical Behavior of Materials, Xi' an Jiaotong University, Xi' an 710049 (China)

    2015-01-05

    The structural stability of thermoelectric materials is a subject of growing importance for their energy harvesting applications. Here, we study the microscopic mechanisms governing the structural stability change of zinc antimony at its working temperature, using molecular dynamics combined with experimental measurements of the electrical and thermal conductivity. Our results show that the temperature-dependence of the thermal and electrical transport coefficients is strongly correlated with a structural transition. This is found to be associated with a relaxation process, in which a group of Zn atoms migrates between interstitial sites. This atom migration gradually leads to a stabilizing structural transition of the entire crystal framework, and then results in a more stable crystal structure of β–Zn{sub 4}Sb{sub 3} at high temperature.

  2. Coherent and Incoherent Structural Dynamics in Laser-Excited Antimony

    CERN Document Server

    Waldecker, Lutz; Bertoni, Roman; Vasileiadis, Thomas; Garcia, Martin E; Zijlstra, Eeuwe S; Ernstorfer, Ralph

    2016-01-01

    We investigate the excitation of phonons in photoexcited antimony and demonstrate that the entire electron-lattice interactions, in particular coherent and incoherent electron-phonon coupling, can be probed simultaneously. Using femtosecond electron diffraction (FED) with high temporal resolution, we observe the coherent excitation of the fully symmetric \\Ag\\ optical phonon mode via the shift of the minimum of the atomic potential energy surface. Molecular dynamics simulations are performed to quantify the change in lattice potential and the associated real-space amplitude of the coherent atomic oscillations. In addition, our experimental configuration allows observing the energy transfer from electrons to phonons via incoherent electron-lattice scattering events. Applying a modified two-temperature model, the electron-phonon coupling is determined from the data as a function of electronic temperature.

  3. NEW THIO S2- ADDUCTS WITH ANTIMONY (III AND V HALIDE: SYNTHESIS AND INFRARED STUDY

    Directory of Open Access Journals (Sweden)

    HASSAN ALLOUCH

    2013-12-01

    Full Text Available Five new S2- adducts with SbIII and SbV halides have been synthesized and studied by infrared. Discrete structures have been suggested, the environment around the antimony being tetrahedral, trigonal bipyramidal or octahedral.

  4. Liquid-liquid extraction of arsenic, antimony, selenium and tellurium by zinc diethyldithiocarbamate

    International Nuclear Information System (INIS)

    The authors report the solvent extraction, oxidation, reduction, extraction in the presence of iron, and reextraction of arsenic, antimony, selenium and tellurium. These processes were studied using radioactive tracers. (G.T.H.)

  5. Antimonial drugs entrapped into phosphatidylserine liposomes: physicochemical evaluation and antileishmanial activity

    OpenAIRE

    Samanta Etel Treiger Borborema; João Alberto Osso Junior; Heitor Franco de Andrade Junior; Nanci do Nascimento

    2016-01-01

    Abstract: INTRODUCTION: Leishmaniasis is a disease caused by the protozoan Leishmania that resides mainly in mononuclear phagocytic system tissues. Pentavalent antimonials are the main treatment option, although these drugs have toxic side effects and high resistance rates. A potentially alternative and more effective therapeutic strategy is to use liposomes as carriers of the antileishmanial agents. The aims of this study were to develop antimonial drugs entrapped into phosphatidylserine l...

  6. Removal of lead from crude antimony by using NaPo3 as lead elimination reagent

    Directory of Open Access Journals (Sweden)

    Ye L.G.

    2015-01-01

    Full Text Available In order to solve the shortcomings when removing lead from crude antimony in the traditional antimony smelting, a new process was provided using NaPO3 as lead elimination reagent to yield phosphate slag, and it was removed by floating on the surface of the liquid antimony. Reaction mechanism was clarified by using the TG-DTA and XRD techniques and single factor experiments of removal lead from crude antimony were engaged. The results show that PbO and NaPO3 begin endothermic reaction at 863K (590°C, and the reaction mainly form NaPb4(PO43 and NaPbPO4 below 1123K (850°C and above 1123K (850°C, respectively. Sb2O3 and NaPO3 start the reaction at 773K (500°C and generate an antimonic salt compound. The reaction product of the mixture of PbO, Sb2O3 and NaPO3 show that NaPO3 reacted with PbO prior when NaPO3 was insufficient, amorphous antimony glass will be generated only when NaPO3 was adequate. Single factor experiments were taken with NaNO3 as oxidizing agent under argon, effect of reaction time, reaction temperature and dosage of NaPO3 and NaNO3 on smelting results. The average content of lead in refined antimony was 0.05340% and 98.85% of lead were removed under optimal conditions; the content of lead in antimony have meet the requirements of commercial antimony.

  7. Electrochemical antimony removal from accumulator acid: Results from removal trials in laboratory cells

    International Nuclear Information System (INIS)

    Highlights: ► In non-divided cells, antimony did not deposit at cathode due to oxidation of Sb(III) at anode. ► Copper and graphite were found to be the most suitable electrode materials for antimony deposition. ► Sb species covering electrode lowers deposition efficiency with time. ► Thus, periodical renewal of cathode material is necessary. ► Calculated specific electroenergy consumption was relatively high. ► In contrast, absolute energy consumption was low due to small quantities of antimony removed. - Abstract: Regeneration of spent accumulator acid could be an alternative process for crystallization, neutralisation and disposal. Therefore, for the first time in a study of the possibilities of electrochemical removal of antimony and accumulator acid regeneration on a laboratory scale, two synthetic and several real systems containing sulfuric acid of concentrations ranging between 28% and 36%, and antimony species were tested. Discontinuous electrochemical reactors with anion exchange membranes were successfully used in these experiments, which were conducted at a temperature of 35 °C. Removal of antimony using cells that were not divided by a separator, however, was not possible. In selected experiments, by varying the electrode material, type of electrolyte, and cell current, the concentration of antimony could be reduced from the range of 5 ppm to 0.15 ppm. This resulted in current efficiencies between 0.00002% and 0.001%, and in specific electroenergy demands between 100 Wh L−1 and 2000 Wh L−1. In other experiments on substances with antimony contents up to 3500 mg L−1, the current efficiencies obtained were more than a thousandfold higher. In contrast to the formally high relative energy consumption parameters absolute demand parameters are relatively small and favour the electrochemical method in small scale application. Besides plate electrodes, 3D-cathodes were used. Copper- and graphite cathodes produced the best results.

  8. Effect of Antimony, Phosphorous and Salinity on Growth, Root Membrane Permeability and Root Antimony, Iron and Zinc Concentration of Corn in Hydroponic Media

    OpenAIRE

    H. Barangizi; M. Afyuni; B. Rezaee

    2010-01-01

    Antimony (Sb) pollution has increased in recent years because of human activities and extensive usage of antimony compounds. To date, only a few researches have been conducted in this field in Iran. The purpose of this research is to determine fresh and dry weight, root permeability percentage and root concentration of Sb, Fe and Zn in the corn. This greenhouse research was performed in hydroponics. A factorial experiment (3 × 2 × 3) with three Sb concentrations (0, 6, 18 mgL-1), with and wit...

  9. Arsenic and Antimony Content in Soil and Plants from Baia Mare Area, Romania

    Directory of Open Access Journals (Sweden)

    Gabriela Oprea

    2010-01-01

    Full Text Available Problem statement: The objective of this research was to evaluate the degree of soil contamination with arsenic and antimony in Baia Mare, a nonferrous mining and metallurgical center located in the North West region of Romania. The soil in the area is affected by the emissions of powders containing metals from metallurgical factories. Previous studies indicated the soil contamination with copper, zinc, cadmium and lead, but there is few data about the actual level of soil pollution with arsenic and antimony. Approach: The soil samples were collected from 2 districts of Baia Mare: Ferneziu, which is located in the proximity of a lead smelter and Săsar district which is located along the Sasar River in the preferential direction of the wind over a metallurgical factory producing lead. As reference was considered Dura area located in a less polluted hilly area, in the west part of the town. Samples of soil and plants from the residential area of Ferneziu, Săsar and Dura districts were collected. The arsenic determination was carried out by inductively coupled plasma atomic emission spectrometry and the antimony determination by inductively coupled plasma mass spectrometry. Results: In Ferneziu area, the concentration of arsenic in soil ranged between 0.25 and 255 mg kg-1. In Săsar district the arsenic concentration in the soil ranged between 5.5 and 295 mg kg-1. Regarding antimony, in Ferneziu area the concentration ranged between 5.3 and 40.6 mg kg-1; while in Săsar, antimony soils concentrations vary in the range: 0.9-18.4. Arsenic and antimony concentrations in plants were low for almost of the samples, both in Ferneziu and Săsar area indicating a low mobility of these elements in the studied soils. Conclusion: This study indicated the soil pollution with arsenic both in Ferneziu district and in Săsar district. The soil pollution with antimony was found especially in Ferneziu district.

  10. The MRP1-mediated effluxes of arsenic and antimony do not require arsenic-glutathione and antimony-glutathione complex formation.

    Science.gov (United States)

    Salerno, Milena; Petroutsa, Maria; Garnier-Suillerot, Arlette

    2002-04-01

    Arsenic trioxide is an effective treatment for acute promyelocytic leukemia, but resistance to metalloid salts is found in humans. Using atomic absorption spectroscopy, we have measured the rate of uptake of arsenic trioxide and of antimony tartrate in GLC4 and GLC4/ADR cells overexpressing MRP1 and the rate of their MRP1-mediated effluxes as a function of the intracellular GSH concentration. In sensitive cells, after 1 h, a pseudosteady state is reached where intra- and extracellular concentrations of metalloid are the same. This precludes the formation, at short term, of complexes between arsenic or antimony with GSH. In resistant cells reduced intracellular accumulation of arsenic (or antimony), reflecting an increased rate of arsenic (or antimony) efflux from the cells, is observed. No efflux of the metalloid is observed in GSH depleted cells. The two metalloids and GSH are pumped out by MRP1 with the same efficiency. Moreover for the three compounds 50% of the efflux is inhibited by 2 microM MK571. This led us to suggest that As- and Sb-containing species could be cotransported with GSH. PMID:12018890

  11. Antimony distribution and mobility in topsoils and plants (Cytisus striatus, Cistus ladanifer and Dittrichia viscosa) from polluted Sb-mining areas in Extremadura (Spain)

    International Nuclear Information System (INIS)

    A study about topsoil antimony distribution and mobility from the soils to the biomass has been afforded in three abandoned Sb mining areas located at Extremadura. Physico-chemical characteristics of the soils and total antimony levels were measured in soils and autochthonous plant species (Cytisus striatus, Cistus ladanifer and Dittrichia viscosa). Comparison with corresponding values in reference areas isolated from the mining activities is discussed. Antimony mobility in the soils was estimated by measuring the water extractable fraction; low results were obtained for the three soil areas, with no statistical differences. Plant ability to accumulate antimony was estimated by use of plant accumulation coefficients (PAC). Seasonal (spring vs. autumn) effects on the antimony content in the plant species. Cytisus striatus from Mari Rosa mine presented antimony excluder characteristics, whereas Dittrichia viscosa specimens growing in San Antonio mine showed a significant antimony bioaccumulation. - Bioaccumulation of antimony in vegetal species growing in mining areas

  12. Antimony distribution and mobility in topsoils and plants (Cytisus striatus, Cistus ladanifer and Dittrichia viscosa) from polluted Sb-mining areas in Extremadura (Spain)

    Energy Technology Data Exchange (ETDEWEB)

    Murciego, A. Murciego [Area de Cristalografia y Mineralogia, Universidad de Extremadura, Avda. Elvas, s/n, E-06071 Badajoz (Spain); Sanchez, A. Garcia [IRNA-CSIC, Departamento de Geoquimica Ambiental, Aptdo. 257, Salamanca (Spain); Gonzalez, M.A. Rodriguez [Area de Cristalografia y Mineralogia, Universidad de Extremadura, Avda. Elvas, s/n, E-06071 Badajoz (Spain); Gil, E. Pinilla [Departamento de Quimica Analitica y Electroquimica, Facultad de Ciencias, Universidad de Extremadura, Avda. Elvas, s/n, E-06071 Badajoz (Spain)]. E-mail: epinilla@unex.es; Gordillo, C. Toro [Departamento de Quimica Analitica y Electroquimica, Facultad de Ciencias, Universidad de Extremadura, Avda. Elvas, s/n, E-06071 Badajoz (Spain); Fernandez, J. Cabezas [Area de Ecologia, Universidad de Extremadura, Avda. Elvas, s/n, E-06071 Badajoz (Spain); Triguero, T. Buyolo [Area de Ecologia, Universidad de Extremadura, Avda. Elvas, s/n, E-06071 Badajoz (Spain)

    2007-01-15

    A study about topsoil antimony distribution and mobility from the soils to the biomass has been afforded in three abandoned Sb mining areas located at Extremadura. Physico-chemical characteristics of the soils and total antimony levels were measured in soils and autochthonous plant species (Cytisus striatus, Cistus ladanifer and Dittrichia viscosa). Comparison with corresponding values in reference areas isolated from the mining activities is discussed. Antimony mobility in the soils was estimated by measuring the water extractable fraction; low results were obtained for the three soil areas, with no statistical differences. Plant ability to accumulate antimony was estimated by use of plant accumulation coefficients (PAC). Seasonal (spring vs. autumn) effects on the antimony content in the plant species. Cytisus striatus from Mari Rosa mine presented antimony excluder characteristics, whereas Dittrichia viscosa specimens growing in San Antonio mine showed a significant antimony bioaccumulation. - Bioaccumulation of antimony in vegetal species growing in mining areas.

  13. Determination of antimony by using tungsten trap atomic absorption spectrometry

    International Nuclear Information System (INIS)

    An electrically heated tungsten coil was used as a trap in the determination of antimony. The technique consists of three steps. Initially, SbH3 is formed by hydride generation procedure; then the analyte species in vapor form are transported to W-coil trap heated at 370 deg. C. Following the preconcentration step, the trap is heated to 895 deg. C; analyte species are revolatilized and transported to the flame-heated quartz atom cell where atomization and the formation of signal take place. The experimental parameters were optimized both for trap and no-trap studies. The most important experimental parameters are concentrations of HCl and NaBH4 solutions, H2 and Ar gas flow rates, and collection and revolatilization temperatures of W-coil. Accuracy was tested using a certified reference material, waste water EU-L-1. Limit of detection for the system is 16 ng l-1 using a sample of 36 ml collected in 4.0 min. Enhancement factor in sensitivity was 17

  14. NEW ERBIUM DOPED ANTIMONY GLASSES FOR LASER AND GLASS AMPLIFICATION

    Directory of Open Access Journals (Sweden)

    B. Tioua

    2015-07-01

    Full Text Available Because of the special spectroscopic properties of the rare earth ions, rare earth doped glasses are widely used in bulk and fiber lasers or amplifiers. The modelling of lasers and searching for new laser transitions require a precise knowledge of the spectroscopic properties of rare earth ions in different host glasses. In this poster will offer new doped erbium glasses synthesized in silicate crucibles were obtained in the combination Sb2O3-WO3-Na2O. Several properties are measured and correlated with glass compositions. The absorption spectral studies have been performed for erbium doped glasses. The intensities of various absorption bands of the doped glasses are measured and the Judd-Ofelt parameters have been computed. From the theory of Judd-Ofelt, various radiative properties, such as transition probability, branching ratio and radiative life time for various emission levels of these doped glasses have been determined and reported. These results confirm the ability of antimony glasses for glass amplification.

  15. 34 CFR 106.2 - Definitions.

    Science.gov (United States)

    2010-07-01

    ... and Secondary Education Act of 1965 (20 U.S.C. 3381), a preschool, a private elementary or secondary... 34 Education 1 2010-07-01 2010-07-01 false Definitions. 106.2 Section 106.2 Education Regulations of the Offices of the Department of Education OFFICE FOR CIVIL RIGHTS, DEPARTMENT OF...

  16. 34 CFR 106.52 - Employment criteria.

    Science.gov (United States)

    2010-07-01

    ... 34 Education 1 2010-07-01 2010-07-01 false Employment criteria. 106.52 Section 106.52 Education Regulations of the Offices of the Department of Education OFFICE FOR CIVIL RIGHTS, DEPARTMENT OF EDUCATION... Discrimination on the Basis of Sex in Employment in Education Programs or Activities Prohibited §...

  17. 34 CFR 106.37 - Financial assistance.

    Science.gov (United States)

    2010-07-01

    ... administer or assist in the administration of scholarships, fellowships, or other forms of financial... 34 Education 1 2010-07-01 2010-07-01 false Financial assistance. 106.37 Section 106.37 Education... NONDISCRIMINATION ON THE BASIS OF SEX IN EDUCATION PROGRAMS OR ACTIVITIES RECEIVING FEDERAL FINANCIAL...

  18. 34 CFR 106.53 - Recruitment.

    Science.gov (United States)

    2010-07-01

    ... 34 Education 1 2010-07-01 2010-07-01 false Recruitment. 106.53 Section 106.53 Education... Recruitment. (a) Nondiscriminatory recruitment and hiring. A recipient shall not discriminate on the basis of sex in the recruitment and hiring of employees. Where a recipient has been found to be...

  19. 7 CFR 1437.106 - Honey.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 10 2010-01-01 2010-01-01 false Honey. 1437.106 Section 1437.106 Agriculture Regulations of the Department of Agriculture (Continued) COMMODITY CREDIT CORPORATION, DEPARTMENT OF AGRICULTURE LOANS, PURCHASES, AND OTHER OPERATIONS NONINSURED CROP DISASTER ASSISTANCE PROGRAM...

  20. 18 CFR 154.106 - Map.

    Science.gov (United States)

    2010-04-01

    ... 18 Conservation of Power and Water Resources 1 2010-04-01 2010-04-01 false Map. 154.106 Section....106 Map. (a) The map must show the general geographic location of the company's principal pipeline... on a single map. In addition, a separate map should be provided for each zone. (b) (c) The map...

  1. 9 CFR 205.106 - Farm products.

    Science.gov (United States)

    2010-01-01

    ... 9 Animals and Animal Products 2 2010-01-01 2010-01-01 false Farm products. 205.106 Section 205.106 Animals and Animal Products GRAIN INSPECTION, PACKERS AND STOCKYARDS ADMINISTRATION (PACKERS AND STOCKYARDS PROGRAMS), DEPARTMENT OF AGRICULTURE CLEAR TITLE-PROTECTION FOR PURCHASERS OF FARM...

  2. 21 CFR 106.20 - Ingredient control.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 2 2010-04-01 2010-04-01 false Ingredient control. 106.20 Section 106.20 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) FOOD FOR HUMAN CONSUMPTION INFANT FORMULA QUALITY CONTROL PROCEDURES Quality Control Procedures for Assuring Nutrient...

  3. 21 CFR 106.90 - Coding.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 2 2010-04-01 2010-04-01 false Coding. 106.90 Section 106.90 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) FOOD FOR HUMAN CONSUMPTION INFANT FORMULA QUALITY CONTROL PROCEDURES Quality Control Procedures for Assuring Nutrient...

  4. 34 CFR 106.56 - Fringe benefits.

    Science.gov (United States)

    2010-07-01

    ... 34 Education 1 2010-07-01 2010-07-01 false Fringe benefits. 106.56 Section 106.56 Education... benefits. (a) Fringe benefits defined. For purposes of this part, fringe benefits means: Any medical, hospital, accident, life insurance or retirement benefit, service, policy or plan, any profit-sharing...

  5. 34 CFR 106.71 - Procedures.

    Science.gov (United States)

    2010-07-01

    ... 1964 are hereby adopted and incorporated herein by reference. These procedures may be found at 34 CFR 100.6-100.11 and 34 CFR, part 101. (Authority: Secs. 901, 902, Education Amendments of 1972, 86 Stat....21(a), 106.2(p), Prohibitions relating to marital and parental status, ; 106.21(c)...

  6. 33 CFR 106.240 - Communications.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Communications. 106.240 Section... Requirements § 106.240 Communications. (a) The Facility Security Officer (FSO) must have a means to effectively notify OCS facility personnel of changes in security conditions at the OCS facility. (b)...

  7. 48 CFR 9.106-4 - Reports.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 1 2010-10-01 2010-10-01 false Reports. 9.106-4 Section 9... CONTRACTOR QUALIFICATIONS Responsible Prospective Contractors 9.106-4 Reports. (a) The surveying activity... performance. The narrative shall report any persistent pattern of need for costly and burdensome...

  8. 34 CFR 106.59 - Advertising.

    Science.gov (United States)

    2010-07-01

    ... 34 Education 1 2010-07-01 2010-07-01 false Advertising. 106.59 Section 106.59 Education Regulations of the Offices of the Department of Education OFFICE FOR CIVIL RIGHTS, DEPARTMENT OF EDUCATION NONDISCRIMINATION ON THE BASIS OF SEX IN EDUCATION PROGRAMS OR ACTIVITIES RECEIVING FEDERAL FINANCIAL...

  9. Predictors of an unsatisfactory response to pentavalent antimony in the treatment of American visceral leishmaniasis

    Directory of Open Access Journals (Sweden)

    Santos Mácia A.

    2002-01-01

    Full Text Available Although treatment of visceral leishmaniasis with pentavalent antimony is usually successful, some patients require second-line drug therapy, most commonly with amphotericin B. To identify the clinical characteristics that predict an inadequate response to pentavalent antimony, a case-control study was undertaken in Teresina, Piaui, Brazil. Over a two-year period, there were 19 cases of VL in which the staff physicians of a hospital prescribed second-line therapy with amphotericin B after determining that treatment with pentavalent antimony had failed. The control group consisted of 97 patients that were successfully treated with pentavalent antimony. A chart review using univariate and multivariate analysis was performed. The cure rate was 90% with amphotericin B. The odds ratio for the prescription of amphotericin B was 10.2 for children less than one year old, compared with individuals aged over 10 years. Patients who presented coinfection had an OR of 7.1 while those on antibiotics had an OR of 2.8. These data support either undertaking a longer course of therapy with pentavalent antimony for children or using amphotericin B as a first-line agent for children and individuals with coinfections. It also suggests that chemoprophylaxis directed toward bacterial coinfection in small children with VL may be indicated.

  10. Copper-promoted cementation of antimony in hydrochloric acid system: A green protocol.

    Science.gov (United States)

    Wu, Lian-Kui; Li, Ying-Ying; Cao, Hua-Zhen; Zheng, Guo-Qu

    2015-12-15

    A new method of recovering antimony in hydrochloric acid system by cementation with copper powder was proposed and carried out at laboratory scale. Thermodynamic analysis and cyclic voltammetry test were conducted to study the cementation process. This is a novel antimony removal technology and quite meets the requirements of green chemistry. The main cement product Cu2Sb is a promising anodic material for lithium and sodium ion battery. And nearly all consumed copper powder are transformed into CuCl which is an important industrial material. The effect of reaction temperature, stoichiometric ratio of Cu to Sb(III), stirring rate and concentration of HCl on the cementation efficiency of antimony were investigated in detail. Optimized cementation condition is obtained at 60 °C for 120 min and stirring rate of 600 rpm with Cu/Sb(III) stoichiometric ratio of 6 in 3 mol L(-1) HCl. At this time, nearly all antimony can be removed by copper powder and the cementation efficiency is over 99%. The structure and morphologies of the cement products were characterized by X-ray diffraction and scanning electron microscopy, respectively. Results show that the reaction temperature has little influence on the morphology of the cement products which consist of particles with various sizes. The activation energy of the cementation antimony on copper is 37.75 kJ mol(-1), indicating a chemically controlled step. Inductively coupled plasma mass spectrometry results show that no stibine generates during the cementation process. PMID:26252996

  11. Determination of traces of uranium and thorium in antimony(III) oxide by ICP-MS

    International Nuclear Information System (INIS)

    Traces of uranium and thorium in antimony(III) oxide were determined by inductively coupled plasma mass spectrometry (ICP-MS). A method of vaporization as the halide was applied to the separation of the analytes from the antimony matrix. Because the above separation method is so simple, reduced of external contamination was expected. In the case of vaporization using hydrochloric acid, however, it was found that antimony trichloride ions overlapped thorium ion of 232 (m/z). To find the most suitable conditions for matrix separation, vaporization behaviors were studied by using different acidic solutions such as HBr, HBr-HClO4 and HBr-H2SO4. Neither HBr+HClO4 nor HBr+H2SO4 was able to reduce the antimony matrix down to an unaffected level on ICP-MS measurement. On the other hand, in the case of the vaporization using hydrobromic acid, almost all the antimony matrix was removed. Determination limits obtained by this method were 0.02 and 0.03 ng g-1 for uranium and thorium, respectively. (author)

  12. Antimony leaching in plastics from waste electrical and electronic equipment (WEEE) with various acids and gamma irradiation

    International Nuclear Information System (INIS)

    Highlights: • We have proposed a method to recover antimony from electronic plastics. • The most efficient acid solution was sodium hydrogen tartrate in dimethyl sulfoxide. • Gamma irradiation did not influence the antimony leaching ability. - Abstract: There has been a recent interest in antimony since the availability in readily mined areas is decreasing compared to the amounts used. It is important in many applications such as flame retardants and in the production of polyester, which can trigger an investigation of the leachability of antimony from plastics using different acids. In this paper, different types of acids are tested for their ability to leach antimony from a discarded computer housing, made of poly(acrylonitrile butadiene styrene), which is a common plastic type used in electrical and electronic equipment. The acid solutions included sodium hydrogen tartrate (0.5 M) dissolved in either dimethyl sulfoxide or water (at ca. 23 °C and heated to ca. 105 °C). The metal content after leaching was determined by inductively coupled plasma optical emission spectroscopy. The most efficient leaching medium was the heated solution of sodium hydrogen tartrate in dimethyl sulfoxide, which leached almost half of the antimony from the poly(acrylonitrile butadiene styrene). Gamma irradiation, which is proposed to improve the mechanical properties in plastics, was used here to investigate the influence of antimony leaching ability. No significant change in the amount of leached antimony could be observed

  13. Mixed Antimony(V Complexes with Different Sugars to Modulate the Oral Bioavailability of Pentavalent Antimonial Drugs

    Directory of Open Access Journals (Sweden)

    Weverson A. Ferreira

    2014-04-01

    Full Text Available Previous studies have shown that the association of the drug meglumine antimoniate (MA with β-cyclodextrin can improve its bioavailability by the oral route. In this work, ribose and maltose were investigated for their ability to form mixed or association complexes with MA, release MA and modulate the serum levels of Sb after oral administration in mice. Analysis of the MA/ribose composition by high performance liquid chromatography coupled to mass spectrometry (LCMS-IT-TOF revealed the presence of mixed meglumine-Sb-ribose and Sb-ribose complexes. Analysis of the MA/maltose composition suggested the formation of MA-maltose association compounds. Circular dichroism characterization of these compositions following dilution in water at 37 °C suggested a partial and slow dissociation of the association compounds. When the MA/ribose composition was administered orally and compared to MA, the serum concentration of Sb was significantly lower after 1 h and greater after 3 h. On the other hand, the MA/maltose composition showed similar serum Sb concentration after 1 h and higher level of Sb after 3 h, when compared to MA. In conclusion, the present study has demonstrated the formation of mixed or association complexes of MA with sugars, such as maltose and ribose, which promoted sustained serum level of Sb after oral administration.

  14. Anodic stripping voltammetry of antimony using gold nanoparticle-modified carbon screen-printed electrodes

    International Nuclear Information System (INIS)

    Carbon screen-printed electrodes (CSPE) modified with gold nanoparticles present an interesting alternative in the determination of antimony using differential pulse anodic stripping voltammetry. Metallic gold nanoparticles deposits have been obtained by direct electrochemical deposition. Scanning electron microscopy measurements show that the electrochemically synthesized gold nanoparticles are deposited in aggregated form. Any undue effects caused by the presence of foreign ions in the solution were also analyzed to ensure that common interferents in the determination of antimony by ASV. The detection limit for Sb(III) obtained was 9.44 x 10-10 M. In terms of reproducibility, the precision of the above mentioned method in %R.S.D. values was calculated at 2.69% (n = 10). The method was applied to determine levels of antimony in seawater samples and pharmaceutical preparations

  15. Response of cutaneous leishmaniasis (chiclero's ulcer) to treatment with meglumine antimoniate in Southeast Mexico.

    Science.gov (United States)

    Vargas-Gonzalez, A; Canto-Lara, S B; Damian-Centeno, A G; Andrade-Narvaez, F J

    1999-12-01

    Cutaneous leishmaniasis, known as chiclero's ulcer in southeastern Mexico, is characterized by a predominantly single, painless, ulcerated lesion, without lymphangitis or adenopathy. When located on the ear, it tends to become chronic, causing destruction of the pinna and disfigurement. It is caused predominantly by Leishmania (L.) mexicana. Although pentavalent antimonials (Sb5+) are the mainstay of leishmanial therapy and have been used for more than 50 years, dosage regimens have been repeatedly modified and the best one has not been fully identified. The main purpose of the present study was to investigate the response of chiclero's ulcer to treatment with meglumine antimoniate. One hundred five patients were treated with meglumine antimoniate at a daily dose of 1 ampule per day (425 mg of Sb5+) until healing. The lesions healed after a mean of 25 days (range = 5-60 days). PMID:10674678

  16. Synthesis of barium mercaptides and application of antimony/barium mercaptides

    Institute of Scientific and Technical Information of China (English)

    瞿龙; 张露露; 舒万艮

    2001-01-01

    Mercaptoacetic acid, isooctyl thioglycolate and barium hydroxide used as start materials, barium bis (2-ethylhexyl thioglycolate) (Ba(2EHTG)2), barium thioglycolate (Ba(TG)) and barium bisthioglycolate (Ba(TG)2) were synthesized. Their optimum synthetic techniques were discussed, and some physicochemical data were reported. Infrared spectroscopy and elemental analysis methods were used to identify the structures. They were put into PVC plastic products together with antimony tris (2-ethylhexyl thioglycolate) (Sb(2EHTG)3) under the suitable compounding, and their heat stability to PVC was studied. It is shown that these barium mercaptides have remarkable synergisms with antimony mercaptides and the long-term stabilizing effect of organoantimony stabilizer can be effectively improved, reducing the amount of antimony compounds so as to avoid the decrease of its stabilizing effect.

  17. Geothermal and fluid flowing simulation of ore-forming antimony deposits in Xikuangshan

    Institute of Scientific and Technical Information of China (English)

    YANG Ruiyan; MA Dongsheng; BAO Zhengyu; PAN Jiayong; CAO Shuanglin; XIA Fei

    2006-01-01

    The Xikuangshan Antimony Deposit located in the Mid-Hunan Basin, China, is the largest antimony deposit in the world. Based on the hydrogeological and geochemical data collected from four sections, Xikuangshan-Dajienao (AO), Xikuangshan-Dashengshan (BO), Xikuangshan-Longshan (CO) and Dafengshan (DO) in the Basin, an advanced metallogenic model related to deep-cyclic meteoric water of Xikuangshan Antimony Deposit is put forward in this paper using a model of heat-gravity-driving fluid flow transportation. The simulation results show that the ore-forming fluid of the deposit mainly comes from the Dashengshan and Longshan areas where BO and CO sections are located if the overall basin keeps a constant atmospheric precipitation and infiltration rate during mineralization, and that the average transportation speed of the ore-forming fluids is about 0.2-0.4 m/a.

  18. Future trends of global atmospheric antimony emissions from anthropogenic activities until 2050

    Science.gov (United States)

    Zhou, Junrui; Tian, Hezhong; Zhu, Chuanyong; Hao, Jiming; Gao, Jiajia; Wang, Yong; Xue, Yifeng; Hua, Shenbin; Wang, Kun

    2015-11-01

    This paper presents the scenario forecast of global atmospheric antimony (Sb) emissions from anthropogenic activities till 2050. The projection scenarios are built based on the comprehensive global antimony emission inventory for the period 1995-2010 which is reported in our previous study. Three scenarios are set up to investigate the future changes of global antimony emissions as well as their source and region contribution characteristics. Trends of activity levels specified as 5 primary source categories are projected by combining the historical trend extrapolation with EIA International energy outlook 2013, while the source-specific dynamic emission factors are determined by applying transformed normal distribution functions. If no major changes in the efficiency of emission control are introduced and keep current air quality legislations (Current Legislation scenario), global antimony emissions will increase by a factor of 2 between 2010 and 2050. The largest increase in Sb emissions is projected from Asia due to large volume of nonferrous metals production and waste incineration. In case of enforcing the pollutant emission standards (Strengthened Control scenario), global antimony emissions in 2050 will stabilize with that of 2010. Moreover, we can anticipate further declines in Sb emissions for all continents with the best emission control performances (Maximum Feasible Technological Reduction scenario). Future antimony emissions from the top 10 largest emitting countries have also been calculated and source category contributions of increasing emissions of these countries present significant diversity. Furthermore, global emission projections in 2050 are distributed within a 1° × 1°latitude/longitude grid. East Asia, Western Europe and North America present remarkable differences in emission intensity under the three scenarios, which implies that source-and-country specific control measures are necessary to be implemented for abating Sb emissions from

  19. Co-doping with antimony to control phosphorous diffusion in germanium

    KAUST Repository

    Tahini, H. A.

    2013-02-15

    In germanium, phosphorous and antimony diffuse quickly and as such their transport must be controlled in order to design efficient n-typed doped regions. Here, density functional theory based calculations are used to predict the influence of double donor co-doping on the migration activation energies of vacancy-mediated diffusion processes. The migration energy barriers for phosphorous and antimony were found to be increased significantly when larger clusters involving two donor atoms and a vacancy were formed. These clusters are energetically stable and can lead to the formation of even larger clusters involving a number of donor atoms around a vacancy, thereby affecting the properties of devices.

  20. Studies on Thin Films of Antimony Vacuum Evaporated from a Knudsen-Type Source

    Directory of Open Access Journals (Sweden)

    K.L. Chaudhary

    2000-10-01

    Full Text Available A Knudsen-type evaporation source was used for the deposition of thin films of antimony to study their growth and microstructure under different rates of evaporation and substrate temperatures when vacuum evaporated onto air-cleaved KC1, mica, amorphous carbon and doped KCl substrates. The crystallisation of these films on exposure to an electron beam of moderate intensity inside the electron microscope was studied, and the orientations of the crystallised films wrt the substrate were established. It has been concluded that antimony films prepared by this source compare well with those prepared by other sources of vacuum evaporation.

  1. 5 CFR 850.106 - Electronic signatures.

    Science.gov (United States)

    2010-01-01

    ... 850.106 Administrative Personnel OFFICE OF PERSONNEL MANAGEMENT (CONTINUED) CIVIL SERVICE REGULATIONS... patterns, and voice recognition; (2) Cryptographic control methods, including— (i) Shared symmetric key cryptography; (ii) Public/private key (asymmetric) cryptography, also known as digital signatures; (3)...

  2. 27 CFR 21.106 - Diethyl phthalate.

    Science.gov (United States)

    2010-04-01

    ... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false Diethyl phthalate. 21.106....106 Diethyl phthalate. (a) Refractive index at 25 °C. 1.497 to 1.502. (b) Color. Colorless. (c) Odor... °/25 °C. 1.115 to 1.118. (f) Ester content (as diethyl phthalate). Not less than 99 percent by...

  3. Study on the characteristics of indigenously developed 106Ru/106Rh source

    International Nuclear Information System (INIS)

    A pilot study was initiated to investigate the characteristics of 106Ru/106Rh source for the purpose of inducting it in Quality Assurance programme of personnel monitoring by Bhabha Atomic Research Centre. Towards this goal, a prototype 106Ru/106Rh source was fabricated indigenously. Different parameters such as activity, gamma ray spectrum, beam uniformity, percentage depth dose, output of the source, contribution of gamma and beta components of the source were studied. The detectors used in the study are CaSO4:Dy Teflon disc, pocket dosimeter, HPGe detector and radiochromic films. - Highlights: • Indigenous development of 106Ru/106Rh source for QA in personnel monitoring. • Source parameters such as activity of the source, gamma spectrum were studied. • Dosimetric parameters such as beam uniformity, BSF, gamma and beta contribution and PDD were studied. • TLDs, EBT radiochromic film, HPGe and electronic pocket dosimeter were used in the study

  4. Diel variation of arsenic, molybdenum and antimony in a stream draining natural As geochemical anomaly

    Czech Academy of Sciences Publication Activity Database

    Drahota, P.; Nováková, B.; Matoušek, Tomáš; Mihaljevič, M.; Rohovec, Jan; Filippi, Michal

    2013-01-01

    Roč. 31, APR (2013), s. 84-93. ISSN 0883-2927 Institutional research plan: CEZ:AV0Z30130516 Institutional support: RVO:68081715 ; RVO:67985831 Keywords : arsenic * molybdenum * antimony * trace elements * diel cycle Subject RIV: CB - Analytical Chemistry, Separation; DD - Geochemistry (GLU-S) Impact factor: 2.021, year: 2013

  5. Differences in antimony and arsenic releases from lead smelter fly ash in soils

    Czech Academy of Sciences Publication Activity Database

    Ettler, V.; Mihaljevič, M.; Šebek, O.; Valigurova, R.; Klementová, Mariana

    2012-01-01

    Roč. 72, Supp. 4 (2012), s. 15-22. ISSN 0009-2819 Institutional research plan: CEZ:AV0Z40320502 Keywords : Antimony * Arsenic * Lead smelting * Fly ash * Soil * Mobility Subject RIV: CA - Inorganic Chemistry Impact factor: 1.351, year: 2012

  6. Transparent Conducting Films of Antimony-Doped Tin Oxide with Uniform Mesostructure Assembled from Preformed Nanocrystals

    Czech Academy of Sciences Publication Activity Database

    Müller, V.; Rathouský, Jiří; Rasp, M.; Schütz, B.; Niederberger, M.; Fattakhova-Rohlfing, D.

    Vol. 1. Boca Raton : Taylor-Francis, 2010, s. 627-630. ISBN 978-1-4398-3401-5. - ( Nanotech 2010) R&D Projects: GA ČR GA104/08/0435 Institutional research plan: CEZ:AV0Z40400503 Keywords : antimony-doped tin oxide * mesoporous materials * nanoparticles * self-assembly Subject RIV: CF - Physical ; Theoretical Chemistry

  7. Determination of barium and antimony in gun shot residues by neutron activation analysis

    International Nuclear Information System (INIS)

    The antimony contents on both hands of 7 persons before and after firing an automatic pistol were determined by instrumental neutron activation analysis. The gun shot residues were removed from hands by a 4% solution of cellulose acetate in acetone. The average content of antimony on both hands before firing obtained from 70 measurements (35 from each hand) was 0.040 ± 0.010 micro gram, whereas the average contents on the right and the left hands after 1 firing were 0.385 ± 0.036 and 0.144 ± 0.029 micro gram respectively. The ration of the antimony contents after 1 firing to the normal level (before firing) was 9.9 for the right and 3.6 for the left. No significant difference was observed between male and female, smoker and non-smoker. The antimony content after several firings was not much different from that of 1 firing and it reduced to the normal level within 2 days after firing. The barium contents before and after firing were studied from one person. Barium was precipitated as Ba SO4 before counting. An average contents of 0.936 ± 0.551 micro gram for both hands before firing, 4.092 ± 2.687 micro gram for the right hand and 1.363 ± 0.879 micro gram for the left hand after 1 firing were found

  8. Transparent Conducting Films of Antimony-Doped Tin Oxide with Uniform Mesostructure Assembled from Preformed Nanocrystals

    Czech Academy of Sciences Publication Activity Database

    Müller, V.; Rasp, M.; Rathouský, Jiří; Schütz, B.; Niederberger, M.; Fattakhova-Rohlfing, D.

    2010-01-01

    Roč. 6, č. 5 (2010), s. 633-637. ISSN 1613-6810 R&D Projects: GA ČR GA104/08/0435 Institutional research plan: CEZ:AV0Z40400503 Keywords : antimony-doped tin oxide * msoporous materials * nanoparticles Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 7.333, year: 2010

  9. Antimony production by carbothermic reduction of stibnite in the presence of lime

    Directory of Open Access Journals (Sweden)

    Padilla R.

    2014-01-01

    Full Text Available Experimental work on the carbothermic reduction of Sb2S3 in the presence of lime was carried out in the temperature range of 973 to 1123 K to produce antimony in an environmentally friendly manner. The results demonstrated the technical feasibility of producing antimony by this method without producing SO2 gas. Complete conversion of Sb2S3 was obtained at 1023 K in about 1000 seconds and at 1123 K in less than 250 seconds using stibnite-carbon-lime mixtures with molar ratios Sb2S3:CaO:C = 1:3:3. It was found that the reduction proceeds through the formation of an intermediate oxide SbO2, which is subsequently reduced by CO(g to yield antimony metal and CaS. The kinetics of the Sb2S3 reduction was analyzed by using the equation ln(1-X = -kt. The activation energy was 233 kJ mol-1 in the temperature range of 973 to 1123 K. This value would correspond to an antimony catalyzed carbon oxidation by CO2.

  10. Reaction products and corrosion of molybdenum electrode in glass melt containing antimony oxides and sodium sulfate

    Czech Academy of Sciences Publication Activity Database

    Matěj, J.; Langrová, Anna

    2012-01-01

    Roč. 56, č. 3 (2012), s. 280-285. ISSN 0862-5468 Institutional support: RVO:67985831 Keywords : antimony oxides * corrosion * glass melt * Molybdenum electrode * sulfate Subject RIV: DD - Geochemistry Impact factor: 0.418, year: 2012 http://www.ceramics-silikaty.cz/2012/pdf/2012_03_280.pdf

  11. On the segregation behavior of tin and antimony at grain boundaries of polycrystalline bcc iron

    Czech Academy of Sciences Publication Activity Database

    Lejček, Pavel; Šandera, P.; Horníková, J.; Pokluda, J.; Godec, M.

    2016-01-01

    Roč. 363, Feb (2016), 140-144. ISSN 0169-4332 R&D Projects: GA ČR GAP108/12/0144 Institutional support: RVO:68378271 Keywords : grain boundary segregation * tin * antimony * Fe based alloy * AES quantification Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 2.711, year: 2014

  12. Synthesis of antimony tris(mercaptoethyl carboxylates) as thermal stabilizer for polyvinyl chloride

    Institute of Scientific and Technical Information of China (English)

    舒万艮; 刘又年; 陈启元

    2002-01-01

    A novel type of thermal stabilizers-antimony tris(mercaptoethyl carboxylates) (Sb(SCH2CH2OOCR) 3), was synthesized from carboxylic acid, antimony trioxide and 2-mercaptoethanol in two steps. The experimental results show that the molar ratio of carboxylic acid to antimony tris(2-hydroxyethyl mercaptide) is 1.2, when adding 0.6% tetra-n-butyl titanate as catalyst and xylene as isotropic solvent, heating and refluxing for about 2~4h. The thermal stability was measured by heat-aging oven test. The thermal stability time is about 8~40min(at 200℃) when adding 2% tetra-n-butyl titanate in polyvinyl chloride(PVC). Among these stabilizers, antimony tris(mercaptoethyl stearate) has best thermal stability. Its thermal stability is better than that of Ca-Zn complex and basic lead stabilizers, and equal to that of organotin. In addition, the stabilization mechanism of this kind of stabilizers for PVC was discussed briefly.

  13. Dicty_cDB: AFM106 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available AF (Link to library) AFM106 (Link to dictyBase) - - - - AFM106P (Link to Original site) AFM106F 527 AFM...106Z 527 AFM106P 1034 - - Show AFM106 Library AF (Link to library) Clone ID AFM106 (Link... to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig - Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/AF/AFM...1-A/AFM106Q.Seq.d/ Representative seq. ID AFM106P (Link to... Original site) Representative DNA sequence >AFM106 (AFM106Q) /CSM/AF/AFM1-A/AFM106Q.Seq.d/ AATTTTTTTTCTTTTC

  14. Chemistry gains a new element: Z=106

    International Nuclear Information System (INIS)

    Even though 112 chemical elements are presently known, for elements with atomic numbers above 105 only nuclear decay properties have been investigated so far. Such data allow to proof the existence of a given nuclide, but they do not yield any information with respect to the position of a chemical element in the Periodic Table. We have performed ever first chemical investigations of element 106. According to the Periodic Table element 106 should be a member of group 6, having similar chemical properties as W, Mo and Cr. Two different techniques were applied to separate and identify element 106: a liquid chromatography system (ARCA = Automated Rapid Chemistry Apparatus) and a continuous isothermal chromatography device (OLGA = On-Line Gaschemistry Apparatus). With ARCA about 5'000 separations on small cation exchange columns (Aminex A6) with a 0.1 M HNO3/5.10-4 M Hf solution were performed and with OLGA the gas adsorption behaviour of oxychlorides on quartz columns using Cl2/SOCl2/O2 as reactive gas were studied. On the basis of only ten detected atoms, it was possible to proof that element 106 forms complexes which are eluted at positions similar to those of Mo and W. In addition, in the gas phase element 106 forms oxychlorides of lower volatility compared to those of Mo and W. (author) 1 ref

  15. Antimonial drugs entrapped into phosphatidylserine liposomes: physicochemical evaluation and antileishmanial activity

    Directory of Open Access Journals (Sweden)

    Samanta Etel Treiger Borborema

    2016-04-01

    Full Text Available Abstract: INTRODUCTION: Leishmaniasis is a disease caused by the protozoan Leishmania that resides mainly in mononuclear phagocytic system tissues. Pentavalent antimonials are the main treatment option, although these drugs have toxic side effects and high resistance rates. A potentially alternative and more effective therapeutic strategy is to use liposomes as carriers of the antileishmanial agents. The aims of this study were to develop antimonial drugs entrapped into phosphatidylserine liposomes and to analyze their biological and physicochemical characteristics. METHODS: Liposomes containing meglumine antimoniate (MA or pentavalent antimony salt (Sb were obtained through filter extrusion (FEL and characterized by transmission electron microscopy. Promastigotes of Leishmania infantum were incubated with the drugs and the viability was determined with a tetrazolium dye (MTT assay. The effects of these drugs against intracellular amastigotes were also evaluated by optical microscopy, and mammalian cytotoxicity was determined by an MTT assay. RESULTS: Liposomes had an average diameter of 162nm. MA-FEL showed inhibitory activity against intracellular L. infantum amastigotes, with a 50% inhibitory concentration (IC50 of 0.9μg/mL, whereas that of MA was 60μg/mL. Sb-FEL showed an IC50 value of 0.2μg/mL, whereas that of free Sb was 9μg/mL. MA-FEL and Sb-FEL had strong in vitro activity that was 63-fold and 39-fold more effective than their respective free drugs. MA-FEL tested at a ten-times higher concentration than Sb-FEL did not show cytotoxicity to mammalian cells, resulting in a higher selectivity index. CONCLUSIONS: Antimonial drug-containing liposomes are more effective against Leishmania-infected macrophages than the non-liposomal drugs.

  16. Internal clinical acceptance test of the dose rate of 106Ru/106Rh ophthalmic applicators

    International Nuclear Information System (INIS)

    For the last forty years or so, episcleral brachytherapy using 106Ru/106Rh ophthalmic applicators has been a proven method of therapy for uveal melanomas, sparing the globe and in many cases conserving the vision. In episcleral brachytherapy, a radioactive 106Ru/106Rh ophthalmic applicator (BEBIG Co., Berlin, Germany) is temporarily fixed on the surface of the bulbus oculi, whereby the intraocular tumour gets irradiated protractedly through the sclera. 106Ru/106Rh ophthalmic applicators are primarily beta sources, i.e. they generate a local dose escalation both in the vessels supplying the tumour and in the tumour itself, while simultaneously sparing the risk structures. In its certificates, BEBIG, the manufacturer of the product, indicates a dose rate for the 106Ru/106Rh ophthalmic applicators at a dose specification reference point which ensures traceability to the NIST standard (12/2001). The dose specification reference point is situated at a distance of 2 mm from the middle of the inner (concave) surface of the applicators, and the dose rate was measured with a scintillation detector (diameter 1 mm, height 0.5 mm). The manufacturer indicates for this dose rate at the dose specification reference point a relative measurement uncertainty of ±20% within the 95% confidence interval. Since the introduction of the NIST calibration, the quality of the calibration passed on by BEBIG to the user has been examined for n=45 ophthalmic applicators

  17. 33 CFR 106.115 - Compliance documentation.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Compliance documentation. 106.115... documentation. Each OCS facility owner or operator subject to this part must ensure before July 1, 2004, that copies of the following documentation are available at the OCS facility and are made available to...

  18. Tank 241-TY-106 Tank Characterization Plan

    Energy Technology Data Exchange (ETDEWEB)

    Schreiber, R.D.

    1995-02-22

    This document is a plan which serves as the contractual agreement between the Characterization Program, Sampling Operations, and WHC 222-S Laboratory. The scope of this plan is to provide guidance for the sampling and analysis of samples for tank 241-TY-106.

  19. 5 CFR 3801.106 - Outside employment.

    Science.gov (United States)

    2010-01-01

    ... EMPLOYEES OF THE DEPARTMENT OF JUSTICE § 3801.106 Outside employment. (a) Definition. For purposes of this... excluded from this definition, so long as they are not combined with the provision of other services that do fall within this definition, such as the practice of law. Employees who wish to engage...

  20. Tank 241-BY-106 tank characterization plan

    International Nuclear Information System (INIS)

    This document is a plan which serves as the contractual agreement between the Characterization Program, Sampling Operations, PNL 325 Analytical Chemistry Laboratory, and WHC 222-S Laboratory. The scope of this plan is to provide guidance for the sampling and analysis of samples for tank 241-BY-106

  1. 42 CFR 3.106 - Security requirements.

    Science.gov (United States)

    2010-10-01

    ... ORGANIZATIONS AND PATIENT SAFETY WORK PRODUCT PSO Requirements and Agency Procedures § 3.106 Security requirements. (a) Application. A PSO must secure patient safety work product in conformance with the security... the confidentiality and security of patient safety work product. (2) Distinguishing patient...

  2. 26 CFR 601.106 - Appeals functions.

    Science.gov (United States)

    2010-04-01

    ... (31 CFR Part 10), and the requirements of Subpart E of this part. In addition to such rules but not in... STATEMENT OF PROCEDURAL RULES General Procedural Rules § 601.106 Appeals functions. (a) General. (1)(i... Code (because the taxpayer has the right to appeal such penalties, such as those provided under...

  3. Recovery of antimony-125 from tin-124 irradiated by neutrons

    International Nuclear Information System (INIS)

    Separation of 125Sb from tin using highly basic, medium-basic, and weakly basic ion-exchangers was studied. The best results were obtained for AN-31 weakly basic anion exchanger. The yield of 125Sb was 95 -98 % of the initial activity, the yield of tin, 98 ± 0.5% of the initial amount. The separation coefficient is 106-107 for one cycle. A procedure based on ion exchange was developed. Extraction procedures of separation of 125Sb from tin were studied. Isoamyl alcohol, ethyl acetate, and di-n-butyl ether were used as extracting agents. The most efficient extracting agent is di-n-butyl ether. Carrier-free radiochemically pure sample of 125Sb was produced. More than 20 mCi of the target product was recovered. The extraction recovery procedure of 125Sb has been developed. (author)

  4. Recovery of antimony-125 from tin-124 irradiated by neutrons

    Science.gov (United States)

    Baluev, A. V.; Mityakhina, V. S.; Krasnikov, L. V.; Galkin, B. Ya.; Besnosyuk, V. I.

    2003-01-01

    Separation of 125Sb from tin using highly basic, medium-basic, and weakly basic ion-exchangers was studied. The best results were obtained for AN-31 weakly basic anion exchanger. The yield of 125Sb was 95-98% of the initial activity, the yield of tin, 98±0.5% of the initial amount. The separation coefficient is 106-107 for one cycle. A procedure based on ion exchange was developed. Extraction procedures of separation of 125Sb from tin were studied. Isoamyl alcohol, ethyl acetate, and di- n-butyl ether were used as extracting agents. The most efficient extracting agent is di- n-butyl ether. Carrier-free radiochemically pure sample of 125Sb was produced. More than 20 mCi of the target product was recovered. The extraction recovery procedure of 125Sb has been developed.

  5. Extraction-radiochemical study of the ion-association complex of antimony (V) with tetrazolium violet and its thermal behavior

    International Nuclear Information System (INIS)

    The optimum conditions for extraction of ion-associated complexes (IAS) formed from the tetrazolium salt - tetrazolium violet and Sb(V) in hydrochloric acid medium have been studied. An isotope of antimony (125Sb) was used for determination of the recovery factor (R%) and distribution ratio (DSb). The thermal behavior of the antimony complex with tetrazole violet was studied using differential thermal and thermogravimetric analysis. (author) 12 refs.; 3 figs

  6. Electrodes modified with bismuth, antimony and tin precursor compounds for electrochemical stripping analysis of trace metals (a short review)

    OpenAIRE

    Lezi, Nikolitsa; Economou, Anastasios; Barek, Jiří

    2014-01-01

    Over the last decade, intensive research is being carried out towards the development of “green” electrochemical sensors. Bismuth, antimony and tin electrodes have been proposed as potential substitutes of mercury electrodes in electrochemical stripping analysis of trace metals. The main advantage of these metals as electrode materials is their lower toxicity compared to mercury. Among the different configuration of bismuth, antimony and tin electrodes, one of the most attractive inv...

  7. Electrodeposition of SnSbCu Alloy on Copper from an Electrolyte with Varied Content of Antimony Chloride

    Science.gov (United States)

    Valeeva, A. Kh.; Valeev, I. Sh.

    2015-10-01

    The microstructure and chemical composition of electrodeposited alloys of the SnSbCu system with varied concentration of antimony chloride in the electrolyte have been investigated. It is shown that during electrodeposition mechanical-mixture alloys are not formed, but rather intermetallic compounds. It is found that increasing the concentration of antimony chloride in the electrolyte leads to a decrease in the tin content and cracking of the coating.

  8. Investigation into properties of the mixture of perfluoro-2-methyl-bicyclo(4,4,0) decane with antimony fluoride

    International Nuclear Information System (INIS)

    State diagram was constructed for a binary system formed by antimony fluoride and perfluoro-2-methyl-bicyclo-(4,4,0)decane in the temperature range of -58 deg to +56 deg C. Temperature dependence of solubility and the differential molar heat of solubility of solid Sb F5 were determined. Above the melting point of antimony fluoride these components were found to form a system of two sparingly miscible liquids with upper critical dissolution temperature

  9. Treatment of antimony mine drainage: challenges and opportunities with special emphasis on mineral adsorption and sulfate reducing bacteria.

    Science.gov (United States)

    Li, Yongchao; Hu, Xiaoxian; Ren, Bozhi

    2016-01-01

    The present article summarizes antimony mine distribution, antimony mine drainage generation and environmental impacts, and critically analyses the remediation approach with special emphasis on iron oxidizing bacteria and sulfate reducing bacteria. Most recent research focuses on readily available low-cost adsorbents, such as minerals, wastes, and biosorbents. It is found that iron oxides prepared by chemical methods present superior adsorption ability for Sb(III) and Sb(V). However, this process is more costly and iron oxide activity can be inhibited by plenty of sulfate in antimony mine drainage. In the presence of sulfate reducing bacteria, sulfate can be reduced to sulfide and form Sb2S3 precipitates. However, dissolved oxygen and lack of nutrient source in antimony mine drainage inhibit sulfate reducing bacteria activity. Biogenetic iron oxide minerals from iron corrosion by iron-oxidizing bacteria may prove promising for antimony adsorption, while the micro-environment generated from iron corrosion by iron oxidizing bacteria may provide better growth conditions for symbiotic sulfate reducing bacteria. Finally, based on biogenetic iron oxide adsorption and sulfate reducing bacteria followed by precipitation, the paper suggests an alternative treatment for antimony mine drainage that deserves exploration. PMID:27148704

  10. Understanding the radiolabelling mechanism of 99mTc-antimony sulphide colloid

    International Nuclear Information System (INIS)

    The chemistry of antimony trisulphide colloid (ATC) was examined to elucidate the radiolabelling mechanism with 99mTcO4-. Ion exchange chromatography and atomic absorption spectrophotometry techniques determined ATC to be resistant to hydrolysis in 0.1 M hydrochloric acid (HCl) at 25 deg. C or 100 deg. C (>97% recovery, Sb3+ absent). Hydrogen sulphide gas detected did not participate in the mechanism, where antimony trisulphide and 99mTcO4- in HCl/100 deg. C yielded 96% 99mTc-product from a K2S-free formulation (versus 98% when K2S was present). 99mTcO4- was reduced >90% by DMSA or dithiothreitol under the same conditions, identifying involvement of thiol groups. Infrared analysis of Re-ATC showed S-O bonds, indicating excess thiol groups at the colloid surface were oxidised at the expense of 99mTcO4- reduction

  11. A facile and fast route to prepare antimony (Sb) nanostructures without additives

    KAUST Repository

    Shah, M.A.

    2011-12-01

    Herein, we report a safe, low cost and reproducible approach for the synthesis of antimony (Sb) nanostructures with most of them having prism like morphology and having well defined faces in the range of ∼70210 nm. The organics free approach is based on a reaction of antimony powder and pure water at ∼210 °C without using any harmful additives and amines. The XRD pattern confirmed the composition and crystallinity of the grown nanostructures. The reported method besides being organics free is economical, fast and free of pollution, which will make it suitable for large scale production. Furthermore, it is well expected that such a technique could be extended to prepare many other important metal and metal oxide nanostructures. The prospects of the process are bright and promising. © 2012 Sharif University of Technology. Production and hosting by Elsevier B.V. All rights reserved.

  12. Determination by neutron activation analysis of loss of arsenic, antimony, bromine and mercury during lyophilization

    International Nuclear Information System (INIS)

    Neutron activation analysis has been used to monitor the loss of arsenic, as dimethylarsinic acid, (CH3)2AsOOH, or as sodium arsenate (Na2HAsO4.7H2O), antimony (as potassium antimony, tartrate, KSbC4O7.1/2H2O) and bromine (as bromide ion) during lyophilization of acidified and neutral aqueous synthetic and environmental samples. Losses of Sb and As ranged from zero to 60%, while losses of bromine were constant (at 91%) in acidic solutions. The variable losses of As and Sb were due solely to the presence of and partial decomposition of the (CH3)2AsOOH. Electrochemical oxidation of Br- to Br2 is responsible for the high losses of bromine. In addition losses of mercury (as methylmercuric chloride) were 1O0% in both acidic and neutral aqueous synthetic samples during lyophilization. (author)

  13. Deciphering lead and cadmium stripping peaks for porous antimony deposited electrodes

    Directory of Open Access Journals (Sweden)

    Taimoor Aqeel Ahmad

    2016-06-01

    Full Text Available Cadmium and lead are generally taken as model heavy metal ions in water to scale the detection limit of various electrode sensors, using electrochemical sensing techniques. These ions interact with the electrochemically deposited antimony electrodes depending on the diffusion limitations. The phenomenon acts differently for the in-situ and ex-situ deposition as well as for porous and non-porous electrodes. A method has been adopted in this study to discourage the stripping and deposition of the working ions (antimony to understand the principle of heavy metal ion detection. X-ray photoelectron spectroscopy (XPS technique was used to establish the interaction between the working and dissolved ions. In addition to the distinct peaks for each analyte, researchers also observed a shoulder peak. A possible reason for the presence of this peak was provided. Different electrochemical tests were performed to ascertain the theory on the basis of the experimental observations.

  14. Antimony/Graphitic Carbon Composite Anode for High-Performance Sodium-Ion Batteries.

    Science.gov (United States)

    Zhao, Xin; Vail, Sean A; Lu, Yuhao; Song, Jie; Pan, Wei; Evans, David R; Lee, Jong-Jan

    2016-06-01

    Although the room-temperature rechargeable sodium-ion battery has emerged as an attractive alternative energy storage solution for large-scale deployment, major challenges toward practical sodium-ion battery technology remain including identification and engineering of anode materials that are both technologically feasible and economical. Herein, an antimony-based anode is developed by incorporating antimony into graphitic carbon matrices using low-cost materials and scalable processes. The composite anode exhibits excellent overall performance in terms of packing density, fast charge/discharge capability and cyclability, which is enabled by the conductive and compact graphitic network. A full cell design featuring this composite anode with a hexacyanometallate cathode achieves superior power output and low polarization, which offers the potential for realizing a high-performance, cost-effective sodium-ion battery. PMID:27172376

  15. Antimony segregation in stressed SiGe heterostructures grown by molecular beam epitaxy

    International Nuclear Information System (INIS)

    The effects of the growth temperature, composition, and elastic strains in separate layers on the segregation of antimony are studied experimentally for stressed SiGe structures grown by molecular beam epitaxy. It is established that the growth conditions and parameters of the structures exert an interrelated influence on the segregation of Sb: the degree of the influence of the composition and elastic stresses in the SiGe layers on Sb segregation depends on the growth temperature. It is shown that usage of a method previously proposed by us for the selective doping of silicon structures with consideration for the obtained dependences of Sb segregation on the growth conditions and parameters of the SiGe layers makes it possible to form SiGe structures selectively doped with antimony

  16. Synthesis, spectroscopic characterization and antibacterial activity of antimony(III) bis(dialkyldithiocarbamato)alkyldithiocarbonates.

    Science.gov (United States)

    Chauhan, H P S; Bakshi, Abhilasha; Bhatiya, Sumit

    2011-10-15

    Some mixed sulfur donor ligand complexes of antimony(III) of the general formula [(R(2)NCS(2))](2)SbS(2)COR' where R = CH(3), C(2)H(5) and R' = Me, Et, Pr(n), Pr(i), Bu(n) and Bu(i) have been synthesized by the reaction of antimony(III) bis(dialkyldithiocarbamate) chloride with potassium organodithiocarbonate in an equimolar ratio by stirring at room temperature in benzene/CS(2) mixture. These complexes have been characterized by physicochemical [elemental analysis, melting points and molecular weight determinations] and spectral [UV, IR, Far-IR, NMR ((1)H and (13)C), FAB(+) mass and powder X-ray diffraction] studies. Free ligands and synthesized complexes have also been screened against different bacterial strains and results obtained made it desirable to delineate a comparison between free ligands, standard drug used and synthesized complexes. PMID:21764366

  17. Measurement of aluminium, silicon, manganese, copper and antimony in slag, castings and white metal

    International Nuclear Information System (INIS)

    Chemical analysis of the slag showed 24.90% SiO2, 17.88% Al2O3, 0.75% F2O3, 46.4% CaO and 2.34% MgO. In the four cast metal samples the manganese concentration was 0.75%, 0.48%, 0.47% and 0.42%. The white metal contained 59.04% tin, 7.43% antimony, 22.55% lead and 7.08% copper. The slag, casting and white metal samples came from the Industrial Research Centre for Central Africa (CRIAC), having been provided originally by the Société Somkat of Lubumbashi which operates iron, bronze and aluminium foundries. The aluminium, silicon, manganese, copper and antimony concentrations were easily measured, without the need for chemical separation. (author)

  18. Internal Clinical Acceptance Test of the Dose Rate of 106Ru/106Rh Ophthalmic Applicators

    International Nuclear Information System (INIS)

    Episcleral brachytherapy using 106Ru/106Rh ophthalmic applicators is a proven method of therapy for uveal melanomas, sparing the globe and in many cases, conserving vision. In its certificates, Bebig, the manufacturer of the product, indicates a dose rate for the 106Ru/106Rh ophthalmic applicators which ensures traceability to the NIST standard (12/2001). Since the introduction of the NIST calibration, the quality of the calibration provided by Bebig to the clinical user has been examined for 45 ophthalmic applicators with a plastic scintillator measurement system. Of these, 20 ophthalmic applicators had a dose rate at the dose specification reference point that exceeded the dose rate stated in the manufacturer's certificate by up to 23%. (author)

  19. Bi-antimony capped Keggin polyoxometalate modified with Cu-ligand fragment

    Energy Technology Data Exchange (ETDEWEB)

    Huang, Jiao [College of Chemistry and Material Science, Hebei Normal University, No. 20 Road East of 2nd Ring South, Yuhua District, Shijiazhuang, Hebei 050024 (China); Han, Zhangang, E-mail: hanzg116@yahoo.com.cn [College of Chemistry and Material Science, Hebei Normal University, No. 20 Road East of 2nd Ring South, Yuhua District, Shijiazhuang, Hebei 050024 (China); Zhang, Heng; Yu, Haitao [College of Chemistry and Material Science, Hebei Normal University, No. 20 Road East of 2nd Ring South, Yuhua District, Shijiazhuang, Hebei 050024 (China); Zhai, Xueliang, E-mail: xlzhai253@mail.hebtu.edu.cn [College of Chemistry and Material Science, Hebei Normal University, No. 20 Road East of 2nd Ring South, Yuhua District, Shijiazhuang, Hebei 050024 (China)

    2012-10-15

    Three polyoxometalates consisting of bi-antimony capped Keggin-type clusters: [Cu(mbpy){sub 2}]{sub 2}[PMo{sub 12}O{sub 40}Sb{sub 2}]{center_dot}4H{sub 2}O (1), [Cu(mbpy){sub 2}][PMo{sub 12}O{sub 40}Sb{sub 2}] (2) and {l_brace}Cu(mbpy)[Cu(mbpy){sub 2}]{sub 2}{r_brace}[VMo{sub 8}V{sub 4}O{sub 40}Sb{sub 2}]{center_dot}2H{sub 2}O (3) (mbpy=4,4 Prime -dimethyl-2,2 Prime - dipyridyl in 1 and 2; 5,5 Prime -dimethyl-2,2 Prime -dipyridyl in 3) have been synthesized and characterized by IR, X-ray powder diffraction, TG analysis and electrochemical property. Single-crystal analysis revealed that all of three compounds are built upon bi-antimony capped Keggin-type polyoxoanions and Cu-mbpy cations. In 1-3, two Sb{sup III} centers located at the two opposite of anionic surface adopt fundamentally tetragonal pyramidal coordination geometry. Both compounds 1 and 2 consist of P-centered Keggin structure, while compound 3 presents a V-centered Keggin anion. The Keggin-type anions present different structural features: isolated cluster in 1 and Cu-ligand-supported cluster in 2 and 3. - Graphical abstract: Three hybrid compounds consisting of bi-antimony capped Keggin-type clusters modified with Cu-ligand cations have been synthesized and characterized. Highlights: Black-Right-Pointing-Pointer Three hybrid compounds consisting of bi-antimony capped Keggin-type clusters have been synthesized. Black-Right-Pointing-Pointer Two Sb{sup III} centers located at the two opposite of anionic surface adopt tetragonal pyramidal coordination geometry. Black-Right-Pointing-Pointer The anions present different structural features: isolated and Cu-ligand-supported cluster.

  20. Application of Hyphenated Techniques in Speciation Analysis of Arsenic, Antimony, and Thallium

    OpenAIRE

    Rajmund Michalski; Sebastian Szopa; Magdalena Jabłońska; Aleksandra Łyko

    2012-01-01

    Due to the fact that metals and metalloids have a strong impact on the environment, the methods of their determination and speciation have received special attention in recent years. Arsenic, antimony, and thallium are important examples of such toxic elements. Their speciation is especially important in the environmental and biomedical fields because of their toxicity, bioavailability, and reactivity. Recently, speciation analytics has been playing a unique role in the studies of biogeochemi...

  1. Metal corrosion studies with the fluorosulphonic acid-antimony pentafluoride superacid system

    International Nuclear Information System (INIS)

    Because of their rapid dissolution of many actinide metals and refractory oxides, superacids such as HSO3F/SbF5 have potential applications in actinide processing. However, material compatibility must first be addressed because of the highly corrosive nature of superacids. This paper describes the qualitative rates of attack of fluorosulphonic acid-antimony pentafluoride superacid on a variety of metal substrates relevant to nuclear processing

  2. Molybdenum-vanadium-antimony mixed oxide catalyst for isobutane partial oxidation synthesized using magneto hydrodynamic forces

    OpenAIRE

    Stuyven, Bernard; Emmerich, Jens; Eloy, Pierre; Van Humbeeck, Jan; Jacobs, Pierre; Kirschhock, Christine; Martens, Johan; Breynaert, Eric

    2014-01-01

    A peculiar effect was observed that the oxidation behavior of antimony oxide prepared in presence of a weak permanent magnetic field is changed. Reactivity of alpha-Sb2O3 (senarmontite) towards oxidation is significantly enhanced after recirculating its suspension in a magneto hydrodynamic (MHD) system. This inspired the MHD synthesis of a molybdenum-vanadiumantimony mixed oxide with superior catalytic activity for selective partial oxidation of isobutane. Traditionally these mixed oxides are...

  3. General report of TC 106: Unsaturated soils

    OpenAIRE

    Jommi, C.

    2013-01-01

    This general report summarises the contributions on unsaturated soil mechanics submitted to the Discussion Session of TC106 – Unsaturated soils –at the 18th International Conference on Soil Mechanics and Geotechnical Engineering held in Paris in September 2013. The thirty-five papers collected under the framework of unsaturated soil mechanics cover a broad spectrum of problems and procedures at varying scales. Much attention is devoted to issues related to experimental techniques and procedur...

  4. Temporal and spatial distribution of atmospheric antimony emission inventories from coal combustion in China

    International Nuclear Information System (INIS)

    A multiple-year inventory of atmospheric antimony (Sb) emissions from coal combustion in China for the period of 1980-2007 has been calculated for the first time. Specifically, the emission inventories of Sb from 30 provinces and 4 economic sectors (thermal power, industry, residential use, and others) are evaluated and analyzed in detail. It shows that the total Sb emissions released from coal combustion in China have increased from 133.19 t in 1980 to 546.67 t in 2007, at an annually average growth rate of 5.4%. The antimony emissions are largely emitted by industrial sector and thermal power generation sector, contributing 53.6% and 26.9% of the totals, respectively. At provincial level, the distribution of Sb emissions shows significant variation. Between 2005 and 2007, provinces always rank at the top five largest Sb emissions are: Guizhou, Hunan, Hebei, Shandong, and Anhui. - Highlights: → Atmospheric Sb emission inventory from coal in China during 1980-2007 is developed. → We included 1612 coal samples to determine the provincial mean Sb contents in coal. →Emission inventories of Sb from 30 provinces and 4 economic sectors are evaluated. → Total 546.67t Sb emissions in 2007 are mainly emitted from industrial sector. → There is significant variation for Sb distribution among different provinces. - A multiple-year inventory of atmospheric antimony emissions from coal combustion in China for the period of 1980-2007 has been calculated for the first time.

  5. Antimony in the Contaminated Site of El Triunfo, Baja California Sur, Mexico

    Directory of Open Access Journals (Sweden)

    Marmolejo-Rodríguez A. J.

    2013-04-01

    Full Text Available Antimony has properties similar to arsenic with some of its compounds toxic to humans. Therefore it is necessary to control the wastes accumulated by anthropogenic activities, such as mining, where it is in tailings to be released to the environment. According to the Environment Protection Agency, the maximum value in sediments is 11.2 mg Sb kg–1 and the Earth’s crust average is 0.2 mg Sb kg–1. In this semiarid area, the drainage basin El Carrizal is impacted with wastes of an abandoned gold mine at the Mining District El Triunfo (MD – ET which have tailings with 17,600 mg kg–1 of antimony. In the main dry river (arroyo, the Sb content is between 0.6 and 122 mg kg–1. This element is transported from the source throughout the fluvial basin to discharge into the Pacific Ocean. In the arroyo mouth we collected one sedimentary core and the sediment from dunes (28.6 – 45.7 and 6.43 – 7.74 mg Sb kg–1. This research concluded the antimony is enriched in this semiarid system, with Normalized Enrichment Factors severely enriched mainly in arroyo sediments close to the MD-ET

  6. Morphology and antimony segregation of spangles on batch hot-dip galvanized coatings

    International Nuclear Information System (INIS)

    Spangles produced by batch hot-dip galvanizing process have a rougher surface and a greater surface segregation of alloying element compared with those in continuous hot-dip galvanizing line (CGL), owing to the cooling rate of the former is much smaller than that of the later. Therefore, typical spangles on a batch hot-dipped Zn-0.05Al-0.2Sb alloy coating were investigated. The chemical, morphological characterization and identification of the phases on the spangles were examined by scanning electron microscopy (SEM), backscattered electron imaging (BSE), atomic force microscopy (AFM), energy dispersive spectroscopy (EDS) and X-ray diffraction analysis (XRD). The results showed that the coating surface usually exhibited three kinds of spangles: shiny, feathery and dull spangle, of which extensively antimony surface segregation was detected. The nature of precipitate on the coating surface was identified as β-Sb3Zn4, The precipitated β-Sb3Zn4 particles distributed randomly on the shiny spangle surface, both β-Sb3Zn4 particles and dentritic segregation of antimony dispersed in the dendritic secondary arm spacings of the feathery spangle and on the whole dull spangle surface. The dentritic segregation of antimony and precipitation of Sb3Zn4 compound are discussed by a proposed model.

  7. Methylated arsenic and antimony species in suspended matter of the river Ruhr, Germany

    Directory of Open Access Journals (Sweden)

    L. Duester

    2008-04-01

    Full Text Available The methylated antimony and arsenic species content of sediments derived from a sedimentation bowl of the river Ruhr were monitored over a 12 month period. The most prevalent species detected were monomethylarsenic (MMAs and monomethylantimony (MMSb. The methylantimony and methylarsenic species concentration was found to be directly correlated to the winter spate. As the biological activity in the water body is generally low at this time of the year, it may be concluded that the concentration maxima in winter originated from the translocation of soil- and sediment particles to the river by heavy rains and the melting of snow. A second maximum in Spring/early Summer was observed for the methylarsenic species, and specifically the dimethylarsenic species (DMAs; this occurred in parallel to the algal bloom. A change in the methylarsenic speciation pattern was observed between April, May and June, with DMAs replacing MMAs as the dominant methylarsenic species. For methylated antimony species no seasonal variation in the species pattern was detected. Taken together these data strongly indicate a higher degree of transformation of arsenic compared to antimony in the Ruhr river system in spring and can be taken as a record for a biogeochemical different behaviour of these two elements which are often treated as equivalent in environmental studies.

  8. Studies in atomic-fluorescence spectroscopy-V The fluorescence characteristics and determination of antimony.

    Science.gov (United States)

    Dagnall, R M; Thompson, K C; West, T S

    1967-10-01

    Atomic-fluorescence of antimony may be generated in an air-propane flame by nebulizing aqueous solutions of antimony salts whilst irradiating the flame by means of a microwave-excited electrode-less discharge tube operating at 30 W. The strongest fluorescence is exhibited by the (4)S(11 2 ) --> (4)P(1 3 ) 2311 A resonance line and weaker signals are observed at the 2068 and 2176 A resonance lines and at four intercombination lines, at 2598, 2671, 2770 and 2878 A. A process of thermally assisted direct-line fluorescence is postulated to account for the otherwise inexplicable intensity of the 2598 A line emission. Atomic-fluorescence spectroscopy at 2176 A permits the determination of antimony in the range 0.1-120 ppm with a detection limit of 0.05 ppm. With the same equipment and source, the range of measurement for atomic-absorption was 6-120 ppm and the detection limit was 1 ppm. No interferences were observed from 100-fold molar amounts of Cd, Co, Cu, Fe, Hg, K, Mg, Mn, Mo, Na, NH(4), Pb and Zn or from arsenate, chloride, nitrate, phosphate and sulphate. PMID:18960212

  9. Ultrasound- assisted emulsification microextraction for separation of trace amounts of antimony prior to FAAS determination

    International Nuclear Information System (INIS)

    We describe a simple and rapid method for the ultrasound-assisted microextraction of antimony using the solidified floating organic drop method. The effects of pH, type and volume of the extractant, time of sonication, amount of chelating agent, type and amount of surfactant were investigated and optimized. Bromopyrogollol red is acting as the chelating agent. Antimony(III) ion was extracted into finely dispersed droplets of undecanol after ion-pair formation with the water soluble chelator and the cationic detergent benzyldimethyltetradecylammonium chloride. Flame atomic absorption spectrometry was used for the detection. The resulting calibration is linear in the concentration range from 4. 0 to 900 ng mL-1 of Sb(III) with a correlation coefficient of 0. 9981. The enrichment factor is 67, the detection limit is 0. 62 ng mL-1, and the relative standard deviation is ±3. 6% (at 100 ng mL-1; for n = 10). The method was successfully applied to the determination of antimony in water samples. (author)

  10. Accumulation of antimony and other potentially toxic elements in plants around a former antimony mine located in the Ribes Valley (Eastern Pyrenees)

    Science.gov (United States)

    Bech, Jaume; Corrales, Isabel; Duran, Paola; Roca, Núria; Tume, Pedro; Barceló, Juan; Poschenrieder, Charlotte

    2010-05-01

    Soil contamination by antimony is of increasing environmental concern due to the use of this amphoterous p-block element in many industrial applications such as flame retardant, electronics, alloys, rubber and textile industries. However, little is still known about the response of plants to antimony. Here we report on the accumulation of antimony and other potentially toxic elements (mainly As, Pb and Cu) in plants growing around a former antimony mine in the ribes Valley located in the Eastern Pyrenees (424078E, 4686100N alt. 1145 m.a.s.l) that was operating approximately between the years 1870 to 1960. The ore mineral veins are included in quartz gangue. The main ores were: Sulphides: Stibnite (Sb2S3), Pyrite (FeS2), Sphalerite (ZnS), Arsenopyrite (FeAs), Galenite (PbS), Chalcopyrite (CuFeS2), Tetrahydrite (Cu5Sb2S3). Sulphosals: Boulangerite (5PbS•2Sb2S3), Jamesonite (4PbS•FeS•3Sb2S3), Zinckenite (6PbS•7Sb2S3), Plagionite (5PbS•4Sb2S3), Bournonite PbCu (Sb,As)S3, Pyrargirite (Ag3SbS3). Soil and plant samples were taken at five locations with different levels of Sb, As, and polymetallic contamination. Both pseudototal (aqua regia soluble) and extractable (EDTA) concentrations of metals from sites with low (sites 1 and 2), moderate (site 3 and 4) and high (sites 5 and 6) pollutant burdens were studied. The range of agua regia and EDTA values in mgkg-1 is as follows: Sb 8-2904 and 0.88-44; As: 33-16186 and 3.2-167; Pb: 79-4794 and 49-397; Cu: 66-712 and 48-56 mg•kg-1, respectively). While sites 1 to 4 had alkaline soil pH (7.4-8.7), sites 5 and 6 were acidic with values of 6 and 4.6, respectively. Different herbaceous plant species (Poa annua, Echium vulgare, Sonchus asper, Barbera verna among others) at the low and moderately polluted sites were able to efficiently restrict Sb and As transport to shoots showing average concentration ranges between 5.5 and 23 mg/kg As and 1.21 mg/kg and 4.9 mg/kg Sb. However, at the highly polluted acidic sites (5 and

  11. Comparison of oral itraconazole and intramuscular meglumine antimoniate in the treatment of cutaneous leishmaniasis

    International Nuclear Information System (INIS)

    To compare the efficacy and tolerability of oral itraconazole against intramuscular meglumine antimoniate in the treatment of Cutaneous Leishmaniasis (CL). Two hundred eligible and consenting patients of Cutaneous Leishmaniasis (CL) were divided in two groups with 100 patients in each. The number and location of the lesions were documented and clinical types of cutaneous leishmaniasis were noted. The diagnosis was confirmed by skin slit smear and histopathology of the lesional skin. Culture on Nicolle Novy MacNeal (NNN) medium and Leishmanin test was done in all patients. All the patients in both groups were subjected to complete blood picture, urine examination, serum urea and creatinine levels and ECG examination. One group was given itraconazole 100 mg twice daily orally for a duration of 6-8 weeks. The other group was given meglumine antimoniate 10 cc in the form of deep intramuscular injections for 15-30 days. The efficacy of the treatment was judged by clinical and parasitological response. Side effects of the agents were also noted during treatment. Out of 200 patients studied, 185 were males and 15 were females. The mean age of presentation was 30 + 6.6 years. Single lesion was seen in 132 (66%) subjects whereas 68 (34%) subjects had multiple lesions. Slit skin smears were positive in 50 (25%) of the patients. Skin biopsy yielded the presence of LT bodies in 150 (75%) subjects. The culture was positive in 102 (51%) cases. Leishmanin test was positive in 94% subjects. Seventy-five (75%) patients on itraconazole therapy showed complete clinical and parasitological cure in 4-8 weeks duration. A rise in ALT was seen in 12% subjects. Five (5%) subjects did not show any improvement till the end of therapy. Sixty-five (65%) subjects on meglumine antimoniate showed complete healing in 15-30 days. In 35 (35%) of the patients, the treatment had to be stopped due to intolerable side-effects. Four cases of lupoid leishmaniasis and 4 cases of sporotrichoid leishmaniasis

  12. Study on determination of antimony in environmental samples by nuclear technique neutron activation analysis

    Energy Technology Data Exchange (ETDEWEB)

    Martins, Tassiane Cristina Gomes; Saiki, Mitiko [Instituto de Pesquisas Energeticas e Nucleares (IPEN/CNEN-SP), Sao Paulo, SP (Brazil)

    2010-07-01

    Full text: The Interest on determination of antimony in environmental samples has increased significantly in recent years due to the impact caused by human activities and their potential cumulative toxic at low concentrations, apart from not having known biological function. However, the quantification of antimony has interference problems due to low concentrations that hinder its analysis. Therefore becomes of great interest to establish adequate procedures for neutron activation analysis (NAA) to obtain reliable results in environmental samples. In this context, reference materials INCT-TL-1 Tea Leaves, INCT-MPH -2 Mixed Polish Herbs, CTA-VTL-2 Virginia Tobaco Leaves, White Cabbage BCR-679, IAEA 140/TM Seaweed (Focus sp), IAEA -SL-1 Lake Sediment and IAEA-336 Lichen, were selected for analysis and evaluation of results. Aliquots of these standard synthetic materials and antimony were irradiated in the nuclear research reactor IEA-R1 under thermal neutron flux of approximately 5 x 1012 cm{sup -2} s{sup -1} for a period of 8 or 16 hours. After appropriate decay time, the induced gamma activity of the irradiated samples and standard was measured using hyperpure Ge detector coupled to the digital spectrum analyzer DAS 1000, both from Canberra. The radioisotopes measured with gamma ray energies and the half-life were Sb-122 (E{gamma} = 564keV ; t1=2 = 2:7d) and Sb - 124 (E{gamma} = 1692keV; t1=2 60:2d). Antimony concentrations were calculated by the comparative method and the uncertainties of the results were estimated using statistical error of the sample and standard counts Results obtained in these analyses showed a good agreement with certified values and relative errors varying from 0.78 to 13.8%. The values of the standardized difference or Z-scores obtained were lower than 2, indicating that the obtained data were within the range of certified values at a significance level of 68%, demonstrating the suitability of the method used for determination of antimony

  13. Study on determination of antimony in environmental samples by nuclear technique neutron activation analysis

    International Nuclear Information System (INIS)

    Full text: The Interest on determination of antimony in environmental samples has increased significantly in recent years due to the impact caused by human activities and their potential cumulative toxic at low concentrations, apart from not having known biological function. However, the quantification of antimony has interference problems due to low concentrations that hinder its analysis. Therefore becomes of great interest to establish adequate procedures for neutron activation analysis (NAA) to obtain reliable results in environmental samples. In this context, reference materials INCT-TL-1 Tea Leaves, INCT-MPH -2 Mixed Polish Herbs, CTA-VTL-2 Virginia Tobaco Leaves, White Cabbage BCR-679, IAEA 140/TM Seaweed (Focus sp), IAEA -SL-1 Lake Sediment and IAEA-336 Lichen, were selected for analysis and evaluation of results. Aliquots of these standard synthetic materials and antimony were irradiated in the nuclear research reactor IEA-R1 under thermal neutron flux of approximately 5 x 1012 cm-2 s-1 for a period of 8 or 16 hours. After appropriate decay time, the induced gamma activity of the irradiated samples and standard was measured using hyperpure Ge detector coupled to the digital spectrum analyzer DAS 1000, both from Canberra. The radioisotopes measured with gamma ray energies and the half-life were Sb-122 (Eγ = 564keV ; t1=2 = 2:7d) and Sb - 124 (Eγ = 1692keV; t1=2 60:2d). Antimony concentrations were calculated by the comparative method and the uncertainties of the results were estimated using statistical error of the sample and standard counts Results obtained in these analyses showed a good agreement with certified values and relative errors varying from 0.78 to 13.8%. The values of the standardized difference or Z-scores obtained were lower than 2, indicating that the obtained data were within the range of certified values at a significance level of 68%, demonstrating the suitability of the method used for determination of antimony in this type sample

  14. Biodistribution of meglumine antimoniate in healthy and Leishmania (Leishmania infantum chagasi-infected BALB/c mice

    Directory of Open Access Journals (Sweden)

    Samanta Etel Treiger Borborema

    2013-08-01

    Full Text Available Pentavalent antimonials such as meglumine antimoniate (MA are the primary treatments for leishmaniasis, a complex disease caused by protozoan parasites of the genus Leishmania . Despite over 70 years of clinical use, their mechanisms of action, toxicity and pharmacokinetics have not been fully elucidated. Radiotracer studies performed on animals have the potential to play a major role in pharmaceutical development. The aims of this study were to prepare an antimony radiotracer by neutron irradiation of MA and to determine the biodistribution of MA in healthy and Leishmania (Leishmania infantum chagasi-infected mice. MA (Glucantime(r was neutron irradiated inside the IEA-R1 nuclear reactor, producing two radioisotopes, 122Sb and 124Sb, with high radionuclidic purity and good specific activity. This irradiated compound presented anti-leishmanial activity similar to that of non-irradiated MA in both in vitro and in vivo evaluations. In the biodistribution studies, healthy mice showed higher uptake of antimony in the liver than infected mice and elimination occurred primarily through biliary excretion, with a small proportion of the drug excreted by the kidneys. The serum kinetic curve was bi-exponential, with two compartments: the central compartment and another compartment associated with drug excretion. Radiotracers, which can be easily produced by neutron irradiation, were demonstrated to be an interesting tool for answering several questions regarding antimonial pharmacokinetics and chemotherapy.

  15. Development of an analytical method for antimony speciation in vegetables by HPLC-hydride generation-atomic fluorescence spectrometry.

    Science.gov (United States)

    Olivares, David; Bravo, Manuel; Feldmann, Jorg; Raab, Andrea; Neaman, Alexander; Quiroz, Waldo

    2012-01-01

    A new method for antimony speciation in terrestrial edible vegetables (spinach, onions, and carrots) was developed using HPLC with hydride generation-atomic fluorescence spectrometry. Mechanical agitation and ultrasound were tested as extraction techniques. Different extraction reagents were evaluated and optimal conditions were determined using experimental design methodology, where EDTA (10 mmol/L, pH 2.5) was selected because this chelate solution produced the highest extraction yield and exhibited the best compatibility with the mobile phase. The results demonstrated that EDTA prevents oxidation of Sb(III) to Sb(V) and maintains the stability of antimony species during the entire analytical process. The LOD and precision (RSD values obtained) for Sb(V), Sb(III), and trimethyl Sb(V) were 0.08, 0.07, and 0.9 microg/L and 5.0, 5.2, and 4.7%, respectively, for a 100 microL sample volume. The application of this method to real samples allowed extraction of 50% of total antimony content from spinach, while antimony extracted from carrots and onion samples ranged between 50 and 60 and 54 and 70%, respectively. Only Sb(V) was detected in three roots (onion and spinach) that represented 60-70% of the total antimony in the extracts. PMID:22970588

  16. 29 CFR 825.106 - Joint employer coverage.

    Science.gov (United States)

    2010-07-01

    ... 29 Labor 3 2010-07-01 2010-07-01 false Joint employer coverage. 825.106 Section 825.106 Labor... AND MEDICAL LEAVE ACT OF 1993 Coverage Under the Family and Medical Leave Act § 825.106 Joint employer... employee, the businesses may be joint employers under FMLA. Joint employers may be separate and...

  17. 5 CFR 185.106 - Prerequisites for issuing a complaint.

    Science.gov (United States)

    2010-01-01

    ... 5 Administrative Personnel 1 2010-01-01 2010-01-01 false Prerequisites for issuing a complaint. 185.106 Section 185.106 Administrative Personnel OFFICE OF PERSONNEL MANAGEMENT CIVIL SERVICE REGULATIONS PROGRAM FRAUD CIVIL REMEDIES § 185.106 Prerequisites for issuing a complaint. (a) The...

  18. 48 CFR 873.106 - Presolicitation exchanges with industry.

    Science.gov (United States)

    2010-10-01

    ... with industry. 873.106 Section 873.106 Federal Acquisition Regulations System DEPARTMENT OF VETERANS... 873.106 Presolicitation exchanges with industry. (a) This section shall be used in lieu of FAR part 10... industry shall be a matter of the contracting officer's discretion (for acquisitions not exceeding...

  19. 28 CFR 34.106 - Number of peer reviewers.

    Science.gov (United States)

    2010-07-01

    ... 28 Judicial Administration 1 2010-07-01 2010-07-01 false Number of peer reviewers. 34.106 Section 34.106 Judicial Administration DEPARTMENT OF JUSTICE OJJDP COMPETITION AND PEER REVIEW PROCEDURES Peer Review § 34.106 Number of peer reviewers. The number of peer reviewers will vary by program...

  20. 34 CFR 106.7 - Effect of employment opportunities.

    Science.gov (United States)

    2010-07-01

    ... 34 Education 1 2010-07-01 2010-07-01 false Effect of employment opportunities. 106.7 Section 106.7... FINANCIAL ASSISTANCE Introduction § 106.7 Effect of employment opportunities. The obligation to comply with this part is not obviated or alleviated because employment opportunities in any occupation...

  1. 10 CFR 766.106 - Late payment fees.

    Science.gov (United States)

    2010-01-01

    ... 10 Energy 4 2010-01-01 2010-01-01 false Late payment fees. 766.106 Section 766.106 Energy DEPARTMENT OF ENERGY URANIUM ENRICHMENT DECONTAMINATION AND DECOMMISSIONING FUND; PROCEDURES FOR SPECIAL ASSESSMENT OF DOMESTIC UTILITIES Procedures for Special Assessment § 766.106 Late payment fees. In the case of a late payment by a domestic utility...

  2. 48 CFR 2428.106-6 - Furnishing information.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 6 2010-10-01 2010-10-01 true Furnishing information. 2428.106-6 Section 2428.106-6 Federal Acquisition Regulations System DEPARTMENT OF HOUSING AND URBAN DEVELOPMENT GENERAL CONTRACTING REQUIREMENTS BONDS AND INSURANCE Bonds 2428.106-6 Furnishing information....

  3. 48 CFR 2828.106-6 - Furnishing information.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 6 2010-10-01 2010-10-01 true Furnishing information. 2828.106-6 Section 2828.106-6 Federal Acquisition Regulations System DEPARTMENT OF JUSTICE General Contracting Requirements BONDS AND INSURANCE Bonds 2828.106-6 Furnishing information. In accordance with...

  4. 49 CFR 230.106 - Steam locomotive frame.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 4 2010-10-01 2010-10-01 false Steam locomotive frame. 230.106 Section 230.106... Tenders Trucks, Frames and Equalizing System § 230.106 Steam locomotive frame. (a) Maintenance and inspection. Frames, decks, plates, tailpieces, pedestals, and braces shall be maintained in a safe...

  5. 21 CFR 106.30 - Finished product evaluation.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 2 2010-04-01 2010-04-01 false Finished product evaluation. 106.30 Section 106.30... Assuring Nutrient Content of Infant Formulas § 106.30 Finished product evaluation. (a) The manufacturer... representative samples of each batch of finished product for: (i) Specific nutrient(s) to assess...

  6. 33 CFR 106.255 - Security systems and equipment maintenance.

    Science.gov (United States)

    2010-07-01

    ... maintenance. 106.255 Section 106.255 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND... Shelf (OCS) Facility Security Requirements § 106.255 Security systems and equipment maintenance. (a... procedures for identifying and responding to security system and equipment failures or malfunctions....

  7. 48 CFR 570.106 - Publicizing/Advertising.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 4 2010-10-01 2010-10-01 false Publicizing/Advertising. 570.106 Section 570.106 Federal Acquisition Regulations System GENERAL SERVICES ADMINISTRATION SPECIAL CONTRACTING PROGRAMS ACQUIRING LEASEHOLD INTERESTS IN REAL PROPERTY General 570.106...

  8. 50 CFR 648.106 - Sea Turtle conservation.

    Science.gov (United States)

    2010-10-01

    ... Summer Flounder Fisheries § 648.106 Sea Turtle conservation. Sea turtle regulations are found at 50 CFR... 50 Wildlife and Fisheries 8 2010-10-01 2010-10-01 false Sea Turtle conservation. 648.106 Section 648.106 Wildlife and Fisheries FISHERY CONSERVATION AND MANAGEMENT, NATIONAL OCEANIC AND...

  9. 7 CFR 4280.106 - Conflict of interest.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 15 2010-01-01 2010-01-01 false Conflict of interest. 4280.106 Section 4280.106... Efficiency Improvements Program § 4280.106 Conflict of interest. No conflict of interest or appearance of conflict of interest will be allowed. For purposes of this subpart, conflict of interest includes, but...

  10. Leachability of antimony from energy ashes. Total contents, leachability and remedial suggestions; Lakning av antimon fraan energiaskor. Totalhalter, lakbarhet samt foerslag till aatgaerder

    Energy Technology Data Exchange (ETDEWEB)

    Baeckstroem, Mattias [Oerebro Univ. (Sweden)

    2006-01-15

    In the current project total concentrations for antimony in 31 energy ashes have been compiled. The average concentration of antimony in boiler fly ash and grate boiler fly ash is 192 and 1,140 mg/kg, respectively. The corresponding antimony concentrations for boiler ashes and grate bottom ashes are 86,5 and 61,8 mg/kg, respectively. Multivariate calculations clearly pointed out waste as the major source for antimony in ashes. The difference between total antimony concentration in fly ash and bottom ash is greatest for grate boilers, in average 18 times higher in the fly ash. The difference for CFB/BFB-boilers is only slightly more than 2. However, based on amount, 75% of the total antimony inventory is recovered in the fly ashes for both CFB/BFB and grate boilers. Eleven (eight of which were bottom ashes) out of the 31 samples exceeded the guidelines for inert waste. It is clear that the higher ionic strength in the solutions from the fly ashes contribute to decrease the solubility for critical minerals retaining antimony. In addition, the fly ashes have considerably larger effective surface able to sorb trace elements. A clear and positive covariance was discovered between aluminium and antimony. Furthermore, it was noted that antimony showed no typical anionic behaviour despite the fact that it according to the geochemical calculations should be present as SbO{sub 3}{sup -}. At L/S 10, a maximum of 1% of the total antimony concentration is leached. This should be compared to chloride that had 94% of the total concentration leached at L/S 10. There was no correlation between the leached antimony concentrations and the total antimony concentrations. The sequential extractions also suggest a low leachability for antimony from the ashes. In average only 9,6% is released at pH 7, 7,3% at pH 5, 3,6% during reducing conditions and 3,2% during oxidising conditions. In total, only 24% of the total antimony concentrations is released during the four extraction steps. The

  11. Selective liquid-liquid extraction of antimony(III from hydrochloric acid media by N-n-octylaniline in xylene

    Directory of Open Access Journals (Sweden)

    M. A. ANUSE

    2004-04-01

    Full Text Available N-n-Octylaniline in xylene was used for the extraction separation of antimony(III from hydrochloric acid media. Antimony(III was extracted quantitatively with 10 mL 4 % N-n-octylaniline in xylene. It was stripped from the organic phase with 0.5 M ammonia and estimated photometrically by the iodide method. The effect of metal ion, acid, reagent concentration and various foreign ions was investigated. The method affords binary and ternary separation of antimony(III from tellurium(IV, selenium(IV, lead(II, bismuth(III, tin(IV, germanium(IV, copper(II, gold(III, iron(III and zinc(II. The method is applicable for the analysis of synthetic mixtures, alloys and semiconductor thin films. It is fast, accurate and precise.

  12. Synthesis, characterization and single crystal X-ray analysis of chlorobis(N,N-dimethyldithiocarbamato-S,S′antimony(III

    Directory of Open Access Journals (Sweden)

    H.P.S. Chauhan

    2015-07-01

    Full Text Available The title compound chlorobis(N,N-dimethyldithiocarbamato-S,S′antimony(III has been prepared in distilled acetonitrile and characterized by physicochemical [melting point and molecular weight determination, elemental analysis (C, H, N, S & Sb], spectral [FT–IR, far IR, NMR (1H & 13C] studies. The crystal and molecular structure was further confirmed using single crystal X-ray diffraction analysis which features a five-coordinate geometry for antimony(III within a ClS4 donor set. The distortion in the co-planarity of ClSbS3 evidences the stereochemical influence exerts by the lone pair of electrons on antimony(III. Two centrosymmetrically related molecule held together via C–H···Cl secondary interaction result in molecular aggregation of the compound.

  13. Search for double beta decay processes in 106Cd with the help of 106CdWO4 crystal scintillator

    CERN Document Server

    Belli, P; Boiko, R S; Brudanin, V B; Cappella, F; Caracciolo, V; Cerulli, R; Chernyak, D M; Danevich, F A; d'Angelo, S; Galashov, E N; Incicchitti, A; Kobychev, V V; Laubenstein, M; Mokina, V M; Poda, D V; Podviyanuk, R B; Polischuk, O G; Shlegel, V N; Stenin, Yu G; Suhonen, J; Tretyak, V I; Vasiliev, Ya V

    2011-01-01

    A search for the double beta processes in 106Cd was realized at the Gran Sasso National Laboratories of the INFN (Italy) with the help of a 106CdWO4 crystal scintillator (215 g) enriched in 106Cd up to 66%. After 6590 h of data taking, new improved half-life limits on the double beta processes in 106Cd were established at the level of 10^{19}-10^{21} yr; in particular, T_{1/2}(2\

  14. C-106 tank process ventilation test

    International Nuclear Information System (INIS)

    Project W-320 Acceptance Test Report for tank 241-C-106, 296-C-006 Ventilation System Acceptance Test Procedure (ATP) HNF-SD-W320-012, C-106 Tank Process Ventilation Test, was an in depth test of the 296-C-006 ventilation system and ventilation support systems required to perform the sluicing of tank C-106. Systems involved included electrical, instrumentation, chiller and HVAC. Tests began at component level, moved to loop level, up to system level and finally to an integrated systems level test. One criteria was to perform the test with the least amount of risk from a radioactive contamination potential stand point. To accomplish this a temporary configuration was designed that would simulate operation of the systems, without being connected directly to the waste tank air space. This was done by blanking off ducting to the tank and connecting temporary ducting and an inlet air filter and housing to the recirculation system. This configuration would eventually become the possible cause of exceptions. During the performance of the test, there were points where the equipment did not function per the directions listed in the ATP. These events fell into several different categories. The first and easiest problems were field configurations that did not match the design documentation. This was corrected by modifying the field configuration to meet design documentation and reperforming the applicable sections of the ATP. A second type of problem encountered was associated with equipment which did not operate correctly, at which point an exception was written against the ATP, to be resolved later. A third type of problem was with equipment that actually operated correctly but the directions in the ATP were in error. These were corrected by generating an Engineering Change Notice (ECN) against the ATP. The ATP with corrected directions was then re-performed. A fourth type of problem was where the directions in the ATP were as the equipment should operate, but the design of

  15. Pharmacokinetics and tissue distribution of Antimony after multiple intramuscular administrations in the Hamster

    International Nuclear Information System (INIS)

    The fate of pentavalent antimony (Sb) in different tissues in the body after intramuscular administration is of great interest for the future study of Sb therapy in different sitting. Pharmacokinetics and tissue distribution of antimony (Sb) were studied in the hamster after daily dose of sodium stibogluconate equivalent to 120 mg kg of Sb, administered intramuscularly for two weeks. Liver, spleen, heart, kidney and skin tissues were isolated after blood collection at the specified time. Antimony was measured in these tissues after suitable treatment, ashing and processing, by flame less atomic absorption spectrophotometry. The concentration of Sb time profile in blood showed a linear raid decline with elimination half life (tz1/2) of 1.7h. The concentration of drug (ug/gm) declined in a biphasic manner from almost all tissues. However, the concentrations of Sb were declined in slower fashion from the hamster tissues than from the blood. The maximum concentration of Sb was determined in the kidney tissues (3416+-631ug/gm) while the lowest concentration was in the spleen (209+-187ug/gm). The maximum concentration of Sb in the kidney (ug/gm) was more than 25 fold higher than that measured from blood (ug/ml). The AUC of Sb in the studied tissues was in this rank: kidney>liver>skin>spleen>heart>blood. Surprisingly, the heart, spleen and liver showed a similar t1/2 of 5.2-6.2h while the kidney and skin had a t1/2 of about 3h. Therefore, disposition of Sb seems to kinetically follow multicompartmental compartmental model. The kidneys got the highest concentration of drug which may lead to nephrotoxicity on long term therapy. (author)

  16. Lithium-antimony-lead liquid metal battery for grid-level energy storage

    Science.gov (United States)

    Wang, Kangli; Jiang, Kai; Chung, Brice; Ouchi, Takanari; Burke, Paul J.; Boysen, Dane A.; Bradwell, David J.; Kim, Hojong; Muecke, Ulrich; Sadoway, Donald R.

    2014-10-01

    The ability to store energy on the electric grid would greatly improve its efficiency and reliability while enabling the integration of intermittent renewable energy technologies (such as wind and solar) into baseload supply. Batteries have long been considered strong candidate solutions owing to their small spatial footprint, mechanical simplicity and flexibility in siting. However, the barrier to widespread adoption of batteries is their high cost. Here we describe a lithium-antimony-lead liquid metal battery that potentially meets the performance specifications for stationary energy storage applications. This Li||Sb-Pb battery comprises a liquid lithium negative electrode, a molten salt electrolyte, and a liquid antimony-lead alloy positive electrode, which self-segregate by density into three distinct layers owing to the immiscibility of the contiguous salt and metal phases. The all-liquid construction confers the advantages of higher current density, longer cycle life and simpler manufacturing of large-scale storage systems (because no membranes or separators are involved) relative to those of conventional batteries. At charge-discharge current densities of 275 milliamperes per square centimetre, the cells cycled at 450 degrees Celsius with 98 per cent Coulombic efficiency and 73 per cent round-trip energy efficiency. To provide evidence of their high power capability, the cells were discharged and charged at current densities as high as 1,000 milliamperes per square centimetre. Measured capacity loss after operation for 1,800 hours (more than 450 charge-discharge cycles at 100 per cent depth of discharge) projects retention of over 85 per cent of initial capacity after ten years of daily cycling. Our results demonstrate that alloying a high-melting-point, high-voltage metal (antimony) with a low-melting-point, low-cost metal (lead) advantageously decreases the operating temperature while maintaining a high cell voltage. Apart from the fact that this finding

  17. Development and pharmacokinetic of antimony encapsulated in liposomes of phosphatidylserine using radioisotopes in experimental leishmaniasis

    International Nuclear Information System (INIS)

    Leishmaniasis are a complex of parasitic diseases caused by intra macrophage protozoa of the genus Leishmania, and is fatal if left untreated. Pentavalent antimonials, though toxic and their mechanism of action being unclear, remain the first-line drugs for treatment. Effective therapy could be achieved by delivering antileishmanial drugs to these sites of infection. Liposomes are phospholipid vesicles that promote improvement in the efficacy and action of drugs in target cell. Liposomes are taken up by the cells of mononuclear phagocytic system (MPS). The purpose of this study was to develop a preparation of meglumine antimonate encapsulated in liposomes of phosphatidylserine and to study its pharmacokinetic in healthy mice to establish its metabolism and distribution. Quantitative analysis of antimony from liposomes demonstrated that Neutron Activation Analysis was the most sensitive technique with almost 100 % of accuracy. All liposome formulations presented a mean diameter size of 150 nm. The determination of IC50 in infected macrophage showed that liposome formulations were between 10 - 63 fold more effective than the free drug, indicating higher selectivity index. By fluorescence microscopy, an increased uptake of fluorescent-liposomes was seen in infected macrophages during short times of incubation compared with non-infected macrophages. Biodistribution studies showed that meglumine antimonate irradiated encapsulated in liposomes of phosphatidylserine promoted a targeting of antimony for MPS tissues and maintained high doses in organs for a prolonged period. In conclusion, these data suggest that meglumine antimonate encapsulated in liposomes showed higher effectiveness than the non-liposomal drug against Leishmania infection. The development of liposome formulations should be a new alternative for the chemotherapy of infection diseases, especially Leishmaniasis, as they are used to sustain and target pharmaceuticals to the local of infection. (author)

  18. The LABCG2 Transporter from the Protozoan Parasite Leishmania Is Involved in Antimony Resistance.

    Science.gov (United States)

    Perea, Ana; Manzano, José Ignacio; Castanys, Santiago; Gamarro, Francisco

    2016-06-01

    Treatment for leishmaniasis, which is caused by Leishmania protozoan parasites, currently relies on a reduced arsenal of drugs. However, the significant increase in the incidence of drug therapeutic failure and the growing resistance to first-line drugs like antimonials in some areas of Northern India and Nepal limit the control of this parasitic disease. Understanding the molecular mechanisms of resistance in Leishmania is now a matter of urgency to optimize drugs used and to identify novel drug targets to block or reverse resistant mechanisms. Some members of the family of ATP-binding cassette (ABC) transporters in Leishmania have been associated with drug resistance. In this study, we have focused our interest to characterize LABCG2's involvement in drug resistance in Leishmania. Leishmania major parasites overexpressing the ABC protein transporter LABCG2 were generated in order to assess how LABCG2 is involved in drug resistance. Assays of susceptibility to different leishmanicidal agents were carried out. Analysis of the drug resistance profile revealed that Leishmania parasites overexpressing LABCG2 were resistant to antimony, as they demonstrated a reduced accumulation of Sb(III) due to an increase in drug efflux. Additionally, LABCG2 was able to transport thiols in the presence of Sb(III) Biotinylation assays using parasites expressing LABCG2 fused with an N-terminal green fluorescent protein tag revealed that LABCG2 is partially localized in the plasma membrane; this supports data from previous studies which suggested that LABCG2 is localized in intracellular vesicles that fuse with the plasma membrane during exocytosis. In conclusion, Leishmania LABCG2 probably confers antimony resistance by sequestering metal-thiol conjugates within vesicles and through further exocytosis by means of the parasite's flagellar pocket. PMID:27021316

  19. Determination of PM10 deposition based on antimony flux to selected urban surfaces

    International Nuclear Information System (INIS)

    Deposition of PM10 particles to several types of urban surfaces was investigated within this study. Antimony was chosen as a tracer element to calculate dry deposition velocities for PM10, since antimony proved to be present almost exclusively in PM10 particles in ambient urban air. During 18 months, eight sampling sites in Berlin and Karlsruhe, two cities in Germany, were operated. PM10 concentrations and dry deposition were routinely sampled as two week averages. Additionally, leaf-samples were collected at three sites with tall vegetation. The obtained deposition velocities ranged from 0.8 to 1.3 cm s-1 at roadside sites and from 0.4 to 0.5 cm s-1 at the other sites. With reference to the whole canopy, additional deposition velocities of about 0.5 cm s-1 were obtained for leaf surfaces. As a consequence, it can be concluded that vegetation-covered areas beside streets show the highest potential to capture particles in urban areas. - Highlights: → Deposition velocities of PM10 were determined using Sb as a tracer element. → Dry PM10 deposition velocities ranged from 0.8 to 1.3 cm s-1 at roadside sites. → Dry PM10 deposition velocities ranged from 0.4 to 0.5 cm s-1 at other urban sites. → Additional deposition velocities of 0.5 cm s-1 were obtained for leaf surfaces. - Antimony is used as a tracer element to calculate dry deposition velocities of PM10 particles to selected urban surfaces.

  20. Separation of antimony from synthetic cloth. Application in forensic science using neutron activation analysis

    International Nuclear Information System (INIS)

    A simple ion-exchange separation procedure was developed for selective removal of antimony from synthetic cloth to facilitate determination of several trace elements frequently used to identify gunshot residues by neutron activation analysis. Radiotracers of Sb, Ba, Cu, Co, As, Zn, Hg and Ag were employed to optimize the developed procedure. The method involves the quantitative retention of the above elements, except of Sb, from 0.2M ammonium carbonate solution using Chelex 100 resin and subsequent quantitative elution of the elements of interest with 2M nitric acid for gamma-ray spectrometry. The procedure was tested by simulated gunshot residues. (author)

  1. Investigation of adsorption interaction of cadmium oxide with antimony (3) in alkaline solutions

    International Nuclear Information System (INIS)

    Adsorption processes on cadmium oxide in pure antimonite alkaline (KOH) solutions and in the presence of organic additions (sodium salt of carboxymethylcellulose, straw oil) have been studied. It is shown, that in the systems being studied, the chemosorptional interaction, leading to a sharp change in the adsorbent surface state is observed. It is established that the formation of a surface high-disperse cadmium oxide-antimony com ound on the cadmium oxide results in practically complete suppression of the cadmium oxide hydration process in aqueous solutions

  2. Polymorphism and properties of Bi{sub 2}WO{sub 6} doped with pentavalent antimony

    Energy Technology Data Exchange (ETDEWEB)

    Kharitonova, E.P.; Belov, D.A. [M.V. Lomonosov Moscow State University, Leninskie Gory, 119991 Moscow (Russian Federation); Gagor, A.B.; Pietraszko, A.P. [W. Trzebiatowski Institute of Low Temperature and Structure Research, Polish Academy of Sciences, Okólna 2, 50-950 Wrocław (Poland); Alekseeva, O.A. [Shubnikov Institute of Crystallography, Russian Academy of Sciences, Leninsky pr. 59, 119333 Moscow (Russian Federation); Voronkova, V.I., E-mail: voronk@polly.phys.msu.ru [M.V. Lomonosov Moscow State University, Leninskie Gory, 119991 Moscow (Russian Federation)

    2014-04-05

    Highlights: • The limit of Bi{sub 2}W{sub 1−x}Sb{sub x}O{sub 6−y} solid solutions is at x = 0.05. • Bi{sub 2}W{sub 1−x}Sb{sub x}O{sub 6−y} does not fully transform into high-temperature monoclinic phase. • Sb{sup 5+} has a weak effect on the temperatures of the ferroelectric transitions. • γ→γ{sup ‴} transition near 650 °C was observed as strong permittivity peak at 0.01–8 Hz. • The conductivity of Bi{sub 2}W{sub 0.96}Sb{sub 0.04}O{sub 6−y} at 800 °C reaches 0.02 S/cm. -- Abstract: Antimony-containing solid solutions isostructural with bismuth tungstate, Bi{sub 2}WO{sub 6}, have been prepared in air as polycrystalline samples by solid-state reactions and as single crystals by unseeded flux growth. The antimony in the solid solutions is in a pentavalent state and substitutes for tungsten in the structure of Bi{sub 2}WO{sub 6}. The Bi{sub 2}W{sub 1−x}Sb{sub x}O{sub 6−y} solid solutions have been shown to exist in the composition range 0 ⩽ x ⩽ 0.05. We have examined the effect of Sb{sup 5+} doping on the polymorphism and properties of Bi{sub 2}WO{sub 6}. In contrast to undoped Bi{sub 2}WO{sub 6}, antimony-substituted bismuth tungstate does not completely transform into its high-temperature, monoclinic phase at 960 °C and remains two-phase up to temperatures approaching its melting point. Antimony substitution for tungsten has a weak effect on the temperatures of the ferroelectric phase transitions. Heterovalent substitution of Sb{sup 5+} for W{sup 6+} is accompanied by the formation of extra oxygen vacancies and an increase in the electrical conductivity of the solid solutions by one to two orders of magnitude relative to undoped Bi{sub 2}WO{sub 6}.

  3. Influence of arsenic,antimony and cobalt impurities on the cathodic process in zinc electrowinning

    Institute of Scientific and Technical Information of China (English)

    2010-01-01

    By means of an electrochemical study,the influence of arsenic,antimony and cobalt on cathodic polarization in the zinc electrowinning process,the associated kinetic equations and parameters,and the polarization mechanism have been studied.The results show that the experimental values of the kinetic parameters are in accord with the theoretical values in the ZnSO4/H2SO4 solution with a single impurity is added.In contrast,the charge transfer coefficient α is smaller than the theoretical value in the ZnSO4/H2SO4 solution when the three impurities are added together.

  4. Determination of arsenic, selenium and antimony by neutron activation analysis. Application to hair samples

    International Nuclear Information System (INIS)

    A fast rabbit system for instrumental activation analysis with reactor neutrons is described. Its use in the determination of selenium in hair is discussed. A survey is given of the correction factors which are inherent to the use of short-lived radionuclides. An alternative to INAA is NAA based on the separation of arsenic, selenium and antimony by hydride evaporation and adsorption to active carbon. Data for some Standard Reference Materials are given. This work was done under research contract 2440/RI/RB with the IAEA

  5. Impact of Biofield Treatment on Physical, Structural and Spectral Properties of Antimony Sulfide

    OpenAIRE

    Trivedi, Mahendra Kumar

    2015-01-01

    Antimony sulfide (Sb2S3) has gained extensive attention in solar cells due to their potential as a low-cost and earth abundant absorber material. In solar cell absorber, the optoelectrical properties such as energy band gap and absorption coefficient of Sb2S3play an important role, which have strong relationships with their crystal structure, lattice parameter and crystallite size. Hence in the present investigation, Sb2S3 powder samples were exposed to biofield treatment, and furthe...

  6. Novel antimony doped tin oxide/carbon aerogel as efficient electrocatalytic filtration membrane

    Science.gov (United States)

    Liu, Zhimeng; Zhu, Mengfu; Wang, Zheng; Wang, Hong; Deng, Cheng; Li, Kui

    2016-05-01

    A facile method was developed to prepare antimony doped tin oxide (Sb-SnO2)/carbon aerogel (CA) for use as an electrocatalytic filtration membrane. The preparation process included synthesis of a precursor sol, impregnation, and thermal decomposition. The Sb-SnO2, which was tetragonal in phase with an average crystallite size of 10.8 nm, was uniformly distributed on the CA surface and firmly attached via carbon-oxygen-tin chemical bonds. Preliminary filtration tests indicated that the Sb-SnO2/CA membrane had a high rate of total organic carbon removal for aqueous tetracycline owing to its high current efficiency and electrode stability.

  7. Electromagnetic absorption and shielding behavior of polyaniline-antimony oxide composites

    Science.gov (United States)

    Faisal, Muhammad; Khasim, Syed

    2013-02-01

    This work highlights the microwave absorption and electromagnetic interference (EMI) shielding properties of synthesized polyaniline (PAni)-antimony oxide (Sb2O3) composites in the 8-12 GHz (X-band) range. These composites showed absorption dominated EMI shielding effectiveness (EMI SEA) of -34 to -40 dB (> 99 % attenuation), indicating their shielding potential throughout the X-band. Our analyses reveal that the Sb2O3 particles in PAni matrix have key impact in determining the microwave absorption properties of the composites.

  8. Chemistry gains a new element: Z=106

    International Nuclear Information System (INIS)

    The correct position of a new element in the periodic table is not a trivial matter since relativistic effects can make heaviest elements behave differently from expectations. For the first time, chemical separations of element 106 (seaborgium, Sg) were performed in the gas phase and in aqueous solution followed by an unambiguous identification of this element and/or its α-decay products. Seaborgium was produced at the UNILAC accelerator of the Gesellschaft fuer Schwerionenforschung in Darmstadt, Germany, in the complete fusion reaction between 22Ne and 248Cm. On the basis of 18 detected atoms of the isotopes 265Sg and 266Sg, which have half-lives of about 7 and 21 s, respectively, it was possible to show that seaborgium is an ordinary member of the periodic table, i.e. it behaves similar to tungsten and molybdenum. (orig.)

  9. STS-106 Crew Interviews: Edward T. Lu

    Science.gov (United States)

    2000-01-01

    Live footage of a preflight interview with Mission Specialist Edward T. Lu is seen. The interview addresses many different questions including why Lu became interested in the space program, the events that led to his interest, the transition from an engineer to research scientist, and finally to getting selected into the astronaut program. Other interesting information that this one-on-one interview discusses are the main goals of the STS-106 mission, its scheduled docking with the new International Space Station (ISS), making the Zvezda Service Module ready for entrance, and crew training both in the United States and Russia. Lu mentions his responsibilities during the much-anticipated docking as well as his scheduled space-walk with Yuri Ivanovich Malenchenko. Lu also discusses the use of the Robotic Arm during his space-walk, installation of a magnetometer on the Zvezda Module, and work that will have to take place inside the Service Module.

  10. New limits on double beta decay of 106Cd

    Science.gov (United States)

    Rukhadze, N. I.; Bakalyarov, A. M.; Briançon, Ch.; Brudanin, V. B.; Čermák, P.; Egorov, V. G.; Klimenko, A. A.; Kovalík, A.; Lebedev, V. I.; Mamedov, F.; Shitov, Yu. A.; Šimkovic, F.; Štekl, I.; Timkin, V. V.; Zhukov, S. V.

    2011-02-01

    Investigation of double electron capture in 106Cd was performed at the Modane underground laboratory (4800 m.w.e.) using the multi-detector spectrometer TGV-2. In Phase I of the experiment, ˜10 g of 106Cd with an enrichment of 75% was measured during 8687 hours. In Phase II, the TGV-2 background was significantly suppressed in comparison with Phase I and the 106Cd mass was increased to ˜13.6 g. New half-life limits (at 90% CL) were obtained for 2νEC/EC decay of 106Cd to the ground state of Pd106 - T1/2>3.0×10 y (Phase I) and T1/2>3.6×10 y (Phase II, 9000 hours), and for 0νEC/EC decay of 106Cd to the 2741 keV excited state of Pd106 - T1/2>1.1×10 y (Phase II).

  11. Effect of antimony incorporation on structural properties of CuInS{sub 2} crystals

    Energy Technology Data Exchange (ETDEWEB)

    Ben Rabeh, M., E-mail: mohamedbenrabeh@yahoo.f [Laboratoire de Photovoltaique et Materiaux Semi-Conducteurs - ENIT BP 37, Le belvedere, 1002 Tunis (Tunisia); Chaglabou, N., E-mail: nadia_chaglabou@yahoo.f [Laboratoire de Photovoltaique et Materiaux Semi-Conducteurs - ENIT BP 37, Le belvedere, 1002 Tunis (Tunisia); Kanzari, M., E-mail: Mounir.Kanzari@ipeit.rnu.t [Laboratoire de Photovoltaique et Materiaux Semi-Conducteurs - ENIT BP 37, Le belvedere, 1002 Tunis (Tunisia)

    2010-02-15

    CuInS{sub 2} (CIS) single crystals doped with 1, 2, 3 and 4 atomic percent (at.%) of antimony (Sb) were grown by the horizontal Bridgman method. The effect of Sb doping on the structural properties of CIS crystal was studied by means of X-ray diffraction (XRD), energy dispersive X-ray analysis (EDAX), scanning electron microscopy (SEM) and PL measurements. X-ray diffraction data suggests that the doping of Sb in the CIS single crystals does not affect the tetragonal (chalcopyrite) crystal structure and exhibited a (1 1 2) preferred orientation. In addition, with increasing Sb concentration, the X-ray diffraction analysis show that Sb doped CIS crystals are more crystallized and the diffraction peaks of the CuInS{sub 2} phase were more pronounced in particular the (1 1 2) plane. EDAX study revealed that Sb atoms can occupy the indium site and/or occupying the sulfur site to make an acceptor. PL spectra of undoped and Sb doped CIS crystals show two emission peaks at 1.52 and 1.62 eV, respectively which decreased with increasing atomic percent antimony. Sb doped CIS crystals show p-type conductivity.

  12. Understanding the radiolabelling mechanism of {sup 99m}Tc-antimony sulphide colloid

    Energy Technology Data Exchange (ETDEWEB)

    Tsopelas, Chris E-mail: ctsopela@mail.rah.sa.gov.au

    2003-12-01

    The chemistry of antimony trisulphide colloid (ATC) was examined to elucidate the radiolabelling mechanism with {sup 99m}TcO{sub 4}{sup -}. Ion exchange chromatography and atomic absorption spectrophotometry techniques determined ATC to be resistant to hydrolysis in 0.1 M hydrochloric acid (HCl) at 25 deg. C or 100 deg. C (>97% recovery, Sb{sup 3+} absent). Hydrogen sulphide gas detected did not participate in the mechanism, where antimony trisulphide and {sup 99m}TcO{sub 4}{sup -} in HCl/100 deg. C yielded 96% {sup 99m}Tc-product from a K{sub 2}S-free formulation (versus 98% when K{sub 2}S was present). {sup 99m}TcO{sub 4}{sup -} was reduced >90% by DMSA or dithiothreitol under the same conditions, identifying involvement of thiol groups. Infrared analysis of Re-ATC showed S-O bonds, indicating excess thiol groups at the colloid surface were oxidised at the expense of {sup 99m}TcO{sub 4}{sup -} reduction.

  13. A Black Phosphate Conversion Coating on Steel Surface Using Antimony(III)-Tartrate as an Additive

    Science.gov (United States)

    Li, Feng; Wang, Guiping

    2016-05-01

    A novel black phosphate conversion coating was formed on steel surface through a Zn-Mn phosphating bath containing mainly ZnO, H3PO4, Mn(H2PO4)2, and Ca(NO3)2, where antimony(III)-tartrate was used as the blackening agent of phosphatization. The surface morphology and composition of the coating were characterized by scanning electron microscopy, energy dispersion spectroscopy, and x-ray photoelectron spectroscopy. Corrosion resistance of the coating was studied by potentiodynamic polarization curves and electrochemical impedance spectroscopy. The pH value of the solution had significant influence on the formation and corrosion resistance of the coating. The experimental results indicated that the Sb plays a vital role in the blackening of phosphate conversion coating. The optimal concentration of antimony(III)-tartrate in the phosphating bath used in this experiment was 1.0 g L-1, as higher values reduced the corrosion resistance of the coating. In addition, by saponification and oil seals, the corrosion duration of the black phosphate coating in a copper sulfate spot test can be as long as 20 min.

  14. Effect of electronic contribution on temperature-dependent thermal transport of antimony telluride thin film

    International Nuclear Information System (INIS)

    Highlights: • We investigated thermal transport of the antimony telluride thin films. • The contribution of the electronic thermal conductivity increased up to ∼77% at 300 K. • We theoretically analyze and explain the high contribution of electronic component. - Abstract: We study the theoretical and experimental characteristics of thermal transport of 100 nm and 500 nm-thick antimony telluride (Sb2Te3) thin films prepared by radio frequency magnetron sputtering. The thermal conductivity was measured at temperatures ranging from 20 to 300 K, using four-point-probe 3-ω method. Out-of-plane thermal conductivity of the Sb2Te3 thin film was much lesser in comparison to the bulk material in the entire temperature range, confirming that the phonon- and electron-boundary scattering are enhanced in thin films. Moreover, we found that the contribution of the electronic thermal conductivity (κe) in total thermal conductivity (κ) linearly increased up to ∼77% at 300 K with increasing temperature. We theoretically analyze and explain the high contribution of electronic component of thermal conductivity towards the total thermal conductivity of the film by a modified Callaway model. Further, we find the theoretical model predictions to correspond well with the experimental results

  15. Antimony retention and release from drained and waterlogged shooting range soil under field conditions.

    Science.gov (United States)

    Hockmann, Kerstin; Tandy, Susan; Lenz, Markus; Reiser, René; Conesa, Héctor M; Keller, Martin; Studer, Björn; Schulin, Rainer

    2015-09-01

    Many soils polluted by antimony (Sb) are subject to fluctuating waterlogging conditions; yet, little is known about how these affect the mobility of this toxic element under field conditions. Here, we compared Sb leaching from a calcareous shooting range soil under drained and waterlogged conditions using four large outdoor lysimeters. After monitoring the leachate samples taken at bi-weekly intervals for >1.5 years under drained conditions, two of the lysimeters were subjected to waterlogging with a water table fluctuating according to natural rainfall water infiltration. Antimony leachate concentrations under drained conditions showed a strong seasonal fluctuation between 110 μg L(-1) in summer and soil solution indicated that this decrease in Sb(V) concentrations was attributable to the reduction of Sb(V) to Sb(III) and the stronger sorption affinity of the latter to iron (Fe) (hydr)oxide phases. Our results demonstrate the importance of considering seasonal and waterlogging effects in the assessment of the risks from Sb-contaminated sites. PMID:25592464

  16. Phase effects on chemical behaviors of tin, antimony and tellurium fission products in aqueous solutions

    International Nuclear Information System (INIS)

    The oxidation states of tin, antimony and tellurium isotopes formed predominantly (>91%) by fission were investigated in aqueous solutions of 233U irradiated in a reactor. Results were corrected for the thermal reactions with the bulk radiolysis products using tracers for each element. In 0.4 M H2SO4 solutions containing 4.3 mM 233UO22+, 1.5 mM Te(IV) and 1.5 mM Te(VI), the fraction of Te(IV) is 98 +- 2% in the absence of oxygen and 92 +- 3% in the presence of oxygen. In frozen solutions of the same composition, the fraction of Te(IV) is 83 +- 2% in the absence of oxygen and 81 +- 3% in the presence of oxygen. Similar differences are also found in the case of the antimony isotopes in 0.4 M H2SO4 solutions and the tin isotopes in 1 M HCl solutions. For the interpretation of the differences, the reducing action of the species diffusing from the track of the fission fragments is considered. (author)

  17. Effect of indium and antimony doping in SnS single crystals

    Energy Technology Data Exchange (ETDEWEB)

    Chaki, Sunil H., E-mail: sunilchaki@yahoo.co.in; Chaudhary, Mahesh D.; Deshpande, M.P.

    2015-03-15

    Highlights: • Single crystals growth of pure SnS, indium doped SnS and antimony doped SnS by direct vapour transport (DVT) technique. • Doping of In and Sb occurred in SnS single crystals by cation replacement. • The replacement mechanism ascertained by EDAX, XRD and substantiated by Raman spectra analysis. • Dopants concentration affects the optical energy bandgap. • Doping influences electrical transport properties. - Abstract: Single crystals of pure SnS, indium (In) doped SnS and antimony (Sb) doped SnS were grown by direct vapour transport (DVT) technique. Two doping concentrations of 5% and 15% each were employed for both In and Sb dopants. Thus in total five samples were studied viz., pure SnS (S1), 5% In doped SnS (S2), 15% In doped SnS (S3), 5% Sb doped SnS (S4) and 15% Sb doped SnS (S5). The grown single crystal samples were characterized by evaluating their surface microstructure, stoichiometric composition, crystal structure, Raman spectroscopy, optical and electrical transport properties using appropriate techniques. The d.c. electrical resistivity and thermoelectric power variations with temperature showed semiconducting and p-type nature of the as-grown single crystal samples. The room temperature Hall Effect measurements further substantiated the semiconducting and p-type nature of the as-grown single crystal samples. The obtained results are deliberated in detail.

  18. The analysis of antimony species by using ESI-MS and HPLC-ICP-MS

    Energy Technology Data Exchange (ETDEWEB)

    Lintschinger, J.; Schramel, O.; Kettrup, A. [GSF-Forschungszentrum fuer Umwelt und Gesundheit GmbH, Institut fuer Oekologische Chemie, Ingolstaedter Landstrasse 1, Gebaeude 22, D-85758 Neuherberg (Germany)

    1998-05-01

    A new method for the separation of organic antimony as trimethylantimony dichloride (TMSbCl{sub 2}) and inorganic Sb(V) and Sb(III) by using anion exchange high-performance liquid chromatography coupled with inductively-coupled plasma mass spectrometry (ICP-MS) is presented. In comparison with previous work the detection limits for both species were significantly decreased, down to 5 ngL{sup -1}, mainly by avoiding any contamination from the chromatographic device. Using an ultrasonic nebulizer (USN) improved the detection limits for inorganic Sb species, but was useless for the HPLC method due to problems in the recovery of the TMSbCl{sub 2}. Matrix interferences of the chromatographic determination were studied in detail and the method was applied to environmental samples assumed to contain organic antimony species. Additionally, the molecular structure of the TMSbCl{sub 2} in solution was studied by using electrospray-ionization mass spectrometry (ESI-MS) showing that this species occurs most probably as [TMSbOH]{sup +} in aqueous solutions. (orig.) With 7 figs., 2 tabs., 14 refs.

  19. Migration of antimony from PET containers into regulated EU food simulants.

    Science.gov (United States)

    Sánchez-Martínez, María; Pérez-Corona, Teresa; Cámara, Carmen; Madrid, Yolanda

    2013-11-15

    Antimony migration from polyethylene terephthalate (PET) containers into aqueous (distilled water, 3% acetic acid, 10% and 20% ethanol) and fatty food simulants (vegetable oil), as well as into vinegar, was studied. Test conditions were according to the recent European Regulation 10/2011 (EU, 2011). Sb migration was assayed by ICP-MS and HG-AFS. The results showed that Sb migration values ranged from 0.5 to 1.2μg Sb/l, which are far below the maximum permissible migration value for Sb, 40μg Sb/kg, (EU, Regulation 10/2011). Parameters as temperature and bottle re-use influence were studied. To assess toxicity, antimony speciation was performed by HPLC-ICP-MS and HG-AFS. While Sb(V) was the only species detected in aqueous simulants, an additional species (Sb-acetate complex) was measured in wine vinegar. Unlike most of the studies reported in the literature, migration tests were based on the application of the EU directive, which enables comparison and harmonisation of results. PMID:23790852

  20. Evaluation of antimony microparticles supported on biochar for application in the voltammetric determination of paraquat.

    Science.gov (United States)

    Gevaerd, Ava; de Oliveira, Paulo R; Mangrich, Antonio S; Bergamini, Márcio F; Marcolino-Junior, Luiz H

    2016-05-01

    This work describes the construction and application of carbon paste electrodes modified with biochar and antimony microparticles (SbBCPE) for voltammetric determination of paraquat using a simple and sensitive procedure based on voltammetric stripping analysis. Some parameters such as amount of biochar and antimony used in the composition of the carbon paste and instrumental parameters were examined in detail. Under optimized conditions, an analytical curve was obtained for paraquat determination employing SbBCPE, which showed a linear response ranging from 0.2 to 2.9μmolL(-1), with limit of detection and quantification of 34nmolL(-1) and 113nmolL(-1), respectively, after paraquat pre-concentration of 120s. The repeatability study presented a RSD=2.0% for 10 consecutive measurements using the same electrode surface and the reproducibility study showed a RSD=2.7% for measurements with 10 different electrode surfaces. The proposed sensor was successfully applied for paraquat determination in tap water and citric fruit juice spiked samples and good recoveries were obtained without any sample pre-treatment, showing its promising analytical performance. PMID:26952405

  1. High levels of antimony in dust from e-waste recycling in southeastern China

    International Nuclear Information System (INIS)

    Environmental contamination due to uncontrolled e-waste recycling is an emerging global issue. Antimony (Sb) is a toxic element used in semiconductor components and flame retardants for circuit board within electronic equipment. When e-waste is recycled, Sb is released and contaminates the surrounding environment; however, few studies have characterized the extent of this problem. In this study, we investigated Sb and arsenic (As) distributions in indoor dust from 13 e-waste recycling villages in Guiyu, Guangdong Province, southeastern China. Results revealed significantly elevated concentrations of Sb (6.1-232 mg/kg) in dust within all villages, which were 3.9-147 times higher than those from the non e-waste sites, indicating e-waste recycling was an important source of Sb pollution. On the contrary, As concentrations (5.4-17.7 mg/kg) in e-waste dusts were similar to reference values from the control sites. Therefore, dusts emitted from e-waste recycling may be characterized by high Sb/As ratios, which may help identify the contamination due to the e-waste recycling activities. - Highlights: → Antimony and arsenic concentrations in dust from e-waste recycling were investigated. → E-waste recycling is an important emerging source of Sb pollution. → Sb/As ratios may help identify the e-waste contamination.

  2. Contrasting distribution of trace elements between representative antimony deposits in southern China

    International Nuclear Information System (INIS)

    The Xuefeng uplifted belt and the neighboring Xikuangshan region of southern China is the largest antimony producing area in the world. The mineralizing solution which was responsible for the antimony deposition is considered to be derived mainly from deep crustal fluids during a large tectonic movement of the Jurassic time. We analyzed trace elements of ore minerals and fluid inclusions from this area by CSIRO's micro-PIXE to understand characteristics of the mineralizing solution. We selected three representative 'super-large' deposits, one in the Xikuangshan area and the others within the Xuefeng belt: (1) Xikuangshan (simple Sb) which is structurally controlled by large-scale transcrustal faults and fractures, and mainly hosted by limestone; (2) Wuxi (Sb-Au-W), embedded in slate and structurally controlled by large-scale faults and fractures; and (3) Banxi (simple Sb) which is hosted by slate and controlled by local fractures. Our preliminary result indicated that the trace element distribution is highly contrasting for these three deposits corresponding to each geologic setting. Our case study showed that being combined with field evidence, micro-PIXE can contribute to understand large tectonic movements and to establish an effective exploration model for super-large mineral deposits

  3. Structure and properties of antimony-doped lanthanum molybdate La2Mo2O9

    International Nuclear Information System (INIS)

    Polycrystalline samples of the composition La2Mo2−xSbxO9−y, where 0 ≤ x ≤ 0.05, were prepared by solid-phase synthesis. Single crystals of La2Mo1.96Sb0.04O8.17 were obtained by spontaneous crystallization from flux. The structure of the metastable βms phase of this compound was determined at room temperature by X-ray diffraction. It was found that the La, Mo, and O1 atoms are displaced from the threefold axis on which they are located in the high-temperature β phase. It was shown that molybdenum atoms in the crystal structure are partially replaced by antimony atoms, which are located on the threefold axis. In antimony-doped crystals, lanthanum atoms partially return to the site on the threefold axis and the coordination environment of molybdenum cations becomes more ordered, thus facilitating the stabilization of the cubic phase at room temperature. Calorimetric measurements (DSC) showed that the introduction of Sb as the dopant into the La2Mo2O9 structure leads to a decrease in the temperature of the α → β phase transition from 570 to 520°C and to the partial suppression of this transition. The temperature behavior of the conductivity confirms the DSC data. Thus, doping with Sb contributes to the stabilization of the cubic phase at room temperature.

  4. Organically complexed iron enhances bioavailability of antimony to maize (Zea mays) seedlings in organic soils.

    Science.gov (United States)

    Ptak, Corey; McBride, Murray

    2015-12-01

    Antimony (Sb) is a metalloid belonging to group 15 of the periodic table. Chemical similarities between arsenic (As) and Sb produce concerns about potential health effects of Sb and enrichment in the environment. Antimony is found in oxic environments predominately as an oxyanionic species, antimonite (Sb[OH](6-)). As a result of its net negative charge, Sb[OH](6-) was not initially predicted to have strong interactions with natural organic matter. Oxyanionic species could bind the negatively charged organic matter via a ternary complexation mechanism, in which cationic metals mediate the strong association between organic matter functional groups and oxyanions. However, these interactions are poorly understood in how they influence the bioavailability of oxyanionic contaminants to plants. Iron (Fe) additions to organic soils have been found to increase the number of organically complexed Fe sites suitable for Sb exchange, resulting in a reduced bioavailable fraction of Sb. The bioavailability of Sb to maize seedlings as a function of organically complexed Fe was examined using a greenhouse study. A significant increase in plant tissue Sb was observed as organically complexed Fe increased, which was not predicted by methods commonly used to assess bioavailable Sb. Extraction of soils with organic acids common to the maize rhizosphere suggested that organic acid exudation can readily mobilize Sb bound by organic Fe complexes. PMID:26076768

  5. Antimony isotopic composition in river waters affected by ancient mining activity.

    Science.gov (United States)

    Resongles, Eléonore; Freydier, Rémi; Casiot, Corinne; Viers, Jérôme; Chmeleff, Jérôme; Elbaz-Poulichet, Françoise

    2015-11-01

    In this study, antimony (Sb) isotopic composition was determined in natural water samples collected along two hydrosystems impacted by historical mining activities: the upper Orb River and the Gardon River watershed (SE, France). Antimony isotope ratio was measured by HG-MC-ICP-MS (Hydride Generation Multi-Collector Inductively Coupled Plasma Mass Spectrometer) after a preconcentration and purification step using a new thiol-cellulose powder (TCP) procedure. The external reproducibility obtained for δ(123)Sb measurements of our in-house Sb isotopic standard solution and a certified reference freshwater was 0.06‰ (2σ). Significant isotopic variations were evident in surface waters from the upper Orb River (-0.06‰≤δ(123)Sb≤+0.11‰) and from the Gardon River watershed (+0.27‰≤δ(123)Sb≤+0.83‰). In particular, streams that drained different former mining sites exploited for Sb or Pb-Zn exhibited contrasted Sb isotopic signature, that may be related to various biogeochemical processes occurring during Sb transfer from rocks, mine wastes and sediments to the water compartment. Nevertheless, Sb isotopic composition appeared to be stable along the Gardon River, which might be attributed to the conservative transport of Sb at distance from mine-impacted streams, due to the relative mobile behavior of Sb(V) in natural oxic waters. This study suggests that Sb isotopic composition could be a useful tool to track pollution sources and/or biogeochemical processes in hydrologic systems. PMID:26452900

  6. Distributions and impact factors of antimony in topsoils and moss in Ny-Ålesund, Arctic

    International Nuclear Information System (INIS)

    The distribution of antimony (Sb) in topsoil and moss (Dicranum angustum) in disturbed and undisturbed areas, as well as coal and gangue, in Ny-Ålesund, Arctic was examined. Results show that the weathering of coal bed could not contribute to the increase of Sb concentrations in topsoil and moss in the study area. The distribution of Sb is partially associated with traffic and historical mining activities. The occurrence of the maximum Sb concentration is due to the contribution of human activities. In addition, the decrease of Sb content in topsoil near the coastline may be caused by the washing of seawater. Compared with topsoils, moss could be a useful tool for monitoring Sb in both highly and lightly polluted areas. - Highlights: ► We examined the distribution of antimony in topsoil and moss in Ny-Ålesund, Arctic. ► The distribution of Sb is associated with traffic and historical mining activities. ► The weathering of coal bed cannot lead to the Sb increase in the surface environment. ► The distribution of Sb in moss could reflect the accumulation of Sb pollution. ► Moss can be a useful tool for monitoring Sb in highly and lightly polluted areas. - The distribution of Sb in Ny-Ålesund is partially associated with traffic and historical mining activities, and moss can be a useful tool for monitoring Sb in both highly and lightly polluted areas.

  7. Determination of antimony in nail and hair by thermal neutron activation analysis

    International Nuclear Information System (INIS)

    The concentration of antimony in nail and hair was determined by thermal neutron activation analysis. Samples were collected from the workers of an antimony refinery, inhabitants near the refinery, and residents in control area. They were irradiated by Kyoto University 5000 kW Reactor for 1 h, and cooled for 30 to 100 days. After cooling, the concentration of Sb in nail and hair was estimated by measuring the intensity of γ-ray from 124Sb of the samples, then the samples were washed by 0.1 % aqueous solution of nonionic surface active agent in an ultrasonic cleaner. The γ-ray spectrometry was done again (after washing). The concentration of Sb in nail before washing was 730 ppm for the workers, 2.46 ppm for habitants near the refinery, and 0.19 ppm for the control; after washing, it became 230 ppm for the workers, 0.63 ppm for habitants, and 0.09 ppm for the control. The concentration of Sb in hair before and after washing was 222 ppm and 196 ppm for the workers, and 0.21 ppm and 0.15 ppm for the control, respectively. (author)

  8. Morphology-controlled growth of crystalline antimony sulfide via a refluxing polyol process

    Science.gov (United States)

    Zhang, Rui; Chen, Xiangying; Mo, Maosong; Wang, Zhenghua; Zhang, Meng; Liu, Xinyuan; Qian, Yitai

    2004-02-01

    By refluxing antimony trichloride (SbCl 3) and thiourea in various solvents at suitable reaction conditions, antimony sulfide (Sb 2S 3) crystallites with a diversity of well-defined morphologies were synthesized. Sb 2S 3 rods with the average diameter of 800 nm and the length of 7 μm, as well as microtubes with the average outer diameter of 1.2 μm, the average inner diameter of 800 nm and the length of 8 μm, were obtained in 1,2-propanediol at 180°C for 10 min. In contrast, a series of experiments under different conditions were carried out to investigate the influencing factors on the reaction. The as-synthesized products were characterized by powder X-ray diffraction, field-emission scanning electron microscopy, transmission electron microscope and X-ray photoelectron spectra. The results indicate Sb 2S 3 crystals with different morphologies, including rod-like, tube-like, bowknot-like, flower-like, straw-bundled-like, taken under different experimental conditions. It is found that the reaction temperature, time, solvent and poly(vinyl pyrrolidone) (as a polymer capping reagent) play important roles in the formation of the final Sb 2S 3 crystallites with different morphologies. Also, the possible growth mechanism is discussed.

  9. Responses of different dosemeters in beta dosimetry of 106Ru/106Rh ophthalmic applicators

    International Nuclear Information System (INIS)

    This work presents the TL response of three kinds of dosimeters from different manufacturing characteristics under irradiation of 106 Ru / 106 Rh sealed sources used in ophthalmic brachytherapy. They are: Ca SO4:Dy + teflon (D- Ca SO4:Dy -0,4), LiF:Mg, Ti (TLD-100) and Ca SO4:Dy (TLD-900). Some of reports accepted by scientific community (NCS report 14 e ICRU report 72) as reference in the quality control of beta applicators dosimetry recommend that the absorbed dose standard uncertainties can be kept below 20%. The TLD Ca SO4:Dy + teflon presented proper sensibility and high precision comparing with the others. Considering the similar dimensions of ophthalmic tumors and aside critical structures it is relevant to reduce undesirable effects due to the irradiation of these structures. Therefore, the quality control in the beta dosimetry using this kind of source is a constant challenge. (author)

  10. Neutron Knockout on Beams of $^{108,106}$Sn and $^{106}$Cd

    CERN Document Server

    Cerizza, Giordano

    2015-01-01

    Characterizing the nature of single-particle states outside of double shell closures is essential to a fundamental understanding of nuclear structure. This is especially true for those doubly magic nuclei that lie far from stability and where the shell closures influence nucleo-synthetic pathways. The region around $^{100}$Sn is one of the most important due to the proximity of the N=Z=50 magic numbers, the proton-drip line, and the end of the rp-process. However, owing to the low production rates, there is a lack of spectroscopic information and no firm spin-parity assignment for ground states of odd-A isotopes close to $^{100}$Sn. Neutron knockout reaction experiments on beams of $^{108,106}$Sn and $^{106}$Cd have been performed at the NSCL. By measuring gamma rays and momentum distributions from reaction residues, the spin of ground state and first excited state for $^{107,105}$Sn have been established. The results also show a degree of mixing in the ground states of the isotopes $^{108,106}$Sn between the...

  11. Chemical properties of element 106 (seaborgium)

    International Nuclear Information System (INIS)

    The synthesis, via nuclear fusion reactions, of elements heavier than the actinides, allows one to prove the limits of the periodic table as a means of classifying the elements. In particular, deviations in the periodicity of chemical properties for the heaviest elements are predicted as a consequence of increasingly strong relativistic effects on the electronic shell structure. The transactinide elements have now been extended up to element 112, but the chemical properties have been investigated only for the first two of the transactinide elements, 104 and 105. Those studies showed that relativistic effect render these two elements chemically different from their lighter homologues in the same columns of the periodic table. Here we report the chemical separation of element 106 (seaborgium, Sg) and investigations of its chemical behaviour in the gas phase and in aqueous solution. The methods that we use are able to probe the reactivity of individual atoms, and are based on the detection of just seven atoms of seaborgium we find that it exhibits properties characteristic of the group 6 homologues molybdenum and tungsten. Thus seaborgium appears to restore the trends of the periodic table disrupted by relativistic effects in elements 104 and 105. (Author)

  12. Methods for macro concentration speciation (>106 M)

    International Nuclear Information System (INIS)

    The range of topics covered by the term 'speciation' varies from the determination of isotopic composition, through whether an element or nuclide is present and under which form, to the full identification of the molecular compound present or the isolation of species. Therefore, it is quite understandable that a rather large range of techniques may be applicable for speciation purposes and that none may be sufficient by itself to cover all purposes. We tried in this report to review on technologies available for speciation purposes in nuclear fuel cycle activities and to provide a reference document to guide researchers in choosing the most useful technique for his purposes by summarizing their characteristics. Particular attention was given to highlight the advantages and disadvantages/limitations of a given technique as well as, when suitable, expected or necessary future improvements. It was also attempted to indicate a 'recommended' application field, though this was not an easy task. In the present part, we concentrate on techniques available for macro concentration speciation with an arbitrary limit fixed around 10-6 M. However, one should be aware that some of the techniques discussed in the present may be also applicable for lower concentration (overlap with over Partim. of the whole report) and vice-versa. Then, we consider that the scope of the present can only be achieved considering the whole parts discussed at the OECD/NEA Workshop on evaluation of speciation technology held in October 1999 at JAERI/Tokai-mura. (author)

  13. Highly conducting nanosized monodispersed antimony-doped tin oxide particles synthesized via nanoaqueous sol-gel method

    Czech Academy of Sciences Publication Activity Database

    Müller, V.; Rathouský, Jiří; Rasp, M.; Štefanić, G.; Günther, S.; Niederberger, M.; Fattakhova-Rohlfing, D.

    Vol. 1. Boca Raton : Taylor-Francis, 2010, s. 340-343. ISBN 978-1-4398-3401-5. - ( Nanotech 2010) R&D Projects: GA ČR GA104/08/0435 Institutional research plan: CEZ:AV0Z40400503 Keywords : antimony-doped tin oxide * TCO * nanoparticles Subject RIV: CF - Physical ; Theoretical Chemistry

  14. Ambulatory oesophageal pH monitoring : a comparison between antimony, ISFET, and glass pH electrodes

    NARCIS (Netherlands)

    Hemmink, Gerrit J. M.; Weusten, Bas L. A. M.; Oors, Jac; Bredenoord, Albert J.; Timmer, Robin; Smout, Andre J. P. M.

    2010-01-01

    Background and aim Ambulatory oesophageal pH-impedance monitoring is a widely used test to evaluate patients with reflux symptoms. Several types of pH electrodes are available: antimony, ion sensitive field effect transistor (ISFET), and glass electrodes. These pH electrodes have not been compared d

  15. Determination of antimony in environment samples by gas phase chemiluminescence detection following flow injection hydride generation and cryotrapping.

    Science.gov (United States)

    Ye, Yousheng; Sang, Jianchi; Ma, Hongbing; Tao, Guanhong

    2010-06-15

    A novel method for the determination of antimony in environmental samples was developed with gas phase chemiluminescence detection following flow injection hydride generation and cryotrapping. The stibine, generated from samples by borohydride reduction of antimony using flow injection technique, was separated by using a new gas-liquid separator, dried with an ice-salt cryogenic bath and concentrated in a glass U-tube immersed in liquid nitrogen. Re-vaporization of stibine based on its boiling point was achieved by allowing the tube to warm at room temperature. A gas phase chemiluminescence signal was produced during the ozonation of the hydride in a reflective chamber. Under optimal conditions, the proposed method was characterized by a wide linear calibration range from 1.0microgL(-1) to 10.0mgL(-1) with a detection limit of 0.18microgL(-1) (n=11). The relative standard deviation for 10.0microgL(-1) antimony was 3.56% (n=11) and the sampling rate was 15 samples h(-1). Blank signal was reduced by the purification of reagents and the interference from transition metal ions was eliminated by the addition of L-cysteine into samples. The method was applied to the determination of antimony in environmental samples with satisfactory results. PMID:20441930

  16. Comparative phytotoxicity of methylated and inorganic arsenic- and antimony species to Lemna minor, Wolffia arrhiza and Selenastrum capricornutum

    NARCIS (Netherlands)

    L. Duester; H.G. van der Geest; S. Moelleken; A.V. Hirner; K. Kueppers

    2011-01-01

    The alkylation of metalloids through the transfer of methyl groups is an important factor in the biogeochemical cycling of elements like arsenic and antimony. In the environment, many different organic and inorganic forms of these elements can therefore be found in soils, sediments or organisms. Stu

  17. A cloud point extraction for spectrophotometric determination of ultra- trace antimony without chelating agent in environmental and biological samples

    International Nuclear Information System (INIS)

    We report on a simple, sensitive and reliable method for the cloud point extraction of antimony (Sb) and its subsequent spectrophotometric detection. It is based on the color reaction of Sb (III) with iodide in acidic medium and subsequent micelle-mediated extraction of tetraiodoantimonate using a non-ionic surfactant in the absence of any chelating agent. The effects of reaction and extraction parameters were optimized. The calibration plot is linear in the range of 0.80-95 ng mL-1 of antimony in the sample solution, with a regression coefficient (r) of 0.9994 (for n=9). The detection limit (at SNR=3) is 0.23 ng mL-1, and the relative standard deviations at 10 and 70 ng mL-1 of antimony are 3.32 and 1.85 % (at n=8), respectively. The method compared favorably to other methods and was applied to determine antimony in seawater, anti-leishmania drug (glucantime), and human serum. (author)

  18. Effect of Annealing on the Properties of Antimony Telluride Thin Films and Their Applications in CdTe Solar Cells

    Directory of Open Access Journals (Sweden)

    Zhouling Wang

    2014-01-01

    Full Text Available Antimony telluride alloy thin films were deposited at room temperature by using the vacuum coevaporation method. The films were annealed at different temperatures in N2 ambient, and then the compositional, structural, and electrical properties of antimony telluride thin films were characterized by X-ray fluorescence, X-ray diffraction, differential thermal analysis, and Hall measurements. The results indicate that single phase antimony telluride existed when the annealing temperature was higher than 488 K. All thin films exhibited p-type conductivity with high carrier concentrations. Cell performance was greatly improved when the antimony telluride thin films were used as the back contact layer for CdTe thin film solar cells. The dark current voltage and capacitance voltage measurements were performed to investigate the formation of the back contacts for the cells with or without Sb2Te3 buffer layers. CdTe solar cells with the buffer layers can reduce the series resistance and eliminate the reverse junction between CdTe and metal electrodes.

  19. The use of colloidal nano gold as an effective modifier for the determination of antimony, arsenic and lead by ETAAS

    International Nuclear Information System (INIS)

    Complete text of publication follows. Colloidal nano gold was prepared and used as a modifier for the determination of antimony, arsenic and lead by electrothermal atomic absorption spectrometry. The effects of pyrolysis and atomization temperature, the amounts of interferants and modifier on the sensitivities of antimony, arsenic and lead in the presence of modifier were investigated. In addition, the contribution of another modifying reagent Mg(NO3)2 mixed with colloidal nano gold was also investigated. The modifier allows the use of pyrolysis temperatures between 1200 deg C and 1300 deg C for antimony, arsenic and lead. In the presence of colloidal nano gold modifier, the tolerance limits of NaCl and Na2SO4 for the quantitative recoveries of antimony, arsenic and lead were investigated. After optimization of experimental conditions, the three elements were successfully determined in some model solutions containing some sulphate and chloride salts as well as in CRM water samples at 95% confidence level using pure aqueous standards. The effectiveness of modifier was compared with that of the mixed universal modifier (Mg+Pd).

  20. Langzeitergebnisse bei Aderhautmelanom nach 106Ruthenium-Brachytherapie

    OpenAIRE

    Krause, Nona

    2015-01-01

    Introduction: 106Ruthenium-brachytherapy (106Ru-brachytherapy) is an established therapy for small and medium-sized uveal melanomas. The aim of this study was to examine the long-time results in regard to recurrence rate, complication rate, ocular preservation, metastasis rate and survival with malignant uveal and ciliary body melanoma, as well as relevant prognosis factors, subsequent to 106Ru-brachytherapy. Methodology: In this retrospective study of all cases with uveal or with ciliary ...

  1. Fabrication of ruthemium 106 sources for betatherapy of choroid cancer

    International Nuclear Information System (INIS)

    Three sources of ruthenium 106 intended to the betatherapy of eye's tumours have been made by electrodeposition on stainless steel supports prior plated with gold 30 microns thick. This report presents the different steps of this preparation: ruthenium 106 purification from a solution of fission products by RuO4 volatilization with AgO acting agent; gilding of the supports; ruthenium 106 electrodeposition as metal; protection of the source by a thin film of epoxyde resin

  2. Search for double electron capture of 106Cd

    Science.gov (United States)

    Rukhadze, N. I.; Beneš, P.; Briançon, Ch.; Brudanin, V. B.; Čermák, P.; Danevich, F. A.; Egorov, V. G.; Gusev, K. N.; Klimenko, A. A.; Kovalenko, V. E.; Kovalik, A.; Salamatin, A. V.; Štekl, I.; Timkin, V. V.; Tretyak, V. I.; Vylov, Ts.

    2006-12-01

    A search for double electron capture of 106Cd was performed at the Modane Underground Laboratory (4800 m w.e.) using a low-background and high-sensitivity multidetector spectrometer TGV-2 (Telescope Germanium Vertical). New limits on β +/EC, EC/EC decays of 106Cd were obtained from preliminary calculations of experimental data accumulated for 4800 h of measurement of 10 g of 106Cd with enrichment of 75%. They are > 6.2 × 1019 yr for transitions to the ground 0+ state of 106Pd. All limits are given at 90% C.L.

  3. 106Ruthenium Plaque Therapy (RPT) for Retinoblastoma

    International Nuclear Information System (INIS)

    Purpose: To evaluate the effectiveness of episcleral 106ruthenium plaque therapy (RPT) in the management of retinoblastoma. Methods and Materials: One hundred one RPTs were retrospectively analyzed that were performed in 90 eyes of 85 patients with retinoblastoma at National Cancer Center Hospital between 1998 and 2008. Each RPT had a corresponding tumor and 101 tumors were considered in the analysis of local control. Median follow-up length was 72.8 months. Median patient age at the RPT was 28 months. Median prescribed doses at reference depth and outer surface of the sclera were 47.4 Gy and 162.3 Gy, respectively. Results: Local control rate (LCR) and ocular retention rate (ORR) at 2 years were 33.7% and 58.7%, respectively. Unilateral disease, International Classification of Retinoblastoma group C or more advanced at the first presentation or at the time of RPT, vitreous and/or subretinal seeding, tumor size greater than 5 disc diameter (DD), reference depth greater than 5 mm, dose rate at reference depth lower than 0.7 Gy/hour, dose at the reference depth lower than 35 Gy, and (biologically effective dose with an α/β ratio of 10 Gy) at the reference depth lower than 40 Gy10 were associated with unfavorable LCR. Two patients died of metastatic disease. Radiation complications included retinal detachment in 12 eyes (13.3%), proliferative retinopathy in 6 (6.7%), rubeosis iris in 2 (2.2%), and posterior subcapsular cataract in 23 (25.6%). Conclusion: RPT is an effective eye-preserving treatment for retinoblastoma.

  4. Determination of natural isotopic variation in antimony using inductively coupled plasma mass spectrometry for an uncertainty estimation of the standard atomic weight of antimony

    International Nuclear Information System (INIS)

    The isotopic variation of industrially produced antimony was estimated using multiple-collector inductively coupled plasma mass spectrometry. A reproducible 123Sb/121Sb ratio of ±0.004% (2 standard deviations) was routinely obtained using a Sn doping mass discrimination correction technique. Only a small isotopic variation of about 0.05% was observed among industrially important Sb materials (five commercially available reagents and two ore minerals). The degree of Sb isotopic variation to determine the uncertainty in Sb atomic weight can be reduced by this new analytical technique to 0.00025 compared to the currently accepted IUPAC isotopic variation determined by conventional mass spectrometry of ±0.001. Heavy isotope enrichment of Sb in a drainage water sample from a stibnite mining area was found. This heavy isotope enrichment tendency in an aqueous environment may be useful in detecting anthropogenic Sb input from industrial emission by the smelting process via air because Sb of anthropogenic origin will have lighter isotope enrichment features. (author)

  5. Spin dynamics of complex oxides, bismuth-antimony alloys, and bismuth chalcogenides

    Science.gov (United States)

    Sahin, Cuneyt

    The emerging field of spintronics relies on the manipulation of electron spin in order to use it in spin-based electronics. Such a paradigm change has to tackle several challenges including finding materials with sufficiently long spin lifetimes and materials which are efficient in generating pure spin currents. This thesis predicts that two types of material families could be a solution to the aforementioned challenges: complex oxides and bismuth based materials. We derived a general approach for constructing an effective spin-orbit Hamiltonian which is applicable to all nonmagnetic materials. This formalism is useful for calculating spin-dependent properties near an arbitrary point in momentum space. We also verified this formalism through comparisons with other approaches for III-V semiconductors, and its general applicability is illustrated by deriving the spin-orbit interaction and predicting spin lifetimes for strained strontium titanate (STO) and a two-dimensional electron gas in STO (such as at the LAO/STO interface). Our results suggest robust spin coherence and spin transport properties in STO related materials even at room temperature. In the second part of the study we calculated intrinsic spin Hall conductivities for bismuth-antimony (BISb) semimetals with strong spin-orbit couplings, from the Kubo formula and using Berry curvatures evaluated throughout the Brillouin zone from a tight-binding Hamiltonian. Nearly crossing bands with strong spin-orbit interaction generate giant spin Hall conductivities in these materials, ranging from 474 ((h/e)O--1cm--1) for bismuth to 96((h/e)O--1cm --1) for antimony; the value for bismuth is more than twice that of platinum. The large spin Hall conductivities persist for alloy compositions corresponding to a three-dimensional topological insulator state, such as Bi0.83Sb0.17. The spin Hall conductivity could be changed by a factor of 5 for doped Bi, or for Bi0.83Sb0.17, by changing the chemical potential by 0.5 e

  6. Antimony: a traffic-related element in the atmosphere of Buenos Aires, Argentina.

    Science.gov (United States)

    Gómez, Darío R; Fernanda Giné, María; Claudia Sánchez Bellato, Ana; Smichowski, Patricia

    2005-12-01

    Vehicular traffic is one of the main sources of antimony in highly populated urban areas like Buenos Aires where an overall traffic density of 1 500 000 vehicles per day (corresponding to 7500 vehicles km(-2)) is estimated. In this context, a study was undertaken to ascertain the levels of Sb and other traffic-related elements (TRE) in the atmosphere of this city. To this end, sixty-seven samples of PM-10 particulate matter were collected during eight days in nine representative sampling sites located downtown Buenos Aires and spread over an area of about 30 km2. The collection of particulate matter was performed on ash-free glass-fibre filters using high volume samplers with PM-10 sampling heads. A combination of aqua regia and perchloric acid was used for leaching metals from filters. The resulting solutions were evaporated and then diluted with 0.1 mol l(-1) HCl. Antimony was determined by inductively coupled plasma-quadrupole mass spectrometry (ICP-QMS) at ng g(-1) levels. Concentrations of Sb varied from 12.9 +/- 0.9 to 375 +/- 23 microg g(-1)(equivalent to 0.87 +/- 0.06 to 15.3 +/- 0.8 ng m(-3)). Statistical analysis was performed on the data set including the measured PM-10 mass and Sb concentrations for the monitored period. Correlations of Sb with other TRE namely, Cu and Mo were also assessed. The highest concentrations of Sb were detected at two sites (Hospital Alemán and Casa Rapallini) located in streets with traffic consisting mostly of passenger cars and showing a "stop-and-go" pattern in peak hours. Antimony levels in the Buenos Aires PM-10 are by far below the level of 0.5 mg m(-3)(for an 8 hour workday, 40 hour work week) set by the US Occupational Safety and Health Administration (OSHA) for occupational exposure. However, monitoring of Sb and other TRE should be carried out in a systematic fashion to detect the possibility of increases in from the present levels. PMID:16307067

  7. 15 CFR 2011.106 - Agreements with foreign countries.

    Science.gov (United States)

    2010-01-01

    ... 15 Commerce and Foreign Trade 3 2010-01-01 2010-01-01 false Agreements with foreign countries. 2011.106 Section 2011.106 Commerce and Foreign Trade Regulations Relating to Foreign Trade Agreements OFFICE OF THE UNITED STATES TRADE REPRESENTATIVE ALLOCATION OF TARIFF-RATE QUOTA ON IMPORTED...

  8. 40 CFR 86.106-96 - Equipment required; overview.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 18 2010-07-01 2010-07-01 false Equipment required; overview. 86.106-96 Section 86.106-96 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) AIR... emissions, use of a dilution tunnel is not required (see § 86.109). The CVS must be connected to...

  9. 14 CFR 1203b.106 - Use of deadly force.

    Science.gov (United States)

    2010-01-01

    ... 14 Aeronautics and Space 5 2010-01-01 2010-01-01 false Use of deadly force. 1203b.106 Section... AUTHORITY AND USE OF FORCE BY NASA SECURITY FORCE PERSONNEL § 1203b.106 Use of deadly force. Deadly force shall be used only in those circumstances where the security force officer reasonably believes...

  10. 34 CFR 106.38 - Employment assistance to students.

    Science.gov (United States)

    2010-07-01

    ... 34 Education 1 2010-07-01 2010-07-01 false Employment assistance to students. 106.38 Section 106.38 Education Regulations of the Offices of the Department of Education OFFICE FOR CIVIL RIGHTS, DEPARTMENT OF EDUCATION NONDISCRIMINATION ON THE BASIS OF SEX IN EDUCATION PROGRAMS OR ACTIVITIES...

  11. 34 CFR 106.60 - Pre-employment inquiries.

    Science.gov (United States)

    2010-07-01

    ... 34 Education 1 2010-07-01 2010-07-01 false Pre-employment inquiries. 106.60 Section 106.60 Education Regulations of the Offices of the Department of Education OFFICE FOR CIVIL RIGHTS, DEPARTMENT OF... FINANCIAL ASSISTANCE Discrimination on the Basis of Sex in Employment in Education Programs or...

  12. Dicty_cDB: VFE106 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VF (Link to library) VFE106 (Link to dictyBase) - G00425 DDB0185421 Contig-U16165-1 VFE106P (Lin ... AY098944_1( AY098944 |pid:none) Homarus americanus dopamine ... beta h... 41 0.033 (Q6NP60) RecName: Full=MOXD1 ho ...

  13. 48 CFR 813.106-3 - Award and documentation.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false Award and documentation. 813.106-3 Section 813.106-3 Federal Acquisition Regulations System DEPARTMENT OF VETERANS AFFAIRS... documentation. The contracting officer may record a quotation on an Abstract of Offers (SF 1409 or 1419),...

  14. 14 CFR 1221.106 - Establishment of the NASA Flag.

    Science.gov (United States)

    2010-01-01

    ... 14 Aeronautics and Space 5 2010-01-01 2010-01-01 false Establishment of the NASA Flag. 1221.106... Program Identifiers, NASA Flags, and the Agency's Unified Visual Communications System § 1221.106 Establishment of the NASA Flag. The NASA Flags for interior and exterior use were created by the...

  15. 21 CFR 106.25 - In-process control.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 2 2010-04-01 2010-04-01 false In-process control. 106.25 Section 106.25 Food and... CONSUMPTION INFANT FORMULA QUALITY CONTROL PROCEDURES Quality Control Procedures for Assuring Nutrient Content... shall establish a quality control system that assures and verifies the addition of each...

  16. Dicty_cDB: SLB106 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SL (Link to library) SLB106 (Link to dictyBase) - - - Contig-U16382-1 SLB106Z (Link to Original ... KIKIIAPPERKYSVWIGGSILASLSTFQQMWISKEEYDESGPSIVHRKCF*tin ... kyvvfylnlkkkkk Translated Amino Acid sequence (All ... KIKIIAPPERKYSVWIGGSILASLSTFQQMWISKEEYDESGPSIVHRKCF*tin ... kyvvfylnlkkkkk Frame B: ---llkeksseiskkn*ptspstlkl ...

  17. 28 CFR 2.106 - Youth Rehabilitation Act.

    Science.gov (United States)

    2010-07-01

    ... 28 Judicial Administration 1 2010-07-01 2010-07-01 false Youth Rehabilitation Act. 2.106 Section 2....106 Youth Rehabilitation Act. (a) Regulations governing YRA offenders and D.C. Code FYCA offenders... to an offender sentenced under the Youth Rehabilitation Act of 1985 (D.C. Code 24-901 et seq.)...

  18. 42 CFR 441.106 - Comprehensive mental health program.

    Science.gov (United States)

    2010-10-01

    ... 42 Public Health 4 2010-10-01 2010-10-01 false Comprehensive mental health program. 441.106... SERVICES Medicaid for Individuals Age 65 or Over in Institutions for Mental Diseases § 441.106 Comprehensive mental health program. (a) If the plan includes services in public institutions for...

  19. 34 CFR 106.31 - Education programs or activities.

    Science.gov (United States)

    2010-07-01

    ... EDUCATION NONDISCRIMINATION ON THE BASIS OF SEX IN EDUCATION PROGRAMS OR ACTIVITIES RECEIVING FEDERAL FINANCIAL ASSISTANCE Discrimination on the Basis of Sex in Education Programs or Activities Prohibited § 106... 34 Education 1 2010-07-01 2010-07-01 false Education programs or activities. 106.31 Section...

  20. Dicty_cDB: VHF106 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF106 (Link to dictyBase) - - - Contig-U16508-1 VHF106P (Link to Original ... DY816594 |DY816594.1 CTOX5192.b1_O02.ab1 CTO(XYZ) dandelion ... Taraxacum officinale cDNA clone CTOX5192, mRNA seq ...

  1. 41 CFR 101-1.106 - Applicability of FPMR.

    Science.gov (United States)

    2010-07-01

    ... 41 Public Contracts and Property Management 2 2010-07-01 2010-07-01 true Applicability of FPMR. 101-1.106 Section 101-1.106 Public Contracts and Property Management Federal Property Management Regulations System FEDERAL PROPERTY MANAGEMENT REGULATIONS GENERAL 1-INTRODUCTION 1.1-Regulation System §...

  2. 34 CFR 106.22 - Preference in admission.

    Science.gov (United States)

    2010-07-01

    ... 34 Education 1 2010-07-01 2010-07-01 false Preference in admission. 106.22 Section 106.22... Preference in admission. A recipient to which this subpart applies shall not give preference to applicants... which admits as students only or predominantly members of one sex, if the giving of such preference...

  3. 33 CFR 106.225 - Drill and exercise requirements.

    Science.gov (United States)

    2010-07-01

    ...) Exercises are a full test of the Facility Security Plan and must include substantial and active.... 106.225 Section 106.225 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY MARITIME SECURITY MARINE SECURITY: OUTER CONTINENTAL SHELF (OCS) FACILITIES Outer Continental Shelf...

  4. The electrical characterizations of selenium (Se) doped gallium antimony (GaSb) single crystal

    Science.gov (United States)

    Choudhari, Rashmi; Deshpande, Manisha; Maske, Dilip; Gadkari, Dattatray

    2016-05-01

    The growth of Se doped GaSb bulk crystal is carried out using Vertical directional solidification (VDS) technique. High purity Gallium and Antimony is taken as source material and selenium as doping material. From grown ingot substrate were obtained in wafer form using diamond cutter. The electrical characteristics such as Hall measurement is used to find the carrier concentration and mobility, while Van der pauw for measuring resistivity of the sample The GaSb:Se sample shows high resistivity and mobility. The grown crystal was detached from the ampoule wall with high crystal quality. The measured resistivity of GaSb:Se is 9.9×10-3ohm-cm, the mobility is 1464cm3/Vsec and carrier concentration is 5.08×1017 per cm3.

  5. Sequential solvent extraction for forms of antimony in five selected coals

    Science.gov (United States)

    Qi, C.; Liu, Gaisheng; Kong, Y.; Chou, C.-L.; Wang, R.

    2008-01-01

    Abundance of antimony in bulk samples has been determined in five selected coals, three coals from Huaibei Coalfield, Anhui, China, and two from the Illinois Basin in the United States. The Sb abundance in these samples is in the range of 0.11-0.43 ??g/g. The forms of Sb in coals were studied by sequential solvent extraction. The six forms of Sb are water soluble, ion changeable, organic matter bound, carbonate bound, silicate bound, and sulfide bound. Results of sequential extraction show that silicate-bound Sb is the most abundant form in these coals. Silicate- plus sulfide-bound Sb accounts for more than half of the total Sb in all coals. Bituminous coals are higher in organic matterbound Sb than anthracite and natural coke, indicating that the Sb in the organic matter may be incorporated into silicate and sulfide minerals during metamorphism. ?? 2008 by The University of Chicago. All rights reserved.

  6. Supermolecular template route to fabrication of well crystallized hollow antimony microspheres

    Institute of Scientific and Technical Information of China (English)

    GU Li; CHEN Shu-da; WEI Xiao-yan

    2006-01-01

    Hollow spheres of elemental antimony (Sb) with good crystallinity, high contrast and thin wall were prepared in the solutions of poly(ethylene glycol) (PEG) and oleic acid(OA) associations at the refluxed temperature. The complexes of Sb3+ with tartaric acid were used as precursors, which can avoid the hydrolysis of SbCl3 and the resulting impurity of products. The average diameter and thickness of the as-prepared hollow sphere are about 300 nm and less than 20 nm, respectively. The formation of hollow spheres depends on the template function of PEG and OA associations, which can be confirmed through the theoretical analysis and results of control experiments. The specific surface area reaches 34.669 m2/g.

  7. Surface morphology of crystalline antimony islands on graphite at room temperature

    International Nuclear Information System (INIS)

    Antimony islands of different shapes and dimensions were grown on highly oriented pyrolytic graphite (HOPG) at room temperature in ultrahigh vacuum. Three-dimensional (3D) spherical, 2D thin films and 1D nanorods of Sb on graphite were studied using in situ scanning tunnelling microscopy. Sb was evaporated in the form of Sb4, which interacts with HOPG weakly and exhibits a high surface mobility, resulting in preferential nucleation of 3D spherical islands at defect sites. Surface diffusion and aggregation lead to the formation of nanoparticles with various shapes and sizes. The shape and size of islands depend on growth parameters, i.e. flux and deposition time. The 3D and 2D structures of Sb on graphite have the same bulk crystalline rhombohedral (α-Sb) structure, but the 1D nanorods show a highly compressed structure different from the α-Sb lattice

  8. Novel antimony doped tin oxide/carbon aerogel as efficient electrocatalytic filtration membrane

    Directory of Open Access Journals (Sweden)

    Zhimeng Liu

    2016-05-01

    Full Text Available A facile method was developed to prepare antimony doped tin oxide (Sb-SnO2/carbon aerogel (CA for use as an electrocatalytic filtration membrane. The preparation process included synthesis of a precursor sol, impregnation, and thermal decomposition. The Sb-SnO2, which was tetragonal in phase with an average crystallite size of 10.8 nm, was uniformly distributed on the CA surface and firmly attached via carbon-oxygen-tin chemical bonds. Preliminary filtration tests indicated that the Sb-SnO2/CA membrane had a high rate of total organic carbon removal for aqueous tetracycline owing to its high current efficiency and electrode stability.

  9. Focused ion beam induced synthesis of a porous antimony nanowire network

    International Nuclear Information System (INIS)

    We present a focused ion beam-based approach for the synthesis of an antimony nanofiber network. The nanofibers, with a homogeneous distribution of diameters of about 25 nm and lengths up to several microns, are synthesized in a self-assembling process without any additional material source at room temperature. It is possible to recrystallize the as-grown amorphous nanofibers by moderate rapid thermal annealing at 473 K. These results have been verified by means of scanning electron microscopy, Auger electron spectroscopy, high-resolution transmission electron microscopy, selected area electron diffraction, and energy dispersive x-ray analysis. As this approach is not limited solely to the material discussed here, other substrates (e.g., GaSb and Ge) and ion sources should extend this method to other materials, which offers a great potential for future nanoscale devices and applications

  10. Novel fabrication of an electrochromic antimony-doped tin oxide film using a nanoparticle deposition system

    Science.gov (United States)

    Kim, Hyungsub; Park, Yunchan; Choi, Dahyun; Ahn, Sung-Hoon; Lee, Caroline Sunyong

    2016-07-01

    Novel deposition method of Antimony-doped tin oxide (ATO) thin films was introduced using a nanoparticle deposition system (NPDS) to fabricate an electrochromic (EC) device. NPDS is a dry deposition method that simplifies the ATO deposition process by eliminating the need for solvents or binders. In this study, an ATO EC layer was deposited using NPDS. The surface morphology and electrochemical and optical transmittance properties were characterized. The optical transmittance change in the ATO EC device was ∼35% over the wavelength range of 350-800 nm, and the cyclic transmittance was stable. The ATO film deposited using NPDS, exhibited a coloration efficiency of 15.5 cm2 C-1. Therefore, our results suggest that ATO EC devices can be fabricated using a simple, cost-effective NPDS, which allows nanoparticles to be deposited directly without pre- or post-processing.

  11. Microbial diversity and community structure in an antimony-rich tailings dump.

    Science.gov (United States)

    Xiao, Enzong; Krumins, Valdis; Dong, Yiran; Xiao, Tangfu; Ning, Zengping; Xiao, Qingxiang; Sun, Weimin

    2016-09-01

    To assess the impact of antimony (Sb) on microbial community structure, 12 samples were taken from an Sb tailings pile in Guizhou Province, Southwest China. All 12 samples exhibited elevated Sb concentrations, but the mobile and bioaccessible fractions were small in comparison to total Sb concentrations. Besides the geochemical analyses, microbial communities inhabiting the tailing samples were characterized to investigate the interplay between the microorganisms and environmental factors in mine tailings. In all samples, Proteobacteria and Actinobacteria were the most dominant phyla. At the genus level, Thiobacillus, Limnobacter, Nocardioides, Lysobacter, Phormidium, and Kaistobacter demonstrated relatively high abundances. The two most abundant genera, Thiobacillus and Limnobacter, are characterized as sulfur-oxidizing bacteria and thiosulfate-oxidizing bacteria, respectively, while the genus Lysobacter contains arsenic (As)-resistant bacteria. Canonical correspondence analysis (CCA) indicates that TOC and the sulfate to sulfide ratio strongly shaped the microbial communities, suggesting the influence of the environmental factors in the indigenous microbial communities. PMID:27188777

  12. Nuclear quadrupole resonance of iodine pentafluoride and its complexes with antimony pentafluoride

    International Nuclear Information System (INIS)

    The spectra of nuclear quadrupole resonance (NQR) have been obtained at 77 deg K for I127 and Sbsup(121,128) in the IF5, IF5xSbF5, IF5x2SbF5, CsIF6, and RbIF6 compounds. An agreement between quadrupole spectra and structural data have been observed. The results of studying IF5 by NQR, gamma resonance and microwave spectroscopy have been compared. It has been established that unshared electron pair of an iodine atom is stereochemically active which leads to a considerable distortion of octahedral symmetry of coordination polyhedron of the iodine atoms. The structure of complexes of iodine pentafluoride with antimony pentafluoride is given

  13. Distributions and impact factors of antimony in topsoils and moss in Ny-Ålesund, Arctic.

    Science.gov (United States)

    Jia, Nan; Sun, Liguang; He, Xin; You, Kehua; Zhou, Xin; Long, Nanye

    2012-12-01

    The distribution of antimony (Sb) in topsoil and moss (Dicranum angustum) in disturbed and undisturbed areas, as well as coal and gangue, in Ny-Ålesund, Arctic was examined. Results show that the weathering of coal bed could not contribute to the increase of Sb concentrations in topsoil and moss in the study area. The distribution of Sb is partially associated with traffic and historical mining activities. The occurrence of the maximum Sb concentration is due to the contribution of human activities. In addition, the decrease of Sb content in topsoil near the coastline may be caused by the washing of seawater. Compared with topsoils, moss could be a useful tool for monitoring Sb in both highly and lightly polluted areas. PMID:22885219

  14. A novel composite material based on antimony(III) oxide and amorphous silica

    Energy Technology Data Exchange (ETDEWEB)

    Zemnukhova, Ludmila A. [Institute of Chemistry, Far-Eastern Branch, Russian Academy of Sciences, 690022 Vladivostok (Russian Federation); Panasenko, Alexander E., E-mail: panasenko@ich.dvo.ru [Institute of Chemistry, Far-Eastern Branch, Russian Academy of Sciences, 690022 Vladivostok (Russian Federation)

    2013-05-01

    The composite material nSb₂O₃·mSiO₂·xH₂O was prepared by hydrolysis of SbCl₃ and Na₂SiO₃ in an aqueous medium. It has been shown that the composition of the material is influenced by the ratio of the initial components and the acidity of the reaction medium. The morphology of the material particles and its specific surface area have been determined. The thermal and optic properties were also investigated. - Graphical abstract: Novel composite material containing amorphous silica and crystal antimony(III) oxide has been synthesized by hydrolysis of SbCl₃ and Na₂SiO₃ in an aqueous medium. Highlights: • The composite material nSb₂O₃·mSiO₂·xH₂O was prepared in an aqueous medium. • The composition of the material is controllable by a synthesis conditions. • The morphology of the material and its optic properties have been determined.

  15. Evaluations of antimony and strontium interaction in an Al–Si–Cu–Zn die cast alloy

    Energy Technology Data Exchange (ETDEWEB)

    Farahany, Saeed, E-mail: saeedfarahany@gmail.com; Idris, Mohd Hasbullah; Ourdjini, Ali

    2014-05-01

    Graphical abstract: - Highlights: • Probable interactions between Sb and Sr in a complex Al–Si alloy were evaluated. • Sequence of addition did not affect thermal and microscopical characteristics. • Threshold ratio for the Sb and Sr interaction is proposed. - Abstract: The interaction between antimony and strontium in an ADC12 die casting alloy is investigated comprehensively by using a computer aided cooling curve thermal analysis coupled with microstructure inspection. The results of the thermal analysis show significant changes in Al–Si eutectic reaction based on different concentrations of Sb and Sr. Sb reduces the efficiency of Sr in modifying the eutectic Si. Based upon the data obtained in this study, the threshold Sr/Sb ratio should exceed about 0.5 in order to obtain fully modified structure. Moreover, a pre-eutectic reaction of Al{sub 2}Si{sub 2}Sr intermetallic was detected for high concentrations of Sr.

  16. Synthesis and optical properties of antimony oxide glasses doped with holmium trioxide

    Science.gov (United States)

    Raghunatha, S.; Eraiah, B.

    2016-05-01

    Holmium doped lithium-antimony-lead borate glasses having 1mol% AgNO3 with composition 50B2O3-20PbO-25Sb2O3-5Li2O have been prepared using single step melt quenching technique. The XRD spectrum confirms amorphous nature of glasses. The optical absorbance studies were carried out on these glasses. The optical direct band gap energies were found to be in the range of 3.10 eV to 3.31 eV and indirect band gap energies were found to be in the range of 2.28 eV to 3.00 eV. The refractive indexes have been calculated by using Lorentz-Lorenz formula and the calculated values in the range of 2.31 to 2.37.

  17. Properties of antimony doped ZnO thin films deposited by spray pyrolysis technique

    Energy Technology Data Exchange (ETDEWEB)

    Sadananda Kumar, N., E-mail: sadanthara@gmail.com; Bangera, Kasturi V.; Shivakumar, G. K. [National Institute of Technology Karnataka, Surathkal, Thin Films Laboratory, Department of Physics (India)

    2015-07-15

    Antimony (Sb) doped zinc oxide (ZnO) thin films were deposited on the glass substrate at 450°C using spray pyrolysis technique. Effect of Sb doping on surface morphology structural, optical and electrical properties were studied. X-ray diffraction (XRD) analysis showed that both the undoped and doped ZnO thin films are polycrystalline in nature with (101) preferred orientation. SEM analysis showed a change in surface morphology of Sb doped ZnO thin films. Doping results in a marked increase in conductivity without affecting the transmittance of the films. ZnO films prepared with 3 at % Sb shows the lowest resistivity of 0.185 Ohm cm with a Hall mobility of 54.05 cm{sup 2} V{sup –1} s{sup –1}, and a hole concentration of 6.25 × 10{sup 17} cm{sup –3}.

  18. First-Principles Study of Antimony Doping Effects on the Iron-Based Superconductor CaFe(SbxAs1-x)2

    Science.gov (United States)

    Nagai, Yuki; Nakamura, Hiroki; Machida, Masahiko; Kuroki, Kazuhiko

    2015-09-01

    We study antimony doping effects on the iron-based superconductor CaFe(SbxAs1-x)2 by using the first-principles calculation. The calculations reveal that the substitution of a doped antimony atom into As of the chainlike As layers is more stable than that into FeAs layers. This prediction can be checked by experiments. Our results suggest that doping homologous elements into the chainlike As layers, which only exist in the novel 112 system, is responsible for rising up the critical temperature. We discuss antimony doping effects on the electronic structure. It is found that the calculated band structures with and without the antimony doping are similar to each other within our framework.

  19. First-principles study of antimony doping effects on the iron-based superconductor CaFe(SbxAs1−x)2

    International Nuclear Information System (INIS)

    We study antimony doping effects on the iron-based superconductor CaFe(SbxAs1−x)2 by using the first-principles calculation. The calculations reveal that the substitution of a doped antimony atom into As of the chainlike As layers is more stable than that into FeAs layers. This prediction can be checked by experiments. Our results suggest that doping homologous elements into the chainlike As layers, which only exist in the novel 112 system, is responsible for rising up the critical temperature. We discuss antimony doping effects on the electronic structure. It is found that the calculated band structures with and without the antimony doping are similar to each other within our framework. (author)

  20. Organic end state analysis of tank 241-S-106

    International Nuclear Information System (INIS)

    This document provides a record of the organic end state analysis of tank 241-S-106. Tank 241-S-106 is one of twelve 22.9-meter (75-feet) diameter single-shell tanks in the 241-S Tank Farm in the 200 West Area of Hanford. This tank was built in 1951 and has a capacity of 2870 kiloliter (kL) (758 kilogallon [kgal]). According to Hanlon (1999), tank 241-S-106 currently contains 1813 kL (479 kgal) of waste comprised of 1613 kL (426 kgal) saltcake, 200 kL (53 kgal) supernatant. Included in those volumes is 719 kL (190 kgal) drainable interstitial liquid. The pumpable volume is estimated at 920 kL (243 kgal). The waste is designated as non-complexed (NCPLX). Tank 241-S-106 is not a Watch List tank. Tank 241-S-106 has not been declared as a leaker

  1. Optical properties of Eu3+-doped antimony-oxide-based low phonon disordered matrices

    Science.gov (United States)

    Som, Tirtha; Karmakar, Basudeb

    2010-01-01

    A new series of monolithic Eu2O3-doped high antimony oxide (40-80 mol%) content disordered matrices (glasses) of low phonon energy (about 600 cm-1) in the K2O-B2O3-Sb2O3 (KBS) system was prepared by the melt-quench technique. Infrared reflection spectroscopy was used to establish the low phonon energy of the glasses. Amorphicity and devitrification of the glasses were confirmed by x-ray diffraction analysis. UV-vis absorption spectra of Eu3+ have been measured and the band positions have been justified with quantitative calculation of the nephelauxetic parameter and covalent bonding characteristics of the host. These Eu2O3-doped glasses upon excitation at 393 nm radiation exhibit six emission bands in the range 500-750 nm due to their low phonon energy. Of these, the magnetic dipole ^{5}\\mathrm {D}_{0} \\to {}^{7} \\mathrm {F_{1}} transition shows small Stark splitting while the electric dipole ^{5}\\mathrm {D}_{0} \\to {}^{7}\\mathrm {F}_{2} transition undergoes remarkable Stark splitting into two components. They have been explained by the crystal field effect. The Judd-Ofelt parameters, Ωt = 2,4,6, were also evaluated and the change of Ωt with the glass composition was correlated with the asymmetric effect at Eu3+ ion sites and the fundamental properties like covalent character and optical basicity. We are the first to report the spectroscopic properties of the Eu3+ ion in KBS low phonon antimony glasses.

  2. Impact of arsenic on uptake and bio-accumulation of antimony by arsenic hyperaccumulator Pteris vittata

    International Nuclear Information System (INIS)

    Individual uptake of As and Sb species in Pteris vittata have been investigated, but little information is available how uptake is affected if both metalloids are simultaneously present in different amounts. We investigated the uptake of antimony and its speciation in Pteris vittata cultivated in quartz substrate with, versus without, co-contamination with arsenic and a contaminated soil for 7 weeks. Applying HPLC-ICP-MS technique Sb(V), Sb(III), As(III), and As(V) could be identified as main species in aqueous extracts of roots and fronds with up to 230 mg kg−1 of total Sb in the roots. Adding increasing amounts of As to the quartz substrate resulted in increasing uptake of Sb. In contrast to As, which is readily transferred to the fronds, Sb is primarily accumulated in the roots with Sb(V) being the dominant species (>90% of Sb). The addition of As doesn't result in enhanced translocation of Sb into the fronds. Highlights: ► Antimonate is bioavailable to P. vittata grown for 7 weeks in different substrates. ► Antimony is primarily accumulated in the roots with Sb(V) being the dominant species. ► Sb(III) is present to a somewhat higher portion in the fronds than in the roots. ► Increasing amounts of As(V) in substrate resulted in increasing uptake of Sb(V). ► Addition of As is not accompanied by any alteration of Sb translocation to fronds. -- Roots of Pteris vittata cultivated under green-house conditioned in substrates containing antimonate accumulates Sb(V). This was promoted by As(V)

  3. Infrared-to-red upconversion luminescence in samarium-doped antimony glasses

    International Nuclear Information System (INIS)

    A new antimony-based glass system (K2O-B2O3-Sb2O3) having low phonon energy (about 600 cm-1) doped with Sm3+ ions has been developed. Infrared reflection spectroscopic (IRRS) studies have been employed to establish its low phonon energy. Ultraviolet-Visible-near infrared (UV-Vis-NIR) absorption and photoluminescence upconversion properties with the spectrochemistry of the 15K2O-15B2O3-70Sb2O3 (mol%) glasses have been studied doping with different concentrations (0.1-1.0 wt%) of Sm2O3. UV-Vis-NIR absorption band positions have been justified with quantitative calculation of nephelauxetic parameter and covalent bonding characteristics of the host. NIR to visible upconversion has been investigated by exciting at 949 nm at room temperature. Three upconverted bands originating from the 4G5/2→6H5/2, 4G5/2→6H7/2 and 4G5/2→6H9/2 transitions are found to be centered at 566 (green, weak), 602 (orange, weak) and 636 (red, remarkably strong) nm, respectively. These bands have been explained from the evaluation of the absorption, normal (downconversion) fluorescence and excitation spectra. The upconversion processes have been explained by the excited state absorption (ESA), energy transfer (ET) and cross-relaxation (CR) mechanisms involving population of the metastable (storage) energy level (4G5/2) by multiphonon deexcitation effect. It is evident from the IRRS study that the upconversion phenomena are expedited by the low multiphonon relaxation rate in antimony glasses owing to their low phonon energy (602 cm-1, the main and highest intensity Sb-O-Sb stretching band) which is very close to that of fluoride glasses (500-600 cm-1)

  4. Effect of valine 106 on structure-function relation of cytosolic human thymidine kinase - Kinetic properties and oligomerization pattern of nine substitution mutants of V106

    DEFF Research Database (Denmark)

    Frederiksen, Hanne; Berenstein, Dvora; Munch-Petersen, Birgitte

    2004-01-01

    characterized nine mutants of amino acid 106 differing in size, conformation and polarity. According to their oligomerization pattern and thymidine kinetics, the TK1 mutants can be divided into two groups. Group I (V106A, V106I and V106T) behaves like V106WT, in that pre-assay exposure to ATP induces reversible...... transition from a dimer with low catalytic activity to a tetramer with high catalytic activity. Group II (V106G, V106H, V106K, V106L and V106Q) behaves like V106M in that they are permanently high activity tetramers, irrespective of ATP exposure. We conclude that size and conformation of amino acid 106 are...

  5. Quantitative HPLC-ICP-MS analysis of antimony redox speciation in complex sample matrices: new insights into the Sb-chemistry causing poor chromatographic recoveries

    OpenAIRE

    Hansen, Claus; Schmidt, Bjørn; Larsen, Erik Huusfeldt; Gammelgaard, Bente; Stürup, Stefan; Hansen, Helle Rüsz

    2011-01-01

    In solution antimony exists either in the pentavalent or trivalent oxidation state. As Sb(III) is more toxic than Sb(V), it is important to be able to perform a quantitative speciation analysis of Sb’s oxidation state. The most commonly applied chromatographic methods used for this redox speciation analysis do, however, often show a low chromatographic Sb recovery when samples of environmental or biological origin are analysed. In this study we explored basal chemistry of antimony and found t...

  6. Nuclear structure studies of 106Pd and 106Cd with the (n,n',γ) reaction

    International Nuclear Information System (INIS)

    Excited states in 106Pd and 106Cd have been studied using the (n,n'γ) reaction. The data include level lifetimes, spins, branching ratios, and multipole mixing ratios, and give a comprehensive view of excitations with spin ≤ 6ℎ. The determined E2 strengths show serious discrepancies with the quadrupole phonon structure expected in these nuclei. (authors)

  7. Decreased antimony uptake and overexpression of genes of thiol metabolism are associated with drug resistance in a canine isolate of Leishmania infantum.

    Science.gov (United States)

    Gómez Pérez, Verónica; García-Hernandez, Raquel; Corpas-López, Victoriano; Tomás, Ana M; Martín-Sanchez, Joaquina; Castanys, Santiago; Gamarro, Francisco

    2016-08-01

    Visceral leishmaniasis (VL) caused by the protozoan parasite Leishmania infantum, is one of the most important zoonotic diseases affecting dogs and humans in the Mediterranean area. The presence of infected dogs as the main reservoir host of L. infantum is regarded as the most significant risk for potential human infection. We have studied the susceptibility profile to antimony and other anti-leishmania drugs (amphotericin B, miltefosine, paromomycin) in Leishmania infantum isolates extracted from a dog before and after two therapeutic interventions with meglumine antimoniate (subcutaneous Glucantime(®), 100 mg/kg/day for 28 days). After the therapeutic intervention, these parasites were significantly less susceptible to antimony than pretreatment isolate, presenting a resistance index of 6-fold to Sb(III) for promastigotes and >3-fold to Sb(III) and 3-fold to Sb(V) for intracellular amastigotes. The susceptibility profile of this resistant L. infantum line is related to a decreased antimony uptake due to lower aquaglyceroporin-1 expression levels. Additionally, other mechanisms including an increase in thiols and overexpression of enzymes involved in thiol metabolism, such as ornithine decarboxylase, trypanothione reductase, mitochondrial tryparedoxin and mitochondrial tryparedoxin peroxidase, could contribute to the resistance as antimony detoxification mechanisms. A major contribution of this study in a canine L. infantum isolate is to find an antimony-resistant mechanism similar to that previously described in other human clinical isolates. PMID:27317865

  8. Remediation of antimony-rich mine waters: Assessment of antimony removal and shifts in the microbial community of an onsite field-scale bioreactor.

    Science.gov (United States)

    Sun, Weimin; Xiao, Enzong; Kalin, Margarete; Krumins, Valdis; Dong, Yiran; Ning, Zengping; Liu, Tong; Sun, Min; Zhao, Yanlong; Wu, Shiliang; Mao, Jianzhong; Xiao, Tangfu

    2016-08-01

    An on-site field-scale bioreactor for passive treatment of antimony (Sb) contamination was installed downstream of an active Sb mine in Southwest China, and operated for one year (including a six month monitoring period). This bioreactor consisted of five treatment units, including one pre-aerobic cell, two aerobic cells, and two microaerobic cells. With the aerobic cells inoculated with indigenous mine water microflora, the bioreactor removed more than 90% of total soluble Sb and 80% of soluble antimonite (Sb(III)). An increase in pH and decrease of oxidation-reduction potential (Eh) was also observed along the flow direction. High-throughput sequencing of the small subunit ribosomal RNA (SSU rRNA) gene variable (V4) region revealed that taxonomically diverse microbial communities developed in the bioreactor. Metal (loid)-oxidizing bacteria including Ferrovum, Thiomonas, Gallionella, and Leptospirillum, were highly enriched in the bioreactor cells where the highest total Sb and Sb(III) removal occurred. Canonical correspondence analysis (CCA) indicated that a suite of in situ physicochemical parameters including pH and Eh were substantially correlated with the overall microbial communities. Based on an UPGMA (Unweighted Pair Group Method with Arithmetic Mean) tree and PCoA (Principal Coordinates Analysis), the microbial composition of each cell was distinct, indicating these in situ physicochemical parameters had an effect in shaping the indigenous microbial communities. Overall, this study was the first to employ a field-scale bioreactor to treat Sb-rich mine water onsite and, moreover, the findings suggest the feasibility of the bioreactor in removing elevated Sb from mine waters. PMID:27208755

  9. Formulation verification study results for 241-AN-106 waste grout

    International Nuclear Information System (INIS)

    Tests were conducted to determine whether the reference formulation and variations around the formulation are adequate for solidifying 241-AN-106 (106-AN) waste into a grout waste form. The reference formulation consists of 21 wt% type I/II Portland cement, 68 wt% fly ash, and 11 wt% attapulgite clay. The mix ratio is 8.4 lb/gal. Variations in dry blend component ratios, mix ratio, and waste concentration were assessed by using a statistically designed experimental matrix consisting of 44 grout compositions. Based on the results of the statistically designed variability study, the 106-AN grout formulations tested met all the formulation criteria except for the heat of hydration

  10. Study of positive-parity structures in 106Ag

    International Nuclear Information System (INIS)

    The high spin states of 106Ag were studied via the 100Mo (11B, 5n) 106Ag reaction with beam energy of 60 MeV at HI-13 Tandem Accelerator in China Institute of Atomic Energy. A new level scheme of 106Ag was presented. Band (1), which has large B(M1)/B(E2) value and no signature splitting, is assigned to the magnetic rotation band based on the πg9/2 ⊗ν[h11/22 (g7/2 /d5/2)] configuration. (authors)

  11. Sodium Antimony Gluconate Induces Generation of Reactive Oxygen Species and Nitric Oxide via Phosphoinositide 3-Kinase and Mitogen-Activated Protein Kinase Activation in Leishmania donovani-Infected Macrophages

    OpenAIRE

    Mookerjee Basu, Jayati; Mookerjee, Ananda; Sen, Prosenjit; Bhaumik, Suniti; Sen, Pradip; Banerjee, Subha; Naskar, Ksudiram; Choudhuri, Soumitra K.; Saha, Bhaskar; Raha, Sanghamitra; Roy, Syamal

    2006-01-01

    Pentavalent antimony complexes, such as sodium stibogluconate and sodium antimony gluconate (SAG), are still the first choice for chemotherapy against various forms of leishmaniasis, including visceral leishmaniasis, or kala-azar. Although the requirement of a somewhat functional immune system for the antileishmanial action of antimony was reported previously, the cellular and molecular mechanism of action of SAG was not clear. Herein, we show that SAG induces extracellular signal-regulated k...

  12. Cyanide and antimony thermodynamic database for the aqueous species and solids for the EPA-MINTEQ geochemical code

    Energy Technology Data Exchange (ETDEWEB)

    Sehmel, G.A.

    1989-05-01

    Thermodynamic data for aqueous species and solids that contain cyanide and antimony were tabulated from several commonly accepted, published sources of thermodynamic data and recent journal article. The review does not include gases or organic complexes of either antimony or cyanide, nor does the review include the sulfur compounds of cyanide. The basic thermodynamic data, ..delta..G/sub f,298//sup o/, ..delta..H/sub f,298//sup o/, and S/sub f//sup o/ values, were chosen to represent each solid phase and aqueous species for which data were available in the appropriate standard state. From these data the equilibrium constants (log K/sub r,298//sup o/) and enthalpies of reaction (..delta..H/sub r,298//sup o/) at 298 K (25/degree/C) were calculated for reactions involving the formation of these aqueous species and solids from the basic components. 34 refs., 14 tabs.

  13. Cyanide and antimony thermodynamic database for the aqueous species and solids for the EPA-MINTEQ geochemical code

    International Nuclear Information System (INIS)

    Thermodynamic data for aqueous species and solids that contain cyanide and antimony were tabulated from several commonly accepted, published sources of thermodynamic data and recent journal article. The review does not include gases or organic complexes of either antimony or cyanide, nor does the review include the sulfur compounds of cyanide. The basic thermodynamic data, ΔG/sub f,298//sup o/, ΔH/sub f,298//sup o/, and S/sub f//sup o/ values, were chosen to represent each solid phase and aqueous species for which data were available in the appropriate standard state. From these data the equilibrium constants (log K/sub r,298//sup o/) and enthalpies of reaction (ΔH/sub r,298//sup o/) at 298 K (25/degree/C) were calculated for reactions involving the formation of these aqueous species and solids from the basic components. 34 refs., 14 tabs

  14. Interest of lymphoscintigraphy with 99sup(m)Tc-labelled antimony sulfide in the arms after breast carcinoma treatment

    International Nuclear Information System (INIS)

    2 mCi of antimony sulfide colloid labelled with sup(99m)Tc were injected subcutaneously between the digits in 25 patients with postoperative lymphoedema of the arm for breast carcinoma. The two arms are examined successively, the normal one being used as control. The lymphoscintigraphy is realised with a gamma camera during an hour. The information obtained is threefoled; on the peripheral block's importance, the place where the lymphatic flow is stopped, and the presence in 40% of patients of axillary lymph nodes. The diminution of the lymphatic flow is not in correlation with the lymphoedema's importance. Lymphoscintigraphy with sup(99m)Tc antimony sulfide colloid is a simple examination but some side effects may occur. In 7 patients, post-injection lymphangitis was observed, with favorable evolution under antibiotic treatment. The lymphoscintigraphy can give some interesting information on the evolution of treated lymphoedema

  15. Antimony incorporation in InAs quantum dots grown on GaAs substrate by molecular beam epitaxy

    Science.gov (United States)

    Rihani, J.; Sallet, V.; Christophe, H. J.; Oueslati, M.; Chtourou, R.

    2008-01-01

    We have grown InAs(Sb) quantum dots (QDs) on GaAs (0 0 1) substrates by molecular beam epitaxy (MBE) using two different antimony exposures ( ΦSb). Atomic force microscopy (AFM) and photoluminescence (PL) spectroscopy were carried out to investigate the dot size evolution as function of the incorporated antimony content in InAs/GaAs QDs material. Anomalous asymmetric-band feature was observed in room temperature photoluminescence (RTPL) spectra of the investigated QD samples grown at relatively high temperature (490 °C). From the temperature-dependent PL measurements, it was found that the asymmetric-band feature is associated with the ground-states transitions from QDs with bimodal size distribution. The analysis of the pump power dependent PL spectra allows us to suggest a type II band lineup for the InAsSb/GaAs QDs materials system.

  16. Co-administration of glycyrrhizic acid with the antileishmanial drug sodium antimony gluconate (SAG) cures SAG-resistant visceral leishmaniasis.

    Science.gov (United States)

    Bhattacharjee, Amrita; Majumder, Saikat; Majumdar, Suchandra Bhattacharyya; Choudhuri, Soumitra Kumar; Roy, Syamal; Majumdar, Subrata

    2015-03-01

    Since there are very few affordable antileishmanial drugs available, antimonial resistance has crippled antileishmanial therapy, thereby emphasising the need for development of novel therapeutic strategies. This study aimed to evaluate the antileishmanial role of combined therapy with sodium antimony gluconate (SAG) and the triterpenoid glycyrrhizic acid (GA) against infection with SAG-resistant Leishmania (GE1F8R). Combination therapy with GA and SAG successfully limited infection with SAG-resistant Leishmania in a synergistic manner (fractional inhibitory concentration index resistant Leishmania and co-treated with GA and SAG exhibited a significant reduction in hepatic and splenic parasite burden. In probing the mechanism, it was observed that GA treatment suppressed the expression and efflux activity of P-glycoprotein (P-gp) and multidrug resistance-associated protein 1 (MRP1), two host ABC transporters responsible for antimony efflux from host cells infected with SAG-resistant parasites. This suppression correlated with greater intracellular antimony retention during SAG therapy both in vitro and in vivo, which was reflected in the reduced parasite load. Furthermore, co-administration of GA and SAG induced a shift in the cytokine balance towards a Th1 phenotype by augmenting pro-inflammatory cytokines (such as IL-12, IFNγ and TNFα) and inducing nitric oxide generation in GE1F8R-infected macrophages as well as GE1F8R-infected mice. This study aims to provide an affordable leishmanicidal alternative to expensive antileishmanial drugs such as miltefosine and amphotericin B. Furthermore, this report explores the role of GA as a resistance modulator in MRP1- and P-gp-overexpressing conditions. PMID:25600891

  17. The Potential Impact of Biofield Energy Treatment on the Atomic and Physical Properties of Antimony Tin Oxide Nanopowder

    OpenAIRE

    Trivedi, Mahendra Kumar

    2015-01-01

    Antimony tin oxide (ATO) is known for its high thermal conductivity, optical transmittance, and wide energy band gap, which makes it a promising material for the display devices, solar cells, and chemical sensor industries. The present study was undertaken to evaluate the effect of biofield energy treatment on the atomic and physical properties of ATO nanopowder. The ATO nanopowder was divided into two parts: control and treated. The treated part was subjected to Mr. Trivedi’s biofield ...

  18. The influence of remelting on the properties of AlSi6Cu4 alloy modified by antimony

    OpenAIRE

    D. Medlen; D. Bolibruchova

    2012-01-01

    The paper deals with the problem of multiple remelting influence on AlSi6Cu4 alloy modified by antimony on chosen mechanical characteristics, microstructure and gas content. This foundry alloy is used mostly in automotive industry. Foundry Aluminum-Silicon alloys are also used in number of industrial weight sensitive applications because of their low weight and very good castability and good mechanical properties. Modifiers are usually added to molten aluminum-silicon alloys to refine the eut...

  19. EFFECT OF GRAIN BOUNDARY SEGREGATION OF ANTIMONY ON RELAXATION AT GRAIN BOUNDARIES IN SILICON-IRON ALLOYS

    OpenAIRE

    Iwasaki, Y.; Fujimoto, K

    1981-01-01

    A sharp grain boundary peak appears in both 2 and 3% silicon-iron alloys due to a substitutional solute of silicon. This peak is highly sensitive to the segregation of the third element of antimony and, contrary to orthodox solute peaks in binary and ternary alloys, largely decreases in magnitude on heating after a segregation treatment. The subsequent measurement on cooling returns the peak to the ordinary magnitude. As a function of annealing time at a temperature of segregation, the height...

  20. Exploring screen printing technology on thermoelectric energy harvesting with printing copper-nickel and bismuth-antimony thermocouples

    OpenAIRE

    Cao, Zhuo; Koukharenko, Elena; Torah, R; Beeby, SP

    2013-01-01

    This paper reports the fabrication and testing of copper (Cu) - nickel (Ni) and bismuth (Bi) - antimony (Sb) based thermocouples fabricated using screen printing technology. The transport properties of the printed thermoelectric material were measured in room temperature while the Seebeck voltage and power output of the printed thermocouples were tested under a variety temperature gradient. Initial thermoelectric materials have been integrated in inks and then deposited on substrate by the si...

  1. Potentiometric stripping analysis of antimony based on carbon paste electrode modified with hexathia crown ether and rice husk

    International Nuclear Information System (INIS)

    Highlights: → Potentiometric stripping analysis (PSA) employed for the determination of antimony. → Hexathia-18C6 and rice husk modified carbon paste electrode developed for the analysis. → Lowest detection limit obtained for the determination of Sb(III) using PSA. → Analysis of Sb in pharmaceutical formulations, human hair, blood serum, urine and sea water. → Rice husk used as a modifier for the first time in electrochemistry. - Abstract: An electrochemical method based on potentiometric stripping analysis (PSA) employing a hexathia 18C6 (HT18C6) and rice husk (RH) modified carbon paste electrode (HT18C6-RH-CPE) has been proposed for the subnanomolar determination of antimony. The characterization of the electrode surface has been carried out by means of scanning electron microscopy, cyclic voltammetry, electrochemical impedance spectroscopy and chronocoulometry. By employing HT18C6-RH-CPE, a 12-fold enhancement in the PSA signal (dt/dE) was observed as compared to plain carbon paste electrode (PCPE). Under the optimized conditions, dt/dE (s V-1) was proportional to the Sb(III) concentration in the range of 1.42 x 10-8 to 6.89 x 10-11 M (r = 0.9944) with the detection limit (S/N = 3) of 2.11 x 10-11 M. The practical analytical utilities of the modified electrode were demonstrated by the determination of antimony in pharmaceutical formulations, human hair, sea water, urine and blood serum samples. The prepared modified electrode showed several advantages, such as simple preparation method, high sensitivity, very low detection limit and excellent reproducibility. Moreover, the results obtained for antimony analysis in commercial and real samples using HT18C6-RH-CPE and those obtained by inductively coupled plasma-atomic emission spectrometry (ICP-AES) are in agreement at the 95% confidence level.

  2. Potentiometric stripping analysis of antimony based on carbon paste electrode modified with hexathia crown ether and rice husk

    Energy Technology Data Exchange (ETDEWEB)

    Gadhari, Nayan S.; Sanghavi, Bankim J. [Department of Chemistry, University of Mumbai, Vidyanagari, Santacruz (East), Mumbai 400098 (India); Srivastava, Ashwini K., E-mail: aksrivastava@chem.mu.ac.in [Department of Chemistry, University of Mumbai, Vidyanagari, Santacruz (East), Mumbai 400098 (India)

    2011-10-03

    Highlights: {yields} Potentiometric stripping analysis (PSA) employed for the determination of antimony. {yields} Hexathia-18C6 and rice husk modified carbon paste electrode developed for the analysis. {yields} Lowest detection limit obtained for the determination of Sb(III) using PSA. {yields} Analysis of Sb in pharmaceutical formulations, human hair, blood serum, urine and sea water. {yields} Rice husk used as a modifier for the first time in electrochemistry. - Abstract: An electrochemical method based on potentiometric stripping analysis (PSA) employing a hexathia 18C6 (HT18C6) and rice husk (RH) modified carbon paste electrode (HT18C6-RH-CPE) has been proposed for the subnanomolar determination of antimony. The characterization of the electrode surface has been carried out by means of scanning electron microscopy, cyclic voltammetry, electrochemical impedance spectroscopy and chronocoulometry. By employing HT18C6-RH-CPE, a 12-fold enhancement in the PSA signal (dt/dE) was observed as compared to plain carbon paste electrode (PCPE). Under the optimized conditions, dt/dE (s V{sup -1}) was proportional to the Sb(III) concentration in the range of 1.42 x 10{sup -8} to 6.89 x 10{sup -11} M (r = 0.9944) with the detection limit (S/N = 3) of 2.11 x 10{sup -11} M. The practical analytical utilities of the modified electrode were demonstrated by the determination of antimony in pharmaceutical formulations, human hair, sea water, urine and blood serum samples. The prepared modified electrode showed several advantages, such as simple preparation method, high sensitivity, very low detection limit and excellent reproducibility. Moreover, the results obtained for antimony analysis in commercial and real samples using HT18C6-RH-CPE and those obtained by inductively coupled plasma-atomic emission spectrometry (ICP-AES) are in agreement at the 95% confidence level.

  3. Separation of Lead from Crude Antimony by Pyro-Refining Process with NaPO3 Addition

    Science.gov (United States)

    Ye, Longgang; Hu, Yuejie; Xia, Zhimei; Chen, Yongming

    2016-06-01

    The main purpose of this study was to separate lead from crude antimony through an oxidation pyro-refining process and by using sodium metaphosphate as a lead elimination reagent. The process parameters that will affect the refining results were optimized experimentally under controlled conditions, such as the sodium metaphosphate charging dosage, the refining temperature and duration, and the air flow rate, to determine their effect on the lead content in refined antimony and the lead removal rate. A minimum lead content of 0.0522 wt.% and a 98.6% lead removal rate were obtained under the following optimal conditions: W_{{{NaPO}_{{3}} }} = 15% W Sb (where W represents weight), a refining temperature of 800°C, a refining time of 30 min, and an air flow rate of 3 L/min. X-ray diffractometry and scanning electron microscopy showed that high-purity antimony was obtained. The smelting operation is free from smoke or ammonia pollution when using monobasic sodium phosphate or ammonium dihydrogen phosphate as the lead elimination reagent. However, this refining process can also remove a certain amount of sulfur, cobalt, and silicon simultaneously, and smelting results also suggest that sodium metaphosphate can be used as a potential lead elimination reagent for bismuth and copper refining.

  4. Evaluation of potential dietary toxicity of heavy metals in some common Nigerian beverages: A look at antimony, tin and mercury

    Directory of Open Access Journals (Sweden)

    I.I. Roberts

    2011-11-01

    Full Text Available There is currently little information on the composition of heavy metals in beverages imported and locally produced in Nigeria. The study quantitatively determined the composition of antimony (Sb, tin (Sn and mercury (Hg in 50 different beverage samples and evaluated the extent of violation of guideline values. Analysis of the beverage samples for the presence of Sb, Sn, and Hg was carried out using an atomic absorption spectrophotometer (AAS 929. The mean values detected for mercury, tin and antimony (±SE in fruit juices and soft drinks were 2.39±0.25, 3.66±0.22 and 0.49±0.048 μg/l; 2.93±0.34, 3.60±0.46 and 0.49±0.10 μg/l in dairy drinks and 0.94±0.02, 4.34±0.48 and 0.48±0.05 μg/l in bottled water samples respectively. While antimony detected in all products was below guideline values, mercury and tin were above the acceptable levels established by the World Health Organization, United States Environmental Protection Agency and European Union in most samples tested.

  5. Distribution, speciation and availability of antimony (Sb) in soils and terrestrial plants from an active Sb mining area

    International Nuclear Information System (INIS)

    Here, we present one of the first studies investigating the mobility, solubility and the speciation-dependent in-situ bioaccumulation of antimony (Sb) in an active Sb mining area (Xikuangshan, China). Total Sb concentrations in soils are high (527-11,798 mg kg-1), and all soils, including those taken from a paddy field and a vegetable garden, show a high bioavailable Sb fraction (6.3-748 mg kg-1), dominated by Sb(V). Elevated concentrations in native plant species (109-4029 mg kg-1) underpin this. Both chemical equilibrium studies and XANES data suggest the presence of Ca[Sb(OH)6]2, controlling Sb solubility. A very close relationship was found between the citric acid extractable Sb in plants and water or sulfate extractable Sb in soil, indicating that citric acid extractable Sb content in plants may be a better predictor for bioavailable Sb in soil than total acid digestible Sb plant content. - Highlights: → Antimony (Sb) in soils from an active Sb mining area is highly bioavailable. → Sb occurs mainly as Sb(V) in Sb mining impacted soils and plants. → Sb solubility in Sb mining impacted soils is governed by Ca[Sb(OH)6]2. → Citric acid extractable Sb in plants and bioavailable Sb in soils are strongly correlated. - Antimony (Sb) in soils from an active Sb mining area is highly bioavailable and controlled by the solubility of calcium antimonate.

  6. Distribution, speciation and availability of antimony (Sb) in soils and terrestrial plants from an active Sb mining area

    Energy Technology Data Exchange (ETDEWEB)

    Okkenhaug, Gudny, E-mail: go@ngi.no [Norwegian University of Life Sciences, Department of Plant and Environmental Sciences, P.O. Box 5003, N-1432 As (Norway); Norwegian Geotechnical Institute, P.O. Box 3930, Ullevaal Stadion, NO-0806 Oslo (Norway); Zhu Yongguan [Department of Soil Environmental Science, Research Center for Eco-Environmental Sciences, Chinese Academy of Sciences, Beijing 100085 (China); Luo Lei [State Key Laboratory of Environmental Chemistry and Ecotoxicology, Research Center for Eco-Environmental Sciences, Chinese Academy of Sciences, Beijing 100085 (China); Lei Ming [College of Resource and Environment, Hunan Agricultural University, Changsha 410128 (China); Li Xi [Department of Soil Environmental Science, Research Center for Eco-Environmental Sciences, Chinese Academy of Sciences, Beijing 100085 (China); Mulder, Jan [Norwegian University of Life Sciences, Department of Plant and Environmental Sciences, P.O. Box 5003, N-1432 As (Norway)

    2011-10-15

    Here, we present one of the first studies investigating the mobility, solubility and the speciation-dependent in-situ bioaccumulation of antimony (Sb) in an active Sb mining area (Xikuangshan, China). Total Sb concentrations in soils are high (527-11,798 mg kg{sup -1}), and all soils, including those taken from a paddy field and a vegetable garden, show a high bioavailable Sb fraction (6.3-748 mg kg{sup -1}), dominated by Sb(V). Elevated concentrations in native plant species (109-4029 mg kg{sup -1}) underpin this. Both chemical equilibrium studies and XANES data suggest the presence of Ca[Sb(OH){sub 6}]{sub 2}, controlling Sb solubility. A very close relationship was found between the citric acid extractable Sb in plants and water or sulfate extractable Sb in soil, indicating that citric acid extractable Sb content in plants may be a better predictor for bioavailable Sb in soil than total acid digestible Sb plant content. - Highlights: > Antimony (Sb) in soils from an active Sb mining area is highly bioavailable. > Sb occurs mainly as Sb(V) in Sb mining impacted soils and plants. > Sb solubility in Sb mining impacted soils is governed by Ca[Sb(OH){sub 6}]{sub 2}. > Citric acid extractable Sb in plants and bioavailable Sb in soils are strongly correlated. - Antimony (Sb) in soils from an active Sb mining area is highly bioavailable and controlled by the solubility of calcium antimonate.

  7. Precipitation of antimony from the solution of sodium thioantimonite by air oxidation in the presence of catalytic agents

    Institute of Scientific and Technical Information of China (English)

    杨天足; 赖琼琳; 唐建军; 楚广

    2002-01-01

    The behavior of antimony oxidation in the solution of sodium thioantimonite was studied in the presence of catalytic agents. The catalytic effects of the respective addition of cupric sulfate, sodium tartrate, potassium permanganate, phenol, 1,2-dihydroxybenzene and their combination on the oxidation of sodium thioantimonite were investigated. A pilot test was carried out. The results show that the respective use of sodium tartrate, cupric sulfate, potassium permanganate, phenol and 1,2-dihydroxybenzene have little catalytic effect on the oxidation of sodium thioantimonite. However there exists obvious catalytic oxidation by the combination of 0.25 g/L 1,2-dihydroxybenzene, 0.5 g/L potassium permanganate and 1.0 g/L phenol. Moreover, high blast intensity, the increase of temperature and NaOH concentration favor the oxidation of antimony. The oxidation process of antimony has such advantages as quick reaction and low operation costs. The results of the pilot test are consistent with those of laboratory experiments.

  8. Tank 241-BX-106 tank characterization plan. Revision 1

    International Nuclear Information System (INIS)

    This document is a plan that identifies the information needed to address relevant issues concerning short-term and long-term safe storage and long-term management of Single-Shell Tank (SST) 241-BX-106

  9. Tallinna 21. kooli ehitamine neelab 106 miljonit krooni / Urmas Seaver

    Index Scriptorium Estoniae

    Seaver, Urmas

    2003-01-01

    2001. a. alustatud ning ligi aasta algselt kavandatust pikemaks veniv Tallinna 21. kooli ehitamine neelab kuni 106 miljonit krooni, sealjuures on linnal kooli lõpuniehitamiseks praegu puudu ligi 12 miljonit krooni

  10. 48 CFR 813.106-70 - Oral purchase orders.

    Science.gov (United States)

    2010-10-01

    ... CONTRACTING METHODS AND CONTRACT TYPES SIMPLIFIED ACQUISITION PROCEDURES Procedures 813.106-70 Oral purchase... a purchase order number to the transaction. A copy of any electronically generated purchase...

  11. Thermal stability of the C106 dye in robust electrolytes

    DEFF Research Database (Denmark)

    Lund, Torben; Phuong, Nguyen Tuyet; Pechy, Peter; Zakeeruddin, Shaik M.; Grätzel, Michael

    Thermal stability of the C106 dye in robust electrolytes. We have investigated the thermal stability and degradation chemistry of the ruthenium dye C106 (Figure 1) at 80 ◦C in the “robust” electrolyte “B” comprised of 1.0 M DMII, 0.03 M I2, 0.5 M NBB, and 0.1 M GuNCS in 3-methoxypropionitrile (3......-MPN) introduced by Gao et al. in 2008. [1]. Figure 1 Thermal degradation of C106 bound to TiO2 at 80 ºC in dark as a function of heating time. ● C106 = RuLL´(NCS)2 ■ RuLL´(NCS)(NBB)+ ▲ RuLL´(NCS)(3-MPN)+ The C106 dye was attached to the surface of TiO2 nano-particles and stable colloidal solutions of...... the particles were prepared in electrolyte mixture B. The solutions were thermally treated at 80 ◦C for 0-2000 hours followed by dye extraction and analysis by HPLC coupled to UV/Vis and electro spray mass spectrometry [2]. Figure 1 shows the concentration profiles of C106 samples prepared under...

  12. Effect of valine 106 on structure-function relation of cytosolic human thymidine kinase - Kinetic properties and oligomerization pattern of nine substitution mutants of V106

    DEFF Research Database (Denmark)

    Frederiksen, Hanne; Berenstein, Dvora; Munch-Petersen, Birgitte

    2004-01-01

    enzymatic properties of the cell-cycle-regulated human cytosolic thymidine kinase 1 (TK1) is investigated. On the basis of the previously observed profound differences between recombinant TK1 with Val106 (V106WT) and Met106 (V106M) in catalytic activity and oligomerization pattern, we designed and...

  13. Preparation of antimony sulfide semiconductor nanoparticles by pulsed laser ablation in liquid

    Energy Technology Data Exchange (ETDEWEB)

    Sun, Ren-De, E-mail: son003@sekisui.com [Research & Development Institute, High Performance Plastics Company, Sekisui Chemical Co., Ltd. 2-1 Hyakuyama, Shimamoto-Cho, Mishima-Gun, Osaka, 618-0021 (Japan); Tsuji, Takeshi [Interdisciplinary Graduate School of Science and Engineering, Shimane University, 1060 Nishikawatsu-Cho, Matsue, 690-8504 (Japan)

    2015-09-01

    Highlights: • Pulsed laser ablation in liquid (LAL) was applied to prepare antimony sulfide nanoparticles (Sb{sub 2}S{sub 3} NPs). • Sb{sub 2}S{sub 3} NPs with a stoichiometric composition were successfully prepared by LAL in water without using any surfactants or capping agents. • Thus-prepared Sb{sub 2}S{sub 3} NPs showed low-temperature crystallization and melting at a temperature low as 200 °C. • The NPs-coated Sb{sub 2}S{sub 3} thin film showed comparable semiconductor properties (carrier mobility and carrier density) to the vacuum deposited one. • Byproducts such as CS{sub 2}, CH{sub 4} and CO were detected by GC-MS analysis when LAL was performed in organic solvent. • The LAL-induced decomposition mechanism of Sb{sub 2}S{sub 3} and organic solvents was discussed based on the GC-MS results. - Abstract: In this paper, we report on the synthesis of antimony sulfide (Sb{sub 2}S{sub 3}) semiconductor nanoparticles by pulsed laser ablation in liquid without using any surfactants or capping agents. Different results were obtained in water and organic solvents. In the case of water, Sb{sub 2}S{sub 3} nanoparticles with chemical compositions of stoichiometry were successfully prepared when laser irradiation was performed under the condition with the dissolved oxygen removed by argon gas bubbling. It was shown that thus-obtained Sb{sub 2}S{sub 3} nanoparticles exhibit features of not only low-temperature crystallization but also low-temperature melting at a temperature as low as 200 °C. Nanoparticle-coated Sb{sub 2}S{sub 3} thin films were found to show good visible light absorption and satisfying semiconductor properties (i.e., carrier mobility and density), which are essential for photovoltaic application. On the other hand, in the case of organic solvents (e.g., acetone, ethanol), such unexpected byproducts as CS{sub 2}, CO and CH{sub 4} were detected from the reaction system by GC-MS analysis, which suggests that both Sb{sub 2}S{sub 3} and organic

  14. Efficient green and red fluorescence upconversion in erbium doped new low phonon antimony glasses

    Science.gov (United States)

    Som, Tirtha; Karmakar, Basudeb

    2009-02-01

    New K 2O-B 2O 3-Sb 2O 3 (KBS) glass system having low phonon energy (about 600 cm -1) doped with Er 3+ ions has been developed. Infrared reflection spectroscopic (IRRS) studies have been employed to establish its low phonon energy. Ultraviolet-visible-near infrared (UV-vis-NIR) absorption and photoluminescence upconversion properties with special emphasis on the spectrochemistry of the 15K 2O-15B 2O 3-70Sb 2O 3 (mol%) glass have been studied doping with different concentrations (0.1-1.0 wt%) of Er 2O 3. UV-vis-NIR absorption band positions have been justified with quantitative calculation of nephelauxetic parameter and covalent bonding characteristics of the host. NIR to visible upconversion has been investigated by exciting at 798 nm at room temperature. Three upconverted bands originating from the 2H 11/2 → 4I 15/2, 4S 3/2 → 4I 15/2 and 4F 9/2 → 4I 15/2 transitions are found to be centered at 522 (green, very weak), 536 (green, medium) and 645 (red, strong) nm, respectively. These bands have been explained from the evaluation of the absorption, normal (down conversion) fluorescence and excitation spectra. The upconversion processes have been explained by the excited state absorption (ESA), energy transfer (ET), cooperative energy transfer (CET) and cross relaxation (CR) mechanisms involving population of the metastable (storage) energy levels ( 2H 11/2, 4S 3/2 and 4F 9/2) by effects of multiphonon deexcitation and thermal population. It is evident from the IRRS study that the upconversion phenomena are expedited by the low multiphonon relaxation rate in antimony glasses owing to their high intense low phonon energy (602 cm -1) which is very close to that of fluoride glasses (500-600 cm -1). We are the first to report the upconversion fluorescence of Er 3+ ions in KBS antimony glasses.

  15. Infrared-to-red upconversion luminescence in samarium-doped antimony glasses

    Energy Technology Data Exchange (ETDEWEB)

    Som, Tirtha [Glass Technology Laboratory, Glass Division, Central Glass and Ceramic Research Institute, 196 Raja S.C. Mullick Road, Kolkata 700 032 (India); Karmakar, Basudeb [Glass Technology Laboratory, Glass Division, Central Glass and Ceramic Research Institute, 196 Raja S.C. Mullick Road, Kolkata 700 032 (India)], E-mail: basudebk@cgcri.res.in

    2008-12-15

    A new antimony-based glass system (K{sub 2}O-B{sub 2}O{sub 3}-Sb{sub 2}O{sub 3}) having low phonon energy (about 600 cm{sup -1}) doped with Sm{sup 3+} ions has been developed. Infrared reflection spectroscopic (IRRS) studies have been employed to establish its low phonon energy. Ultraviolet-Visible-near infrared (UV-Vis-NIR) absorption and photoluminescence upconversion properties with the spectrochemistry of the 15K{sub 2}O-15B{sub 2}O{sub 3}-70Sb{sub 2}O{sub 3} (mol%) glasses have been studied doping with different concentrations (0.1-1.0 wt%) of Sm{sub 2}O{sub 3}. UV-Vis-NIR absorption band positions have been justified with quantitative calculation of nephelauxetic parameter and covalent bonding characteristics of the host. NIR to visible upconversion has been investigated by exciting at 949 nm at room temperature. Three upconverted bands originating from the {sup 4}G{sub 5/2}{yields}{sup 6}H{sub 5/2}, {sup 4}G{sub 5/2}{yields}{sup 6}H{sub 7/2} and {sup 4}G{sub 5/2}{yields}{sup 6}H{sub 9/2} transitions are found to be centered at 566 (green, weak), 602 (orange, weak) and 636 (red, remarkably strong) nm, respectively. These bands have been explained from the evaluation of the absorption, normal (downconversion) fluorescence and excitation spectra. The upconversion processes have been explained by the excited state absorption (ESA), energy transfer (ET) and cross-relaxation (CR) mechanisms involving population of the metastable (storage) energy level ({sup 4}G{sub 5/2}) by multiphonon deexcitation effect. It is evident from the IRRS study that the upconversion phenomena are expedited by the low multiphonon relaxation rate in antimony glasses owing to their low phonon energy (602 cm{sup -1}, the main and highest intensity Sb-O-Sb stretching band) which is very close to that of fluoride glasses (500-600 cm{sup -1})

  16. Energy deposition by a 106Ru/106Rh eye applicator simulated using LEPTS, a low-energy particle track simulation

    International Nuclear Information System (INIS)

    The present study introduces LEPTS, an event-by-event Monte Carlo programme, for simulating an ophthalmic 106Ru/106Rh applicator relevant in brachytherapy of ocular tumours. The distinctive characteristics of this code are the underlying radiation-matter interaction models that distinguish elastic and several kinds of inelastic collisions, as well as the use of mostly experimental input data. Special emphasis is placed on the treatment of low-energy electrons for generally being responsible for the deposition of a large portion of the total energy imparted to matter. - Highlights: → We present the Monte Carlo code LEPTS, a low-energy particle track simulation. → Carefully selected input data from 10 keV to 1 eV. → Application to an electron emitting Ru-106/Rh-106 plaque used in brachytherapy.

  17. A study on low cost-high conducting fluorine and antimony-doped tin oxide thin films

    International Nuclear Information System (INIS)

    Thin films of undoped, fluorine- and antimony-doped tin oxide on glass at 400 deg. C was prepared by spray pyrolysis technique. Tin chloride (SnCl2), ammonium fluoride (NH4F), and antimony trichloride (SbCl3) were used as source for tin (Sn), fluorine (F), and antimony (Sb), respectively. To ensure the control of solution concentration on growth rate, fluorine-doped tin oxide (SnO2:F) thin films were first prepared with different amount of tin precursor, in the range of 5-12g, which has resulted in deposition of films with different thickness values. The optimum amount of tin precursor found from this study (11g) was fixed constant for preparing SnO2 films with different doping levels of F and Sb. From the X-ray diffraction analyses, it is understood that the preferred orientation of SnO2:F films is dependent on their thickness and the solution concentration. The variation in the solution concentration and orientation of the films was reflected in their morphology as examined by scanning electron microscopy (SEM) and atomic force microscopy (AFM). SEM studies showed that the variation in the solution concentration lead to different grain shapes for different orientations. The AFM study showed that the RMS roughness of undoped films reduced considerably from 86 to 24nm due to fluorine doping (15wt.%), whereas the antimony doping (2wt.%) has no significance effect on RMS roughness (93nm). The electrical properties of the films were examined by a Hall measurements setup in van der Pauw configuration. A minimum sheet resistance of 1.75 and 2.17Ω/ were obtained for F and Sb doped films, respectively. From the optical studies, it is found that the transmittance of undoped films increased from 42% to a maximum 85% on 30wt.% fluorine doping, whereas that has been decreased to a minimum of 12% on 4wt.% antimony doping (800nm). A discussion on the effect of type of dopants and their concentration on the structural, electrical and optical properties of the SnO2 film have

  18. Development of a MSFIA system for sequential determination of antimony, arsenic and selenium using hydride generation atomic fluorescence spectrometry.

    Science.gov (United States)

    de Santana, Fernanda A; Portugal, Lindomar A; Serra, Antonio M; Ferrer, Laura; Cerdà, Víctor; Ferreira, Sergio L C

    2016-08-15

    This paper proposed a multisyringe flow injection analysis (MSFIA) system for antimony, arsenic and selenium determination in peanut samples by hydride generation atomic fluorescence spectrometry (HG-AFS). The optimization step of the hydride generation was performed using a two-level full factorial design involving the parameters: hydrochloric acid, sodium tetrahydroborate and potassium iodide concentrations. So, using the chemical conditions optimized, this method allows the determination of these elements employing the external calibration technique using aqueous standards with limits of detection and quantification of 0.04 and 0.14µgL(-1) for antimony, 0.04 and 0.14µgL(-1) for arsenic and 0.14 and 0.37µgL(-1) for selenium, respectively. Additionally, the effect of vanadium, chromium, cobalt, nickel, zinc, copper, iron and molybdenum on the generation of chemical vapour was also studied. The precision expressed as relative standard deviation varied from 1.2 to 3.6% for antimony, 1.8-3.9% for arsenic and 1.8-2% for selenium. The accuracy for arsenic and selenium was confirmed using the certified peach leaves reference material SRM 1547 produced by National Institute of Standard and Technology. The proposed method showed 45 injection throughput (h(-1)) using 1.6mL sample volume for each element, 0.8mL NaBH4 0.5% (w/v) containing NaOH 0.05% (w/v), 0.8mL HCl 5M and 0.4mL KI 14% (w/v) containing L-ascorbic acid 2.5% (w/v). The method was applied to the determination of antimony, arsenic and selenium in peanut samples, which were firstly lyophilized and afterward digested using microwave assisted radiation. Six samples were analyzed and the contents of the elements found were: 28.7-41.3µgkg(-1) for arsenic, 86.4-480.1µgkg(-1) for selenium and 32.6-52.4µgkg(-1) for antimony. Addition/recovery tests were also performed to confirm the method accuracy for the three elements. PMID:27260431

  19. Partitioning geochemistry of arsenic and antimony, El Tatio Geyser Field, Chile

    International Nuclear Information System (INIS)

    The abundance of As and Sb in aqueous, mineral and biological reservoirs was examined at El Tatio Geyser Field, a unique hydrothermal basin located in the Atacama Desert region of Chile. Here the concentration of total As and Sb in hydrothermal springs and discharge streams are the highest reported for a natural surface water, and the geyser basin represents a significant source of toxic elements for downstream users across Region II, Chile. The geyser waters are near neutral Na:Cl type with ∼0.45 and 0.021 mmol L-1 total As and Sb, respectively, primarily in the reduced (III) redox state at the discharge with progressive oxidation downstream. The ferric oxyhydroxides associated with the microbial mats and some mineral precipitates accumulate substantial As that was identified as arsenate by XAS analysis (>10 wt% in the mats). This As is easily mobilized by anion exchange or mild dissolution of the HFO, and the ubiquitous microbial mats represent a significant reservoir of As in this system. Antimony, in contrast, is not associated with the mineral ferric oxides or the biomats, but is substantially enriched in the silica matrix of the geyserite precipitates, up to 2 wt% as Sb2O3. Understanding the mobility and partitioning behavior of these metalloids is critical for understanding their eventual impact on regional water management.

  20. Suppression of the vapor-liquid-solid growth of silicon nanowires by antimony addition.

    Science.gov (United States)

    Nimmatoori, Pramod; Zhang, Qi; Dickey, Elizabeth C; Redwing, Joan M

    2009-01-14

    The effect of Sb addition on the growth rate and structural properties of Si nanowires synthesized by vapor-liquid-solid growth was investigated. The nanowire growth rate was reduced by an order of magnitude following the addition of a low concentration pulse of trimethylantimony (TMSb) to the gas phase during growth. Transmission electron microscopy analysis revealed that the wires had a thick amorphous coating ( approximately 8 nm) around the catalyst particle and a distorted catalyst shape. Energy-dispersive x-ray spectroscopy showed the presence of trace amounts of Sb in the amorphous coating around the catalyst and at the catalyst-wire interface. Antimony was also found to be incorporated in the Si nanowires with a peak in the Sb concentration measured at the initial point where the TMSb pulse was added to the gas stream. The significant reduction in wire growth rate was attributed to Sb segregation at the vapor-liquid and liquid-solid interfaces which results in a change in interfacial energies and a reduction in the rate of Si incorporation at these interfaces. PMID:19417276

  1. Synthesis of Copper-Antimony-Sulfide Nanocrystals for Solution-Processed Solar Cells.

    Science.gov (United States)

    Suehiro, Satoshi; Horita, Keisuke; Yuasa, Masayoshi; Tanaka, Tooru; Fujita, Katsuhiko; Ishiwata, Yoichi; Shimanoe, Kengo; Kida, Tetsuya

    2015-08-17

    The p-type nanocrystals (NCs) of copper-based chalcogenides, such as CuInSe2 and Cu2ZnSnS4, have attracted increasing attention in photovoltaic applications due to their potential to produce cheap solution-processed solar cells. Herein, we report the synthesis of copper-antimony-sulfide (CAS) NCs with different crystal phases including CuSbS2, Cu3SbS4, and Cu12Sb4S13. In addition, their morphology, crystal phase, and optical properties were characterized using transmission electron microscopy, X-ray diffractometry, UV-vis-near-IR spectroscopy, and photoemission yield spectroscopy. The morphology, crystal phase, and electronic structure were significantly dependent on the chemical composition in the CAS system. Devices were fabricated using particulate films consisting of CAS NCs prepared by spin coating without a high-temperature treatment. The CAS NC-based devices exhibited a diode-like current-voltage characteristic when coupled with an n-type CdS layer. In particular, the CuSbS2 NC devices exhibited photovoltaic responses under simulated sunlight, demonstrating its applicability for use in solution-processed solar cells. PMID:26237216

  2. Assessment and distribution of antimony in soils around three coal mines, Anhui, China

    Science.gov (United States)

    Qi, C.; Liu, Gaisheng; Kang, Y.; Lam, P.K.S.; Chou, C.

    2011-01-01

    Thirty-three soil samples were collected from the Luling, Liuer, and Zhangji coal mines in the Huaibei and Huainan areas of Anhui Province, China. The samples were analyzed for antimony (Sb) by inductively coupled plasmaoptical emission spectrometry (ICP-OES) method. The average Sb content in the 33 samples was 4 mg kg-1, which is lower than in coals from this region (6.2 mg kg-1). More than 75% of the soils sampled showed a significant degree of Sb pollution (enrichment factors [EFs] 5-20). The soils collected near the gob pile and coal preparation plant were higher in Sb content than those collected from residential areas near the mines. The gob pile and tailings from the preparation plant were high in mineral matter content and high in Sb. They are the sources of Sb pollution in surface soils in the vicinity of coal mines. The spatial dispersion of Sb in surface soil in the mine region shows that Sb pollution could reach out as far as 350 m into the local environment conditions. Crops in rice paddies may adsorb some Sb and reduce the Sb content in soils from paddyfields. Vertical distribution of Sb in two soil profiles indicates that Sb is normally relatively immobile in soils. ?? 2011 Air & Waste Management Association.

  3. Antimony nanoparticles anchored in three-dimensional carbon network as promising sodium-ion battery anode

    Science.gov (United States)

    Luo, Wen; Zhang, Pengfei; Wang, Xuanpeng; Li, Qidong; Dong, Yifan; Hua, Jingchen; Zhou, Liang; Mai, Liqiang

    2016-02-01

    A novel composite with antimony (Sb) nanoparticles anchored in three-dimensional carbon network (denoted as SbNPs@3D-C) is successfully synthesized via a NaCl template-assisted self-assembly strategy, followed by freeze-drying and one-step in-situ carbonization. The three-dimensional interconnected macroporous carbon framework can not only stabilize the architecture and buffer the volume expansion for Sb nanoparticles, but also provide high electrical conductivity for the whole electrode. Consequently, as a sodium-ion battery anode, the SbNPs@3D-C delivers a high reversible capacity (456 mAh g-1 at 100 mA g-1), stable cycling performance (94.3% capacity retention after 500 cycles at 100 mA g-1) as well as superior rate capability (270 mAh g-1 at 2000 mA g-1). When compared with commercial Sb particles, the SbNPs@3D-C exhibits dramatically enhanced electrochemical performance. Free from expensive template sources and complex manipulation, this work might shed some light on the synthesis of low-cost and high-performance materials for the next "beyond lithium" battery generation.

  4. Antimony uptake, translocation and speciation in rice plants exposed to antimonite and antimonate.

    Science.gov (United States)

    Ren, Jing-Hua; Ma, Lena Q; Sun, Hong-Jie; Cai, Fei; Luo, Jun

    2014-03-15

    Antimony (Sb) accumulation in rice is a potential threat to human health, but its uptake mechanisms are unclear. A hydroponic experiment was conducted to investigate uptake, translocation, speciation and subcellular distribution of Sb in rice plants exposed to antimonite (SbIII) and antimonate (SbV) at 0.2, 1.0 or 5.0 mg/L for 4h. More Sb was accumulated in iron plaque than in the plant, with both the roots (~10-12 times) and Fe plaque (~28-54 times) sequestering more SbIII than SbV. The presence of iron plaque decreased uptake of both SbV and SbIII. SbIII uptake kinetics fitted better to the Michaelis-Menten function than SbV. Antimonate (56 to 98%) was the predominant form in rice plant with little methylated species being detected using HPLC-ICP-MS. Cell walls accumulated more Sb than organelles and cytosol, which were considered as the first barrier against Sb entering into cells. Sb transformation and subcellular distribution can help to understand the metabolic mechanisms of Sb in rice. PMID:24419289

  5. A new method for antimony speciation in plant biomass and nutrient media using anion exchange cartridge.

    Science.gov (United States)

    Tisarum, Rujira; Ren, Jing-Hua; Dong, Xiaoling; Chen, Hao; Lessl, Jason T; Ma, Lena Q

    2015-11-01

    A selective separation method based on anion exchange cartridge was developed to determine antimony (Sb) speciation in biological matrices by graphite furnace atomic absorption spectrophotometry (GFAAS). The selectivity of the cartridge towards antimonite [Sb(III)] and antimonate [Sb(V)] reversed in the presence of deionized (DI) water and 2mM citric acid. While Sb(V) was retained by the cartridge in DI water, Sb(III) was retained in citric acid media. At pH 6, Sb(III) and Sb(V) formed Sb(III)- and Sb(V)-citrate complexes, but the cartridge had higher affinity towards the Sb(III)-citrate complex. Separation of Sb(III) was tested at various concentrations in fresh and spent growth media and plant tissues. Our results showed that cartridge-based Sb speciation was successful in plant tissues, which was confirmed by HPLC-ICP-MS. The cartridge retained Sb(III) and showed 92-104% Sb(V) recovery from arsenic hyperaccumulator Pteris vittata roots treated with Sb(III) and Sb(V). The cartridge procedure is an effective alternative for Sb speciation, offering low cost, reproducible results, and simple Sb analysis using GFAAS. PMID:26452943

  6. Antimony release from contaminated mine soils and its migration in four typical soils using lysimeter experiments.

    Science.gov (United States)

    Shangguan, Yu-Xian; Zhao, Long; Qin, Yusheng; Hou, Hong; Zhang, Naiming

    2016-11-01

    Antimony (Sb) can pose great risks to the environment in mining and smelting areas. The migration of Sb in contaminated mine soil was studied using lysimeter experiments. The exchangeable concentration of soil Sb decreased with artificial leaching. The concentrations of Sb retained in the subsoil layers (5-25cm deep) were the highest for Isohumosol and Ferrosol and the lowest for Sandy soil. The Sb concentrations in soil solutions decreased with soil depth, and were adequately simulated using a logarithmic function. The Sb migration pattern in Sandy soil was markedly different from the patterns in the other soils which suggested that Sb may be transported in soil colloids. Environmental factors such as water content, soil temperature, and oxidation-reduction potential of the soil had different effects on Sb migration in Sandy soil and Primosol. The high Fe and Mn contents in Ferrosol and Isohumosol significantly decreased the mobility of Sb in these soils. The Na and Sb concentrations in soils used in the experiments positively correlated with each other (PPrimosol>Isohumosol>Ferrosol, and we concluded that the Sb mobility in the soils also decreased in that order. PMID:27395817

  7. Enhanced hematite water electrolysis using a 3D antimony-doped tin oxide electrode.

    Science.gov (United States)

    Moir, Jonathon; Soheilnia, Navid; O'Brien, Paul; Jelle, Abdinoor; Grozea, Claudia M; Faulkner, Daniel; Helander, Michael G; Ozin, Geoffrey A

    2013-05-28

    We present herein an example of nanocrystalline antimony-doped tin oxide (nc-ATO) disordered macroporous "inverse opal" 3D electrodes as efficient charge-collecting support structures for the electrolysis of water using a hematite surface catalyst. The 3D macroporous structures were created via templating of polystyrene spheres, followed by infiltration of the desired precursor solution and annealing at high temperature. Using cyclic voltammetry and electrochemical impedance spectroscopy, it was determined that the use of this 3D transparent conducting oxide with a hematite surface catalyst allowed for a 7-fold increase in active surface area for water splitting with respect to its 2D planar counterpart. This ratio of surface areas was evaluated based on the presence of oxidized trap states on the hematite surface, as determined from the equivalent circuit analysis of the Nyquist plots. Furthermore, the presence of nc-ATO 2D and 3D "underlayer" structures with hematite deposited on top resulted in decreased charge transfer resistances and an increase in the number of available active surface sites at the semiconductor-liquid junction when compared to hematite films lacking any nc-ATO substructures. Finally, absorption, transmission, and reflectance spectra of all of the tested films were measured, suggesting the feasibility of using 3D disordered structures in photoelectrochemical reactions, due to the high absorption of photons by the surface catalyst material and trapping of light within the structure. PMID:23581965

  8. Spark Plasma Sintering and Densification Mechanisms of Antimony-Doped Tin Oxide Nanoceramics

    Directory of Open Access Journals (Sweden)

    Junyan Wu

    2013-01-01

    Full Text Available Densification of antimony-doped tin oxide (ATO ceramics without sintering aids is very difficult, due to the volatilization of SnO2, formation of deleterious phases above 1000°C, and poor sintering ability of ATO particles. In this paper, monodispersed ATO nanoparticles were synthesized via sol-gel method, and then ATO nanoceramics with high density were prepared by spark plasma sintering (SPS technology using the as-synthesized ATO nanoparticles without the addition of sintering aids. The effect of Sb doping content on the densification was investigated, and the densification mechanisms were explored. The results suggest that ATO nanoparticles derived from sol-gel method show good crystallinity with a crystal size of 5–20 nm and Sb is incorporated into the SnO2 crystal structure. When the SPS sintering temperature is 1000°C and the Sb doping content is 5 at.%, the density of ATO nanoceramics reaches a maximum value of 99.2%. Densification mechanisms are explored in detail.

  9. Leaching of Antimony (Sb)from Municipal Solid Waste Incineration (MSWI) Residues

    Energy Technology Data Exchange (ETDEWEB)

    Herrmann, Inga

    2004-07-01

    The mobility of antimony (Sb) in municipal solid waste incineration (MSWI) residues often exceeds the limit values stipulated by the European Union. As an ash treatment by washing is conceivable, this work investigated the Sb release from Swedish bottom ash and fly ash when mixed with water. The leaching experiments revealed the factors significantly (a = 0.05) affecting Sb release from the ashes. The following factors were investigated: Liquid to solid ratio (L/S), time, pH, carbonation (treatment with CO{sub 2}), ultrasonics and temperature. The data were evaluated using multiple linear regression (MLR). The impact of the factors could be quantified. The maximum Sb release calculated was 13 mg/kg DM for bottom ash and 51 mg/kg DM for fly ash. The derived models explained the observed data well. Nevertheless, the calculated values were subject to a high uncertainty. For bottom ash, a lowering of the Sb total content of approximately 22% could be achieved. If this also involves a sufficient lowering of the Sb mobility to meet EU limit values could not yet be assessed. Chemical equilibrium calculations were performed to explain the empirical results. However, no solid phases controlling Sb release from the ashes could be identified.

  10. Controlled n-doping in chemical vapour deposition grown graphene by antimony

    International Nuclear Information System (INIS)

    We have studied the effects of antimony (Sb) doping on graphene grown by chemical vapour deposition without any significant change in its electrical properties. By increasing the metal thickness from 1 to 5 nm, we found a shift in the wave numbers of Raman G and two-dimensional (2D) peaks consistent with n-doping and a change in the Fermi level of the graphene into the conduction band. The relative intensity of the D peak to the G peak did not show a significant change and that of the 2D peak to the G peak remained at a large enough number as a function of metal thickness, implying little degradation by the metal dopants. Transport measurements also confirm the n-doping of graphene through a shift of Dirac point in the transfer characteristics and the quality preservation with little changes in mobility. We also report on the formation of a p–n junction by metal doping on selected areas of the graphene and their electrical properties with transfer characteristics and Hall measurements. (paper)

  11. Evaluation of atmospheric inputs as possible sources of antimony in pregnant women from urban areas.

    Science.gov (United States)

    Fort, Marta; Grimalt, Joan O; Querol, Xavier; Casas, Maribel; Sunyer, Jordi

    2016-02-15

    Antimony and copper are common components of brake linings. The occurrence of these two metals in urban atmospheric aerosols has been related to vehicular use. Urine samples (n=466) taken during the 32nd week of pregnancy were analyzed for Sb and Cu in pregnant women from an urban area (Sabadell, Catalonia, Spain). The geometric mean levels were 0.28 and 13 μg/g creatinine, respectively. Positive significant associations between urine concentrations of Sb and seasonality, intensity of physical exercise, working activities and traffic intensity at their home streets were observed. Cu showed the same trends but without statistical significance. In both cases, the estimated dietary ingestion of these two metals was larger than the inhalation inputs but the difference was much higher for Cu than for Sb. While Sb has no dietary role, Cu is an essential element which is also incorporated into humans through diet. The results suggest that inhalation of atmospheric particles may also constitute a source of Sb in pregnant women and general population of urban areas. PMID:26657384

  12. Partitioning geochemistry of arsenic and antimony, El Tatio Geyser Field, Chile

    Energy Technology Data Exchange (ETDEWEB)

    Landrum, J.T. [Department of Geological Sciences, The University of Texas, Austin, TX 78759 (United States); Bennett, P.C., E-mail: pbennett@mail.utexas.edu [Department of Geological Sciences, University of Texas, Austin, TX 78759 (United States); Engel, A.S. [Department of Geology and Geophysics, Louisiana State University, Baton Rouge, LA 70803 (United States); Alsina, M.A.; Pasten, P.A. [Departamento de Ingenieria Hidraulica y Ambiental, Pontificia Universidad Catolica de Chile, Santiago (Chile); Milliken, K. [Department of Geological Sciences, University of Texas, Austin, TX 78759 (United States)

    2009-04-15

    The abundance of As and Sb in aqueous, mineral and biological reservoirs was examined at El Tatio Geyser Field, a unique hydrothermal basin located in the Atacama Desert region of Chile. Here the concentration of total As and Sb in hydrothermal springs and discharge streams are the highest reported for a natural surface water, and the geyser basin represents a significant source of toxic elements for downstream users across Region II, Chile. The geyser waters are near neutral Na:Cl type with {approx}0.45 and 0.021 mmol L{sup -1} total As and Sb, respectively, primarily in the reduced (III) redox state at the discharge with progressive oxidation downstream. The ferric oxyhydroxides associated with the microbial mats and some mineral precipitates accumulate substantial As that was identified as arsenate by XAS analysis (>10 wt% in the mats). This As is easily mobilized by anion exchange or mild dissolution of the HFO, and the ubiquitous microbial mats represent a significant reservoir of As in this system. Antimony, in contrast, is not associated with the mineral ferric oxides or the biomats, but is substantially enriched in the silica matrix of the geyserite precipitates, up to 2 wt% as Sb{sub 2}O{sub 3}. Understanding the mobility and partitioning behavior of these metalloids is critical for understanding their eventual impact on regional water management.

  13. Comparison of arsenic and antimony biogeochemical behavior in water, soil and tailings from Xikuangshan, China.

    Science.gov (United States)

    Fu, Zhiyou; Wu, Fengchang; Mo, Changli; Deng, Qiujing; Meng, Wei; Giesy, John P

    2016-01-01

    Although similar geochemical behaviors of arsenic (As) and antimony (Sb) in the environment has been assumed and widely reported, growing evidence suggests the two elements cannot, under some conditions, be assumed to behave similarly. In this four-year study (samples collected in each year), comparative investigation of the biogeochemistry of As and Sb in water/fish, soil/vegetable, tailings/plant samples were carried out at the world's largest active Sb mine area (Xikuangshan, China). Depending on duration the tailings had been stacked, significant differences in spatial distributions between As and Sb were found, and these were associated with change in pH over time. Bio-accumulation factors (BAFs) of As were approximately 10-fold greater than those of Sb in fish/water, plant/tailing, and vegetable/soil systems. Sb had higher BAF in non-fatty tissues such as gills of fishes and shells of crabs. BAFs of Sb in vegetable/soil exhibited insignificantly, but different from As, positive correlation with pH in soil. PMID:26356182

  14. DFT Study on the Carrier Concentration and Temperature-Dependent Thermoelectric Properties of Antimony Selenide

    Directory of Open Access Journals (Sweden)

    Aditya Jayaraman

    2016-01-01

    Full Text Available We present the thermoelectric properties of Antimony Selenide (Sb2Se3 obtained using first principles calculations. We investigated the electronic band structure using the FP-LAPW method within the sphere of the density functional theory. Thermoelectric properties were calculated using BoltzTrap code using the constant relaxation time (τ approximation at three different temperatures 300 K, 600 K, and 800 K. Seebeck coefficient (S was found to decrease with increasing temperature, electrical conductivity (σ/τ was almost constant in the entire temperature range, and electronic thermal conductivity (κ/τ increased with increasing temperature. With increase in temperature S decreased from 1870 μV/K (at 300 K to 719 μV/K (at 800 K, electronic thermal conductivity increased from 1.56 × 1015 W/m K s (at 300 K to 3.92 × 1015 W/m K s (at 800 K, and electrical conductivity decreased from 22 × 1019/Ω m s (at 300 K to 20 × 1019/Ω m s (at 800 K. The thermoelectric properties were also calculated for different hole concentrations and the optimum concentration for a good thermoelectric performance over a large range of temperatures (from 300 K to 1000 K was found for hole concentration around 1019 cm−3.

  15. Validation of methodology and uncertainty assessment of antimony determination in environmental materials using Neutron Activation Analysis

    International Nuclear Information System (INIS)

    Antimony is an element found in low concentrations in the environment. However, its determination has attracted great interest because of the knowledge of its toxicity and increasing application. Neutron activation analysis (NAA) is a suitable method for the determination of several elements in different types, but in case of Sb, the analysis presents some difficulties due to spectral interferences. The objective of this research was to validate the method of NAA and uncertainty assessment for Sb determination in environmental samples. The experimental procedure consisted of irradiating twelve certified reference samples of different kind of matrices. The samples were irradiated in the nuclear research reactor IEA R1 IPEN/CNEN/SP followed by measurement of induced radioactivity, using a hyperpure germanium detector coupled to a gamma ray spectrometry. The radioisotopes 122Sb and 124Sb were measured and the Sb concentrations with their respective uncertainties were obtained by the comparative method. Relative errors and values of Z scores were calculated to evaluate the accuracy of the results for Sb determination in certified reference materials. The evaluation of the components that contribute to uncertainty measurement of the Sb concentration, showed that the major uncertainty contribution is due to statistical counting. The results also indicated that the uncertainty value of the combined standard uncertainty depends on the radioisotope measured and the decay time used for counting. (author)

  16. Antimony-Doped Tin Oxide Thin Films Grown by Home Made Spray Pyrolysis Technique

    Science.gov (United States)

    Yusuf, Gbadebo; Babatola, Babatunde Keji; Ishola, Abdulahi Dimeji; Awodugba, Ayodeji O.; Solar cell Collaboration

    2016-03-01

    Transparent conducting antimony-doped tin oxide (ATO) films have been deposited on glass substrates by home made spray pyrolysis technique. The structural, electrical and optical properties of the ATO films have been investigated as a function of Sb-doping level and annealing temperature. The optimum target composition for high conductivity and low resistivity was found to be 20 wt. % SnSb2 + 90 wt. ATO. Under optimized deposition conditions of 450oC annealing temperature, electrical resistivity of 5.2×10-4 Ω -cm, sheet resistance of 16.4 Ω/sq, average optical transmittance of 86% in the visible range, and average optical band-gap of 3.34eV were obtained. The film deposited at lower annealing temperature shows a relatively rough, loosely bound slightly porous surface morphology while the film deposited at higher annealing temperature shows uniformly distributed grains of greater size. Keywords: Annealing, Doping, Homemade spray pyrolysis, Tin oxide, Resistivity

  17. New limits on double beta processes in 106-Cd

    CERN Document Server

    Tretyak, V I; Bernabei, R; Brudanin, V B; Cappella, F; Caracciolo, V; Cerulli, R; Chernyak, D M; Danevich, F A; d'Angelo, S; Di Marco, A; Incicchitti, A; Laubenstein, M; Mokina, V M; Poda, D V; Polischuk, O G; Tupitsyna, I A

    2016-01-01

    A radiopure cadmium tungstate crystal scintillator, enriched in 106-Cd to 66%, with mass of 216 g (106-CdWO4) was used in coincidence with four ultra-low background HPGe detectors contained in a single cryostat to search for double beta decay processes in 106-Cd. New improved half-life limits on the double beta processes in 106-Cd have been set on the level of 1e20-1e21 yr after 13085 h of data taking deep underground (3600 m w.e.) at the Gran Sasso National Laboratories of INFN (Italy). In particular, the limit on the two neutrino electron capture with positron emission T1/2 >1.1e21 yr, has reached the region of theoretical predictions. The resonant neutrinoless double electron captures to the 2718, 2741 and 2748 keV excited states of 106-Pd are restricted on the level of T1/2 > 8.5e20 - 1.4e21 yr.

  18. Collective bands in 104,106,108Mo

    International Nuclear Information System (INIS)

    We have used our analysis of γ-γ-γ data (5.7 x 1011 triples and higher folds) taken with Gammasphere from prompt γ rays emitted in the spontaneous fission of 252Cf to study the collective bands in 104,106,108Mo. The one-phonon and two-phonon γ-vibrational bands and known two-quasiparticle bands in neutron-rich 104,106Mo were extended to higher spins. The one-and two-phonon γ-vibrational bands have remarkably close energies for transitions from the same spin states and identical moments of inertia. Several new bands are observed and are proposed as quasiparticle bands in 104,106Mo, along with the first β-type vibrational band in 106Mo. The quasiparticle bands have essentially constant moments of inertia near the rigid-body value that indicate blocking of the pairing interaction. Candidates for chiral doublet bands in 106Mo are strong. These are the first reported chiral vibrational bands in an even-even nucleus

  19. Gold and Antimony Mixed Flotation on a Micrite Gold Antimony ore in Guizhou%贵州某泥晶灰岩型含锑金矿金锑混浮试验

    Institute of Scientific and Technical Information of China (English)

    石贵明; 周意超

    2015-01-01

    贵州某泥晶灰岩型含锑金矿石为块状构造,金属矿物主要为黄铁矿、针铁矿,含量小于1%,非金属矿物以方解石为主,另有少量石英、有机质等;金含量为6.04 g/t,显微镜下未见自然金粒,74.34%的金赋存在硫化矿中,游离金仅占总金的7.14%;硅酸盐、碳酸盐包裹金分别占11.96%和6.56%;锑主要以辉锑矿的形式存在。为高效、低成本回收矿石中的金、锑,对混合浮选工艺进行了试验研究。结果表明,在一段磨矿细度为-0.074 mm占71%的情况下1粗2扫混浮、尾矿再磨细度为-0.074 mm占92.7%的情况下再1粗2扫混浮、两粗精矿合并后3次精选、中矿顺序返回流程处理,最终获得了金品位为47.60 g/t、锑品位为9.81%、金回收率为76.68%、锑回收率为85.22%的金锑混合精矿,金锑混浮效果较理想。尾矿中金的回收及金锑分离工艺研究将另文介绍。%The micrite type antimony-containing gold ore in Guizhou is in blocky construction. Its metallic minerals are mainly pyrite and goethite,with content of less than 1%. Non-metallic minerals are calcite,and few of quartz,organic matter, etc. It contains gold of 6. 04 g/t,and natural gold grains were not seen in microscope,74. 34% of the gold occurred in sulfide ore,free gold accounted for only 7. 14%,wrapped gold in silicate and carbonate accounted for 11. 96% and 6. 56% respective-ly. Antimony mainly existed in the form of stibnite. Bulk flotation process was studied to make high efficient recovery of gold and antimony at low costs. The results indicated that,at the grinding fineness of 71% passing 0. 074 mm,through one roughing and two scavenging bulk flotation,one roughing and two scavenging bulk flotation after regrinding the tailings to 92. 7% passing 0. 074 mm,three cleaning flotation for the two mixed rough concentrate,and then middles back to the flow-sheet in turn,rough gold-antimony concentrate with gold grade of 47. 60 g

  20. Photomultiplier tube development for the 1.06 micrometer wavelength

    Science.gov (United States)

    Enck, R. S., Jr.

    1976-01-01

    High speed, electrostatic photomultipliers were developed for use in 400 megabit laser communication systems operating at the 1.06 micron wavelength. A high performance, electrostatic III-V photocathode PMT was shown in communication system tests to perform competitively with solid state and avalanche photodiodes. Signal-induced noise and III-V cathode stability were identified as remaining technical problems while cathode quantum efficiencies of or = 5% at 1.06 micron and 320 picosecond rise and fall time pulse performance were achieved.

  1. Quantitative HPLC-ICP-MS analysis of antimony redox speciation in complex sample matrices: new insights into the Sb-chemistry causing poor chromatographic recoveries

    DEFF Research Database (Denmark)

    Hansen, Claus; Schmidt, Bjørn; Larsen, Erik Huusfeldt;

    2011-01-01

    low chromatographic recoveries. A combination of HPLC-ICP-MS, AFFF-ICP-MS and spinfiltration was applied for analysis of model compounds and biological samples. Quantitative chromatographic Sb redox speciation analysis was possible by acidic hydrolysis of the antimony polymers prior to analysis......In solution antimony exists either in the pentavalent or trivalent oxidation state. As Sb(III) is more toxic than Sb(V), it is important to be able to perform a quantitative speciation analysis of Sb’s oxidation state. The most commonly applied chromatographic methods used for this redox speciation...... analysis do, however, often show a low chromatographic Sb recovery when samples of environmental or biological origin are analysed. In this study we explored basal chemistry of antimony and found that formation of macromolecules, presumably oligomeric and polymeric Sb(V) species, is the primary cause of...

  2. Changes induced by gamma radiation in nanocomposites based on copper II and antimony sulfides in commercial poly(methyl methacrylate) matrix

    International Nuclear Information System (INIS)

    Poly (methyl methacrylate) (PMMA) is a polymer with wide application in the manufacture of medical devices that is exposed to gamma irradiation. Currently the use of composite materials has been disseminated and PMMA is an excellent polymer matrix to package various materials. This study aimed to analyze the changes induced by gamma irradiation (25 kGy) on the properties of PMMA nanocomposites with nanoparticles of copper II sulfide (250nm-900nm) and antimony sulfite (300-500 nm). The nanoparticles were added to the polymer in different concentrations and synthesized by ultrasonic irradiation from the corresponding chlorides with thioacetamide. Viscometric results showed a good radioprotective effect of nanoparticles of copper and antimony. It was found a good protection of nanoparticles on PMMA matrix in the concentration of 0.3% wt. The protections of 75% and 50% were calculated for nanoparticles of antimony and copper II, respectively. (author)

  3. Cobalt doped antimony oxide nano-particles based chemical sensor and photo-catalyst for environmental pollutants

    International Nuclear Information System (INIS)

    Graphical abstract: A dichloromethane chemical sensor using cobalt antimony oxides has been fabricated. This sensor showed high sensitivity and will be a useful candidate for environmental and health monitoring. Also it showed high photo-catalytic activity and can be a good candidate as a photo-catalyst for organic hazardous materials. Highlights: ► Reusable chemical sensor. ► Green environmental and eco-friendly chemi-sensor. ► High sensitivity. ► Good candidate for environmental and health monitoring. - Abstract: Cobalt doped antimony oxide nano-particles (NPs) have been synthesized by hydrothermal process and structurally characterized by utilizing X-ray diffraction (XRD), field emission scanning electron microscopy (FE-SEM) and Fourier transforms infrared spectrophotometer (FT-IR) which revealed that the synthesized cobalt antimony oxides (CoSb2O6) are well crystalline nano-particles with an average particles size of 26 ± 10 nm. UV–visible absorption spectra (∼286 nm) were used to investigate the optical properties of CoSb2O6. The chemical sensing of CoSb2O6 NPs have been primarily investigated by I–V technique, where dichloromethane is used as a model compound. The analytical performance of dichloromethane chemical sensor exhibits high sensitivity (1.2432 μA cm−2 mM−1) and a large linear dynamic range (1.0 μM–0.01 M) in short response time (10 s). The photo catalytic activity of the synthesized CoSb2O6 nano-particles was evaluated by degradation of acridine orange (AO), which degraded 58.37% in 200 min. These results indicate that CoSb2O6 nano-particles can play an excellent research impact in the environmental field.

  4. Cobalt doped antimony oxide nano-particles based chemical sensor and photo-catalyst for environmental pollutants

    Energy Technology Data Exchange (ETDEWEB)

    Jamal, Aslam [Centre for Advanced Materials and Nano-Engineering (CAMNE) and Department of Chemistry, Faculty of Sciences and Arts, Najran University, P. O. Box 1988, Najran 11001 (Saudi Arabia); Rahman, Mohammed M. [Center of Excellence for Advanced Materials Research (CEAMR), King Abdulaziz University, P.O. Box 80203, Jeddah 21589 (Saudi Arabia); Chemistry Department, Faculty of Science, King Abdulaziz University, P.O. Box 80203, Jeddah 21589 (Saudi Arabia); Khan, Sher Bahadar, E-mail: drkhanmarwat@gmail.com [Center of Excellence for Advanced Materials Research (CEAMR), King Abdulaziz University, P.O. Box 80203, Jeddah 21589 (Saudi Arabia); Chemistry Department, Faculty of Science, King Abdulaziz University, P.O. Box 80203, Jeddah 21589 (Saudi Arabia); Faisal, Mohd. [Centre for Advanced Materials and Nano-Engineering (CAMNE) and Department of Chemistry, Faculty of Sciences and Arts, Najran University, P. O. Box 1988, Najran 11001 (Saudi Arabia); Akhtar, Kalsoom [Division of Nano Sciences and Department of Chemistry, Ewha Womans University, Seoul 120-750 (Korea, Republic of); Rub, Malik Abdul; Asiri, Abdullah M.; Al-Youbi, Abdulrahman O. [Center of Excellence for Advanced Materials Research (CEAMR), King Abdulaziz University, P.O. Box 80203, Jeddah 21589 (Saudi Arabia); Chemistry Department, Faculty of Science, King Abdulaziz University, P.O. Box 80203, Jeddah 21589 (Saudi Arabia)

    2012-11-15

    Graphical abstract: A dichloromethane chemical sensor using cobalt antimony oxides has been fabricated. This sensor showed high sensitivity and will be a useful candidate for environmental and health monitoring. Also it showed high photo-catalytic activity and can be a good candidate as a photo-catalyst for organic hazardous materials. Highlights: Black-Right-Pointing-Pointer Reusable chemical sensor. Black-Right-Pointing-Pointer Green environmental and eco-friendly chemi-sensor. Black-Right-Pointing-Pointer High sensitivity. Black-Right-Pointing-Pointer Good candidate for environmental and health monitoring. - Abstract: Cobalt doped antimony oxide nano-particles (NPs) have been synthesized by hydrothermal process and structurally characterized by utilizing X-ray diffraction (XRD), field emission scanning electron microscopy (FE-SEM) and Fourier transforms infrared spectrophotometer (FT-IR) which revealed that the synthesized cobalt antimony oxides (CoSb{sub 2}O{sub 6}) are well crystalline nano-particles with an average particles size of 26 {+-} 10 nm. UV-visible absorption spectra ({approx}286 nm) were used to investigate the optical properties of CoSb{sub 2}O{sub 6}. The chemical sensing of CoSb{sub 2}O{sub 6} NPs have been primarily investigated by I-V technique, where dichloromethane is used as a model compound. The analytical performance of dichloromethane chemical sensor exhibits high sensitivity (1.2432 {mu}A cm{sup -2} mM{sup -1}) and a large linear dynamic range (1.0 {mu}M-0.01 M) in short response time (10 s). The photo catalytic activity of the synthesized CoSb{sub 2}O{sub 6} nano-particles was evaluated by degradation of acridine orange (AO), which degraded 58.37% in 200 min. These results indicate that CoSb{sub 2}O{sub 6} nano-particles can play an excellent research impact in the environmental field.

  5. Clinical and Parasitological Features of Patients with American Cutaneous Leishmaniasis that Did Not Respond to Treatment with Meglumine Antimoniate

    Science.gov (United States)

    Robayo, Marta L.; Lopez, Myriam C.; Daza, Carlos D.; Bedoya, Angela; Mariño, Maria L.; Saavedra, Carlos H.

    2016-01-01

    Background American cutaneous leishmaniasis (ACL) is a complicated disease producing about 67.000 new cases per year. The severity of the disease depends on the parasite species; however in the vast majority of cases species confirmation is not feasible. WHO suggestion for ACL produced by Leishmania braziliensis, as first line treatment, are pentavalent antimonial derivatives (Glucantime or Sodium Stibogluconate) under systemic administration. According to different authors, pentavalent antimonial derivatives as treatment for ACL show a healing rate of about 75% and reasons for treatment failure are not well known. Methods In order to characterise the clinical and parasitological features of patients with ACL that did not respond to Glucantime, a cross-sectional observational study was carried out in a cohort of 43 patients recruited in three of the Colombian Army National reference centers for complicated ACL. Clinical and paraclinical examination, and epidemiological and geographic information were recorded for each patient. Parasitological, histopathological and PCR infection confirmation were performed. Glucantime IC50 and in vitro infectivity for the isolated parasites were estimated. Results Predominant infecting Leishmania species corresponds to L. braziliensis (95.4%) and 35% of the parasites isolated showed a significant decrease in in vitro Glucanatime susceptibility associated with previous administration of the medicament. Lesion size and in vitro infectivity of the parasite are negatively correlated with decline in Glucantime susceptibility (Spearman: r = (-)0,548 and r = (-)0,726; respectively). Conclusion A negative correlation between lesion size and parasite resistance is documented. L. braziliensis was found as the main parasite species associated to lesion of patients that underwent treatment failure or relapse. The indication of a second round of treatment in therapeutic failure of ACL, produced by L. braziliensis, with pentavalent antimonial

  6. Characterization of circulating lymphocyte subpopulations in canine leishmaniasis throughout treatment with antimonials and allopurinol.

    Science.gov (United States)

    Miranda, Sonia; Martorell, Susanna; Costa, Manuela; Ferrer, Lluis; Ramis, Antonio

    2007-03-31

    Canine leishmaniasis (CL) is a systemic parasitic disease with a wide variability of response to specific therapy: the majority of patients apparently improve with treatment, some of them respond but later relapse, and few of them do not respond at all. It has been demonstrated that the immune response plays a key role in the development and outcome of Leishmania infection in the dog and in the response to the treatment, although this response is not well understood. Some authors have suggested that ill dogs show a reduction in the percentage of circulating CD4+ lymphocytes and in the CD4+/CD8+ ratio, both of which normalize after treatment and clinical recovery. The present paper discusses the variation of the different lymphocyte subpopulations (CD3, CD4, CD8, CD21) of peripheral blood mononuclear cells (PBMC) in 28 dogs diagnosed with CL and submitted to conventional treatment with meglumine antimoniate (Glucantime) for 1 month and with allopurinol (Zyloric) for 1 year, in order to evaluate the usefulness of these parameters as indicators of the immunological condition of the ill animals and of the prognosis of their evolution during the treatment. It is concluded that circulating lymphocyte subpopulations are similar in dogs with leishmaniasis and in healthy dogs and that there is no correlation between the clinical status or response to therapy and the values of the counts of the different lymphocyte subpopulations. Therefore, the percentage of different lymphocyte subpopulations cannot be used as a parameter to predict the evolution of an individual patient in a clinical context. PMID:17110042

  7. Radiation-induced reactions of antimony and tellurium compounds in sulfuric acid solutions

    International Nuclear Information System (INIS)

    In deaerated 0.4 M H2SO4 solutions containing both Sb(III) and Sb(V), Sb(III) was oxidized to Sb(V) and Sb(V) was reduced to Sb(III) by γ rays. The initial yield of reduction G/sub i/(Sb(V) → Sb(III)) increased linearly with the ratio [Sb(V)]0/[Sb(III)]0, that of oxidation G/sub i/(Sb(III) → Sb(V)) increased with increasing G/sub i/(Sb(V) → Sb(III)), and the overall yield of oxidation G/sub i/(Sb(V)) = G/sub i/(Sb(III) → Sb(V)) - G/sub i/(Sb(V) → Sb(III)) was constant and equivalent to the primary yield of hydrogen g/sub H2/ = 1/2(g/sub OH/ - g/sub H/) + g/sub H2O2/. A possible mechanism of γ-ray-induced reactions in deaerated solutions was proposed in which Sb(III) was reduced by H and oxidized by OH, Sb(II) was oxidized by H2O2, and Sb(IV), and the disproportionation of Sb(IV) to Sb(III) and Sb(V) followed. In the presence of Sb(V), reduction of Sb(V) by H gives the same stoichiometry. The results on Te(IV) and Te(VI) in 0.02 M H2SO4 solutions support a similar sequence to that of the antimony system, in which the unstable valence states Te(III) and Te(V) play an important part

  8. Semimetal-semiconductor transitions in bismuth-antimony films and nanowires induced by size quantization

    International Nuclear Information System (INIS)

    In this paper we present the experimental results of an investigation of the electrical transport, thermoelectrical properties, the Shubnikov de Haas oscillations of Bi1-xSbx films (0 < x < 0.04) grown by the vacuum thermal evaporation and nanowires prepared by a modified Ulitovsky - Teilor technique. The results of the X-ray diffraction indicate that the trigonal axes were perpendicular to the film plane and the single Bi-2at%Sb nanowires with the diameter 100-1000 nm were represented by single crystals in a glass capillary with (1011) orientation along the wire axis. The investigations of the Shubnikov de Haas oscillations on Bi-2at%Sb wires with d > 600 nm show that overlapping of L and T bands was twice smaller than that in pure Bi. The temperature dependences of thin semimetallic Bi-3at%Sb films and Bi-2at%Sb wires show a semiconducting behavior. The semimetal semiconductor transition induced by the quantum confinement effect is observed in semimetal Bi1-xSbx films and nanowires at the diameters up to five times greater than those in the pure Bi. That experimental fact, on the one hand, will allow observing the display quantum confinement effect at higher temperatures on nanowires of the same diameters, and, on the other hand, will allows separating effects connected with the surface state and the quantum size effects. In addition, the thermoelectric properties and thermoelectric efficiency of bismuth-antimony wires are considered and a possibility to use them in thermoelectric converters of energy is discussed. (authors)

  9. Contamination of bottled waters with antimony leaching from polyethylene terephthalate (PET) increases upon storage.

    Science.gov (United States)

    Shotyk, William; Krachler, Michael

    2007-03-01

    Antimony concentrations were determined in 132 brands of bottled water from 28 countries. Two of the brands were at or above the maximum allowable Sb concentration for drinking water in Japan (2 microg/L). Elevated concentrations of Sb in bottled waters are due mainly to the Sb2O3 used as the catalyst in the manufacture of polyethylene terephthalate (PET(E)). The leaching of Sb from PET(E) bottles shows variable reactivity. In 14 brands of bottled water from Canada, Sb concentrations increased on average 19% during 6 months storage at room temperature, but 48 brands of water from 11 European countries increased on average 90% under identical conditions. A mineral water from France in PET(E), purchased in Germany, yielded 725 ng/L when first tested, but 1510 ng/L when it was stored for 6 months at room temperature; the same brand of water, purchased in Hong Kong, yielded 1990 ng/L Sb. Pristine groundwater containing 1.7+/-0.4 ng/L Sb (n = 6) yielded 26.6+/-2.3 ng/L Sb (n = 3) after storage in PET(E) bottles from Canada for 6 months versus 281+/-38 ng/L Sb (n = 3) in PET(E) bottles from Germany. Tap water bottled commercially in PET(E) in December 2005 contained 450+/-56 ng/L Sb (n = 3) versus 70.3+/-0.3 ng/L Sb (n = 3) when sampled from a household faucet in the same village (Bammental, Germany), and 25.7+/-1.5 ng/L Sb (n = 3) from a local artesian flow. PMID:17396641

  10. EPR, optical absorption and luminescence studies of Cr3+-doped antimony phosphate glasses

    Science.gov (United States)

    De Vicente, F. S.; Santos, F. A.; Simões, B. S.; Dias, S. T.; Siu Li, M.

    2014-12-01

    Antimony phosphate glasses (SbPO) doped with 3 and 6 mol% of Cr3+ were studied by Electron Paramagnetic Resonance (EPR), UV-VIS optical absorption and luminescence spectroscopy. The EPR spectra of Cr3+-doped glasses showed two principal resonance signals with effective g values at g = 5.11 and g = 1.97. UV-VIS optical absorption spectra of SbPO:Cr3+ presented four characteristics bands at 457, 641, 675, and 705 nm related to the transitions from 4A2(F) to 4T1(F), 4T2(F), 2T1(G), and 2E(G), respectively, of Cr3+ ions in octahedral symmetry. Optical absorption spectra of SbPO:Cr3+ allowed evaluating the crystalline field Dq, Racah parameters (B and C) and Dq/B. The calculated value of Dq/B = 2.48 indicates that Cr3+ ions in SbPO glasses are in strong ligand field sites. The optical band gap for SbPO and SbPO:Cr3+ were evaluated from the UV optical absorption edges. Luminescence measurements of pure and Cr3+-doped glasses excited with 350 nm revealed weak emission bands from 400 to 600 nm due to the 3P1 → 1S0 electronic transition from Sb3+ ions. Cr3+-doped glasses excited with 415 nm presented Cr3+ characteristic luminescence spectra composed by two broad bands, one band centered at 645 nm (2E → 4A2) and another intense band from 700 to 850 nm (4T2 → 4A2).

  11. Metagenomic approach reveals variation of microbes with arsenic and antimony metabolism genes from highly contaminated soil.

    Directory of Open Access Journals (Sweden)

    Jinming Luo

    Full Text Available Microbes have great potential for arsenic (As and antimony (Sb bioremediation in heavily contaminated soil because they have the ability to biotransform As and Sb to species that have less toxicity or are more easily removed. In this study, we integrated a metagenomic method with physicochemical characterization to elucidate the composition of microbial community and functional genes (related to As and Sb in a high As (range from 34.11 to 821.23 mg kg-1 and Sb (range from 226.67 to 3923.07 mg kg-1 contaminated mine field. Metagenomic analysis revealed that microbes from 18 phyla were present in the 5 samples of soil contaminated with high As and Sb. Moreover, redundancy analysis (RDA of the relationship between the 18 phyla and the concentration of As and Sb demonstrated that 5 phyla of microbes, i.e. Actinobacteria, Firmicutes, Nitrospirae, Tenericutes and Gemmatimonadetes were positively correlated with As and Sb concentration. The distribution, diversity and abundance of functional genes (including arsC, arrA, aioA, arsB and ACR3 were much higher for the samples containing higher As and Sb concentrations. Based on correlation analysis, the results showed a positive relationship between arsC-like (R2 = 0.871 and aioA-like (R2 = 0.675 gene abundance and As concentration, and indicated that intracellular As(V reduction and As(III oxidation could be the dominant As detoxification mechanism enabling the microbes to survive in the environment. This study provides a direct and reliable reference on the diversity of microbial community and functional genes in an extremely high concentration As- and Sb-contaminated environment.

  12. Green and red fluorescence upconversion in neodymium-doped low phonon antimony glasses

    International Nuclear Information System (INIS)

    A new K2O-B2O3-Sb2O3 (KBS) glass system having low phonon energy (about 600 cm-1) doped with Nd3+ ions has been developed. Infrared reflection spectroscopic (IRRS) studies have been employed to establish its low phonon energy. Ultraviolet-visible-near infrared (UV-vis-NIR) absorption and photoluminescence upconversion properties with special emphasis on the spectrochemistry of the 15K2O-15B2O3-70Sb2O3 (mol%) glass have been studied doping with different concentrations (0.1-1.0 wt%) of Nd2O3. UV-vis-NIR absorption band positions have been justified with quantitative calculation of nephelauxetic parameter and covalent bonding characteristics of the host. NIR to visible upconversion has been investigated by exciting at 805 nm at room temperature. Two upconverted bands originating from the 4G7/2 → 4I9/2 and 4G7/2 → 4I13/2 transitions are found to be centered at 540 nm (green, medium) and 650 nm (red, strong), respectively. These bands have been explained from the evaluation of the absorption and excitation spectra. The upconversion processes have been explained by the excited state absorption (ESA), energy transfer (ET), cooperative energy transfer (CET) and cross-relaxation (CR) mechanisms involving population of the metastable (storage) energy level (4G7/2) by effects of multiphonon deexcitation and thermal population. It is evident from the IRRS study that the upconversion phenomena are expedited by the low multiphonon relaxation rate in antimony glasses owing to their low phonon energy (602 cm-1, the main and highest intensity Sb-O-Sb stretching band) which is very close to that of fluoride glasses (500-600 cm-1).

  13. Effect of external energy on atomic, crystalline and powder characteristics of antimony and bismuth powders

    Indian Academy of Sciences (India)

    Vikram V Dabhade; Rama Mohan R Tallapragada; Mahendra Kumar Trivedi

    2009-10-01

    Next to atoms and molecules the powders are the smallest state of matter available in high purities and large quantities. The effect of any external energy on the shape, morphology and structure can thus be studied with relative ease. The present investigation deals with the effect of a non-contact external energy on the powders of antimony and bismuth. The characteristics of powders treated by external energy are compared with the as received powders (control). The average particle sizes, 50 and 99, the sizes below which 99% of the particles are present showed significant increase and decrease indicating that the energy had caused deformation and fracture as if the powders have been subjected to high energy milling. To be able to understand the reasons for these changes the powders are characterized by techniques such as X-ray diffraction (XRD), surface area determination (BET), thermal analytical techniques such as DTA–DTG, DSC–TGA and SDTA and scanning electron microscopy (SEM). The treated powder samples exhibited remarkable changes in the powder characteristics at all structural levels starting from polycrystalline particles, through single crystal to atoms. The external energy had changed the lattice parameters of the unit cell which in turn changed the crystallite size and density. The lattice parameters are then used to compute the weight and effective nuclear charge of the atom which showed significant variation. It is speculated that the external energy is acting on the nucleus through some reversible weak interaction of larger cross section causing changes in the proton to neutron ratios. Thus the effect is felt by all the atoms, and hence the unit cell, single crystal grain and grain boundaries. The stresses generated in turn may have caused deformation or fracture of the weak interfaces such as the crystallite and grain boundaries.

  14. The influence of remelting on the properties of AlSi6Cu4 alloy modified by antimony

    Directory of Open Access Journals (Sweden)

    D. Medlen

    2012-01-01

    Full Text Available The paper deals with the problem of multiple remelting influence on AlSi6Cu4 alloy modified by antimony on chosen mechanical characteristics, microstructure and gas content. This foundry alloy is used mostly in automotive industry. Foundry Aluminum-Silicon alloys are also used in number of industrial weight sensitive applications because of their low weight and very good castability and good mechanical properties. Modifiers are usually added to molten aluminum-silicon alloys to refine the eutectic phase particle shape and improve the mechanical properties of the final cast products and Al-Si alloys cast properties.

  15. Flow analysis-hydride generation-gas phase derivative molecular absorption spectrophotometric determination of antimony in antileishmanial drugs

    Directory of Open Access Journals (Sweden)

    Máximo Gallignani

    2009-01-01

    Full Text Available In the present work, the development of a method based on the coupling of flow analysis (FA, hydride generation (HG, and derivative molecular absorption spectrophotometry (D-EAM in gas phase (GP, is described in order to determine total antimony in antileishmanial products. Second derivative order (D²224nm of the absorption spectrum (190 - 300 nm is utilized as measurement criterion. Each one of the parameters involved in the development of the proposed method was examined and optimized. The utilization of the EAM in GP as detection system in a continuous mode instead of atomic absorption spectrometry represents the great potential of the analytic proposal.

  16. Influence of antimony on the mechanical properties and gas content of alloy AlSi6Cu4

    OpenAIRE

    D. Medlen; D. Bolibruchova

    2011-01-01

    Aluminium alloys based on Al-Si are used in automotive and aerospace industries. AlSi6Cu4 alloy is used the complicated castings, whichmust comply high strength requirements. Strength characteristics can also be affected by the modifiers: Na, Sr, Sb. In the li terature ismentioned, that AlSi6Cu4 modified by sodium and strontium has negative effect - increases of the gas absorption. Modification of AlSi6Cu4 alloy by antimony, is still not mentioned in the literature. The article gives the effe...

  17. First-principle study of antimony doping effects on the iron-based superconductor CaFe(Sb$_{x}$As$_{1-x}$)$_{2}$

    OpenAIRE

    Nagai, Yuki; Nakamura, Hiroki; Machida, Masahiko; Kuroki, Kazuhiko

    2015-01-01

    We study antimony doping effects in the iron-based superconductor CaFe(Sb$_{x}$As$_{1-x}$)$_{2}$ by using the first-principle calculation. The calculations reveal that the substitution of the doped antimony atom into As of the chainlike As layers is more stable than that in FeAs layers. This prediction can be checked by experiments. Our results suggest that doping homologous elements into the chainlike As layers existing only in novel 112 system is responsible for rising up the critical tempe...

  18. 48 CFR 828.106-72 - Contract provision.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false Contract provision. 828... GENERAL CONTRACTING REQUIREMENTS BONDS AND INSURANCE Bonds and Other Financial Protections 828.106-72 Contract provision. Insert 852.228-72, Assisting Service-Disabled Veteran-Owned and Veteran-Owned...

  19. Dicty_cDB: CHL106 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CH (Link to library) CHL106 (Link to dictyBase) - G22947 DDB0231491 Contig-U11389-1 | Contig-U12 ... 2_1( EU826122 |pid:none) Chlamydomonas reinhardtii PAS ... doma... 56 2e-06 CR548612_184( CR548612 |pid:none) ...

  20. 24 CFR 1710.106 - Table of contents.

    Science.gov (United States)

    2010-04-01

    ... DEVELOPMENT (INTERSTATE LAND SALES REGISTRATION PROGRAM) LAND REGISTRATION Reporting Requirements § 1710.106..., the entry for Title and Land Use would appear as follows: Title and Land Use # Page # Method of Sale... Plat Maps, Zoning, Surveying, Permits and Environment (b) Use of “You” and “We”. At the end of...

  1. 11 CFR 106.4 - Allocation of polling expenses.

    Science.gov (United States)

    2010-01-01

    ... become a candidate, see 11 CFR 100.131(a). (b) The purchase of opinion poll results by a political... become a candidate, see 11 CFR 100.72(a). The poll results are accepted by a candidate or other political... ACTIVITIES § 106.4 Allocation of polling expenses. (a) The purchase of opinion poll results by a candidate...

  2. New limits on double beta decay of (106)Cd

    Czech Academy of Sciences Publication Activity Database

    Rukhadze, NI.; Bakalyarov, A.M.; Briancon, C.; Brudanin, V. B.; Cermak, P.; Egorov, V. G.; Klimenko, A. A.; Kovalík, Alojz; Lebedev, VI.; Mamedov, F.; Shitov, Yu. A.; Simkovič, F.; Stekl, I.; Timkin, VV.; Zhukov, S.V.

    2011-01-01

    Roč. 852, č. 1 (2011), s. 197-206. ISSN 0375-9474 R&D Projects: GA MŠk LC07050 Institutional research plan: CEZ:AV0Z10480505 Keywords : RADIOACTIVITY (106)Cd(2EC) * measured E(KX-ray) * I(KX-ray) Subject RIV: BN - Astronomy, Celestial Mechanics, Astrophysics Impact factor: 1.540, year: 2011

  3. The HORUS Cube spectrometer and multiphonon excitations in 106Cd

    International Nuclear Information System (INIS)

    In the context of this work a series of experiments on 106Cd were accomplished. An off-beam γ-γ-angular correlation experiment after β-decay from 106In was done with the β-slider technique at the new HORUS-cube-spectrometer at the Institut fuer Kernphysik der Universitaet zu Koeln. Two other in-beam γ-γ-angular correlation experiments, with the reactions 104Pd(α,2n)106Cd and 105Pd(3He,2n)106Cd were carried out at the HORUS-cube-spectrometer. Lifetime information belonging to dipole excitations were determined in two NRF-experiments, which were done at the Institut fuer Strahlenphysik der Universitaet Stuttgart, and the β-decay experiment. From this set of data we determined the 1--candidate of quadrupole-octupole coupled quintuplet. The powerful combination of these techniques offered an excellent possibility to identify fragments of the 1+ mixed-symmetric two-phonon excitation. The measurement of lifetimes, branching ratios and multipole mixing ratios with the inelastic neutron scattering technique (INS) at the University of Kentucky allowed the identification of the mixed-symmetric (weak fragmented) 2+1,ms state and the (3-) and 5(-) states of the quadrupole-octupole quintuplet. (orig.)

  4. Tank 241-AP-106 tank characterization plan: Revision 1

    International Nuclear Information System (INIS)

    Tank 241-AP-106 (AP-106) is a candidate feed tank which is expected to be processed at the 242-A Evaporator. Three issues related to the overall concern of the evaporator must be evaluated: compatibility of the candidate waste with respect to feed tank, slurry tank, and evaporator requirements; safety parameters of the candidate waste tank to avoid a facility condition which is outside the safety boundaries; and compliance of the waste as dictated by regulations from various government and environmental agencies. The characterization efforts of this Tank Characterization Plan are focused on the resolution of the issues above. To evaluate the potential for waste incompatibility with the feed tank, slurry tank, and evaporator, as well as relevant safety issues, analyses will be performed on the grab samples obtained from tank AP-106. These analyses are discussed in Section 4.0. Once the characterization of tank AP-106 has been performed, the waste compatibility and safety assessment shall be conducted. This effort is discussed elsewhere

  5. 5 CFR 9901.106 - Relationship to other provisions.

    Science.gov (United States)

    2010-01-01

    ... 5 Administrative Personnel 3 2010-01-01 2010-01-01 false Relationship to other provisions. 9901... NATIONAL SECURITY PERSONNEL SYSTEM (NSPS) General Provisions § 9901.106 Relationship to other provisions... Governmentwide regulations that reference provisions under chapters 43, 51, 53, and 55 (subchapter V only),...

  6. 33 CFR 106.415 - Amendment and audit.

    Science.gov (United States)

    2010-07-01

    ... Security Plan (FSP) § 106.415 Amendment and audit. (a) Amendments. (1) Amendments to a Facility Security... duties; and (iii) Be independent of any security measures being audited. (5) If the results of an audit... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Amendment and audit....

  7. 48 CFR 949.106 - Fraud or other criminal conduct.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false Fraud or other criminal... MANAGEMENT TERMINATION OF CONTRACTS General Principles 949.106 Fraud or other criminal conduct. Any evidence of fraud or other criminal conduct in connection with the settlement of a contract termination...

  8. 48 CFR 849.106 - Fraud or other criminal conduct.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false Fraud or other criminal... CONTRACT MANAGEMENT TERMINATION OF CONTRACTS General Principles 849.106 Fraud or other criminal conduct. (a) If the contracting officer suspects fraud or other criminal conduct related to the settlement of...

  9. 48 CFR 649.106 - Fraud or other criminal conduct.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 4 2010-10-01 2010-10-01 false Fraud or other criminal... MANAGEMENT TERMINATION OF CONTRACTS General Principles. 649.106 Fraud or other criminal conduct. If the Termination Contracting Officer (TCO) suspects fraud or other criminal conduct related to the settlement of...

  10. 48 CFR 49.106 - Fraud or other criminal conduct.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 1 2010-10-01 2010-10-01 false Fraud or other criminal... CONTRACT MANAGEMENT TERMINATION OF CONTRACTS General Principles 49.106 Fraud or other criminal conduct. If the TCO suspects fraud or other criminal conduct related to the settlement of a terminated...

  11. 48 CFR 1449.106 - Fraud or other criminal conduct.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false Fraud or other criminal... CONTRACT MANAGEMENT TERMINATION OF CONTRACTS General Principles 1449.106 Fraud or other criminal conduct. When fraud or other criminal conduct is suspected, the CO will submit a report documenting the...

  12. 48 CFR 449.106 - Fraud or other criminal conduct.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 4 2010-10-01 2010-10-01 false Fraud or other criminal... MANAGEMENT TERMINATION OF CONTRACTS General Principles 449.106 Fraud or other criminal conduct. (a) If the contracting officer suspects fraud or other criminal conduct a written report documenting the facts shall...

  13. 48 CFR 1349.106 - Fraud or other criminal conduct.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false Fraud or other criminal... MANAGEMENT TERMINATION OF CONTRACTS General Principles 1349.106 Fraud or other criminal conduct. If the terminating contracting officer (TCO) suspects fraud or other criminal conduct related to the settlement of...

  14. Project W-320, 241-C-106 sluicing, master calculation list

    International Nuclear Information System (INIS)

    This supporting document has been prepared to make the Master Calculation List readily retrievable. The list gives the status of the calculation (as-built, not used, applied, etc.), the calculation title, its originator, comments, and report number under which it was issued. Tank 241-C-106 has been included on the High Heat Load Watch List

  15. Exploring the origin of degenerate doublet bands in $^{106}$Ag

    CERN Document Server

    Rather, N; Chattopadhyay, S; Roy, S; Rajbanshi, S; Gowsami, A; Bhat, G H; Sheikh, J A; Palit, R; Pal, S; Saha, S; Sethi, J; Biswas, S; Singh, P; Jain, H C

    2013-01-01

    The electromagnetic transition probabilities of the excited levels for the two nearly degenerate bands of $^{106}$Ag have been measured using the Doppler Shift Attenuation Method. A comparison with the calculated values using triaxial projected shell model approach indicates that these bands originate from two different quasi-particle configurations but constructed from the same mean-field deformation.

  16. 7 CFR 762.106 - Preferred and certified lender programs.

    Science.gov (United States)

    2010-01-01

    ... local area, drop in local land values, industries moving into or out of an area, loss of access to a..., DEPARTMENT OF AGRICULTURE SPECIAL PROGRAMS GUARANTEED FARM LOANS § 762.106 Preferred and certified lender... guaranteed loans by showing that the lender: (i) Submitted substantially complete and correct guaranteed...

  17. 33 CFR 157.106 - Letter of acceptance.

    Science.gov (United States)

    2010-07-01

    ...) POLLUTION RULES FOR THE PROTECTION OF THE MARINE ENVIRONMENT RELATING TO TANK VESSELS CARRYING OIL IN BULK Crude Oil Washing (COW) System on Tank Vessels General § 157.106 Letter of acceptance. The Coast Guard...) The plans submitted show that the COW system meets this subpart; or (b) The plans submitted and...

  18. Project W-320, 241-C-106 sluicing supporting documentation bibliography

    International Nuclear Information System (INIS)

    This supporting document has been prepared to make the listing of documentation used to develop, or in support of Project W-320, readily retrievable. All documents are sorted by document number and list the document type. Tank 241-C-106 has been included on the High Heat Load Watch List

  19. 48 CFR 32.106 - Order of preference.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 1 2010-10-01 2010-10-01 false Order of preference. 32... CONTRACTING REQUIREMENTS CONTRACT FINANCING Non-Commercial Item Purchase Financing 32.106 Order of preference. The contracting officer must consider the following order of preference when a contractor...

  20. Observatory wins GBP 10.6m contract

    CERN Multimedia

    Dalton, A W

    2003-01-01

    Funding has been secured for a revolutionary GBP 10.6 million telescope camera, SCUBA 2, to be built in Edinburgh. The instrument will be able to track much larger areas of sky more quickly and will replace the original Sub-millimetre Common User Bolometer Array camera which was also built in Edinburgh (1/2 page).

  1. 27 CFR 26.106 - Marking containers of beer.

    Science.gov (United States)

    2010-04-01

    ... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false Marking containers of beer... Liquors and Articles in Puerto Rico Beer § 26.106 Marking containers of beer. Containers of beer of Puerto... brewer; the serial number, capacity, and size of the container; the kind of beer; and the serial...

  2. 40 CFR 180.106 - Diuron; tolerances for residues.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 23 2010-07-01 2010-07-01 false Diuron; tolerances for residues. 180... PROGRAMS TOLERANCES AND EXEMPTIONS FOR PESTICIDE CHEMICAL RESIDUES IN FOOD Specific Tolerances § 180.106 Diuron; tolerances for residues. (a) General. Tolerances are established for the combined residues of...

  3. Assessment of ocular beta radiation dose distribution due to 106Ru/106Rh brachytherapy applicators using MCNPX Monte Carlo code

    Directory of Open Access Journals (Sweden)

    Nilseia Aparecida Barbosa

    2014-08-01

    Full Text Available Purpose: Melanoma at the choroid region is the most common primary cancer that affects the eye in adult patients. Concave ophthalmic applicators with 106Ru/106Rh beta sources are the more used for treatment of these eye lesions, mainly lesions with small and medium dimensions. The available treatment planning system for 106Ru applicators is based on dose distributions on a homogeneous water sphere eye model, resulting in a lack of data in the literature of dose distributions in the eye radiosensitive structures, information that may be crucial to improve the treatment planning process, aiming the maintenance of visual acuity. Methods: The Monte Carlo code MCNPX was used to calculate the dose distribution in a complete mathematical model of the human eye containing a choroid melanoma; considering the eye actual dimensions and its various component structures, due to an ophthalmic brachytherapy treatment, using 106Ru/106Rh beta-ray sources. Two possibilities were analyzed; a simple water eye and a heterogeneous eye considering all its structures. Two concave applicators, CCA and CCB manufactured by BEBIG and a complete mathematical model of the human eye were modeled using the MCNPX code. Results and Conclusion: For both eye models, namely water model and heterogeneous model, mean dose values simulated for the same eye regions are, in general, very similar, excepting for regions very distant from the applicator, where mean dose values are very low, uncertainties are higher and relative differences may reach 20.4%. For the tumor base and the eye structures closest to the applicator, such as sclera, choroid and retina, the maximum difference observed was 4%, presenting the heterogeneous model higher mean dose values. For the other eye regions, the higher doses were obtained when the homogeneous water eye model is taken into consideration. Mean dose distributions determined for the homogeneous water eye model are similar to those obtained for the

  4. Determination of Antimony (III in Real Samples by Anodic Stripping Voltammetry Using a Mercury Film Screen-Printed Electrode

    Directory of Open Access Journals (Sweden)

    Olga Domínguez-Renedo

    2009-01-01

    Full Text Available This paper describes a procedure for the determination of antimony (III by differential pulse anodic stripping voltammetry using a mercury film screen-printed electrode as the working electrode. The procedure has been optimized using experimental design methodology. Under these conditions, in terms of Residual Standard Deviation (RSD, the repeatability (3.81 % and the reproducibility (5.07 % of the constructed electrodes were both analyzed. The detection limit for Sb (III was calculated at a value of 1.27×10–8 M. The linear range obtained was between 0.99 × 10–8 – 8.26 × 10–8 M. An analysis of possible effects due to the presence of foreign ions in the solution was performed and the procedure was successfully applied to the determination of antimony levels in pharmaceutical preparations and sea water samples.

  5. Nutritional status in patients with cutaneous leishmaniasis and a study of the effects of zinc supplementation together with antimony treatment

    Directory of Open Access Journals (Sweden)

    Miguel Guzman-Rivero

    2014-11-01

    Full Text Available Background: The role of micronutrient status for the incidence and clinical course of cutaneous leishmaniasis is not much studied. Still zinc supplementation in leishmaniasis has shown some effect on the clinical recovery, but the evidence in humans is limited. Objective: To compare biochemical nutritional status in cutaneous leishmaniasis patients with that in controls and to study the effects of zinc supplementation for 60 days. Design: Twenty-nine patients with cutaneous leishmaniasis were treated with antimony for 20 days. Fourteen of them got 45 mg zinc daily and 15 of them got placebo. Biomarkers of nutritional and inflammatory status and changes in size and characteristics of skin lesions were measured. Results: The level of transferrin receptor was higher in patients than in controls but otherwise no differences in nutritional status were found between patients and controls. No significant effects of zinc supplementation on the clinical recovery were observed as assessed by lesion area reduction and characteristics or on biochemical parameters. Conclusions: It is concluded that nutritional status was essentially unaffected in cutaneous leishmaniasis and that oral zinc supplementation administered together with intramuscular injection of antimony had no additional clinical benefit.

  6. Treatment of air pollution control residues with iron rich waste sulfuric acid: does it work for antimony (Sb)?

    Science.gov (United States)

    Okkenhaug, Gudny; Breedveld, Gijs D; Kirkeng, Terje; Lægreid, Marit; Mæhlum, Trond; Mulder, Jan

    2013-03-15

    Antimony (Sb) in air pollution control (APC) residues from municipal solid waste incineration has gained increased focus due to strict Sb leaching limits set by the EU landfill directive. Here we study the chemical speciation and solubility of Sb at the APC treatment facility NOAH Langøya (Norway), where iron (Fe)-rich sulfuric acid (∼3.6M, 2.3% Fe(II)), a waste product from the industrial extraction of ilmenite, is used for neutralization. Antimony in water extracts of untreated APC residues occurred exclusively as pentavalent antimonate, even at low pH and Eh values. The Sb solubility increased substantially at pHettringite (at alkaline pH) or calcium (Ca)-antimonate. Treated APC residues, stored anoxically in the laboratory, simulating the conditions at the NOAH Langøya landfill, gave rise to decreasing concentrations of Sb in porewater, occurring exclusively as Sb(V). Concentrations of Sb decreased from 87-918μgL(-1) (day 3) to 18-69μgL(-1) (day 600). We hypothesize that an initial sorption of Sb to Fe(II)-Fe(III) hydroxides (green rust) and eventually precipitation of Ca- and Fe-antimonates (tripuhyite; FeSbO4) occurred. We conclude that Fe-rich, sulfuric acid waste is efficient to immobilize Sb in APC residues from waste incineration. PMID:23465722

  7. Complement activation-related pseudoallergy in dogs following intravenous administration of a liposomal formulation of meglumine antimoniate

    Directory of Open Access Journals (Sweden)

    Raul R. Ribeiro

    2013-08-01

    Full Text Available The increasing use of nanotechnologies in advanced therapies has allowed the observation of specific adverse reactions related to nanostructures. The toxicity of a novel liposome formulation of meglumine antimoniate in dogs with visceral leishmaniasis after single dose has been investigated. Groups of 12 animals received by the intravenous route a single dose of liposomal meglumine antimoniate (group I [GI], 6.5 mg Sb/kg, empty liposomes (GII or isotonic saline (GIII. Evaluation of hematological and biochemical parameters showed no significant changes 4 days after administration. No undesired effects were registered in the GIII. However, adverse reactions were observed in 67.7% of dogs from both groups that received liposomal formulations. The side effects began moments after bolus administration and disappeared during the first 15 minutes after treatment. Prostation, sialorrhea and defecation were the most frequent clinical signs, registered in 33.3% and 41.6 % of animals from the groups GI and GII, respectively. Tachypnea, mydriasis, miosis, vomiting and cyanosis were also registered in both groups. The adverse reactions observed in this study were attributed to the activation of the complement system by lipid vesicles in a phenomenon known as Complement Activation-Related Pseudoallergy (CARPA. The influence of the physical-chemical characteristics of liposomal formulation in the triggering of CARPA is discussed.

  8. Detection of pathogenic bacteria in skin lesions of patients with chiclero's ulcer: reluctant response to antimonial treatment

    Directory of Open Access Journals (Sweden)

    Isaac-Márquez Angélica Patricia

    2003-01-01

    Full Text Available We investigated the bacterial flora present in skin lesions of patients with chiclero's ulcer from the Yucatan peninsula of Mexico using conventional culture methods (11 patients, and an immunocolorimetric detection of pathogenic Streptococcus pyogenes (15 patients. Prevalence of bacteria isolated by culture methods was 90.9% (10/11. We cultured, from chiclero's ulcers (60%, pathogenic bacterial such as Staphylococcus aureus (20%, S. pyogenes (1.6%, Pseudomonas aeruginosa (1.6%, Morganella morganii (1.6%, and opportunist pathogenic bacteria such as Klebsiella spp. (20.0%, Enterobacter spp. (20%, and Enterococcus spp. (20%. We also cultured coagulase-negative staphylococci in 40% (4/10 of the remaining patients. Micrococcus spp. and coagulase-negative staphylococci constituted the bacterial genuses more frequently isolated in the normal skin of patients with chiclero's ulcer and healthy individuals used as controls. We also undertook another study to find out the presence of S. pyogenes by an immunocolorimetric assay. This study indicated that 60% (9/15 of the ulcerated lesions, but not normal controls, were contaminated with S. pyogenes. Importantly, individuals with purulent secretion and holding concomitant infections with S. pyogenes, S. aureus, P. aeruginosa, M. morganii, and E. durans took longer to heal Leishmania (L. mexicana infections treated with antimonial drugs. Our results suggest the need to eliminate bacterial purulent infections, by antibiotic treatment, before starting antimonial administration to patients with chiclero's ulcer.

  9. Effect of germanium pre-amorphization on solid-phase epitaxial regrowth of antimony and arsenic ion-implanted silicon

    International Nuclear Information System (INIS)

    Shallow, low-resistive n+/p junction was investigated for sub 100-nm metal-oxide-semiconductor field-effect transistors (MOSFETs) using antimony and arsenic ion-implantation and low-temperature rapid thermal annealing-increased gate leakage current due to high-permittivity gate dielectric crystallization during high-temperature source and drain dopant activation imposes low temperature annealing for next generation devices. In contrast to arsenic implanted junctions, Sb-doped specimens showed shallower junction depth, lower sheet resistance and leakage current at low temperature processing (600 deg. C). In addition, Ge pre-amorphization prior to As-implant was used to fully amorphize Si for ideal solid-phase epitaxial regrowth. Pre-amorphized As-doped samples did not result in highly activated junctions at low temperature. Pre-amorphized Sb-doped junctions did not regrow in acceptable annealing time. The results indicated the superiority of antimony to arsenic as a dopant for ultra-shallow and low-resistive source and drain extensions. Arsenic will not be a proper candidate because of higher sheet resistance as a consequence of presence of inactive As-vacancy clusters and higher leakage current for devices that should be fabricated at low temperature with implementing of high-κ dielectric metal-electrode gate stack in next generation MOSFETs

  10. Dicty_cDB: CHG106 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available m clone RP13-315I1. 44 3.9 1 BQ042127 |BQ042127.1 C2F49 Diethylnitrosamine Treated Medaka Oryzias latipes cDNA clone C2F49 simi...e-18 BC109318_1( BC109318 |pid:none) Homo sapiens ATPase, aminophosphol... 95 3e-18 AK295616_1( AK295616 |pid:none) Homo sa... Score E Sequences producing significant alignments: (bits) Value AE013599_1784( AE013599 |pid:none) Drosophila melanogaster chro...CH (Link to library) CHG106 (Link to dictyBase) - - - Contig-U16291-1 CHG106P (Link to Original sit...k to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16291-1 Original site

  11. Responses of different dosemeters in beta dosimetry of {sup 106}Ru/{sup 106}Rh ophthalmic applicators;Respostas de diferentes dosimetros termoluminescentes na dosimetria beta de aplicadores oftalmicos de {sup 106}Ru/{sup 106}Rh

    Energy Technology Data Exchange (ETDEWEB)

    Ferreira, D.F.P.; Daros, K.A.C.; Segreto, R.A.; Medeiros, R.B. [Universidade Federal de Sao Paulo (UNIFESP), Sao Paulo, SP (Brazil)

    2009-07-01

    This work presents the TL response of three kinds of dosimeters from different manufacturing characteristics under irradiation of 106 Ru / 106 Rh sealed sources used in ophthalmic brachytherapy. They are: Ca SO{sub 4}:Dy + teflon (D- Ca SO{sub 4}:Dy -0,4), LiF:Mg, Ti (TLD-100) and Ca SO{sub 4}:Dy (TLD-900). Some of reports accepted by scientific community (NCS report 14 e ICRU report 72) as reference in the quality control of beta applicators dosimetry recommend that the absorbed dose standard uncertainties can be kept below 20%. The TLD Ca SO{sub 4}:Dy + teflon presented proper sensibility and high precision comparing with the others. Considering the similar dimensions of ophthalmic tumors and aside critical structures it is relevant to reduce undesirable effects due to the irradiation of these structures. Therefore, the quality control in the beta dosimetry using this kind of source is a constant challenge. (author)

  12. The presence and leachability of antimony in different wastes and waste handling facilities in Norway.

    Science.gov (United States)

    Okkenhaug, G; Almås, Å R; Morin, N; Hale, S E; Arp, H P H

    2015-11-01

    The environmental behaviour of antimony (Sb) is gathering attention due to its increasingly extensive use in various products, particularly in plastics. Because of this it may be expected that plastic waste is an emission source for Sb in the environment. This study presents a comprehensive field investigation of Sb concentrations in diverse types of waste from waste handling facilities in Norway. The wastes included waste electrical and electronic equipment (WEEE), glass, vehicle fluff, combustibles, bottom ash, fly ash and digested sludge. The highest solid Sb concentrations were found in WEEE and vehicle plastic (from 1238 to 1715 mg kg(-1)) and vehicle fluff (from 34 to 4565 mg kg(-1)). The type of acid used to digest the diverse solid waste materials was also tested. It was found that HNO3:HCl extraction gave substantially lower, non-quantitative yields compared to HNO3:HF. The highest water-leachable concentration for wastes when mixed with water at a 1 : 10 ratio were observed for plastic (from 0.6 to 2.0 mg kg(-1)) and bottom ash (from 0.4 to 0.8 mg kg(-1)). For all of the considered waste fractions, Sb(v) was the dominant species in the leachates, even though Sb(iii) as Sb2O3 is mainly used in plastics and other products, indicating rapid oxidation in water. This study also presents for the first time a comparison of Sb concentrations in leachate at waste handling facilities using both active grab samples and DGT passive samples. Grab samples target the total suspended Sb, whereas DGT targets the sum of free- and other chemically labile species. The grab sample concentrations (from 0.5 to 50 μg L(-1)) were lower than the predicted no-effect concentration (PNEC) of 113 μg L(-1). The DGT concentrations were substantially lower (from 0.05 to 9.93 μg L(-1)) than the grab samples, indicating much of the Sb is present in a non-available colloidal form. In addition, air samples were taken from the chimney and areas within combustible waste incinerators, as

  13. Correlation models between environmental factors and bacterial resistance to antimony and copper.

    Directory of Open Access Journals (Sweden)

    Zunji Shi

    Full Text Available Antimony (Sb and copper (Cu are toxic heavy metals that are associated with a wide variety of minerals. Sb(III-oxidizing bacteria that convert the toxic Sb(III to the less toxic Sb(V are potentially useful for environmental Sb bioremediation. A total of 125 culturable Sb(III/Cu(II-resistant bacteria from 11 different types of mining soils were isolated. Four strains identified as Arthrobacter, Acinetobacter and Janibacter exhibited notably high minimum inhibitory concentrations (MICs for Sb(III (>10 mM,making them the most highly Sb(III-resistant bacteria to date. Thirty-six strains were able to oxidize Sb(III, including Pseudomonas-, Comamonas-, Acinetobacter-, Sphingopyxis-, Paracoccus- Aminobacter-, Arthrobacter-, Bacillus-, Janibacter- and Variovorax-like isolates. Canonical correspondence analysis (CCA revealed that the soil concentrations of Sb and Cu were the most obvious environmental factors affecting the culturable bacterial population structures. Stepwise linear regression was used to create two predictive models for the correlation between soil characteristics and the bacterial Sb(III or Cu(II resistance. The concentrations of Sb and Cu in the soil was the significant factors affecting the bacterial Sb(III resistance, whereas the concentrations of S and P in the soil greatly affected the bacterial Cu(II resistance. The two stepwise linear regression models that we derived are as follows: MIC(Sb(III=606.605+0.14533 x C(Sb+0.4128 x C(Cu and MIC((Cu(II=58.3844+0.02119 x C(S+0.00199 x CP [where the MIC(Sb(III and MIC(Cu(II represent the average bacterial MIC for the metal of each soil (μM, and the C(Sb, C(Cu, C(S and C(P represent concentrations for Sb, Cu, S and P (mg/kg in soil, respectively, p<0.01]. The stepwise linear regression models we developed suggest that metals as well as other soil physicochemical parameters can contribute to bacterial resistance to metals.

  14. Growth, photosynthesis, and defense mechanism of antimony (Sb)-contaminated Boehmeria nivea L.

    Science.gov (United States)

    Chai, Li-Yuan; Mubarak, Hussani; Yang, Zhi-Hui; Yong, Wang; Tang, Chong-Jian; Mirza, Nosheen

    2016-04-01

    Ramie (Boehmeria nivea L.) is the oldest cash fiber crop in China and is widely grown in antimony (Sb) mining areas. To evaluate the extent of Sb resistance and tolerance, the growth, tolerance index (TI), Sb content in plant parts and in Hoagland solution, bioaccumulation factor (BF), photosynthesis, and physiological changes in Sb-contaminated B. nivea (20, 40, 80, and 200 mg L(-1) Sb) grown hydroponically were investigated. The Sb tolerance and resistance of ramie were clearly revealed by growth inhibition, a TI between 13 and 99 %, non-significant changes in the maximum quantum efficiency of photosystem (F v /F m ), energy-harvesting efficiency (photosystem II (PSII)) and single-photon avalanche diode (SPAD) value, a significant increase in Sb in plant parts, BF >1, and an increase in catalase (CAT) and malondialdehyde (MDA) at 200 mg L(-1) Sb. Under increasing Sb stress, nearly the same non-significant decline in the maximum quantum efficiency of photosystem (F v /F m ), energy-harvesting efficiency (PSII), relative quantum yield of photosystem II (φPSII), and photochemical quenching (qP), except for F v /F m at 20 mg L(-1) Sb, were recorded. SPAD values for chlorophyll under Sb stress showed an increasing trend, except for a slight decrease, i.e., continuous increase in MDA, superoxide dismutase (SOD), peroxidase (POD), and CAT activities were suppressed under Sb addition up to 40 mg L(-1) Sb and the addition of Sb enhanced enzyme production at 80 and 200 mg L(-1) Sb. A continuous decrease in SOD, POD, and CAT up to 40 mg L(-1) Sb and enhancements at ≥80 mg L(-1), along with the continuous enhancement of MDA activity and inhibited biomass production, clearly reveal the roles of these enzymes in detoxifying Sb stress and the defense mechanism of ramie at 80 mg L(-1) Sb. Thus, B. nivea constitutes a promising candidate for Sb phytoremediation at mining sites. PMID:26711292

  15. Green and red fluorescence upconversion in neodymium-doped low phonon antimony glasses

    Energy Technology Data Exchange (ETDEWEB)

    Som, Tirtha [Glass Technology Laboratory, Central Glass and Ceramic Research Institute (Council of Scientific and Industrial Research), 196 Raja S.C. Mullick Road, Kolkata 700032 (India); Karmakar, Basudeb [Glass Technology Laboratory, Central Glass and Ceramic Research Institute (Council of Scientific and Industrial Research), 196 Raja S.C. Mullick Road, Kolkata 700032 (India)], E-mail: basudebk@cgcri.res.in

    2009-05-12

    A new K{sub 2}O-B{sub 2}O{sub 3}-Sb{sub 2}O{sub 3} (KBS) glass system having low phonon energy (about 600 cm{sup -1}) doped with Nd{sup 3+} ions has been developed. Infrared reflection spectroscopic (IRRS) studies have been employed to establish its low phonon energy. Ultraviolet-visible-near infrared (UV-vis-NIR) absorption and photoluminescence upconversion properties with special emphasis on the spectrochemistry of the 15K{sub 2}O-15B{sub 2}O{sub 3}-70Sb{sub 2}O{sub 3} (mol%) glass have been studied doping with different concentrations (0.1-1.0 wt%) of Nd{sub 2}O{sub 3}. UV-vis-NIR absorption band positions have been justified with quantitative calculation of nephelauxetic parameter and covalent bonding characteristics of the host. NIR to visible upconversion has been investigated by exciting at 805 nm at room temperature. Two upconverted bands originating from the {sup 4}G{sub 7/2} {yields} {sup 4}I{sub 9/2} and {sup 4}G{sub 7/2} {yields} {sup 4}I{sub 13/2} transitions are found to be centered at 540 nm (green, medium) and 650 nm (red, strong), respectively. These bands have been explained from the evaluation of the absorption and excitation spectra. The upconversion processes have been explained by the excited state absorption (ESA), energy transfer (ET), cooperative energy transfer (CET) and cross-relaxation (CR) mechanisms involving population of the metastable (storage) energy level ({sup 4}G{sub 7/2}) by effects of multiphonon deexcitation and thermal population. It is evident from the IRRS study that the upconversion phenomena are expedited by the low multiphonon relaxation rate in antimony glasses owing to their low phonon energy (602 cm{sup -1}, the main and highest intensity Sb-O-Sb stretching band) which is very close to that of fluoride glasses (500-600 cm{sup -1})

  16. Novel organo-colloidal synthesis, optical properties, and structural analysis of antimony sesquioxide nanoparticles

    Energy Technology Data Exchange (ETDEWEB)

    Validzic, Ivana Lj., E-mail: validzic@vinca.rs; Abazovic, Nadica D.; Mitric, Miodrag [University of Belgrade, ' Vinca' Institute of Nuclear Sciences (Serbia); Lalic, Milan V. [Universidade Federal de Sergipe, Departamento de Fisica (Brazil); Popovic, Zoran S. [University of Belgrade, ' Vinca' Institute of Nuclear Sciences (Serbia); Vukajlovic, Filip R. [' Vinca' Institute of Nuclear Sciences (Serbia)

    2013-01-15

    We report the novel colloidal syntheses in organic media of antimony sesquioxide ( Sb{sub 2}O{sub 3} ) spherical nanoparticles (30-250 nm) and octahedron micro- and nanocrystals (100nm - 4{mu}) depending on the synthetic method conditions. It is observed that small differences in the synthetic procedure cause large differences in the very changeable morphology. The structure of Sb{sub 2}O{sub 3} powders was refined down to the R-factors of 9.57, 7.44, 9.19, 9.78, and 8.30 %. The refinement showed that Sb{sub 2}O{sub 3} powder belongs to the cubic crystal type with space group Fd 3-bar m (No. 227). The values of estimated standard deviations, as well as reliability factors, confirmed that the structure of Sb{sub 2}O{sub 3} was well refined. Ultraviolet and visible (UV-Vis) absorption spectroscopy and diffuse reflectance measurements (DRS) reveal that the optical band gap energies found for the Sb{sub 2}O{sub 3} octahedrons and nanoparticles, micro- and nanocrystals, respectively, are quite independent of the synthetic method conditions and synthesized morphology and is found to be between 4.1-4.4 eV. No peaks in both photoluminescence (PL) emission and excitation spectra have been observed for a broad spectral range, typical for this material. In order to discriminate between conflicting experimental results concerning the band gap energy of this compound, we investigated theoretically the electronic structure and optical properties of one of the cubic sesquioxide Sb{sub 2}O{sub 3} samples synthesized here. This has been done on the basis of density functional theory (DFT) with the generalized gradient approximation (GGA) and improved version of exchange potential suggested recently by Tran and Blaha (TB-mBJ). The main characteristic of the calculated TB-mBJ electronic structure is the significant improvement of the band gap value, which is in perfect agreement with our experimental measurements. The real and imaginary parts of the dielectric tensor are also

  17. Dicty_cDB: SSJ106 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available iiiiynk*ink*nknkkygs**tncikkshrkwytnfggf* renf*ifn*rikk*rssskirdsftrpiyersydnt*iiypti*nw*tncwicyw*syks rlsik...s carnosus subsp. ... 202 3e-50 CP001022_791( CP001022 |pid:none) Exiguobacterium sibiricum 255-15... 201 4e...vfsr*lhygsftmai*ihlqfkqsick*nrynisaigiiplsfgygrinslsrsq rdrrt--- ---gnpiggisyw*gskrqaqhprysrwvdsimgsfphgqsgf...hlqlqtvpyanktdtti sahwnhslssfgygrinslsrsqrdrrtktr*thgnqrcsrcsrsigrsnw*nqrlqscr yrrfrredkihrr*ir...iginal site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/SS/SSJ1-A/SSJ106Q.Seq.d/ R

  18. Real-world emission factors for antimony and other brake wear related trace elements: size-segregated values for light and heavy duty vehicles.

    Science.gov (United States)

    Bukowiecki, Nicolas; Lienemann, Peter; Hill, Matthias; Figi, Renato; Richard, Agnes; Furger, Markus; Rickers, Karen; Falkenberg, Gerald; Zhao, Yongjing; Cliff, Steven S; Prevot, Andre S H; Baltensperger, Urs; Buchmann, Brigitte; Gehrig, Robert

    2009-11-01

    Hourly trace element measurements were performed in an urban street canyon and next to an interurban freeway in Switzerland during more than one month each, deploying a rotating drum impactor (RDI) and subsequent sample analysis by synchrotron radiation X-ray fluorescence spectrometry (SR-XRF). Antimony and other brake wear associated elements were detected in three particle size ranges (2.5-10, 1-2.5, and 0.1-1 microm). The hourly measurements revealed that the effect of resuspended road dust has to be taken into account for the calculation of vehicle emission factors. Individual values for light and heavy duty vehicles were obtained for stop-and-go traffic in the urban street canyon. Mass based brake wear emissions were predominantly found in the coarse particle fraction. For antimony, determined emission factors were 11 +/- 7 and 86 +/- 42 microg km(-1) vehicle(-1) for light and heavy duty vehicles, respectively. Antimony emissions along the interurban freeway with free-flowing traffic were significantly lower. Relative patterns for brake wear related elements were very similar for both considered locations. Beside vehicle type specific brake wear emissions, road dust resuspension was found to be a dominant contributor of antimony in the street canyon. PMID:19924925

  19. Lysosome size, motility and stress response regulated by fronto-temporal dementia modifier TMEM106B.

    Science.gov (United States)

    Stagi, Massimiliano; Klein, Zoe A; Gould, Travis J; Bewersdorf, Joerg; Strittmatter, Stephen M

    2014-07-01

    Fronto-temporal lobar degeneration with TDP-43 (FTLD-TDP) is a fatal neurodegeneration. TMEM106B variants are linked to FTLD-TDP risk, and TMEM106B is lysosomal. Here, we focus on neuronal TMEM106B, and demonstrate co-localization and traffic with lysosomal LAMP-1. pH-sensitive reporters demonstrate that the TMEM106B C-terminus is lumenal. The TMEM106B N-terminus interacts with endosomal adaptors and other TMEM106 proteins. TMEM106B knockdown reduces neuronal lysosomal number and diameter by STED microscopy, and overexpression enlarges LAMP-positive structures. Reduction of TMEM106B increases axonally transported lysosomes, while TMEM106B elevation inhibits transport and yields large lysosomes in the soma. TMEM106B overexpression alters lysosomal stress signaling, causing a translocation of the mTOR-sensitive transcription factor, TFEB, to neuronal nuclei. TMEM106B loss-of-function delays TFEB translocation after Torin-1-induced stress. Enlarged TMEM106B-overexpressing lysosomes maintain organelle integrity longer after lysosomal photodamage than do control lysosomes, while small TMEM106B-knockdown lysosomes are more sensitive to illumination. Thus, neuronal TMEM106B plays a central role in regulating lysosomal size, motility and responsiveness to stress, highlighting the possible role of lysosomal biology in FTLD-TDP. PMID:25066864

  20. Synthesis and Properties of Light-tolerant Organic Antimony%耐光型有机锑的合成及其性能研究

    Institute of Scientific and Technical Information of China (English)

    高勇; 韩永和; 李建丰; 袁余斌; 王爱红

    2014-01-01

    硫醇锑稳定剂由于其耐紫外光性能很差,在存储、运输和使用方面受到很大的限制。为解决这一问题,试探性以三氯化锑和巯基酯为原料,引入抗紫外线活性基团TBP-1(2,4-二羟基二苯甲酮),合成了“晒不黑”的有机锑热稳定剂。用红外光谱对产品结构进行了确认,光敏性实验表明其7周内不变色;静态热稳定性实验结果表明其与硫醇锑热稳定剂相当。%Because of its poor ultraviolet resistance , the storage , transportation and use of antimony mercaptide stabilizer was greatly limited.In order to solve this problem , a kind of synthesized organic antimony thermal stabilizer was prepared, which was light -tolerant with antimony trichloride , isooctyl thioglycollat as raw materials and TBP -1(2,4-dihydroxybenzophenone ) , with an anti-ultraviolet agent added in.The light-tolerant performance and thermal stability of product tested showed that the color of organic antimony as -synthesized was unchangeable when under the impact of direct sunlight for 7 weeks by infrared spectroscopy spectrum that was confirmed for structure of product , and the static experimental results showed that the thermal stability was nearly equivalent to antimony mercaptide.

  1. Quadrupole mixed-symmetry states in 106Pd

    International Nuclear Information System (INIS)

    The isoscalar and isovector parts of the quadrupole transition matrix elements for the direct 0+gs→2i+ excitation of low-lying 2+ states in 106Pd are derived from the inelastic scattering of deuterons and of polarized protons. The isovector component for the 2+ level at 3.070 MeV exceeds significantly the isoscalar one. This level is therefore identified as a mixed-symmetry state in the language of the neutron and proton interacting boson model (IBA-2). (orig.)

  2. Quadrupole mixed-symmetry states in /sup 106/Pd

    Energy Technology Data Exchange (ETDEWEB)

    De Leo, R.; Lagamba, L.; Blasi, N.; Micheletti, S.; Pignanelli, M.; Fujiwara, M.; Hosono, K.; Katayama, I.; Matsuoka, N.; Morinobu, S.

    1989-08-03

    The isoscalar and isovector parts of the quadrupole transition matrix elements for the direct 0/sup +//sub gs/->2/sub i//sup +/ excitation of low-lying 2/sup +/ states in /sup 106/Pd are derived from the inelastic scattering of deuterons and of polarized protons. The isovector component for the 2/sup +/ level at 3.070 MeV exceeds significantly the isoscalar one. This level is therefore identified as a mixed-symmetry state in the language of the neutron and proton interacting boson model (IBA-2). (orig.).

  3. Dicty_cDB: SSB106 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ing significant alignments: (bits) Value N ( AU051988 ) Dictyostelium discoideum slug cDNA, clone SSB106. 57...7 e-177 2 ( C91121 ) Dictyostelium discoideum slug cDNA, clone SSJ652. 480 e-169 ...3 ( C92519 ) Dictyostelium discoideum slug cDNA, clone SSE517. 480 e-169 3 ( AU037690 ) Dictyostelium discoideum slug... cDNA, clone SSE177. 480 e-169 3 ( AU039039 ) Dictyostelium discoideum slug cDNA, clone SSM310. 480... e-169 3 ( AU051804 ) Dictyostelium discoideum slug cDNA, clone SSA256. 480 e-169

  4. Dicty_cDB: VHB106 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available omology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Val...ces producing significant alignments: (bits) Value ( P36415 ) RecName: Full=Heat shock cogna...1-A/VHB106Q.Seq.d/ Representative seq. ID - (Link to Original site) Representative DNA sequen...1 (VHH751Q) /CSM/VH/VHH7-C/VHH751Q.Seq.d/ 1409 0.0 own update 2004.12.24 Homology vs DNA Score E Sequences producing significant ali...gnments: (bits) Value N X75263 |X75263.1 D.discoideum (AX

  5. A perfect launch of Atlantis on mission STS-106

    Science.gov (United States)

    2000-01-01

    After a perfect on-time launch on mission STS-106 at 8:45:47 a.m. EDT, Space Shuttle Atlantis rolls and displays its external tank and solid rocket boosters. On the 11-day mission to the International Space Station, the seven-member crew will perform support tasks on orbit, transfer supplies and prepare the living quarters in the newly arrived Zvezda Service Module. The first long-duration crew, dubbed '''Expedition One,''' is due to arrive at the Station in late fall. Landing of Atlantis is targeted for 4:45 a.m. EDT on Sept. 19.

  6. Absolute standardization of 106Ru by anti-coincidence method

    International Nuclear Information System (INIS)

    The system of absolute standardization activity of radionuclide by anti-coincidence counting and live-time techniques was implemented at LNMRI in 2008 to reduce the impacts of some influence factors in the determination of the activity with coincidence counting technique used for decades in the lab, for example, the measurement time. With the anti-coincidence system, the variety of radionuclides that can be calibrated by LNMRI was increased, in relation to the type of decay. The objective of this work is the standardization of 106Ru by the method of counting anti-coincidence and estimate its measurement uncertainties. (author)

  7. Yrast states of the proton drip line nucleus 106Sb

    International Nuclear Information System (INIS)

    Yrast states of 106Sb have been investigated in the 54Fe(58Ni,αpn) reaction using in-beam γ-spectroscopic methods and in the 50Cr(58Ni,pn) reaction performing delayed γ and conversion electron studies. A new isomeric state was found at 103 keV with t1/2=232(21) ns. The number of states and transitions in the proposed level scheme have been doubled. The experimental results are discussed within the framework of the shell model. copyright 1999 The American Physical Society

  8. Clinical quality assurance for 106Ru ophthalmic applicators

    International Nuclear Information System (INIS)

    Background and purpose: Episcleral brachytherapy using 106Ru/106Rh ophthalmic applicators is a proven method of therapy of uveal melanomas sparing the globe and in many cases sparing the vision. In the year 2001, an internal clinical quality assurance procedure revealed that part of the ophthalmic applicators leaked and that the calibration was erroneous. Consequently, the producer modernized its production procedures and, in May 2002, introduced a dose rate calibration that is traceable to the NIST standard. This NIST calibration confirmed that the previous calibration had been incorrect. In order to study the effects of the producer's new internal quality assurance procedures on the ophthalmic applicators, applicators of this new generation were submitted to a newly improved internal clinical acceptance test. Patients and methods: The internal clinical acceptance test consists of a leakage test and a dosimetric test of the ophthalmic applicators. The leakage test simulates contact of the ophthalmic applicators with chloride containing body fluid. The dosimetric tests measure depth dose curves and dose rate with a plastic scintillator dosimetric system and compare them with the indications in the producer's certificate. Furthermore, the depth dose profile of the most frequently used applicator (type CCB) was compared with published data. Results: The internal clinical leakage test showed that all of the tested ophthalmic applicators belonging to the new generation (n=17) were tight and not contaminated. The dosimetric acceptance tests applied to seven different types of applicators revealed that the relative depth dose profiles in the therapeutically relevant range (up to a depth of ≤7 mm) deviate from the producer's indications only by -2.7 to +3.2%. The acceptance test of the dose rate values of the ophthalmic applicators at a distance of 2 mm from the surface of the applicators resulted in a coefficient of variation of 1.7% (n=17). In the evaluation of the

  9. The chemistry and behaviour of antimony in the soil environment with comparisons to arsenic: A critical review

    Energy Technology Data Exchange (ETDEWEB)

    Wilson, Susan C., E-mail: swilso24@une.edu.a [School of Environmental and Rural Science, University of New England, Armidale, NSW 2351 (Australia); Lockwood, Peter V., E-mail: peter.lockwood@une.edu.a [School of Environmental and Rural Science, University of New England, Armidale, NSW 2351 (Australia); Ashley, Paul M., E-mail: pashley@une.edu.a [School of Environmental and Rural Science, University of New England, Armidale, NSW 2351 (Australia); Tighe, Matthew, E-mail: mtighe2@une.edu.a [School of Environmental and Rural Science, University of New England, Armidale, NSW 2351 (Australia)

    2010-05-15

    This article provides a critical review of the environmental chemistry of inorganic antimony (Sb) in soils, comparing and contrasting findings with those of arsenic (As). Characteristics of the Sb soil system are reviewed, with an emphasis on speciation, sorption and phase associations, identifying differences between Sb and As behaviour. Knowledge gaps in environmentally relevant Sb data for soils are identified and discussed in terms of the limitations this imposes on understanding the fate, behaviour and risks associated with Sb in environmental soil systems, with particular reference to mobility and bioavailability. - A critical and comparative review of Sb and As chemistry and associations in soil systems identifies research directions needed for better understanding of risks.

  10. Photoelectron imaging as a probe of the repulsive Coulomb barrier in the photodetachment of antimony tartrate dianions

    Science.gov (United States)

    West, Christopher W.; Bull, James N.; Woods, David A.; Verlet, Jan R. R.

    2016-02-01

    A photoelectron imaging study of the text-book antimony tartrate dianion is presented. The vertical and adiabatic detachment energies are determined to be 2.5 ± 0.1 eV and 2.1 ± 0.2 eV, respectively. The photoelectron spectra exhibit a typical cut-off due to the presence of the repulsive Coulomb barrier (RCB) and the photoelectron images are highly anisotropic. Using a simple model for the RCB combined with classical molecular dynamics simulations, the photoelectron images were calculated and compared with experiment. Very good overall agreement between the simulations and experiments was achieved when the photodetachment occurs along a specific molecular axis.

  11. Improving the photoluminescence properties of self-assembled InAs surface quantum dots by incorporation of antimony

    International Nuclear Information System (INIS)

    This study investigates the effects of surfactant and segregation from InAs surface quantum dots (SQDs) by incorporating antimony (Sb) into the QD layers. The Sb surfactant effect extends planar growth and suppresses dot formation. Incorporating Sb can reduce the density of SQDs by more than two orders of magnitude. Photoluminescence (PL) reveals enhancement in the optical properties of InAs SQDs as the Sb beam equivalent pressure (BEP) increases. This improvement is caused by the segregation of Sb on the surface of SQDs, which reduces non-radiative recombination and suppresses carrier loss. The dark line at the SQDs surface in the transmission electron microscopic image suggests that the incorporated Sb probably segregates close to the surface of the SQDs. These results indicate a marked Sb segregation effect that can be exploited to improve the surface-sensitive properties of SQDs for biological sensing.

  12. Pb-Sb and Pb-Sb-Bi sulfosalts and associated sulphides from Dubrava antimony deposit, Nizke Tatry Mts

    International Nuclear Information System (INIS)

    A sulfosalt study was carried out on an antimony deposit Dubrava in Western Carpathians, Slovakia. Quartz-sulphide veins are hosted by Variscan crystalline complex built by granitoid rocks with lenticular bodies of amphibolite gneisses and migmatites. Pb-Sb sulfosalts are constituents of Sb ores and occur together with stibnite, sphalerite, pyrite and other sulphides. Among the sulfosalts, identified by X-ray micro-analyses, the most abundant one is zinckenite. Other phases are chemically close to plagionite, robinsonite, heteromorphite, semseyite and boulangerite. Sulfosalts richter in Bi accompany later tetrahedrite, bournonite and chalcostibite. These include tintinaite (kobellite homologous series) and Bi zinckenite. Intermediate phases between stibnite and bismuthinite, referred to as horobetsuite, are also common. (authors)

  13. Conjugative plasmid in Corynebacterium flaccumfaciens subsp. oortii that confers resistance to arsenite, arsenate, and antimony(III)

    Energy Technology Data Exchange (ETDEWEB)

    Hendrick, C.A.; Haskins, W.P.; Vidaver, A.K.

    1984-07-01

    Gene transfer systems for phytopathogenic corynebacteria have not been reported previously. In this paper a conjugative 46-megadalton plasmid (pDG101) found in Corynebacterium flaccumfaciens subsp. oorii CO101 is described that mediates resistance to arsenite, arsenate, and antimony(III). Transfer of the plasmid from CO101 to four other strains from the C. flaccumfaciens group occurred between cells immobilized on nitrocellulose filters or on agar surfaces. Transconjugant strains expressed the same levels of metal resistance as the donor strain and were able to act as donor strains in subsequent matings. The physical presence of the plasmid was detected by agarose gel electrophoresis. Arsenite-sensitive derivatives of the donor and transconjugant strains were obtained after heat treatment; these were cured of pDG101.

  14. Antimony orthophosphate glasses with large nonlinear refractive indices, low two-photon absorption coefficients, and ultrafast response

    International Nuclear Information System (INIS)

    Antimony glasses based on the composition Sb2O3-SbPO4 were prepared and characterized. The samples present high refractive index, good transmission from 380 to 2000 nm, and high thermal stability. The nonlinear refractive index, n2, of the samples was studied using the optical Kerr shutter technique at 800 nm. The third-order correlation signals between pump and probe pulses indicate ultrafast response (2 was observed by adding lead oxide to the Sb2O3-SbPO4 composition. Large values of n2≅10-14 cm2/W and negligible two-photon absorption coefficients (smaller than 0.01 cm/GW) were determined for all samples. The glass compositions studied present appropriate figure-of-merit for all-optical switching applications

  15. Fabrication of superhydrophobic and heat-insulating antimony doped tin oxide/polyurethane films by cast replica micromolding.

    Science.gov (United States)

    Feng, Jie; Huang, Baoyuan; Zhong, Mingqiang

    2009-08-01

    A novel process for fabricating superhydrophobic and heat-insulating polymeric nanocomposite films was developed. Briefly, antimony doped tin oxide (ATO) nanoparticles that commonly endow coats heat-insulating and transparent functions were mixed into commercial waterborne polyurethane (WPU) suspensions to obtain ATO/WPU suspensions, which were then cast onto poly(dimethylsiloxane) (PDMS) stamps replicated from fresh lotus leaves. After being dried and peeled off from stamps, ATO/PU films with superhydrophobic surface and heat-insulating property were created, while PU films without ATO only showed high hydrophobicity. Scanning electron microscopy (SEM) imaging showed the surface of ATO/PU superhydrophobic films had unique micro- and nano-structures similar with those on the lotus leaf. On the contrary, no obvious nano-structures were found on the surface of pure PU films, demonstrating mixing functional nanoparticles into polymers is a necessary and feasible step in creating superhydrophobic and functional films by replica molding method. PMID:19394955

  16. Effects of Antimony Doping on Cu(In1-x,Gax)Se2 Thin Films and Solar Cells

    Science.gov (United States)

    Yatsushiro, Yuta; Nakakoba, Hiroya; Mise, Takahiro; Kobayashi, Taizo; Nakada, Tokio

    2012-10-01

    The effects of antimony (Sb) doping into Cu(In1-x,Gax)Se2 (CIGS) thin films and solar cells have been investigated. 10-50-nm-thick Sb thin layers were deposited onto Mo-coated sodalime glass (SLG) and SiOx-coated SLG substrates by vacuum evaporation. CIGS thin films were then deposited by a three-stage process at substrate temperatures of 450-550 °C. The grain growth of CIGS thin films was enhanced, and the open-circuit voltage and hence the conversion efficiency improved with the Sb doping when the SLG substrates were used. However, little or no effect was observed when the alkali barrier SiOx layer was deposited on SLG substrates. As a result, we found that Sb doping is beneficial for improving the cell performance when sodium exists simultaneously in CIGS layers.

  17. Antimony (SbIII) reduces growth, declines photosynthesis, and modifies leaf tissue anatomy in sunflower (Helianthus annuus L.).

    Science.gov (United States)

    Vaculík, Marek; Mrázová, Anna; Lux, Alexander

    2015-12-01

    The role of antimony (Sb)--a non-essential trace metalloid--in physiological processes running in crops is still poorly understood. Present paper describes the effect of Sb tartrate (SbIII) on growth, Sb uptake, photosynthesis, photosynthetic pigments, and leaf tissue organization in young sunflower plants grown in hydroponics. We found that growth of below- and aboveground part was reduced with increasing concentration of Sb in the medium. Although Sb was mostly taken up by sunflower roots and only small part (1-2%) was translocated to the shoots, decline in photosynthesis, transpiration, and decreased content of photosynthetic pigments were observed. This indicates that despite relatively low mobility of Sb in root-shoot system, Sb in shoot noticeably modifies physiological status and reduced plant growth. Additionally, leaf anatomical changes indicated that Sb reduced the size of intercellular spaces and made leaf tissue more compact. PMID:26194244

  18. The chemistry and behaviour of antimony in the soil environment with comparisons to arsenic: A critical review

    International Nuclear Information System (INIS)

    This article provides a critical review of the environmental chemistry of inorganic antimony (Sb) in soils, comparing and contrasting findings with those of arsenic (As). Characteristics of the Sb soil system are reviewed, with an emphasis on speciation, sorption and phase associations, identifying differences between Sb and As behaviour. Knowledge gaps in environmentally relevant Sb data for soils are identified and discussed in terms of the limitations this imposes on understanding the fate, behaviour and risks associated with Sb in environmental soil systems, with particular reference to mobility and bioavailability. - A critical and comparative review of Sb and As chemistry and associations in soil systems identifies research directions needed for better understanding of risks.

  19. Synthesis and characterization of nanostructured Mn(II) doped antimony-tin oxide (ATO) films on glass

    International Nuclear Information System (INIS)

    Sol–gel Mn(II) doped antimony tin oxide films were developed with precursor of atomic ratio range, Sn:Sb:Mn = 68–72:23–25:9–3. The X-ray diffraction patterns depict tetragonal cassiterite phase of SnO2. Transmission electron microscopy images suggest the nanostructured form of the doped materials. The increase in crystallite size with Mn(II) concentration is reflected by the larger band gap values (4.61–4.73 eV) arising from the excitonic transitions which also respond to PL emissions. Hall effect measurements show that the carrier concentration increases but mobility decreases for Mn(II) doping. Room temperature ferromagnetism with different saturation magnetic moments (Ms) has been observed for all dopant concentrations, 3–9 at%.

  20. Novel antimony-silicate material Quasar-n for the removal of radionuclides from acidic decontamination liquids - 16157

    International Nuclear Information System (INIS)

    Novel antimony silicate material, commercially available from PQ Corporation (previously Ineos Silicas) is highly selective for the removal of several key radionuclides (Co-60, Sr-90, Cs-137, Pu-236 and Am-241) from acidic and neutral nuclear waste effluents. The paper will summarise most the key results that have been obtained in the previous studies of the material. In addition, new test results on the removal Co-60, Sr-90, Cs-137 and Am-241 from acid media are reported. Static batch experiments and column experiments show that Am can be removed efficiently from nitric and oxalic acid, indicating that Quasar is suitable e.g. for the purification of acidic decontamination solutions. (authors)

  1. lVIICROSTRUCTURE AND EUTECTIC MORPHOLOGY OF AL-12.5°/o Si ALLOY REFINED WITH ANTIMONY

    Directory of Open Access Journals (Sweden)

    Funda Kahraman

    2007-01-01

    Full Text Available Modification of Al-Si cast alloys can be achieved in two different ways, namely by additions of certain eleınents orwith rapid cooling rate. Modifications of the Al-Si al1oys are carried out extensivcly in industry to improve themechanical properties, particularly ductility. In this study, the effects of antiınony addition.s and growth rate on theınicrostructure and eutectic morphology on the directionally solidified Al- 1 2.5°/o Si cutectic all oy has beeninvestigated. The results showed that antimony can be identified as a grain refıner. Over modification occurs in Al-12.5 °/oSi alloy when modifier is present in the amount of 1 %Sb results in AISb compound.

  2. Enhanced Removal of Arsenic and Antimony in the Mining Site by Calcined γ-Fe2O3/Layered Double Hydroxide Nanocomposite

    Science.gov (United States)

    Lee, Sang-Ho; Choi, Heechul; Kim, Kyoung-Woong

    2016-04-01

    Arsenic (As) and Antimony (Sb) have been recognized as harmful contaminants in aquatic environment due to its high toxicity and carcinogenicity. Especially, the contamination of arsenic in the mining areas is considered as a serious emerging environmental issue in Korea. Due to the hazardous effect of arsenic, the United States Environmental Protection Agency (US EPA) regulated maximum contamination level of arsenic to 10 μg/L in drinking water. The harmful effect on human health by excessive intake of antimony was also reported by previous studies, and severe contamination level (100 - 7,000 μg/L) of antimony reported in surface and groundwater of abandoned mining area in China and Slovakia. Therefore, US EPA regulated maximum contaminants level of antimony in drinking water to 6 μg/L. In order to remove anionic contaminants in drinking water, various type of nanomaterials have been developed. Layered double hydroxide (LDH) is the artificial anionic clay that is based on the layered structure of positively charged brucite-like layers with interlayers of anions. The LDH is one of the promising nanomaterials for the removal of anionic contaminants because it has high selectivity for arsenic, phosphate, chromium and antimony. However, the biggest problem of LDH for wastewater treatment is that the particles cannot be easily separated after the removal of contaminants. In this study, magnetic nanoparticles (γ-Fe2O3) supported LDH nanocomposite (γ-Fe2O3/LDH) was investigated to enhance magnetic particle recovery and removal efficiency for arsenic and antimony. The calcined γ-Fe2O3/LDH nanocomposites synthesized by co-precipitation method, and the crystallographic properties of maghemite (γ-Fe2O3) and layered structure of LDH were confirmed by X-ray diffraction. The nano-sized γ-Fe2O3 (30 to 50 nm) was stably attached on the surface of LDH (100 to 150 nm) and O1s spectrum by X-ray photoelectron spectroscopy (XPS) explained that there are both physical and

  3. Growth and Characterization of Co-Doped Fluorine and Antimony in Tin Oxide Thin Films Obtained by Ultrasonic Spray Pyrolysis

    Science.gov (United States)

    Gaewdang, Thitinai; Wongcharoen, Ngamnit

    Fluorine (F)-doped, antimony (Sb)-doped, fluorine and antimony co-doped tin oxide (SnO2) thin films were prepared by ultrasonic spray pyrolysis technique using SnCl2, NH4F and SbCl3 as precursors of Sn, F and Sb elements respectively. F and Sb doping concentrations carried out from 1 to 20 wt% and 1 to 4 wt% in F-doped and Sb-doped SnO2 films respectively. In F and Sb co-doped SnO2 films, the proportions of F and Sb to Sn in starting solution were 15 and 2 wt% respectively. XRD patterns showed that the preferred orientation of SnO2:F, SnO2:Sb and SnO2:F, Sb is dependent on the doping concentration. The variation of doping concentration and preferred orientation of the films was reflected in their morphology as investigated by SEM. The electrical properties of the films were performed by Hall effect measurements in van der Pauw configuration. The minimum resistivity values of SnO2:F and SnO2:Sb were found in the films doped with 15 wt% of F and 2 wt% of Sb. However, The minimum of resistivity value of F and Sb co-doped SnO2 films is not better than neither the one of F-doped nor the one of Sb-doped SnO2 films. The optical transmission of SnO2:F films was found to increase with increasing in F doping concentration. Whereas the optical transmission of SnO2:Sb was found to decrease with increasing in Sb concentration. The F and Sb co-doped SnO2 films annealed in three different conditions at 500°C show the lower transmission values than the value obtained in the as-prepared SnO2:F, Sb films.

  4. One-step synthesis and properties of monolithic photoluminescent ruby colored cuprous oxide antimony oxide glass nanocomposites

    International Nuclear Information System (INIS)

    Research highlights: → Single-step synthesis of Cu2O, CuySb2-x(O,OH)6-7 (y ≤ 2, x ≤ 1) and Cu nanocrystals co-doped novel antimony oxide glass hybrid nanocomposites. → Yellow and orange colored nanocomposites shows size-controlled band gap shift of Cu2O. → Red nanocomposite exhibits surface plasmon resonance band due to metallic Cu. → They exhibit broad deep-red photoluminescence emission under various UV excitation wavelengths. - Abstract: Cuprous oxide (Cu2O) antimony glass (K2O-B2O3-Sb2O3) monolithic nanocomposites having brilliant yellow to ruby red color have been synthesized by a single-step melt-quench technique involving in situ thermochemical reduction of Cu2+ (CuO) by the reducing glass matrix without using any external reducing agent. The X-ray diffraction (XRD), infrared transmission and reflection spectra, and selected area electron diffraction analysis support the reduction of Cu2+ to Cu+ with the formation of Cu2O nanoclusters along with CuySb2-x(O,OH)6-7 (y ≤ 2, x ≤ 1) nanocrystalline phases while Cu0 nanoclusters are formed at very high Cu concentration. The UV-vis spectra of the yellow and orange colored nanocomposites show size-controlled band gap shift of the semiconductor (Cu2O) nanocrystallites embedded in the glasses while the red nanocomposite exhibits surface plasmon resonance band at 529 nm due to metallic Cu. Transmission electron microscopic image advocates the formation of nanocystallites (5-42 nm). Photoluminescence emission studies show broad red emission band around 626 nm under various excitation wavelengths from 210 to 270 nm.

  5. Fabrication and excellent conductive performance of antimony-doped tin oxide-coated diatomite with porous structure

    Energy Technology Data Exchange (ETDEWEB)

    Du Yucheng, E-mail: ychengdu@bjut.edu.cn [Key Lab of Advanced Functional Materials, Ministry of Education, College of Materials Science and Engineering, Beijing University of Technology, Beijing 100124 (China); Yan Jing; Meng Qi; Wang Jinshu [Key Lab of Advanced Functional Materials, Ministry of Education, College of Materials Science and Engineering, Beijing University of Technology, Beijing 100124 (China); Dai Hongxing, E-mail: hxdai@bjut.edu.cn [Laboratory of Catalysis Chemistry and Nanoscience, Department of Chemistry and Chemical Engineering, College of Environmental and Energy Engineering, Beijing University of Technology, Beijing 100124 (China)

    2012-04-16

    Graphical abstract: Antimony-doped tin oxide (ATO)-coated diatomite with porous structures are fabricated using the co-precipitation method. The porous ATO-coated diatomite material shows excellent conductive performance. Highlights: Black-Right-Pointing-Pointer Sb-doped SnO{sub 2} (ATO)-coated diatomite materials with porous structures are prepared. Black-Right-Pointing-Pointer Sn/Sb ratio, ATO coating amount, pH value, and temperature influence resistivity. Black-Right-Pointing-Pointer Porous ATO-coated diatomite materials show excellent conductive performance. Black-Right-Pointing-Pointer The lowest resistivity of the porous ATO-coated diatomite sample is 10 {Omega} cm. - Abstract: Diatomite materials coated with antimony-doped tin oxide (ATO) were prepared by the co-precipitation method, and characterized by means of the techniques, such as X-ray diffraction, Fourier transform infrared spectroscopy, scanning electron microscopy, transmission electron microscopy, selected-area electron diffraction, X-ray fluorescence spectroscopy, and N{sub 2} adsorption-desorption measurement. It was shown that the coated ATO possessed a tetragonal rutile crystal structure, and the ATO-coated diatomite materials had a multi-pore (micro- meso-, and macropores) architecture. The porous ATO-coated diatomite materials exhibited excellent electrical conductive behaviors. The best conductive performance (volume resistivity = 10 {Omega} cm) was achieved for the sample that was prepared under the conditions of Sn/Sb molar ratio = 5.2, Sn/Sb coating amount = 45 wt%, pH = 1.0, and reaction temperature = 50 Degree-Sign C. Such a conductive porous material is useful for the applications in physical and chemical fields.

  6. Search for $2\\beta$ decay of $^{106}$Cd with enriched $^{106}$CdWO$_4$ crystal scintillator in coincidence with four HPGe detectors

    CERN Document Server

    Belli, P; Brudanin, V B; Cappella, F; Caracciolo, V; Cerulli, R; Chernyak, D M; Danevich, F A; d'Angelo, S; Di Marco, A; Incicchitti, A; Laubenstein, M; Mokina, V M; Poda, D V; Polischuk, O G; Tretyak, V I; Tupitsyna, I A

    2016-01-01

    A radiopure cadmium tungstate crystal scintillator, enriched in $^{106}$Cd to 66%, with mass of 216 g ($^{106}$CdWO$_4$), was used to search for double beta decay processes in $^{106}$Cd in coincidence with four ultra-low background high purity germanium detectors in a single cryostat. New improved limits on the double beta processes in $^{106}$Cd have been set on the level of $10^{20}- 10^{21}$ yr after 13085 h of data taking. In particular, the half-life limit on the two neutrino electron capture with positron emission, $T_{1/2}^{2\

  7. Synthesis and characterization of a novel mesoporous silica funtionalized whith [1,5 bis (di-2-pyridyl) methylene thiocarbohydrazide] and its application as enrichment sorbent for determination of antimony by FI-HG-ETAAS

    OpenAIRE

    Siles Cordero, María Teresa; López Guerrero, María del Mar; Vereda Alonso, Elisa Isabel; García de Torres, Amparo; Cano Pavón, José Manuel

    2014-01-01

    Antimony is an element of environmental concern due to its toxicity and biological effects and is therefore considered as a priority pollutant by the US Environmental Protection Agency (EPA). Dissolved antimony is present in seawater at very low concentration levels, typical concentrations of Sb in unpolluted water samples are less than 1 µg L-1. Since the concentration of this element in water is very low, high sensitive analytical techniques are required, The system is based on retent...

  8. Antimony leaching from MSWI bottom ash: modelling of the effect of pH and carbonation.

    Science.gov (United States)

    Cornelis, Geert; Van Gerven, Tom; Vandecasteele, Carlo

    2012-02-01

    Development of treatment methods to reduce Sb leaching from municipal solid waste incinerator (MSWI) bottom ash, such as accelerated carbonation, is being complicated by insufficient understanding of Sb geochemistry. The leaching of antimonate (Sb(V)) and antimonite (Sb(III)) in MSWI bottom was studied as a function of pH and degree of carbonation. While total (Sb(V)+Sb(III)) leaching was lowest (1.2 mg kg(-1)) at the natural pH (i.e. 10.6) of uncarbonated bottom ash, HPLC-ICP-MS analysis showed that acidification and carbonation increased Sb(V) leaching, but decreased Sb(III) leaching, probably because Sb(III)(OH)(4)(-) became less stable. PHREEQC geochemical modelling suggested that Sb(V) concentrations approached equilibrium with the romeites, i.e. calcium antimonates, Ca(1.13)Sb(2)(OH)(0.26)·0.74H(2)O at pH=10.6 and Ca[Sb(OH)(6)](2) at pH=8. It is hypothesised that not interaction with ettringite but dissolution of romeite controls antimonate leaching in the pH range 8-11 in MSWI bottom ash, because while Ca is preferentially leached from romeite, the mineral structures containing more Ca at higher pH are less soluble. A model was proposed where acidification and carbonation both lead to lower Ca(2+) and/or hydroxyl concentration, which removes Ca(2+) and hydroxyls from the romeite structure and leads to comparably higher Sb(V) concentration in equilibrium with romeite. Sb solubility depends on pH and Ca(2+) availability in this model, which has implications for bottom ash valorisation and risk assessment. PMID:22035902

  9. Ruprecht 106: the first single population Globular Cluster?

    CERN Document Server

    Villanova, S; Carraro, G; Bidin, C Moni; Munoz, C

    2013-01-01

    All old Galactic Globular Clusters studied in detail to date host at least two generations of stars, where the second is formed from gas polluted by processed material produced by massive stars of the first. This process can happen if the initial mass of the cluster exceeds a threshold above which ejecta are retained and a second generation is formed. A determination of this mass-threshold is mandatory in order to understand how GCs form. We analyzed 9 RGB stars belonging to the cluster Ruprecht 106. Targets were observed with the UVES@VLT2 spectrograph. Spectra cover a wide range and allowed us to measure abundances for light (O,Na,Mg,Al), alpha (Si,Ca,Ti), iron-peak (Sc,V,Cr,Mn,Fe,Co,Ni,Cu,Zn) and neutron-capture (Y,Zr,Ba,La,Ce,Pr,Nd,Sm,Eu,Dy,Pb) elements. Based on these abundances we show that Ruprecht 106 is the first convincing example of a single population GC (i.e. a true simple stellar population), although the sample is relatively small. This result is supported also by an independent photometric tes...

  10. Characterization of spent fuel approved testing material: ATM-106

    International Nuclear Information System (INIS)

    The characterization data obtained to date are described for Approved Testing Material (ATM)-106 spent fuel from Assembly BT03 of pressurized-water reactor Calvert Cliffs No. 1. This report is one in a series being prepared by the Materials Characterization Center at Pacific Northwest Laboratory on spent fuel ATMs. The ATMs are receiving extensive examinations to provide a source of well- characterized spent fuel for testing in the US Department of Energy Office of Civilian Radioactive Waste Management (OCWRM) program. ATM-106 consists of 20 full-length irradiated fuel rods with rod-average burnups of about 3700 GJ/kgM (43 MWd/kgM) and expected fission gas release of /approximately/10%. Characterization data include (1) as-fabricated fuel design, irradiation history, and subsequent storage and handling; (2) isotopic gamma scans; (3) fission gas analyses; (4) ceramography of the fuel and metallography of the cladding; (5) calculated nuclide inventories and radioactivities in the fuel and cladding; and (6) radiochemical analyses of the fuel and cladding. Additional analyses of the fuel rod are being conducted and will be included in planned revisions of this report. 12 refs., 110 figs., 81 tabs

  11. Tracking the curved jet in PKS 1502+106

    CERN Document Server

    An, T; Venturi, T; Jiang, D R; Wang, W H

    2004-01-01

    We carried out a multifrequency and multiepoch study of the highly polarized quasar, PKS 1502+106 at radio frequencies. The analysis is based on an EVN dataset at 5 GHz, archive VLBA datasets at 2.3, 8.3, 24.4 and 43.1 GHz and an archive MERLIN dataset at 5 GHz. The various datasets span over a period of 10 years. The source is characterized by a multi-component one-sided jet at all epochs. The VLBI images show that a complex curved jet is located to the southeast and east of the core, with the position angle (PA) of the jet axis wiggling between 80 deg and 130 deg. The MERLIN image reveals that the jet extends to 0.6 arcsec at a PA 135+-12 degr. The radio core in the VLBI images has a brightness temperature approaching the equipartition limit, indicating highly relativistic plasma beamed towards us. Delta PA in the source, the misalignment of the kpc- and pc-scale radio structure, is estimated about 32 degr, suggesting that PKS 1502+106 belongs to the aligned population. Four superluminal components are dete...

  12. Localizing the $\\gamma$ rays from blazar PKS 1502+106

    CERN Document Server

    Karamanavis, Vassilis; Krichbaum, T P; Angelakis, E; Hodgson, J; Myserlis, I; Nestoras, I; Zensus, J A; Ungerechts, H; Sievers, A

    2015-01-01

    Blazars are among the most variable objects in the universe. They feature energetic jets of plasma that launch from the cores of these active galactic nuclei (AGN), triggering activity from radio up to gamma-ray energies. Spatial localization of the region of their MeV/GeV emission is a key question in understanding the blazar phenomenon. The flat spectrum radio quasar (FSRQ) PKS 1502+106 has exhibited extreme and correlated, radio and high-energy activity that triggered intense monitoring by the Fermi-GST AGN Multi-frequency Monitoring Alliance (F-GAMMA) program and the Global Millimeter VLBI Array (GMVA) down to $\\lambda$3 mm (or 86 GHz), enabling the sharpest view to date towards this extreme object. Here, we report on preliminary results of our study of the gamma-ray loud blazar PKS 1502+106, combining VLBI and single dish data. We deduce the critical aspect angle towards the source to be $\\theta_{\\rm c} = 2.6^{\\circ}$, calculate the apparent and intrinsic opening angles and constrain the distance of the ...

  13. β-Ray brachytherapy with 106Ru plaques for retinoblastoma

    International Nuclear Information System (INIS)

    Purpose: A retrospective analysis of 134 patients who received 106Ru brachytherapy for retinoblastomas (175 tumors in 140 eyes). Treatment and follow-up were analyzed with special emphasis on tumor control organ, preservation, and late complications. Results: Treated tumors had a mean height and diameter of 3.7 ± 1.4 mm and 5.0 ± 2.8 disk diameters, respectively. The radiation dose values were recalculated according to the calibration standard recently introduced by the National Institute of Standards and Technology. The recalculation revealed a mean applied dose of 419 Gy at the sclera (SD, 207 Gy) and 138 Gy (SD, 67 Gy) at the tumor apex. The 5-year tumor control rate was 94.4%. Tumor recurrence was more frequent in eyes with vitreous tumor cell seeding or fish-flesh regression. The estimated 5-year eye preservation rate was 86.5%. Previous treatment by brachytherapy or external beam radiotherapy, as well as a large tumor diameter, were significant factors for enucleation. The radiotherapy-induced complications after 5 years of follow-up were retinopathy (22%), optic neuropathy (21%), and cataract (17%). These complications were significantly more frequent after prior brachytherapy or external beam radiotherapy. Conclusion: Brachytherapy using 106Ru plaques is a highly efficient therapy with excellent local tumor control and an acceptable incidence of side effects

  14. Study of the 106Cd(α,α)106Cd scattering at energies relevant to the p-process

    International Nuclear Information System (INIS)

    Most of the stable proton-rich nuclides with charge number Z ≥ 34 are the so-called p nuclei. Their production through the s or r process is blocked by stable nuclei. The main stellar mechanism synthesizing these neutron deficient nuclei is the so-called p-process. These process involves a series of (γ,n), (γ,p) and (γ,α) reaction on stable nuclei and takes place in the O/Ne layers in massive stars during the pre-supernova phase or the explosion. Describing the synthesis of the p-nuclei and calculating their abundances requires an extended network calculation, involving ca. 10,000 reaction on more than 1000 nuclei. Calculated cross sections are based on theoretical predictions of the Hauser-Feshbach model. On the other hand systematic experimental study of charged particle reactions was initiated in several laboratories in order to measure the α and proton capture cross sections. Considerable differences between calculated and experimental values were found for certain (α,γ) reactions. The α-nucleus optical potential at low energies was identified as the main source of the difference. This led to the idea of systematically studying the low-energy α optical model potential in (α,α) reactions. In the past years optical model parameters of 144Sm, 92Mo and 112,124Sn have been determined at ATOMKI. Here we present a set of preliminary results for the reaction 106Cd(α,α)106Cd at E ∼ 19, 17 and 16 MeV. The derivation of the α optical potential allows a prediction of the 106Cd(α,γ)110Sn cross section, which has been recently measured at the University of Notre Dame and ATOMKI. (author)

  15. 15 CFR 270.106 - Conflicts of interest related to service on a Team.

    Science.gov (United States)

    2010-01-01

    ... service on a Team. 270.106 Section 270.106 Commerce and Foreign Trade Regulations Relating to Commerce and... SAFETY TEAMS NATIONAL CONSTRUCTION SAFETY TEAMS Establishment and Deployment of Teams § 270.106 Conflicts of interest related to service on a Team. (a) Team members who are not Federal employees will...

  16. 47 CFR 68.106 - Notification to provider of wireline telecommunications.

    Science.gov (United States)

    2010-10-01

    ... 47 Telecommunication 3 2010-10-01 2010-10-01 false Notification to provider of wireline telecommunications. 68.106 Section 68.106 Telecommunication FEDERAL COMMUNICATIONS COMMISSION (CONTINUED) COMMON... of Terminal Equipment § 68.106 Notification to provider of wireline telecommunications. (a)...

  17. 50 CFR 20.106 - Seasons, limits, and shooting hours for sandhill cranes.

    Science.gov (United States)

    2010-10-01

    ... this section, see the List of CFR Sections Affected, which appears in the Finding Aids section of the... sandhill cranes. 20.106 Section 20.106 Wildlife and Fisheries UNITED STATES FISH AND WILDLIFE SERVICE..., and Shooting Hours Schedules § 20.106 Seasons, limits, and shooting hours for sandhill cranes....

  18. 13 CFR 106.502 - Who has authority to perform a Gift conflict of interest determination?

    Science.gov (United States)

    2010-01-01

    ... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Who has authority to perform a Gift conflict of interest determination? 106.502 Section 106.502 Business Credit and Assistance SMALL... § 106.502 Who has authority to perform a Gift conflict of interest determination? (a) For...

  19. 25 CFR 115.106 - Assets of members of the Agua Caliente Band of Mission Indians.

    Science.gov (United States)

    2010-04-01

    ... 25 Indians 1 2010-04-01 2010-04-01 false Assets of members of the Agua Caliente Band of Mission Indians. 115.106 Section 115.106 Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR FINANCIAL ACTIVITIES TRUST FUNDS FOR TRIBES AND INDIVIDUAL INDIANS IIM Accounts § 115.106 Assets of members of the...

  20. 18 CFR 1300.106 - Harassment on the basis of race, color, religion, age, or disability.

    Science.gov (United States)

    2010-04-01

    ... of race, color, religion, age, or disability. 1300.106 Section 1300.106 Conservation of Power and... AUTHORITY § 1300.106 Harassment on the basis of race, color, religion, age, or disability. It is TVA policy... basis of race, color, religion, age, or disability. Accordingly, all employees must avoid any action...

  1. 10 CFR 72.106 - Controlled area of an ISFSI or MRS.

    Science.gov (United States)

    2010-01-01

    ... 10 Energy 2 2010-01-01 2010-01-01 false Controlled area of an ISFSI or MRS. 72.106 Section 72.106 Energy NUCLEAR REGULATORY COMMISSION (CONTINUED) LICENSING REQUIREMENTS FOR THE INDEPENDENT STORAGE OF... Evaluation Factors § 72.106 Controlled area of an ISFSI or MRS. (a) For each ISFSI or MRS site, a...

  2. 48 CFR 18.106 - Acquisitions from Federal Prison Industries, Inc. (FPI).

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 1 2010-10-01 2010-10-01 false Acquisitions from Federal Prison Industries, Inc. (FPI). 18.106 Section 18.106 Federal Acquisition Regulations System FEDERAL... Flexibilities 18.106 Acquisitions from Federal Prison Industries, Inc. (FPI). Purchase from FPI is not...

  3. The FTLD risk factor TMEM106B and MAP6 control dendritic trafficking of lysosomes

    NARCIS (Netherlands)

    Schwenk, B.M.; Lang, C.M.; Hogl, S.; Tahirovic, S.; Orozco, D.; Rentzsch, K.; Lichtenthaler, S.F.; Hoogenraad, Casper; Capell, A.; Haass, C.; Edbauer, D.

    2014-01-01

    TMEM106B is a major risk factor for frontotemporal lobar degeneration with TDP‐43 pathology. TMEM106B localizes to lysosomes, but its function remains unclear. We show that TMEM106B knockdown in primary neurons affects lysosomal trafficking and blunts dendritic arborization. We identify microtubule‐

  4. Highly active and stable Pt electrocatalysts promoted by antimony-doped SnO2 supports for oxygen reduction reactions

    DEFF Research Database (Denmark)

    Yin, Min; Xu, Junyuan; Li, Qingfeng; Jensen, Jens Oluf; Huang, Yunjie; Cleemann, Lars Nilausen; Bjerrum, Niels J.; Xing, Wei

    2014-01-01

    composite supports, which limited the mass activity of the supported catalysts. When the ATO composites were used as supports, the Pt/C-ATO catalysts showed significantly enhanced catalytic activity and durability for the ORR, attributable to the high ECSA and modified electronic structure of Pt by the ATO......Alternative composite supports for platinum catalysts were synthesized from antimony doped tin dioxide (ATO) nanoparticles. In the range of the antimony content from 0 to 11mol%, the highest electrical conductivity of 1.1Scm-1 at 130°C was obtained for the 5mol% Sb ATO, from which composite...... supports composed of oxides and carbon and supported platinum catalysts were prepared. Using the pure oxide support, the Pt/ATO catalyst displayed superior specific activity and stability for the oxygen reduction reactions (ORRs). Low surface area of ATO caused poor dispersion of Pt particles compared to...

  5. Promoting the Hydrosilylation of Benzaldehyde by Using a Dicationic Antimony-Based Lewis Acid: Evidence for the Double Electrophilic Activation of the Carbonyl Substrate.

    Science.gov (United States)

    Hirai, Masato; Cho, Junsang; Gabbaï, François P

    2016-05-01

    The concomitant activation of carbonyl substrates by two Lewis acids has been investigated by using [1,2-(Ph2 MeSb)2 C6 H4 ](2+) ([1](2+) ), an antimony-based bidentate Lewis acid obtained by methylation of the corresponding distibine. Unlike the simple stibonium cation [Ph3 MeSb](+) , dication [1](2+) efficiently catalyzes the hydrosilylation of benzaldehyde under mild conditions. The catalytic activity of this dication is correlated to its ability to doubly activate the carbonyl functionality of the organic substrate. This view is supported by the isolation of [1-μ2 -DMF][OTf]2 , an adduct, in which the DMF oxygen atom bridges the two antimony centers. PMID:26934491

  6. Contribution to the study of ruthenium-106 migration in soils

    International Nuclear Information System (INIS)

    Two solutions of nitrosyl-ruthenium complexes, the states in which ruthenium is released by Marcoule processing plant, and an uncomplex solution of ruthenium chloride were used to show out ruthenium-106 mobility during earth - column percolation. Ruthenium migration was mainly dependent on its ionic state. Anionic forms were mobile in the soil and a large fraction could be found in the percolate whereas cationic states were sorbed more quickly. The nature of the soil played too: ruthenium migrated deeply in sandy soils, whereas it was strongly sorbed by the muddy fractions of soils with a mud-sand texture. Ruthenium mobility in the soils studied was found to depend more on the solution percolation rates than on particle size distribution, both factors being however closely connected. (author)

  7. Light duty utility arm deployment in Hanford tank T-106

    International Nuclear Information System (INIS)

    An existing gap in the technology for the remediation of underground waste storage tanks filled by the Light Duty Utility Arm (LDUA) System. On September 27 and 30, 1996, the LDUA System was deployed in underground storage tank T-106 at Hanford. The system performed successfully, satisfying all objectives of the in-tank operational test (hot test); performing close-up video inspection of features of tank dome, risers, and wall; and grasping and repositioning in-tank debris. The successful completion of hot testing at Hanford means that areas of tank structure and waste surface that were previously inaccessible are now within reach of remote tools for inspection, waste analysis, and small-scale retrieval. The LDUA System has become a new addition to the arsenal of technologies being applied to solve tank waste remediation challenges

  8. TYPHOON TRACK PREDICTION EXPERIMENTS USING T106L19

    Institute of Scientific and Technical Information of China (English)

    麻素红; 万丰; 陈德辉; 王诗文

    2003-01-01

    A series of 96-h typhoon track prediction experiments were carried outusing medium range forecasting system of NMC by adding BOGUS typhoon (simplified as B-TC) into the first guess field or the analysis field in order to provide longer time typhoon track forecast. The results show that T106L19 could provide a better forecast to typhoon tracks when the B-TC was added, especially when thetyphoon vortex is even weaker. The sensitive experiments on where to add the B-TC show that the results from adding the B-TC into the first guess field are better. The results also show that the initialization smoothes the B-TC a lot and this will affect the typhoon track prediction.

  9. Well drilling summary report for well 199-N-106A

    International Nuclear Information System (INIS)

    Past liquid waste disposal practices within the 100-N Area have resulted in the contamination of the underlying sediments and groundwater. The release of large volumes of liquid effluent to the 1301-N and 1325-N Liquid Waste Disposal Facilities caused the transport of 90Sr and other contaminants to the groundwater. Further discussion of 100-N Area hydrogeology is provided in Hartman and Lindsey (1993). A pump-and-treat system combined with a vertical barrier is the preferred alternative for the N Springs Expedited Response Action. This document is a compilation of the data collected during the drilling of well 199-N-106A, an extraction well for the 100-N Pump-and-Treat Project

  10. Destruction of direct blue 106 dye in underwater discharge

    International Nuclear Information System (INIS)

    An application of underwater discharge is one possible way how make the destruction of organic dyes. This contribution presents results of Direct Blue 106 destruction in discharge generated in bubbles. The initial conductivity value of 30 μS.cm−1 was obtained using electrolyte; the starting dye concentration was 20 mg.l−1. The DC voltage from 1.5 kV to 3.0 kV was applied to generate the discharge at the mean current of 10-30 mA. The system was bubbled through the high voltage capillary electrode by He, Ar and N2 at the constant gas follow of 200 sccm. The dye destruction rate was directly proportional to the applied discharge current, so the highest efficiency was reached at the current of 30 mA. The destruction rate was strongly dependent on the filling gas. While using He and Ar only 4% destruction was obtained during the 20 minutes treatment at 10 mA of discharge current but the decomposition of 52 % was reached if nitrogen was introduced into the high voltage electrode. The destruction efficiency of about 40 % (He, Ar) and over 60 % in nitrogen was reached at discharge current of 30 mA. This enormous difference was probably connected not only to the production of hydrogen peroxide that seems to be usually the main oxidative specie in under water discharges but also atomic and excited nitrogen particles, both atomic and molecular, can have very positive effect in the dye destruction. The detailed study of the kinetic mechanisms leading to the Direct Blue 106 dye destruction will be a subject of the further studies.

  11. Late side effects of Ruthenium 106 therapy for uveal melanomas

    International Nuclear Information System (INIS)

    When effectiveness is evaluated in brachytherapy with Ruthenium 106 special emphasis has to be put on tumor destruction and late side effects responsible for the definite functional results. We evaluated the late side effects of 22 uveal melanomas, which had been treated with 106 Ruthenium plaques. The tumor prominences ranged from 3 to 10 mm, the diameter from 4 to 9 disc diameters. In 4 patients the tumor involved the posterior pole, 14 melanomas were located in the midperiphery of the fundus, 4 tumors were ciliary body melanomas. The total radiation dose of the apex ranged from 100 to 240 Gy with a corresponding dose to the sclera between 540 to 1000 Gy. Because of the short half life of the plaque we have been using different dose rates (1.6-11 Gy/h). In 17/22 eyes adequate regression could be achieved by Ruthenium therapy alone. In one case additional laser treatment of the macular part of the melanoma had to be performed, Gamma Knife therapy was necessary in another melanoma with 10 mm tumor prominence. 3 recurrences led to enucleation. The mean follow up was 4.8 years ranging from 1 to 7 years. In 2/22 patients opticopathy caused severe visual impairment, in another 2 patients radiation maculopathy and opticopathy was observed. 7/22 developed vasculopathy with neovascularization treated by photocoagulation. In one case of focal radiation maculopathy laser treatment could prevent further visual impairment. The following factors are responsible for a higher incidence of late side effects: 1. High dose rate of the plaques in combination with a high radiation dose to the sclera 2. Location of the tumor within a minimum distance of 2 disc diameters to the optic nerve or macula 3. Tumor location at the ciliary body Laser treatment in case of neovascularization and focal radiation maculopathy is the only effective treatment with regard to late side effects. Ischemic maculopathy and radiation opticopathy are responsible for late visual impairment. (authors)

  12. Dose distribution determination of ruthenium-106 ophthalmic applicators

    International Nuclear Information System (INIS)

    Full text: Dose distributions of COB and CCA type ruthenium-106 ophthalmic applicators (15 and 20 mm diameter) were investigated using small thin CaSO4:Dy thermoluminescent dosimeters with dimensions of approximately 2 x 3 x 0.05 mm3. TLD characteristics, namely linearity, reproducibility and sensitivity were studied. Measured sensitivities (variations in response to a nominal dose due to differences in size, homogeneity, etc) of individual TLD discs ranged from approximately -20% to +17%. TLDs were then placed at different positions in a water equivalent eye phantom. Dose points in planes at 1 to 10 mm depths from the plaque active surface were measured. Hot spots and cold spots (up to 50% difference from the dose on the central axis) were found in various positions throughout the plaques. The depth dose values provided by the manufacturer agreed well with the measured ones, but the standard errors for TLD measurements were considerably less than that of manufacturer. The percentage uncertainty obtained with proposed method was on average better than 5% compared to 30% indicated by manufacturer. MOSFET semiconductor detector was also employed in determination of Percentage Depth Dose (PDD) of the plaques. This was found to be a very feasible dosimetry method providing fast readout and high sensitivity to low radiation doses. The measurements agreed within a few percent with TLD results and manufacturer provided data. Determination of dose distributions of ruthenium-106 applicators using small CaSO4:Dy TLDs proved to be a useful technique for estimation of 2D dose distributions resulting from plaque treatments. On the other hand, fast measurement of PDD using MOSFET detector can be used for regular quality assurance and acceptance testing of the plaques

  13. Antimoniais empregados no tratamento da leishmaniose: estado da arte Antimonials employed in the treatment of leishmaniaisis: the state of the art

    OpenAIRE

    Susanne Rath; Luciano Augusto Trivelin; Talitha Rebecca Imbrunito; Daniela Maria Tomazela; Marcelo Nunes de Jesús; Percy Calvo Marzal; Heitor Franco de Andrade Junior; André Gustavo Tempone

    2003-01-01

    Antimony preparations are the drugs of choice for the treatment of leishmaniasis over 90 years, a disease that currently affects 12 million people worldwide. Its introduction was based on 19th century concepts of therapeutic effects of metal salts as arsenicals and other metals, most of them abandoned due to toxic effects or better drugs. In the last three decades, there was a great improvement in the knowledge of cell biology and immunology of those infections, but chemotherapy has not been ...

  14. Arsenic and antimony determination in refined and unrefined table salts by means of hydride generation atomic absorption spectrometry--comparison of sample decomposition and determination methods

    OpenAIRE

    AKSUNER, Nur; TİRTOM, Vedia Nüket; HENDEN, Emür

    2011-01-01

    An evaluation was made of different digestion methods for the determination of arsenic and antimony in table salt samples prior to hydride generation atomic absorption spectrometric analysis. Microwave acid digestion, classical wet digestion, dry ashing, and fusion were applied to the decomposition of salt samples and optimum conditions were investigated. Samples were decomposed by changing heating time, digestion techniques, and the amount and composition of acid, and then the concen...

  15. Decreased antimony uptake and overexpression of genes of thiol metabolism are associated with drug resistance in a canine isolate of Leishmania infantum

    OpenAIRE

    Verónica Gómez Pérez; Raquel García-Hernandez; Victoriano Corpas-López; Tomás, Ana M.; Joaquina Martín-Sanchez; Santiago Castanys; Francisco Gamarro

    2016-01-01

    Visceral leishmaniasis (VL) caused by the protozoan parasite Leishmania infantum, is one of the most important zoonotic diseases affecting dogs and humans in the Mediterranean area. The presence of infected dogs as the main reservoir host of L. infantum is regarded as the most significant risk for potential human infection. We have studied the susceptibility profile to antimony and other anti-leishmania drugs (amphotericin B, miltefosine, paromomycin) in Leishmania infantum isolates extracted...

  16. Antimony determination in seawater and pore water of marine sediments by means of coprecipitation with Mg(OH)2 and atomic absorption spectrometry

    International Nuclear Information System (INIS)

    The study of biogeochemical cycling of trace elements in inshore marine environment is of basic importance in order to understand the long-term distribution of both conventional and radioactive pollutants among the ecosystem components. Antimony is of radio- ecological interest, and its determination in some environmental matrices (seawater, pore water, biota) is always difficult from the analytical point of view. A quick method for antimony determination in seawater and interstitial water of marine sediments, by coprecipitation with Mg(OH)2 and subsequent atomic absorption measurement, is reported. Coprecipitation recovery (about 80% in optimal conditions) was evaluated using both radiotracers and the addition of known amounts of stable element, and turned out to depend on several parameters (percentage of precipitated Mg as compared to the natural content in seawater, ageing of Mg(OH)2, concomitant Fe and Mn concentrations, etc.). The total standard deviation of the proposed method is about 10%. The variance analysis showed that about 90% of total variance is due to the preconcentration procedure (sample handling and random contaminations) and only about 10% is due to the instrumental measurement. The results of antimony determinations in seawater and pore water of marine sediments collected at Montalto di Castro (Central Mediterranean Sea) are presented and discussed

  17. Mobility and chemical fate of arsenic and antimony in water and sediments of Sarouq River catchment, Takab geothermal field, northwest Iran.

    Science.gov (United States)

    Sharifi, Reza; Moore, Farid; Keshavarzi, Behnam

    2016-04-01

    Arsenic (As) and antimony (Sb) concentrations in water and sediments were determined along flow paths in the Sarouq River, Zarshuran and Agh Darreh streams. The results indicate high As and Sb concentrations in water and sediment samples. Raman spectroscopy shows hematite (α-Fe2O3), goethite [α-FeO(OH)] and lepidocrocite [γ-FeO(OH)] in sediment samples. Calculated saturation indices (SI) indicate oversaturation with respect to amorphous Fe(OH)3 for all samples, but undersaturation with respect to Al and Mn mineral and amorphous phases. Therefore, ferric oxides and hydroxides are assumed to be principal mineral phases for arsenic and antimony attenuation by adsorption/co-precipitation processes. The considerable difference between As and Sb concentration in sediment is due to strong adsorption of As(V) into the solid phase. Also, lower affinity of Sb(V) for mineral surfaces suggests a greater potential for aqueous transport. The adsorption of arsenic and antimony was examined using the Freundlich adsorption isotherm to determine their distribution model in water-sediment system and its compatibility with the existing theoretical model. The results showed that the adsorption behavior of both elements complies with the Freundlich adsorption isotherm. PMID:26820974

  18. Structural, morphological, magnetic and dielectric characterization of nano-phased antimony doped manganese zinc ferrites

    Science.gov (United States)

    Sridhar, Ch. S. L. N.; Lakshmi, Ch. S.; Govindraj, G.; Bangarraju, S.; Satyanarayana, L.; Potukuchi, D. M.

    2016-05-01

    Nano-phased doped Mn-Zn ferrites, viz., Mn0.5-x/2Zn0.5-x/2SbXFe2O4 for x=0 to 0.3 (in steps of 0.05) prepared by hydrothermal method are characterized by X-ray diffraction, Infrared and scanning electron microscopy. XRD and SEM infer the growth of nano-crystalline cubic and hematite (α-Fe2O3) phase structures. IR reveals the ferrite phase abundance and metal ion replacement with dopant. Decreasing trend of lattice constant with dopant reflects the preferential replacement of Fe3+ions by Sb5+ion. Doping is found to cause for the decrease (i.e., 46-14 nm) of grain size. An overall trend of decreasing saturation magnetization is observed with doping. Low magnetization is attributed to the diamagnetic nature of dopant, abundance of hematite (α-Fe2O3) phase, non-stoichiometry and low temperature (800 °C) sintering conditions. Increasing Yafet-Kittel angle reflects surface spin canting to pronounce lower Ms. Lower coercivity is observed for x≤0.1, while a large Hc results for higher concentrations. High ac resistivity (~106 ohm-cm) and low dielectric loss factor (tan δ~10-2-10-3) are witnessed. Resistivity is explained on the base of a transformation in the Metal Cation-to-Oxide anion bond configuration and blockade of conductivity path. Retarded hopping (between adjacent B-sites) of carriers across the grain boundaries is addressed. Relatively higher resistivity and low dielectric loss in Sbdoped Mn-Zn ferrite systems pronounce their utility in high frequency applications.

  19. The Physics Force- Physics for ages 6 to 106.

    Science.gov (United States)

    Dahlberg, E. Dan

    2006-03-01

    The Physics Force is a very successful and entertaining outreach program of the Institute of Technology in the University of Minnesota developed to make science exciting and fun for students of all ages, from 6 to 106. Although all attendees, including high school and college students and guests from retirement homes, praise our performances, the primary focus is on K-6 students. The original Force consists of six k-12 teachers, Hank Ryan, Jon Barber, Jack Netland, Fred Orsted, Aaron Pinski, and Jay Dornfeld and Dan Dahlberg of the University of Minnesota Physics Department. The Force performed variations of The Physics Circus, our most popular show, at Disney's Epcot Center, parts of it were shown on Newton's Apple and several of us have performed demonstrations on the Knoff-Hoff Show, a very successful German T.V. science program. The goal of The Physics Force is to show students and the public Science is Fun, Science is Interesting, and Science is Understandable. By all measures we have available, we are extremely successful in reaching our goals. In the last three year cycle of our University support almost 100,000 residents of Minnesota (or about 2% of the total population) saw a Physics Force performance; it appears we will surpass those numbers in the present cycle.

  20. Dabigatran in Secondary Stroke Prevention: Clinical Experience with 106 Patients

    Directory of Open Access Journals (Sweden)

    Alicia DeFelipe-Mimbrera

    2014-01-01

    Full Text Available Introduction. Our aim was to analyze our clinical experience with dabigatran etexilate in secondary stroke prevention. Methods. We retrospectively included patients starting dabigatran etexilate for secondary stroke prevention from March 2010 to December 2012. Efficacy and safety variables were registered. Results. 106 patients were included, median follow-up of 12 months (range 1–31. Fifty-six females (52.8%, mean age 76.4 (range 50–95, SD 9.8, median CHADS2 4 (range 2–6, CHA2DS2-VASc 5 (range 2–9, and HAS-BLED 2 (range 1–5. Indication for dabigatran etexilate was ischemic stroke in 101 patients and acute cerebral hemorrhage (CH due to warfarin in 5 (4.7%. Dabigatran etexilate 110 mg bid was prescribed in 71 cases (67% and 150 mg bid was prescribed in the remaining. Seventeen patients (16% suffered 20 complications during follow-up. Ischemic complications (10 were 6 transient ischemic attacks (TIA, 3 ischemic strokes, and 1 acute coronary syndrome. Hemorrhagic complications (10 were CH (1, gastrointestinal bleeding (6, mild hematuria (2, and mild metrorrhagia (1, leading to dabigatran etexilate discontinuation in 3 patients. Patients with previous CH remained uneventful. Three patients died (pneumonia, congestive heart failure, and acute cholecystitis and 9 were lost during follow-up. Conclusions. Dabigatran etexilate was safe and effective in secondary stroke prevention in clinical practice, including a small number of patients with previous history of CH.