WorldWideScience

Sample records for annual doe-ersp pi

  1. 4th Annual DOE-ERSP PI Meeting: Abstracts

    Energy Technology Data Exchange (ETDEWEB)

    Hazen, Terry C.

    2009-03-01

    This contains abstracts from the 2009 Annual Environmental Remediation Sciences Program (ERSP) Principal Investigators (PI) Meeting. The ERSP seeks to advance fundamental science to understand, predict, and mitigate the impacts of environmental contamination from past nuclear weapons production and provide a scientific basis for the long-term stewardship of nuclear waste disposal. These ambitious goals cannot be achieved by any one project alone. Therefore, ERSP funds a combination of research programs at the DOE national laboratories, individual projects at universities and federal agencies, and large long(er)-term field site research. Integration of these activities to advance the ERSP goals is a constant challenge, but made significantly simpler by bringing together all funded ERSP researchers once a year to discuss the very latest research results. It is at these meetings where new ideas and/or scientific advancements in support of ERSP goals can be discussed and openly debated among all PIs in the program. The ERSP thrives, in part, on the new ideas, concepts, scientific connections, and collaborations generated as a result of these meetings. The annual PI Meeting is very much a working meeting with three major goals: (1) to provide opportunities for scientific interaction among the ERSP scientists, a critical element for the program; (2) to provide the ERSP program staff with an opportunity to evaluate the progress of each program and project; and (3) to showcase the ERSP to interested parties within DOE and within other federal agencies In addition to program managers from within OBER, there will be representatives from other offices within DOE and other federal agencies in attandance at the meeting.

  2. 2nd Annual DOE-ERSP PI Meeting: Abstracts

    Energy Technology Data Exchange (ETDEWEB)

    Hazen, Terry C.

    2007-03-14

    Welcome to the annual 2007 Environmental Remediation Sciences Program (ERSP) Principal Investigators (PIs) meeting. The purpose of this meeting is to bring together all of the lead PIs and key Co-PIs in the program to share and review the results of funded research from the past year. This meeting allows program managers from the Environmental Remediation Sciences Division (ERSD) within the Office of Biological and Environmental Research (OBER) to gauge the progress and significance of the funded research, and it is also an important venue to showcase ERSP research to interested parties within DOE and other invited federal agency representatives. Additionally, these meetings should serve as an opportunity for funded PIs to view their research in the context of the entire ERSP portfolio. Past ERSP meetings have been very important venues for detailed discussion of research results among PIs, development of new research ideas, fostering new collaborations and discussion with ERSD program managers on future research efforts and/or initiatives within the program. In short, these meetings are an important resource for both program managers and PIs. There will be only one ERSP PI meeting for 2007. In years past, ERSD has sponsored two PI meetings, one in the spring and a separate meeting in the fall that focused primarily on field research. However, this format tends to insulate laboratory-based research from the field research sponsored in the program and is incompatible with the ERSD view that laboratory-based research should progress towards understanding the relevant processes in natural environments at the field scale. Therefore the agenda for this year's PI meeting is well integrated with both lab-based and field-based projects, to allow for detailed discussion between PIs involved in each area. In the agenda, you will notice a more relaxed format than in years past. This year's meeting spans four days, but is less heavily regimented in terms of oral

  3. $\\tau^{-} \\to (\\pi \\pi \\pi )^{-} \

    CERN Document Server

    Gómez-Dumm, D; Portolés, J; 10.1016/j.nuclphysbps.2004.04.166

    2004-01-01

    We analyse tau to pi pi pi nu /sub tau / decays within the framework of the resonance effective theory of QCD. We have worked out the relevant Lagrangian that describes the axial-vector current hadronization contributing to these processes, and the new coupling constants that arise have been constrained by imposing the asymptotic behaviour of the corresponding spectral function within QCD. Hence we compare the theoretical framework with the experimental data, obtaining a good quality fit from the ALEPH spectral function and branching ratio. We also get values for the mass and on-shell width of the a/sub 1/(1260) resonance, and provide the tau to pi pi pi nu /sub tau / structure functions that have been measured by OPAL and CLEO-II finding an excellent agreement.

  4. Reducing False Alarms of Annual Forecast in the Central China North-South Seismic Belt by Reverse Tracing of Precursors (RTP) Using the Pattern Informatics (PI) `Hotspots'

    Science.gov (United States)

    Zhang, Shengfeng; Wu, Zhongliang; Jiang, Changsheng

    2016-05-01

    The annual consultation on the likelihood of earthquakes in the next year, the `Annual Consultation Meeting', has been one of the most important forward forecast experiments organized by the China Earthquake Administration (CEA) since the 1970s, in which annual alarm regions are identified by an expert panel considering multi-disciplinary `anomalies'. In such annual forecasts, one of the problems in need of further technical solution is its false alarms. To tackle this problem, the concept of `reverse tracing of precursors (RTP)' is used to the annual consultation, as a temporal continuation and spatial extension of the work of Zuc(hao) et al. (Pure Appl Geophys 167:783-800, 2010). The central China north-south seismic belt (in connection to the CSEP testing region) is selected as the testing region of such an approach. Applying the concept of RTP, for an annual alarm region delineated by the Annual Consultation Meeting, the distribution of `hotspots' of the pattern informatics (PI), which targets the 5-year-scale seismic hazard, is considered. The `hit', or successful forecast, of the annual seismic hazard is shown to be related to the sufficient coverage of the `hotspots' within the annual alarm region. The ratio of the areas of the `hotspots' over the whole area of the annual alarm region is thus used to identify the false alarms which have few `hotspots'. The results of the years 2004-2012 show that using a threshold of 17 % can reduce 34 % (13 among 38) of the false alarms without losing the successful hit (being 6 in that period).

  5. Observation of $\\eta'$ decays to $\\pi^+\\pi^-\\pi^0$ and $\\pi^+\\pi^-\\e^+e^-$

    CERN Document Server

    Naik, P; Asner, D M; Edwards, K W; Reed, J; Robichaud, A N; Tatishvili, G; Briere, R A; Vogel, H; Onyisi, P U E; Rosner, J L; Alexander, J P; Cassel, D G; Duboscq, J E; Ecklund, K M; Ehrlich, R; Fields, L; Galik, R S; Gibbons, L; Gray, R; Gray, S W; Hartill, D L; Heltsley, B K; Hertz, D; Hunt, J M; Kandaswamy, J; Kreinick, D L; Kuznetsov, V E; Ledoux, J; Mahlke-Krüger, H; Mohapatra, D; Patterson, J R; Peterson, D; Riley, D; Ryd, A; Sadoff, A J; Shi, X; Stroiney, S; Sun, W M; Wilksen, T; Athar, S B; Yelton, J; Rubin, P; Mehrabyan, S; Lowrey, N; Selen, M; White, E J; Wiss, J; Mitchell, R E; Shepherd, M R; Besson, D; Pedlar, T K; Cronin-Hennessy, D; Gao, K Y; Hietala, J; Kubota, Y; Klein, T; Poling, R; Scott, A W; Zweber, P; Dobbs, S; Metreveli, Z; Seth, K K; Tan, B J Y; Tomaradze, A G; Libby, J; Martin, L; Powell, A; Wilkinson, G; Méndez, H; Ge, J Y; Miller, D H; Pavlunin, V; Sanghi, B; Shipsey, I P J; Xin, B; Adams, G S; Hu, D; Moziak, B; Napolitano, J; He, Q; Insler, J; Muramatsu, H; Park, C S; Thorndike, E H; Yang, F; Artuso, M; Blusk, S; Khalil, S; Li, J; Mountain, R; Randrianarivony, K; Sultana, N; Skwarnicki, T; Stone, S; Wang, J C; Zhang, L M; Bonvicini, G; Cinabro, D; Dubrovin, M; Lincoln, A

    2008-01-01

    Using psi(2S) --> pi+ pi- J/psi, J/psi --> gamma eta' events acquired with the CLEO-c detector at the CESR e+e- collider, we make the first observations of the decays eta' --> pi+ pi- pi0 and eta' --> pi+ pi- e+ e-, measuring absolute branching fractions (37 +11 -9 +- 4) x 10^-4 and (25 +12 -9 +- 5) x 10^-4, respectively. For eta' --> pi+ pi- pi0, this result probes the mechanism of isospin violation and the roles of pi0/eta/eta'-mixing and final state rescattering in strong decays. We also set upper limits on branching fractions for eta' decays to pi+ pi- mu+ mu-, 2(pi+ pi-), pi+ pi- 2pi0, 2(pi+ pi-)pi0, 3(pi+ pi-), and invisible final states.

  6. Study of the D0 ---> pi- pi+ pi- pi+ decay

    Energy Technology Data Exchange (ETDEWEB)

    Link, J.M.; Yager, P.M.; /UC, Davis; Anjos, J.C.; Bediaga, I.; Castromonte, C.; Machado, A.A.; Magnin, J.; Massafferri, A.; de Miranda, J.M.; Pepe, I.M.; Polycarpo, E.; /Rio de Janeiro, CBPF /CINVESTAV, IPN /Colorado U. /Fermilab /Frascati /Guanajuato U. /Illinois U., Urbana /Indiana U. /Korea U. /Kyungpook Natl. U. /INFN, Milan /Milan U.

    2007-01-01

    Using data from the FOCUS (E831) experiment at Fermilab, they present new measurements for the Cabbibo-suppressed decay mode D{sup 0} {yields} {pi}{sup -}{pi}{sup +}{pi}{sup -}{pi}{sup +}. They measure the branching ratio {Lambda}(D{sup 0} {yields} {pi}{sup +}{pi}{sup -}{pi}{sup +}{pi}{sup -})/{Lambda}(D{sup 0} {yields} K{sup -} {pi}{sup +}{pi}{sup -}{pi}{sup +}) = 0.0914 {+-} 0.0018 {+-} 0.0022. An amplitude analysis has been performed, a first for this channel, in order to determine the resonant substructure of this decay mode. The dominant component is the decay D{sup 0} {yields} a{sub 1}(1260){sup +}{pi}{sup -}, accounting for 60% of the decay rate. The second most dominant contribution comes from the decay D{sup 0} {yields} {rho}(770){sup 0}{rho}(770){sup 0}, with a fraction of 25%. They also study the a{sub 1}(1260) line shape and resonant substructure. Using the helicity formalism for the angular distribution of the decay D{sup 0} {yields} {rho}(770){sup 0}{rho}(770){sup 0}, they measure a longitudinal polarization of P{sub L} = (71 {+-} 4 {+-} 2)%.

  7. Extracting the chiral anomaly from gamma pi --> pi pi

    CERN Document Server

    Hoferichter, Martin; Sakkas, Dimitrios

    2012-01-01

    We derive dispersive representations for the anomalous process gamma pi --> pi pi with the pi pi P-wave phase shift as input. We investigate how in this framework the chiral anomaly can be extracted from a cross-section measurement using all data up to 1 GeV, and discuss the importance of a precise representation of the gamma pi --> pi pi amplitude for the hadronic light-by-light contribution to the anomalous magnetic moment of the muon.

  8. Observation of $\\eta^{\\prime}\\to\\pi^{+}\\pi^{-}\\pi^{+}\\pi^{-}$ and $\\eta^{\\prime}\\to\\pi^{+}\\pi^{-}\\pi^{0}\\pi^{0}$

    CERN Document Server

    Ablikim, M; Ai, X C; Albayrak, O; Albrecht, M; Ambrose, D J; An, F F; An, Q; Bai, J Z; Ferroli, R Baldini; Ban, Y; Bennett, J V; Bertani, M; Bian, J M; Boger, E; Bondarenko, O; Boyko, I; Braun, S; Briere, R A; Cai, H; Cai, X; Cakir, O; Calcaterra, A; Cao, G F; Cetin, S A; Chang, J F; Chelkov, G; Chen, G; Chen, H S; Chen, J C; Chen, M L; Chen, S J; Chen, X; Chen, X R; Chen, Y B; Cheng, H P; Chu, X K; Chu, Y P; Cronin-Hennessy, D; Dai, H L; Dai, J P; Dedovich, D; Deng, Z Y; Denig, A; Denysenko, I; Destefanis, M; Ding, W M; Ding, Y; Dong, C; Dong, J; Dong, L Y; Dong, M Y; Du, S X; Fan, J Z; Fang, J; Fang, S S; Fang, Y; Fava, L; Feng, C Q; Fu, C D; Fuks, O; Gao, Q; Gao, Y; Geng, C; Goetzen, K; Gong, W X; Gradl, W; Greco, M; Gu, M H; Gu, Y T; Guan, Y H; Guo, A Q; Guo, L B; Guo, T; Guo, Y P; Han, Y L; Harris, F A; He, K L; He, M; He, Z Y; Held, T; Heng, Y K; Hou, Z L; Hu, C; Hu, H M; Hu, J F; Hu, T; Huang, G M; Huang, G S; Huang, H P; Huang, J S; Huang, L; Huang, X T; Huang, Y; Hussain, T; Ji, C S; Ji, Q; Ji, Q P; Ji, X B; Ji, X L; Jiang, L L; Jiang, L W; Jiang, X S; Jiao, J B; Jiao, Z; Jin, D P; Jin, S; Johansson, T; Kalantar-Nayestanaki, N; Kang, X L; Kang, X S; Kavatsyuk, M; Kloss, B; Kopf, B; Kornicer, M; Kuehn, W; Kupsc, A; Lai, W; Lange, J S; Lara, M; Larin, P; Leyhe, M; Li, C H; Li, Cheng; Li, Cui; Li, D; Li, D M; Li, F; Li, G; Li, H B; Li, H J; Li, J C; Li, K; Li, Lei; Li, P R; Li, Q J; Li, T; Li, W D; Li, W G; Li, X L; Li, X N; Li, X Q; Li, Z B; Liang, H; Liang, Y F; Liang, Y T; Lin, D X; Liu, B J; Liu, C L; Liu, C X; Liu, F H; Liu, Fang; Liu, Feng; Liu, H B; Liu, H H; Liu, H M; Liu, J; Liu, J P; Liu, K; Liu, K Y; Liu, P L; Liu, Q; Liu, S B; Liu, X; Liu, Y B; Liu, Z A; Liu, Zhiqiang; Liu, Zhiqing; Loehner, H; Lou, X C; Lu, G R; Lu, H J; Lu, H L; Lu, J G; Lu, X R; Lu, Y; Lu, Y P; Luo, C L; Luo, M X; Luo, T; Luo, X L; Lv, M; Ma, F C; Ma, H L; Ma, Q M; Ma, S; Ma, T; Ma, X Y; Maas, F E; Maggiora, M; Malik, Q A; Mao, Y J; Mao, Z P; Messchendorp, J G; Min, J; Min, T J; Mitchell, R E; Mo, X H; Mo, Y J; Moeini, H; Morales, C Morales; Moriya, K; Muchnoi, N Yu; Muramatsu, H; Nefedov, Y; Nikolaev, I B; Ning, Z; Nisar, S; Niu, X Y; Olsen, S L; Ouyang, Q; Pacetti, S; Pelizaeus, M; Peng, H P; Peters, K; Ping, J L; Ping, R G; Poling, R; Q., N; Qi, M; Qian, S; Qiao, C F; Qin, L Q; Qin, X S; Qin, Y; Qin, Z H; Qiu, J F; Rashid, K H; Redmer, C F; Ripka, M; Rong, G; Ruan, X D; Sarantsev, A; Schoenning, K; Schumann, S; Shan, W; Shao, M; Shen, C P; Shen, X Y; Sheng, H Y; Shepherd, M R; Song, W M; Song, X Y; Spataro, S; Spruck, B; Sun, G X; Sun, J F; Sun, S S; Sun, Y J; Sun, Y Z; Sun, Z J; Sun, Z T; Tang, C J; Tang, X; Tapan, I; Thorndike, E H; Toth, D; Ullrich, M; Uman, I; Varner, G S; Wang, B; Wang, D; Wang, D Y; Wang, K; Wang, L L; Wang, L S; Wang, M; Wang, P; Wang, P L; Wang, Q J; Wang, S G; Wang, W; Wang, X F; Wang, Y D; Wang, Y F; Wang, Y Q; Wang, Z; Wang, Z G; Wang, Z H; Wang, Z Y; Wei, D H; Wei, J B; Weidenkaff, P; Wen, S P; Werner, M; Wiedner, U; Wolke, M; Wu, L H; Wu, N; Wu, Z; Xia, L G; Xia, Y; Xiao, D; Xiao, Z J; Xie, Y G; Xiu, Q L; Xu, G F; Xu, L; Xu, Q J; Xu, Q N; Xu, X P; Xue, Z; Yan, L; Yan, W B; Yan, W C; Yan, Y H; Yang, H X; Yang, L; Yang, Y; Yang, Y X; Ye, H; Ye, M; Ye, M H; Yu, B X; Yu, C X; Yu, H W; Yu, J S; Yu, S P; Yuan, C Z; Yuan, W L; Yuan, Y; Zafar, A A; Zallo, A; Zang, S L; Zeng, Y; Zhang, B X; Zhang, B Y; Zhang, C; Zhang, C B; Zhang, C C; Zhang, D H; Zhang, H H; Zhang, H Y; Zhang, J J; Zhang, J Q; Zhang, J W; Zhang, J Y; Zhang, J Z; Zhang, S H; Zhang, X J; Zhang, X Y; Zhang, Y; Zhang, Y H; Zhang, Z H; Zhang, Z P; Zhang, Z Y; Zhao, G; Zhao, J W; Zhao, Lei; Zhao, Ling; Zhao, M G; Zhao, Q; Zhao, Q W; Zhao, S J; Zhao, T C; Zhao, X H; Zhao, Y B; Zhao, Z G; Zhemchugov, A; Zheng, B; Zheng, J P; Zheng, Y H; Zhong, B; Zhou, L; Zhou, Li; Zhou, X; Zhou, X K; Zhou, X R; Zhou, X Y; Zhu, K; Zhu, K J; Zhu, X L; Zhu, Y C; Zhu, Y S; Zhu, Z A; Zhuang, J; Zou, B S; Zou, J H

    2014-01-01

    Using a sample of $1.3\\times 10^9$ $J/\\psi$ events collected with the BESIII detector, we report the first observation of $\\eta^{\\prime}\\to\\pi^{+}\\pi^{-}\\pi^{+}\\pi^{-}$ and $\\eta^{\\prime}\\to\\pi^{+}\\pi^{-}\\pi^{0}\\pi^{0}$. The measured branching fractions are $\\mathcal{B}$($\\eta^{\\prime}\\to\\pi^{+}\\pi^{-}\\pi^{+}\\pi^{-}$) = $(8.41\\pm0.68({\\rm stat.})\\pm0.63({\\rm syst.}))\\times10^{-5}$ and $\\mathcal{B}$($\\eta^{\\prime}\\to\\pi^{+}\\pi^{-}\\pi^{0}\\pi^{0}$) = $(1.90\\pm0.36({\\rm stat.})\\pm0.19({\\rm syst.}))\\times10^{-4}$, which are consistent with theoretical predictions based on a combination of chiral perturbation theory and vector-meson dominance.

  9. Fair Pi

    OpenAIRE

    2006-01-01

    International audience; In this paper, we define fair computations in the pi-calculus. We follow Costa and Stirling's approach for CCS-like languages but exploit a more natural labeling method of process actions to filter out unfair process executions. The new labeling allows us to prove all the significant properties of the original one, such as unicity, persistence and disappearance of labels. It also turns out that the labeled pi-calculus is a conservative extension of the standard one. We...

  10. Cusps in eta' --> eta pi pi decays

    CERN Document Server

    Schneider, Sebastian P

    2009-01-01

    The discovery of the cusp effect in the decay K+ --> pi+ pi0 pi0 has spurred the search for other decay channels, where this phenomenon, which is generated by strong final-state interactions, should also occur. A very promising candidate is eta' --> eta pi0 pi0. The cusp effect offers an excellent opportunity to experimentally extract pi pi S-Wave scattering lengths. We adapt and generalize the non-relativistic effective field theory framework developed for K --> 3 pi decays to eta' --> eta pi pi. The cusp effect is predicted to have an effect of more than 8 % on the decay spectrum below the pi+ pi- threshold. We also show that with our current theoretical information about eta' --> eta pi pi decays, it is not possible to extract pi eta threshold parameters.

  11. An Amplitude Analysis of the Decay B+- -> pi+- pi+- pi-+

    CERN Document Server

    Aubert, B; Boutigny, D; Couderc, F; Karyotakis, Yu; Lees, J P; Poireau, V; Tisserand, V; Zghiche, A; Graugès-Pous, E; Palano, A; Pompili, A; Chen, J C; Qi, N D; Rong, G; Wang, P; Zhu, Y S; Eigen, G; Ofte, I; Stugu, B; Abrams, G S; Borgland, A W; Breon, A B; Brown, D N; Button-Shafer, J; Cahn, R N; Charles, E; Day, C T; Gill, M S; Gritsan, A V; Groysman, Y; Jacobsen, R G; Kadel, R W; Kadyk, J; Kerth, L T; Kolomensky, Yu G; Kukartsev, G; Lynch, G; Mir, L M; Oddone, P J; Orimoto, T J; Pripstein, M; Roe, N A; Ronan, Michael T; Wenzel, W A; Barrett, M; Ford, K E; Harrison, T J; Hart, A J; Hawkes, C M; Morgan, S E; Watson, A T; Fritsch, M; Goetzen, K; Held, T; Koch, H; Lewandowski, B; Pelizaeus, M; Peters, K; Schröder, T; Steinke, M; Boyd, J T; Burke, J P; Chevalier, N; Cottingham, W N; Kelly, M P; Latham, T E; Wilson, F F; Çuhadar-Dönszelmann, T; Hearty, C; Knecht, N S; Mattison, T S; McKenna, J A; Thiessen, D; Khan, A; Kyberd, P; Teodorescu, L; Blinov, A E; Blinov, V E; Druzhinin, V P; Golubev, V B; Ivanchenko, V N; Kravchenko, E A; Onuchin, A P; Serednyakov, S I; Skovpen, Yu I; Solodov, E P; Yushkov, A N; Best, D; Bruinsma, M; Chao, M; Eschrich, I; Kirkby, D; Lankford, A J; Mandelkern, M A; Mommsen, R K; Röthel, W; Stoker, D P; Buchanan, C; Hartfiel, B L; Weinstein, A J R; Foulkes, S D; Gary, J W; Long, O; Shen, B C; Wang, K; Del Re, D; Hadavand, H K; Hill, E J; MacFarlane, D B; Paar, H P; Rahatlou, S; Sharma, V; Berryhill, J W; Campagnari, C; Cunha, A; Dahmes, B; Hong, T M; Lu, A; Mazur, M A; Richman, J D; Verkerke, W; Beck, T W; Eisner, A M; Flacco, C J; Heusch, C A; Kroseberg, J; Lockman, W S; Nesom, G; Schalk, T; Schumm, B A; Seiden, A; Spradlin, P; Williams, D C; Wilson, M G; Albert, J; Chen, E; Dubois-Felsmann, G P; Dvoretskii, A; Hitlin, D G; Narsky, I; Piatenko, T; Porter, F C; Ryd, A; Samuel, A; Yang, S; Jayatilleke, S M; Mancinelli, G; Meadows, B T; Sokoloff, M D; Blanc, F; Bloom, P; Chen, S; Ford, W T; Nauenberg, U; Olivas, A; Rankin, P; Ruddick, W O; Smith, J G; Ulmer, K A; Zhang, J; Zhang, L; Chen, A; Eckhart, E A; Harton, J L; Soffer, A; Toki, W H; Wilson, R J; Zeng, Q; Spaan, B; Altenburg, D; Brandt, T; Brose, J; Dickopp, M; Feltresi, E; Hauke, A; Lacker, H M; Maly, E; Nogowski, R; Otto, S; Petzold, A; Schott, G; Schubert, J; Schubert, K R; Schwierz, R; Sundermann, J E; Bernard, D; Bonneaud, G R; Grenier, P; Schrenk, S; Thiebaux, C; Vasileiadis, G; Verderi, M; Bard, D J; Clark, P J; Muheim, F; Playfer, S; Xie, Y; Andreotti, M; Azzolini, V; Bettoni, D; Bozzi, C; Calabrese, R; Cibinetto, G; Luppi, E; Negrini, M; Piemontese, L; Sarti, A; Anulli, F; Baldini-Ferroli, R; Calcaterra, A; De, R; Sangro; Finocchiaro, G; Patteri, P; Peruzzi, I M; Piccolo, M; Zallo, A; Buzzo, A; Capra, R; Contri, R; Crosetti, G; Lo Vetere, M; Macri, M; Monge, M R; Passaggio, S; Patrignani, C; Robutti, E; Santroni, A; Tosi, S; Bailey, S; Brandenburg, G; Chaisanguanthum, K S; Morii, M; Won, E; Dubitzky, R S; Langenegger, U; Marks, J; Uwer, U; Bhimji, W; Bowerman, D A; Dauncey, P D; Egede, U; Gaillard, J R; Morton, G W; Nash, J A; Nikolich, M B; Taylor, G P; Charles, M J; Grenier, G J; Mallik, U; Mohapatra, A K; Cochran, J; Crawley, H B; Lamsa, J; Meyer, W T; Prell, S; Rosenberg, E I; Rubin, A E; Yi, J; Arnaud, N; Davier, M; Giroux, X; Grosdidier, G; Höcker, A; Le Diberder, F R; Lepeltier, V; Lutz, A M; Petersen, T C; Pierini, M; Plaszczynski, S; Schune, M H; Wormser, G; Cheng, C H; Lange, D J; Simani, M C; Wright, D M; Bevan, A J; Chavez, C A; Coleman, J P; Forster, I J; Fry, J R; Gabathuler, Erwin; Gamet, R; Hutchcroft, D E; Parry, R J; Payne, D J; Touramanis, C; Cormack, C M; Di Lodovico, F; Brown, C L; Cowan, G; Flack, R L; Flächer, H U; Green, M G; Jackson, P S; McMahon, T R; Ricciardi, S; Salvatore, F; Winter, M A; Brown, D; Davis, C L; Allison, J; Barlow, N R; Barlow, R J; Hodgkinson, M C; Lafferty, G D; Naisbit, M T; Williams, J C; Chen, C; Farbin, A; Hulsbergen, W D; Jawahery, A; Kovalskyi, D; Lae, C K; Lillard, V; Roberts, D A; Blaylock, G; Dallapiccola, C; Hertzbach, S S; Kofler, R; Koptchev, V B; Moore, T B; Saremi, S; Stängle, H; Willocq, S; Cowan, R; Koeneke, K; Sciolla, G; Sekula, S J; Taylor, F; Yamamoto, R K; Patel, P M; Robertson, S H; Lazzaro, A; Lombardo, V; Palombo, F; Bauer, J M; Cremaldi, L M; Eschenburg, V; Godang, R; Kroeger, R; Reidy, J; Sanders, D A; Summers, D J; Zhao, H W; Brunet, S; Côté, D; Taras, P; Nicholson, H; Cavallo, N; Fabozzi, F; Gatto, C; Lista, L; Monorchio, D; Paolucci, P; Piccolo, D; Sciacca, C; Baak, M; Bulten, H; Raven, G; Snoek, H L; Wilden, L; Jessop, C P; LoSecco, J M; Allmendinger, T; Benelli, G; Gan, K K; Honscheid, K; Hufnagel, D; Kagan, H; Kass, R; Pulliam, T; Rahimi, A M; Ter-Antonian, R; Wong, Q K; Brau, J E; Frey, R; Igonkina, O; Lu, M; Potter, C T; Sinev, N B; Strom, D; Torrence, E; Colecchia, F; Dorigo, A; Galeazzi, F; Margoni, M; Morandin, M; Posocco, M; Rotondo, M; Simonetto, F; Stroili, R; Voci, C; Benayoun, M; Briand, H; Chauveau, J; David, P; Del Buono, L; La Vaissière, C de; Hamon, O; John, M J J; Leruste, P; Malcles, J; Ocariz, J; Roos, L; Therin, G; Behera, P K; Gladney, L; Guo, Q H; Panetta, J; Biasini, M; Covarelli, R; Pioppi, M; Angelini, C; Batignani, G; Bettarini, S; Bondioli, M; Bucci, F; Calderini, G; Carpinelli, M; Forti, F; Giorgi, M A; Lusiani, A; Marchiori, G; Morganti, M; Neri, N; Paoloni, E; Rama, M; Rizzo, G; Simi, G; Walsh, J; Haire, M; Judd, D; Paick, K; Wagoner, D E; Danielson, N; Elmer, P; Lau, Y P; Lü, C; Miftakov, V; Olsen, J; Smith, A J S; Telnov, A V; Bellini, F; Cavoto, G; D'Orazio, A; Di Marco, E; Faccini, R; Ferrarotto, F; Ferroni, F; Gaspero, M; Li Gioi, L; Mazzoni, M A; Morganti, S; Piredda, G; Polci, F; Safai, F; Tehrani; Voena, C; Christ, S; Schröder, H; Wagner, G; Waldi, R; Adye, T; De Groot, N; Franek, B J; Gopal, G P; Olaiya, E O; Aleksan, Roy; Emery, S; Gaidot, A; Ganzhur, S F; Giraud, P F; Graziani, G; Hamel de Monchenault, G; Kozanecki, Witold; Legendre, M; London, G W; Mayer, B; Vasseur, G; Yéche, C; Zito, M; Purohit, M V; Weidemann, A W; Wilson, J R; Yumiceva, F X; Abe, T; Aston, D; Bartoldus, R; Berger, N; Boyarski, A M; Buchmüller, O L; Claus, R; Convery, M R; Cristinziani, M; De Nardo, Gallieno; Dingfelder, J C; Dong, D; Dorfan, J; Dujmic, D; Dunwoodie, W M; Fan, S; Field, R C; Glanzman, T; Gowdy, S J; Hadig, T; Halyo, V; Hast, C; Hrynóva, T; Innes, W R; Kelsey, M H; Kim, P; Kocian, M L; Leith, D W G S; Libby, J; Luitz, S; Lüth, V; Lynch, H L; Marsiske, H; Messner, R; Müller, D R; O'Grady, C P; Ozcan, V E; Perazzo, A; Perl, M; Ratcliff, B N; Roodman, A; Salnikov, A A; Schindler, R H; Schwiening, J; Snyder, A; Soha, A; Stelzer, J; Strube, J; Su, D; Sullivan, M K; Vavra, J; Wagner, S R; Weaver, M; Wisniewski, W J; Wittgen, M; Wright, D H; Yarritu, A K; Young, C C; Burchat, P R; Edwards, A J; Majewski, S A; Petersen, B A; Roat, C; Ahmed, M; Ahmed, S; Alam, M S; Ernst, J A; Saeed, M A; Saleem, M; Wappler, F R; Bugg, W; Krishnamurthy, M; Spanier, S M; Eckmann, R; Kim, H; Ritchie, J L; Satpathy, A; Schwitters, R F; Izen, J M; Kitayama, I; Lou, X C; Ye, S; Bianchi, F; Bóna, M; Gallo, F; Gamba, D; Bosisio, L; Cartaro, C; Cossutti, F; Della Ricca, G; Dittongo, S; Grancagnolo, S; Lanceri, L; Poropat, P; Vitale, L; Vuagnin, G; Martínez-Vidal, F; Panvini, R S; Banerjee, S W; Bhuyan, B; Brown, C M; Fortin, D; Hamano, K; Jackson, P D; Kowalewski, R V; Roney, J M; Sobie, R J; Back, J J; Harrison, P F; Mohanty, G B; Band, H R; Chen, X; Cheng, B; Dasu, S; Datta, M; Eichenbaum, A M; Flood, K T; Graham, M; Hollar, J J; Johnson, J R; Kutter, P E; Li, H; Liu, R; Mihályi, A; Pan, Y; Prepost, R; Tan, P; Von Wimmersperg-Töller, J H; Wu, J; Wu, S L; Yu, Z; Greene, M G; Neal, H

    2005-01-01

    We present a Dalitz-plot analysis of charmless B+- decays to the final state pi+- pi+- pi-+ using 210 fb^-1 of data recorded by the BABAR experiment at sqrt(s) = 10.58 GeV. We measure the branching fractions B(B+- -> pi+- pi+- pi-+) = (16.2 +- 1.2 +- 0.9) x 10^-6 and B(B+- -> rho^0(770) pi+-) = (8.8 +- 1.0 +- 0.6 +0.1-0.7) x 10^-6. Measurements of branching fractions for the quasi-two-body decays B+- -> rho^0(1450) pi+-, B+- -> f_0(980) pi+- and B+- -> f_2(1270) pi+- are also presented. We observe no charge asymmetries for the above modes, and there is no evidence for the decays B+- -> chic0 pi+-, B+- -> f_0(1370) pi+- and B+- -> sigma pi+-.

  12. Amplitude Analysis of B -> pi pi pi and B -> K pi pi

    CERN Document Server

    Aubert, B; Abrams, G S; Adye, T; Ahmed, S; Alam, M S; Albert, J; Aleksan, Roy; Allison, J; Allmendinger, T; Altenburg, D; Andreotti, M; Angelini, C; Anulli, F; Aston, D; Azzolini, V; Baak, M; Back, J J; Bailey, S; Baldini-Ferroli, R; Band, H R; Banerjee, Sw; Barate, R; Bard, D J; Barlow, N R; Barlow, R J; Barrett, M; Bartoldus, R; Batignani, G; Bauer, J M; Beck, T W; Behera, P K; Bellini, F; Benayoun, M; Berger, N; Bernard, D; Berryhill, J W; Best, D; Bettarini, S; Bettoni, D; Bevan, A J; Bhimji, W; Bianchi, F; Biasini, M; Blanc, F; Blaylock, G; Blinov, A E; Blinov, V E; Bloom, P; Bóna, M; Bondioli, M; Bonneaud, G R; Borgland, A W; Bosisio, L; Boutigny, D; Bowerman, D A; Boyarski, A M; Boyd, J T; Bozzi, C; Brandenburg, G; Brandt, T; Brau, J E; Breon, A B; Briand, H; Brochard, F; Brose, J; Brown, C L; Brown, C M; Brown, D; Brown, D N; Bruinsma, M; Brunet, S; Bucci, F; Buchanan, C; Buchmüller, O L; Bugg, W; Bulten, H; Burchat, Patricia R; Button-Shafer, J; Buzzo, A; Côté, D; Cahn, R N; Calabrese, R; Calcaterra, A; Calderini, G; Campagnari, C; Capra, R; Carpinelli, M; Cartaro, C; Cavallo, N; Cavoto, G; Chaisanguanthum, K S; Chao, M; Charles, E; Charles, M J; Chauveau, J; Chavez, C A; Chen, A; Chen, E; Chen, J C; Chen, S; Cheng, B; Cheng, C H; Chevalier, N; Christ, S; Cibinetto, G; Clark, P J; Claus, R; Cochran, J; Colecchia, F; Coleman, J P; Contri, R; Convery, M R; Cormack, C M; Cossutti, F; Cottingham, W N; Couderc, F; Covarelli, R; Cowan, G; Cowan, R; Crawley, H B; Cremaldi, L M; Cristinziani, M; Crosetti, G; Çuhadar-Dönszelmann, T; Dahmes, B; Dallapiccola, C; Danielson, N; Dasu, S; Datta, M; Dauncey, P D; David, P; Davier, M; Davis, C L; Day, C T; De Groot, N; De Nardo, Gallieno; Del Buono, L; Della Ricca, G; Di Lodovico, F; Dickopp, M; Dittongo, S; Dong, D; Dorfan, J; Dorigo, A; Druzhinin, V P; Dubitzky, R S; Dubois-Felsmann, G P; Dujmic, D; Dunwoodie, W M; Dvoretskii, A; Eckmann, R; Edwards, A J; Egede, U; Eichenbaum, A M; Eigen, G; Eisner, A M; Elmer, P; Elsen, E E; Emery, S; Ernst, J A; Eschenburg, V; Eschrich, I; Fabozzi, F; Faccini, R; Fan, S; Farbin, A; Feltresi, E; Ferrarotto, F; Ferroni, F; Field, R C; Finocchiaro, G; Flack, R L; Flächer, H U; Flood, K T; Ford, K E; Ford, W T; Forster, I J; Forti, F; Fortin, D; Foulkes, S D; Franek, B J; Frey, R; Fritsch, M; Fry, J R; Gabathuler, Erwin; Gaidot, A; Gaillard, J M; Gaillard, J R; Galeazzi, F; Gallo, F; Gamba, D; Gamet, R; Gan, K K; Ganzhur, S F; Gary, J W; Gaspero, M; Gatto, C; Geddes, N I; Gill, M S; Giorgi, M A; Giraud, P F; Giroux, X; Gladney, L; Glanzman, T; Godang, R; Goetzen, K; Golubev, V B; Gopal, G P; Gowdy, S J; Graham, M; Grancagnolo, S; Green, M G; Greene, M G; Grenier, G J; Grenier, P; Gritsan, A V; Grosdidier, G; Groysman, Y; Guo, Q H; Hadavand, H K; Hadig, T; Haire, M; Halyo, V; Hamel de Monchenault, G; Hamon, O; Harrison, P F; Harrison, T J; Hart, A J; Hart, P A; Hartfiel, B L; Harton, J L; Hast, C; Hauke, A; Hawkes, C M; Hearty, C; Held, T; Hertzbach, S S; Heusch, C A; Hicheur, A; Hill, E J; Hitlin, D G; Höcker, A; Hodgkinson, M C; Hollar, J J; Honscheid, K; Hrynóva, T; Hufnagel, D; Hulsbergen, W D; Hutchcroft, D E; Igonkina, O; Innes, W R; Ivanchenko, V N; Izen, J M; Jackson, P D; Jackson, P S; Jacobsen, R G; Jawahery, A; Jayatilleke, S M; Jessop, C P; John, M J J; Johnson, J R; Judd, D; Kadel, R W; Kadyk, J; Kagan, H; Karyotakis, Yu; Kass, R; Kelly, M P; Kelsey, M H; Kerth, L T; Khan, A; Kim, H; Kim, P; Kirkby, D; Kitayama, I; Knecht, N S; Koch, H; Kocian, M L; Kofler, R; Kolomensky, Yu G; Koptchev, V B; Kovalskyi, D; Kowalewski, R V; Kozanecki, Witold; Kravchenko, E A; Krishnamurthy, M; Kroeger, R; Kroseberg, J; Kukartsev, G; Kutter, P E; Kyberd, P; Lacker, H M; Lae, C K; Lafferty, G D; Lamsa, J; Lanceri, L; Lange, D J; Langenegger, U; Lankford, A J; Laplace, S; Latham, T E; Lau, Y P; Lavin, D; Lazzaro, A; Le Diberder, F R; Lees, J P; Legendre, M; Leith, D W G S; Lepeltier, V; Leruste, P; Lewandowski, B; Li Gioi, L; Li, H; Libby, J; Lillard, V; Lista, L; Liu, R; LoSecco, J M; Lo Vetere, M; Lockman, W S; Lombardo, V; London, G W; Long, O; Lou, X C; Lu, A; Lü, C; Luitz, S; Luppi, E; Lusiani, A; Lüth, V; Lutz, A M; Lynch, G; Lynch, H L; Lyon, A J; MacFarlane, D B; Macri, M; Malcles, J; Mallik, U; Mancinelli, G; Mandelkern, M A; Manfredi, P F; Mangeol, D J J; Marchiori, G; Margoni, M; Marsiske, H; Martínez-Vidal, F; Mattison, T S; Mayer, B; Mazur, M A; Mazzoni, M A; McKenna, J A; McMahon, T R; Meadows, B T; Messner, R; Meyer, T I; Meyer, W T; Miftakov, V; Mihályi, A; Mir, L M; Mohanty, G B; Mohapatra, A K; Mommsen, R K; Monge, M R; Monorchio, D; Moore, T B; Morandin, M; Morgan, S E; Morganti, M; Morganti, S; Morii, M; Morton, G W; Muheim, F; Müller, D R; Müller-Pfefferkorn, R; Narsky, I; Nash, J A; Nauenberg, U; Neal, H; Negrini, M; Neri, N; Nesom, G; Nicholson, H; Nikolich, M B; Nogowski, R; O'Grady, C P; Ocariz, J; Oddone, P J; Ofte, I; Olaiya, E O; Olivas, A; Olsen, J; Onuchin, A P; Orimoto, T J; Otto, S; Ozcan, V E; Paar, H P; Paick, K; Palano, A; Palombo, F; Pan, Y; Panetta, J; Panvini, R S; Paoloni, E; Paolucci, P; Parry, R J; Passaggio, S; Patel, P M; Patrignani, C; Patteri, P; Payne, D J; Pelizaeus, M; Perazzo, A; Perl, M; Peruzzi, I M; Petersen, B A; Petersen, T C; Petrak, S; Petzold, A; Piatenko, T; Piccolo, D; Piccolo, M; Piemontese, L; Pierini, M; Pioppi, M; Piredda, G; Pivk, M; Plaszczynski, S; Playfer, S; Pompili, A; Poropat, P; Porter, F C; Posocco, M; Potter, C T; Prell, S; Prepost, R; Pripstein, M; Pulliam, T; Purohit, M V; Qi, N D; Rahatlou, S; Rahimi, A M; Rama, M; Rankin, P; Ratcliff, B N; Raven, G; Re, V; Reidy, J; Ricciardi, S; Richman, J D; Ritchie, J L; Rizzo, G; Roat, C; Roberts, D A; Robertson, S H; Robutti, E; Roe, N A; Röthel, W; Ronan, Michael T; Roney, J M; Rong, G; Roodman, A; Roos, L; Rosenberg, E I; Rotondo, M; Rubin, A E; Ryd, A; Saeed, M A; Safai-Tehrani, F; Saleem, M; Salnikov, A A; Salvatore, F; Samuel, A; Sanders, D A; Sandrelli, F; Santroni, A; Saremi, S; Sarti, A; Satpathy, A; Schalk, T; Schindler, R H; Schott, G; Schrenk, S; Schubert, J; Schubert, Klaus R; Schumm, B A; Schune, M H; Schwiening, J; Schwierz, R; Schwitters, R F; Sciacca, C; Sciolla, G; Seiden, A; Sekula, S J; Serednyakov, S I; Sharma, V; Shelkov, V G; Shen, B C; Simani, M C; Simi, G; Simonetto, F; Sinev, N B; Skovpen, Yu I; Sloane, R J; Smith, A J S; Smith, J G; Snoek, H L; Snyder, A; Sobie, R J; Soffer, A; Soha, A; Sokoloff, M D; Solodov, E P; Spaan, B; Spanier, S M; Spradlin, P; Stängle, H; Steinke, M; Stelzer, J; Stoker, D P; Stroili, R; Strom, D; Stugu, B; Su, D; Sullivan, M K; Summers, D J; Sundermann, J E; T'Jampens, S; Tan, P; Tantot, L; Taras, P; Taylor, F; Taylor, G P; Telnov, A V; Teodorescu, L; Ter-Antonian, R; Therin, G; Thiebaux, C; Thiessen, D; Tiozzo, G; Tisserand, V; Toki, W H; Torrence, E; Tosi, S; Touramanis, C; Treadwell, E; Vasileiadis, G; Vasseur, G; Vavra, J; Verderi, M; Verkerke, W; Vitale, L; Voci, C; Voena, C; Vuagnin, G; Wagner, G; Wagner, S R; Wagoner, D E; Waldi, R; Walsh, J; Wang, K; Wang, P; Wappler, F R; Watson, A T; Weaver, M; Weidemann, A W; Weinstein, A J R; Wenzel, W A; Wilden, L; Williams, D C; Williams, J C; Willocq, S; Wilson, F F; Wilson, J R; Wilson, M G; Wilson, R J; Winter, M A; Wisniewski, W J; Wittgen, M; Won, E; Wong, Q K; Wormser, G; Wright, D H; Wright, D M; Wu, J; Wu, S L; Xie, Y; Yamamoto, R K; Yang, S; Yarritu, A K; Ye, S; Yéche, C; Yi, J; Young, C C; Yu, Z; Yumiceva, F X; Yushkov, A N; Zallo, A; Zeng, Q; Zghiche, A; Zhang, J; Zhang, L; Zhao, H W; Zhu, Y S; Zito, M; De Sangro, R; Del Re, D; La Vaissière, C de

    2004-01-01

    We present preliminary results of a maximum-likelihood Dalitz-plot analysis of the charmless hadronic B decays to the final states pi pi pi and K pi pi from data corresponding to an integrated on-resonance luminosity of 166 fb^-1 recorded by the BABAR experiment at the SLAC PEP-II asymmetric-energy B Factory. We measure the total branching fractions B(B -> pi pi pi) = (16.2 +- 2.1 +- 1.3) x 10^-6 and B(B -> K pi pi) = (61.4 +- 2.4 +- 4.5) x 10^-6, and provide fit fractions and phases for intermediate resonance states.

  13. Double pomeron exchange in the reactions pp --> pppi$^{+}$pi$^{-}$, K$^{+}$p --> K$^{+}$ppi$^{+}$pi$^{-}$, pi$^{+}$p --> pi$^{+}$ppi$^{+}$pi$^{-}$ and pi$^{-}$p --> pi$^{-}$ppi$^{+}$pi$^{-}$ at 147 GeV/c

    CERN Document Server

    Brick, D H; Shapiro, A M; Widgoff, M; Ansorge, Rainer E; Carter, J R; Neale, William W; Rushbrooke, John G; Ward, D R; Whyman, B M; Burnstein, R A; Rubin, H A; Cooper, J W; Snyder, A; Alyea, E D; Bachman, L; Chien, C Y; Lucas, P; Pevsner, A; Bober, J T; Elahi, M; Frank, T; Hafen, E S; Haridas, P; Hochman, D; Huang, D; Hulsizer, R I; Kistiakowsky, V; Levy, A; Lutz, P; Oh, S; Pless, I A; Stoughton, T B; Suchorebrow, V; Tether, S; Trepagnier, P C; Wu, Y; Yamamoto, R K; Grard, F; Hanton, J; Henri, V; Herquet, P; Lesceux, J M; Windmolders, R; Crijns, F; De Bock, H; Kittel, E W; Metzger, W J; Pols, C L A; Schouten, M M; Van de Walle, R T; Cohn, H O

    1980-01-01

    Double pomeron exchange in the reactions pp --> pppi$^{+}$pi$^{-}$, K$^{+}$p --> K$^{+}$ppi$^{+}$pi$^{-}$, pi$^{+}$p --> pi$^{+}$ppi$^{+}$pi$^{-}$ and pi$^{-}$p --> pi$^{-}$ppi$^{+}$pi$^{-}$ at 147 GeV/c

  14. Some comments on B -> pi pi decays

    CERN Document Server

    Fayyazuddin, A

    2004-01-01

    Isospin analysis has been used to constrain the CP-asymmetries in B -> pi pi decays. In particular correlation between a weak phase \\theta and a strong phase \\delta is obtained. Further using the experimental values for the CP-average branching ratios, the following bounds on direct CP-asymmetries are obtained: -0.35+/- 0.22=< C_{\\pi ^+\\pi^-}\\leq 0; C_{\\pi ^0\\pi ^0}=-(2.4\\pm 1.0) C_{\\pi ^+\\pi ^-}. Constraints on mixing induced CP-asymmetries are also discussed.

  15. An Amplitude Analysis of the Decay B+- -> pi+- pi+- pi-+

    Energy Technology Data Exchange (ETDEWEB)

    Aubert, B.; Barate, R.; Boutigny, D.; Couderc, F.; Karyotakis, Y.; Lees, J.P.; Poireau, V.; Tisserand, V.; Zghiche, A.; /Annecy, LAPP; Grauges, E.; /Barcelona, IFAE; Palano, A.; Pappagallo, M.; Pompili, A.; /Bari U. /INFN, Bari; Chen, J.C.; Qi, N.D.; Rong, G.; Wang, P.; Zhu, Y.S.; /Beijing, Inst. High Energy Phys.; Eigen, G.; Ofte, I.; Stugu, B.

    2005-07-11

    The authors present a Dalitz-plot analysis of charmless B{sup {+-}} decays to the final state {pi}{sup {+-}}{pi}{sup {+-}}{pi}{sup {-+}} using 210 fb{sup -1} of data recorded by the BABAR experiment at {radical}s = 10.58 GeV. We measure the branching fractions {Beta}(B{sup {+-}} {yields} {pi}{sup {+-}}{pi}{sup {+-}}{pi}{sup {-+}}) = (16.2 {+-} 1.2 {+-} 0.9) x 10{sup -6} and {Beta}(B{sup {+-}} {yields} {rho}{sup 0}(770){pi}{sup {+-}}) = (8.8 {+-} 1.0 {+-} 0.6{sub -0.7}{sup +0.1}) x 10{sup -6}. Measurements of branching fractions for the quasi-two-body decays B{sup {+-}} {yields} {rho}{sup 0}(1450){pi}{sup {+-}}, B{sup {+-}} {yields} f{sub 0}(980){pi}{sup {+-}} and B{sup {+-}} f{sub 2}(1270){pi}{sup {+-}} are also presented. They observe no charge asymmetries for the above modes, and there is no evidence for the decays B{sup {+-}} {yields} {chi}{sub c0}{pi}{sup {+-}}, B{sup {+-}} {yields} f{sub 0}(1370){pi}{sup {+-}} and B{sup {+-}} {yields} {sigma}{pi}{sup {+-}}.

  16. Pi and PiPi Decays of Excited D Mesons

    OpenAIRE

    Lahde, T. A.; Riska, D. O.

    2001-01-01

    The $\\pi$ and $\\pi\\pi$ decay widths of the excited charm mesons are calculated using a Hamiltonian model within the framework of the covariant Blankenbecler-Sugar equation. The pion-light constituent quark coupling is described by the chiral pseudovector Lagrangian.

  17. Electromagnetic corrections to gamma pi(-) -> pi(0) pi(-)

    CERN Document Server

    Ametller, L; Talavera, P; Ametller, Ll.

    2001-01-01

    The amplitude for the anomalous transition gamma pi(-) --> pi(0) pi(-) is analyzed within Chiral Perturbation Theory including electromagnetic interactions. The presence of a t-channel one-photon exchange contribution induces sizeable O(e^2) corrections which enhance the cross-section in the threshold region and bring the theoretical prediction into agreement with available data.

  18. Dalitz Plot Analysis of Ds+->pi+pi-pi+

    Energy Technology Data Exchange (ETDEWEB)

    Aubert, B.; Bona, M.; Karyotakis, Y.; Lees, J.P.; Poireau, V.; Prencipe, E.; Prudent, X.; Tisserand, V.; /Annecy, LAPP; Garra Tico, J.; Grauges, E.; /Barcelona U., ECM; Lopez, L.; Palano, A.; Pappagallo, M.; /INFN, Bari /Bari U.; Eigen, G.; Stugu, B.; Sun, L.; /Bergen U.; Abrams, G.S.; Battaglia, M.; Brown, D.N.; Cahn, R.N.; Jacobsen, R.G.; /LBL, Berkeley /UC, Berkeley /Birmingham U. /Ruhr U., Bochum /British Columbia U. /Brunel U. /Novosibirsk, IYF /UC, Irvine /UCLA /UC, Riverside /UC, San Diego /UC, Santa Barbara /UC, Santa Cruz /Caltech /Cincinnati U. /Colorado U. /Colorado State U. /Dortmund U. /Dresden, Tech. U. /Ecole Polytechnique /Edinburgh U. /INFN, Ferrara /Ferrara U. /INFN, Ferrara /INFN, Ferrara /Ferrara U. /INFN, Ferrara /INFN, Ferrara /Ferrara U. /Frascati /INFN, Genoa /INFN, Genoa /Genoa U. /INFN, Genoa /INFN, Genoa /Genoa U. /INFN, Genoa /INFN, Genoa /Genoa U. /INFN, Genoa /INFN, Genoa /Genoa U. /Harvard U. /Heidelberg U. /Humboldt U., Berlin /Imperial Coll., London /Iowa U. /Iowa State U. /Johns Hopkins U. /Orsay, LAL /LLNL, Livermore /Liverpool U. /Queen Mary, U. of London /Royal Holloway, U. of London /Louisville U. /Mainz U., Inst. Kernphys. /Manchester U. /Maryland U. /Massachusetts U., Amherst /MIT, LNS /McGill U. /INFN, Milan /Milan U. /INFN, Milan /INFN, Milan /Milan U. /Mississippi U. /Montreal U. /Mt. Holyoke Coll. /INFN, Naples /Naples U. /INFN, Naples /INFN, Naples /Naples U. /NIKHEF, Amsterdam /Notre Dame U. /Ohio State U. /Oregon U. /INFN, Padua /Padua U. /INFN, Padua /INFN, Padua /Padua U. /Paris U., VI-VII /Pennsylvania U. /INFN, Perugia /Perugia U. /INFN, Pisa /Pisa U. /INFN, Pisa /Pisa, Scuola Normale Superiore /INFN, Pisa /Pisa U. /INFN, Pisa /Princeton U. /INFN, Rome /INFN, Rome /Rome U. /INFN, Rome /INFN, Rome /Rome U. /INFN, Rome /INFN, Rome /Rome U. /INFN, Rome /INFN, Rome /Rome U. /INFN, Rome /Rostock U. /Rutherford /DSM, DAPNIA, Saclay /South Carolina U. /SLAC /Stanford U., Phys. Dept. /SUNY, Albany /Tennessee U. /Texas U. /Texas U., Dallas /INFN, Turin /Turin U. /INFN, Trieste /Trieste U. /Valencia U., IFIC /Victoria U. /Warwick U. /Wisconsin U., Madison

    2009-01-26

    A Dalitz plot analysis of {approx} 13, 000 D{sub s}{sup +} decays to {pi}{sup +}{pi}{sup +}{pi}{sup -} has been performed. A 384 fb{sup -1} data sample, recorded by the BABAR detector at the PEP-II asymmetric-energy e{sup +}e{sup -} storage ring running at center of mass energies near 10.6 GeV, is used. Amplitudes and phases of the intermediate resonances which contribute to this final state are measured. A high precision measurement of the ratio: {Beta}(D{sub s}{sup +} {yields} {pi}{sup +}{pi}{sup +}{pi}{sup -})/{Beta}(D{sub s}{sup +} {yields} K{sup +}K{sup -}{pi}{sup +}) = 0.199 {+-} 0.004 {+-} 0.006 is performed. Using a model independent partial wave analysis the amplitude and phase of the S-wave have been measured.

  19. Study of B0 -> pi0pi0, B+ -> pi+pi0 and B+ -> K+pi0 decays

    CERN Document Server

    Aubert, B; Abrams, G S; Adye, T; Ahmed, S; Alam, M S; Albert, J; Aleksan, Roy; Allison, J; Allmendinger, T; Altenburg, D; Andreotti, M; Angelini, C; Anulli, F; Aston, D; Azzolini, V; Baak, M; Back, J J; Bailey, S; Baldini-Ferroli, R; Band, H R; Banerjee, Sw; Barate, R; Bard, D J; Barlow, N R; Barlow, R J; Barrett, M; Bartoldus, R; Batignani, G; Bauer, J M; Beck, T W; Behera, P K; Bellini, F; Benayoun, M; Berger, N; Bernard, D; Berryhill, J W; Best, D; Bettarini, S; Bettoni, D; Bevan, A J; Bhimji, W; Bianchi, F; Biasini, M; Blanc, F; Blaylock, G; Blinov, A E; Blinov, V E; Bloom, P; Bóna, M; Bondioli, M; Bonneaud, G R; Borgland, A W; Bosisio, L; Boutigny, D; Bowerman, D A; Boyarski, A M; Boyd, J T; Bozzi, C; Brandenburg, G; Brandt, T; Brau, J E; Breon, A B; Briand, H; Brochard, F; Brose, J; Brown, C L; Brown, C M; Brown, D; Brown, D N; Bruinsma, M; Brunet, S; Bucci, F; Buchanan, C; Buchmüller, O L; Bugg, W; Bulten, H; Burchat, Patricia R; Button-Shafer, J; Buzzo, A; Côté, D; Cahn, R N; Calabrese, R; Calcaterra, A; Calderini, G; Campagnari, C; Capra, R; Carpinelli, M; Cartaro, C; Cavallo, N; Cavoto, G; Chaisanguanthum, K S; Chao, M; Charles, E; Charles, M J; Chauveau, J; Chavez, C A; Chen, A; Chen, E; Chen, J C; Chen, S; Cheng, B; Cheng, C H; Chevalier, N; Christ, S; Cibinetto, G; Clark, P J; Claus, R; Cochran, J; Colecchia, F; Coleman, J P; Contri, R; Convery, M R; Cormack, C M; Cossutti, F; Cottingham, W N; Couderc, F; Covarelli, R; Cowan, G; Cowan, R; Crawley, H B; Cremaldi, L M; Cristinziani, M; Crosetti, G; Çuhadar-Dönszelmann, T; Dahmes, B; Dallapiccola, C; Danielson, N; Dasu, S; Datta, M; Dauncey, P D; David, P; Davier, M; Davis, C L; Day, C T; De Groot, N; De Nardo, Gallieno; Del Buono, L; Della Ricca, G; Di Lodovico, F; Dickopp, M; Dittongo, S; Dong, D; Dorfan, J; Dorigo, A; Druzhinin, V P; Dubitzky, R S; Dubois-Felsmann, G P; Dujmic, D; Dunwoodie, W M; Dvoretskii, A; Eckmann, R; Edwards, A J; Egede, U; Eichenbaum, A M; Eigen, G; Eisner, A M; Elmer, P; Elsen, E E; Emery, S; Ernst, J A; Eschenburg, V; Eschrich, I; Fabozzi, F; Faccini, R; Fan, S; Farbin, A; Feltresi, E; Ferrarotto, F; Ferroni, F; Field, R C; Finocchiaro, G; Flack, R L; Flächer, H U; Flood, K T; Ford, K E; Ford, W T; Forster, I J; Forti, F; Fortin, D; Foulkes, S D; Franek, B J; Frey, R; Fritsch, M; Fry, J R; Gabathuler, Erwin; Gaidot, A; Gaillard, J M; Gaillard, J R; Galeazzi, F; Gallo, F; Gamba, D; Gamet, R; Gan, K K; Ganzhur, S F; Gary, J W; Gaspero, M; Gatto, C; Geddes, N I; Gill, M S; Giorgi, M A; Giraud, P F; Giroux, X; Gladney, L; Glanzman, T; Godang, R; Goetzen, K; Golubev, V B; Gopal, G P; Gowdy, S J; Graham, M; Grancagnolo, S; Green, M G; Greene, M G; Grenier, G J; Grenier, P; Gritsan, A V; Grosdidier, G; Groysman, Y; Guo, Q H; Hadavand, H K; Hadig, T; Haire, M; Halyo, V; Hamel de Monchenault, G; Hamon, O; Harrison, P F; Harrison, T J; Hart, A J; Hart, P A; Hartfiel, B L; Harton, J L; Hast, C; Hauke, A; Hawkes, C M; Hearty, C; Held, T; Hertzbach, S S; Heusch, C A; Hicheur, A; Hill, E J; Hitlin, D G; Höcker, A; Hodgkinson, M C; Hollar, J J; Honscheid, K; Hrynóva, T; Hufnagel, D; Hulsbergen, W D; Hutchcroft, D E; Igonkina, O; Innes, W R; Ivanchenko, V N; Izen, J M; Jackson, P D; Jackson, P S; Jacobsen, R G; Jawahery, A; Jayatilleke, S M; Jessop, C P; John, M J J; Johnson, J R; Judd, D; Kadel, R W; Kadyk, J; Kagan, H; Karyotakis, Yu; Kass, R; Kelly, M P; Kelsey, M H; Kerth, L T; Khan, A; Kim, H; Kim, P; Kirkby, D; Kitayama, I; Knecht, N S; Koch, H; Kocian, M L; Kofler, R; Kolomensky, Yu G; Koptchev, V B; Kovalskyi, D; Kowalewski, R V; Kozanecki, Witold; Kravchenko, E A; Krishnamurthy, M; Kroeger, R; Kroseberg, J; Kukartsev, G; Kutter, P E; Kyberd, P; Lacker, H M; Lae, C K; Lafferty, G D; Lamsa, J; Lanceri, L; Lange, D J; Langenegger, U; Lankford, A J; Laplace, S; Latham, T E; Lau, Y P; Lavin, D; Lazzaro, A; Le Diberder, F R; Lees, J P; Legendre, M; Leith, D W G S; Lepeltier, V; Leruste, P; Lewandowski, B; Li Gioi, L; Li, H; Libby, J; Lillard, V; Lista, L; Liu, R; LoSecco, J M; Lo Vetere, M; Lockman, W S; Lombardo, V; London, G W; Long, O; Lou, X C; Lu, A; Lü, C; Luitz, S; Luppi, E; Lusiani, A; Lüth, V; Lutz, A M; Lynch, G; Lynch, H L; Lyon, A J; MacFarlane, D B; Macri, M; Malcles, J; Mallik, U; Mancinelli, G; Mandelkern, M A; Manfredi, P F; Mangeol, D J J; Marchiori, G; Margoni, M; Marsiske, H; Martínez-Vidal, F; Mattison, T S; Mayer, B; Mazur, M A; Mazzoni, M A; McKenna, J A; McMahon, T R; Meadows, B T; Messner, R; Meyer, T I; Meyer, W T; Miftakov, V; Mihályi, A; Mir, L M; Mohanty, G B; Mohapatra, A K; Mommsen, R K; Monge, M R; Monorchio, D; Moore, T B; Morandin, M; Morgan, S E; Morganti, M; Morganti, S; Morii, M; Morton, G W; Muheim, F; Müller, D R; Müller-Pfefferkorn, R; Narsky, I; Nash, J A; Nauenberg, U; Neal, H; Negrini, M; Neri, N; Nesom, G; Nicholson, H; Nikolich, M B; Nogowski, R; O'Grady, C P; Ocariz, J; Oddone, P J; Ofte, I; Olaiya, E O; Olivas, A; Olsen, J; Onuchin, A P; Orimoto, T J; Otto, S; Ozcan, V E; Paar, H P; Paick, K; Palano, A; Palombo, F; Pan, Y; Panetta, J; Panvini, R S; Paoloni, E; Paolucci, P; Parry, R J; Passaggio, S; Patel, P M; Patrignani, C; Patteri, P; Payne, D J; Pelizaeus, M; Perazzo, A; Perl, M; Peruzzi, I M; Petersen, B A; Petersen, T C; Petrak, S; Petzold, A; Piatenko, T; Piccolo, D; Piccolo, M; Piemontese, L; Pierini, M; Pioppi, M; Piredda, G; Pivk, M; Plaszczynski, S; Playfer, S; Pompili, A; Poropat, P; Porter, F C; Posocco, M; Potter, C T; Prell, S; Prepost, R; Pripstein, M; Pulliam, T; Purohit, M V; Qi, N D; Rahatlou, S; Rahimi, A M; Rama, M; Rankin, P; Ratcliff, B N; Raven, G; Re, V; Reidy, J; Ricciardi, S; Richman, J D; Ritchie, J L; Rizzo, G; Roat, C; Roberts, D A; Robertson, S H; Robutti, E; Roe, N A; Röthel, W; Ronan, Michael T; Roney, J M; Rong, G; Roodman, A; Roos, L; Rosenberg, E I; Rotondo, M; Rubin, A E; Ryd, A; Saeed, M A; Safai-Tehrani, F; Saleem, M; Salnikov, A A; Salvatore, F; Samuel, A; Sanders, D A; Sandrelli, F; Santroni, A; Saremi, S; Sarti, A; Satpathy, A; Schalk, T; Schindler, R H; Schott, G; Schrenk, S; Schubert, J; Schubert, Klaus R; Schumm, B A; Schune, M H; Schwiening, J; Schwierz, R; Schwitters, R F; Sciacca, C; Sciolla, G; Seiden, A; Sekula, S J; Serednyakov, S I; Sharma, V; Shelkov, V G; Shen, B C; Simani, M C; Simi, G; Simonetto, F; Sinev, N B; Skovpen, Yu I; Sloane, R J; Smith, A J S; Smith, J G; Snoek, H L; Snyder, A; Sobie, R J; Soffer, A; Soha, A; Sokoloff, M D; Solodov, E P; Spaan, B; Spanier, S M; Spradlin, P; Stängle, H; Steinke, M; Stelzer, J; Stoker, D P; Stroili, R; Strom, D; Stugu, B; Su, D; Sullivan, M K; Summers, D J; Sundermann, J E; T'Jampens, S; Tan, P; Tantot, L; Taras, P; Taylor, F; Taylor, G P; Telnov, A V; Teodorescu, L; Ter-Antonian, R; Therin, G; Thiebaux, C; Thiessen, D; Tiozzo, G; Tisserand, V; Toki, W H; Torrence, E; Tosi, S; Touramanis, C; Treadwell, E; Vasileiadis, G; Vasseur, G; Vavra, J; Verderi, M; Verkerke, W; Vitale, L; Voci, C; Voena, C; Vuagnin, G; Wagner, G; Wagner, S R; Wagoner, D E; Waldi, R; Walsh, J; Wang, K; Wang, P; Wappler, F R; Watson, A T; Weaver, M; Weidemann, A W; Weinstein, A J R; Wenzel, W A; Wilden, L; Williams, D C; Williams, J C; Willocq, S; Wilson, F F; Wilson, J R; Wilson, M G; Wilson, R J; Winter, M A; Wisniewski, W J; Wittgen, M; Won, E; Wong, Q K; Wormser, G; Wright, D H; Wright, D M; Wu, J; Wu, S L; Xie, Y; Yamamoto, R K; Yang, S; Yarritu, A K; Ye, S; Yéche, C; Yi, J; Young, C C; Yu, Z; Yumiceva, F X; Yushkov, A N; Zallo, A; Zeng, Q; Zghiche, A; Zhang, J; Zhang, L; Zhao, H W; Zhu, Y S; Zito, M; De Sangro, R; Del Re, D; La Vaissière, C de

    2004-01-01

    We present updated measurements of the branching fractions for the modes B0->pi0pi0, B+ -> pi+pi0, and B+ -> K+pi0. We also measure the time-integrated asymmetry C_pi0pi0 and the charge asymmetries A_CP(pi+pi0) and A_CP(K+pi0). Based on a sample of approximately 227 million BBar pairs collected by the BaBar detector at the PEP-II asymmetric-energy B Factory at SLAC, we measure BR(B0 -> pi0pi0) = (1.17 +/- 0.32 +/- 0.10)*10^{-6}, C_pi0pi0 = -0.12 +/- 0.56 +/- 0.06, where the first errors are statistical and the second are systematic. The B0 -> pi0pi0 signal has a significance of 4.9sigma including systematic uncertainties. We also measure BR(B+ -> pi+pi0) = (5.8 +/- 0.6 +/- 0.4)*10^{-6}, A_CP(pi+pi0) = -0.01 +/- 0.10 +/- 0.02, BR(B+ -> K+pi0) = (12.0 +/- 0.7 +/- 0.6)*10^{-6}, A_CP(K+pi0) = 0.06 +/- 0.06 +/- 0.01 . Using related BaBar measurements and isospin relations we find an upper bound on the angle difference |delta| = |alpha - alpha_eff| of 35 degrees at the 90% C.L.

  20. Analysis of the $\\pi^+ \\pi^- \\pi^+ \\pi-$ and $\\pi^+ \\pi^{0}\\pi^- \\pi^{0}$ final states in quasi-real two-photon collisions at LEP

    CERN Document Server

    Achard, P; Aguilar-Benítez, M; Alcaraz, J; Alemanni, G; Allaby, J; Aloisio, A; Alviggi, M G; Anderhub, H; Andreev, V P; Anselmo, F; Arefev, A; Azemoon, T; Aziz, T; Bagnaia, P; Bajo, A; Baksay, G; Baksay, L; Baldew, S V; Banerjee, S; Banerjee, Sw; Barczyk, A; Barillère, R; Bartalini, P; Basile, M; Batalova, N; Battiston, R; Bay, A; Becattini, F; Becker, U; Behner, F; Bellucci, L; Berbeco, R; Berdugo, J; Berges, P; Bertucci, B; Betev, B L; Biasini, M; Biglietti, M; Biland, A; Blaising, J J; Blyth, S C; Bobbink, G J; Böhm, A; Boldizsar, L; Borgia, B; Bottai, S; Bourilkov, D; Bourquin, M; Braccini, S; Branson, J G; Brochu, F; Burger, J D; Burger, W J; Cai, X D; Capell, M; Cara Romeo, G; Carlino, G; Cartacci, A; Casaus, J; Cavallari, F; Cavallo, N; Cecchi, C; Cerrada, M; Chamizo-Llatas, M; Chang, Y H; Chemarin, M; Chen, A; Chen, G; Chen, G M; Chen, H F; Chen, H S; Chiefari, G; Cifarelli, L; Cindolo, F; Clare, I; Clare, R; Coignet, G; Colino, N; Costantini, S; de la Cruz, B; Cucciarelli, S; De Asmundis, R; Deglon, P; Debreczeni, J; Degré, A; Dehmelt, K; Deiters, K; Della Volpe, D; Delmeire, E; Denes, P; De Notaristefani, F; De Salvo, A; Diemoz, M; Dierckxsens, M; Dionisi, C; Dittmar, M; Doria, A; Dova, M T; Duchesneau, D; Duda, M; Echenard, B; Eline, A; El-Hage, A; El-Mamouni, H; Engler, A; Eppling, F J; Extermann, P; Falagán, M A; Falciano, S; Favara, A; Fay, J; Fedin, O; Felcini, M; Ferguson, T; Fesefeldt, H; Fiandrini, E; Field, J H; Filthaut, F; Fisher, P H; Fisher, W; Forconi, G; Freudenreich, K; Furetta, C; Galaktionov, Yu; Ganguli, S N; García-Abia, P; Gataullin, M; Gentile, S; Giagu, S; Gong, Z F; Grenier, G; Grimm, O; Grünewald, M W; Guida, M; Gupta, V K; Gurtu, A; Gutay, L J; Haas, D; Hatzifotiadou, D; Hebbeker, T; Hervé, A; Hirschfelder, J; Hofer, H; Hohlmann, M; Holzner, G; Hou, S R; Jin, B N; Jindal, P; Jones, L W; de Jong, P; Josa-Mutuberria, I; Kaur, M; Kienzle-Focacci, M N; Kim, J K; Kirkby, J; Kittel, W; Klimentov, A; König, A C; Kopal, M; Koutsenko, V; Kraber, M; Krämer, R W; Krüger, A; Kunin, A; Ladrón de Guevara, P; Laktineh, I; Landi, G; Lebeau, M; Lebedev, A; Lebrun, P; Lecomte, P; Lecoq, P; Le Coultre, P; Le Goff, J M; Leiste, R; Levtchenko, M; Levchenko, P; Li, C; Likhoded, S; Lin, C H; Lin, W T; Linde, Frank L; Lista, L; Liu, Z A; Lohmann, W; Longo, E; Lü, Y S; Luci, C; Luminari, L; Lustermann, W; Ma, W G; Malgeri, L; Malinin, A; Maña, C; Mans, J; Martin, J P; Marzano, F; Mazumdar, K; McNeil, R R; Mele, S; Merola, L; Meschini, M; Metzger, W J; Mihul, A; Milcent, H; Mirabelli, G; Mnich, J; Mohanty, G B; Muanza, G S; Muijs, A J M; Musy, M; Nagy, S; Natale, S; Napolitano, M; Nessi-Tedaldi, F; Nesterov, S; Newman, H; Nisati, A; Novák, T; Nowak, H; Ofierzynski, R; Organtini, G; Pal, I; Palomares, C; Paolucci, P; Paramatti, R; Passaleva, G; Patricelli, S; Paul, T; Pauluzzi, M; Paus, C; Pauss, F; Pedace, M; Pensotti, S; Perret-Gallix, D; Piccolo, D; Pierella, F; Pieri, M; Pioppi, M; Piroué, P A; Pistolesi, E; Plyaskin, V; Pohl, M; Pozhidaev, V; Pothier, J; Prokofev, D; Rahal-Callot, G; Rahaman, M A; Raics, P; Raja, N; Ramelli, R; Rancoita, P G; Ranieri, R; Raspereza, A; Razis, P; Rembeczki, S; Ren, D; Rescigno, M; Reucroft, S; Riemann, S; Riles, K; Roe, B P; Romero, L; Rosca, A; Rosemann, C; Rosenbleck, C; Rosier-Lees, S; Roth, S; Rubio, J A; Ruggiero, G; Rykaczewski, H; Sakharov, A; Saremi, S; Sarkar, S; Salicio, J; Sánchez, E; Schäfer, C; Schopper, H; Schotanus, D J; Sciacca, C; Servoli, L; Shevchenko, S; Shivarov, N; Shumilov, V Shoutko E; Shvorob, A; Son, D; Souga, C; Spillantini, P; Steuer, M; Stickland, D P; Stoyanov, B; Strässner, A; Sudhakar, K; Sultanov, G G; Sun, L Z; Sushkov, S; Swain, H Suter J D; Szillási, Z; Tang, X W; Tarjan, P; Tauscher, L; Taylor, L; Tellili, B; Teyssier, D; Timmermans, C; Samuel; Ting, C C; Ting, S M; Tonwar, S C; Tóth, J; Tully, C; Tung, K L; Ulbricht, J; Valente, E; Van de Walle, R T; Vásquez, R; Vesztergombi, G; Vetlitskii, I; Viertel, G; Vivargent, M; Vlachos, S; Vodopyanov, I; Vogel, H; Vogt, H; Vorobev, I; Vorobyov, A A; Wadhwa, M; Wang, Q; Wang, X L; Wang, Z M; Weber, M; Wynhoff, S; Xia, L; Xu, Z Z; Yamamoto, J; Yang, B Z; Yang, C G; Yang, H J; Yang, M; Yeh, S C; Zalite, A; Zalite, Yu; Zhang, Z P; Zhao, J; Zhu, G Y; Zhu, R Y; Zhuang, H L; Zichichi, A; Zimmermann, B; Zöller, M

    2006-01-01

    The reactions gamma gamma -> pi^+pi^-pi^+pi^- and gamma gamma -> pi^+pi^0pi^-pi^0 are studied with the L3 detector at LEP in a data sample collected at centre-of-mass energies from 161GeV to 209GeV with a total integrated luminosity of 698/pb. A spin-parity-helicity analysis of the rho^0 rho^0 and rho^+ rho^- systems for two-photon centre-of-mass energies between 1GeV and 3GeV shows the dominance of the spin-parity state 2+ with helicity 2. The contribution of 0+ and 0- spin-parity states is also observed, whereas contributions of 2- states and of a state with spin-parity 2+ and zero helicity are found to be negligible.

  1. The $e^+ e^-\\to 2(\\pi^+\\pi^-)\\pi^0$, 2(\\pi^+\\pi^-)\\eta$, $K^+ K^-\\pi^+\\pi^-\\pi^0$ and $K^+ K^-\\pi^+\\pi^-\\eta$ Cross Sections Measured with Initial-State Radiation

    CERN Document Server

    Aubert, B; Boutigny, D; Karyotakis, Yu; Lees, J P; Poireau, V; Prudent, X; Tisserand, V; Zghiche, A; Garra Tico, J; Graugès-Pous, E; López, L; Palano, A; Pappagallo, M; Eigen, G; Stugu, B; Sun, L; Abrams, G S; Battaglia, M; Brown, D N; Button-Shafer, J; Cahn, R N; Groysman, Y; Jacobsen, R G; Kadyk, J A; Kerth, L T; Kolomensky, Yu G; Kukartsev, G; Lopes-Pegna, D; Lynch, G; Mir, L M; Orimoto, T J; Osipenkov, I L; Ronan, M T; Tackmann, K; Tanabé, T; Wenzel, W A; Del Amo-Sánchez, P; Hawkes, C M; Watson, A T; Koch, H; Schröder, T; Walker, D; Asgeirsson, D J; Çuhadar-Dönszelmann, T; Fulsom, B G; Hearty, C; Mattison, T S; McKenna, J A; Barrett, M; Khan, A; Saleem, M; Teodorescu, L; Blinov, V E; Bukin, A D; Druzhinin, V P; Golubev, V B; Onuchin, A P; Serednyakov, S I; Skovpen, Yu I; Solodov, E P; Todyshev, K Yu; Bondioli, M; Curry, S; Eschrich, I; Kirkby, D; Lankford, A J; Lund, P; Mandelkern, M; Martin, E C; Stoker, D P; Abachi, S; Foulkes, C; Buchanan S D; Gary, J W; Liu, F; Long, O; Shen, B C; Vitug, G M; Zhang, L; Paar, H P; Rahatlou, S; Sharma, V; Berryhill, J W; Campagnari, C; Cunha, A; Dahmes, B; Hong, T M; Kovalskyi, D; Richman, J D; Beck, T W; Eisner, A M; Flacco, C J; Heusch, C A; Kroseberg, J; Lockman, W S; Schalk, T; Schumm, B A; Seiden, A; Wilson, M G; Winstrom, L O; Chen, E; Cheng, C H; Fang, F; Hitlin, D G; Narsky, I; Piatenko, T; Porter, F C; Mancinelli, G; Meadows, B T; Mishra, K; Sokoloff, M D; Blanc, F; Bloom, P C; Chen, S; Ford, W T; Hirschauer, J F; Kreisel, A; Nagel, M; Nauenberg, U; Olivas, A; Smith, J G; Ulmer, K A; Wagner, S R; Zhang, J; Gabareen, A M; Soffer, A; Toki, W H; Wilson, R J; Winklmeier, F; Altenburg, D D; Feltresi, E; Hauke, A; Jasper, H; Merkel, J; Petzold, A; Spaan, B; Wacker, K; Klose, V; Kobel, M J; Lacker, H M; Mader, W F; Nogowski, R; Schubert, J; Schubert, K R; Schwierz, R; Sundermann, J E; Volk, A; Bernard, D; Bonneaud, G R; Latour, E; Lombardo, V; Thiebaux, C; Verderi, M; Clark, P J; Gradl, W; Muheim, F; Playfer, S; Robertson, A I; Watson, J E; Xie, Y; Bettoni, D; Bozzi, C; Calabrese, R; Cecchi, A; Cibinetto, G; Franchini, P; Luppi, E; Negrini, M; Petrella, A; Piemontese, L; Prencipe, E; Santoro, V; Anulli, F; Baldini-Ferroli, R; Calcaterra, A; De Sangro, R; Finocchiaro, G; Pacetti, S; Patteri, P; Peruzzi, I M; Piccolo, M; Rama, M; Zallo, A; Buzzo, A; Contri, R; Lo Vetere, M; Macri, M M; Monge, M R; Passaggio, S; Patrignani, C; Robutti, E; Santroni, A; Tosi, S; Chaisanguanthum, K S; Morii, M; Wu, J; Dubitzky, R S; Marks, J; Schenk, S; Uwer, U; Bard, D J; Dauncey, P D; Flack, R L; Nash, J A; Panduro-Vazquez, W; Tibbetts, M; Behera, P K; Chai, X; Charles, M J; Mallik, U; Cochran, J; Crawley, H B; Dong, L; Eyges, V; Meyer, W T; Prell, S; Rosenberg, E I; Rubin, A E; Gao, Y Y; Gritsan, A V; Guo, Z J; Lae, C K; Denig, A G; Fritsch, M; Schott, G; Arnaud, N; Bquilleux, J; D'Orazio, A; Davier, M; Grosdidier, G; Höcker, A; Lepeltier, V; Le Diberder, F; Lutz, A M; Pruvot, S; Rodier, S; Roudeau, P; Schune, M H; Serrano, J; Sordini, V; Stocchi, A; Wang, W F; Wormser, G; Lange, D J; Wright, D M; Bingham, I; Burke, J P; Chavez, C A; Fry, J R; Gabathuler, E; Gamet, R; Hutchcroft, D E; Payne, D J; Schofield, K C; Touramanis, C; Bevan, A J; George, K A; Di Lodovico, F; Sacco, R; Cowan, G; Flächer, H U; Hopkins, D A; Paramesvaran, S; Salvatore, F; Wren, A C; Brown, D N; Davis, C L; Allison, J; Bailey, D; Barlow, N R; Barlow, R J; Chia, Y M; Edgar, C L; Lafferty, G D; West, T J; Yi, J I; Chen, C; Jawahery, A; Roberts, D A; Simi, G; Tuggle, J M; Blaylock, G; Dallapiccola, C; Hertzbach, S S; Li, X; Moore, T B; Salvati, E; Saremi, S; Cowan, R; Dujmic, D; Fisher, P H; Koeneke, K; Sciolla, G; Spitznagel, M; Taylor, F; Yamamoto, R K; Zhao, M; Zheng, Y; Mclachlin, S E; Patel, P M; Robertson, S H; Lazzaro, A; Palombo, F; Bauer, J M; Cremaldi, L; Eschenburg, V; Godang, R; Kroeger, R; Sanders, D A; Summers, D J; Zhao, H W; Brunet, S; Côté, D; Simard, M; Taras, P; Viaud, F B; Nicholson, H; De Nardo, Gallieno; Fabozzi, F; Lista, L; Monorchio, D; Sciacca, C; Baak, M A; Raven, G; Snoek, H L

    2007-01-01

    We study the processes $e^+ e^-\\to 2(\\pi^+\\pi^-)\\pi^0\\gamma$, $2(\\pi^+\\pi^-)\\eta\\gamma$, $K^+ K^-\\pi^+\\pi^-\\pi^0\\gamma$ and $K^+ K^-\\pi^+\\pi^-\\eta\\gamma$ with the hard photon radiated from the initial state. About 20000, 4300, 5500 and 375 fully reconstructed events, respectively, are selected from 232 fb$^{-1}$ of BaBar data. The invariant mass of the hadronic final state defines the effective $e^+ e^-$ center-of-mass energy, so that the obtained cross sections from the threshold to about 5 GeV can be compared with corresponding direct \\epem measurements, currently available only for the $\\eta\\pi^+\\pi^-$ and $\\omega\\pi^+\\pi^-$ submodes of the $e^+ e^-\\to 2(\\pi^+\\pi^-)\\pi^0$ channel. Studying the structure of these events, we find contributions from a number of intermediate states, and we extract their cross sections where possible. In particular, we isolate the contribution from $e^+ e^-\\to\\omega(782)\\pi^+\\pi^-$ and study the $\\omega(1420)$ and $\\omega(1650)$ resonances. In the charmonium region, we observe ...

  2. Measurement of the matrix elements for the decays eta -> pi(+)pi(-)pi(0) and eta/eta ' -> pi(0)pi(0)pi(0)

    NARCIS (Netherlands)

    Ablikim, M.; Achasov, M. N.; Ai, X.C.; Albayrak, O.; Albrecht, M.; Ambrose, D. J.; Amoroso, A.; Haddadi, Z.; Kalantar-Nayestanaki, N.; Kavatsyuk, M.; Loehner, H.; Messchendorp, J.G.; Tiemens, M.

    2015-01-01

    Based on a sample of 1.31 x 10(9) J/psi events collected with the BESIII detector at the BEPCII collider, Dalitz plot analyses of selected 79,625 eta -> pi(+)pi(-)pi(0) events, 33,908 eta -> pi(0)pi(0)pi(0) events, and 1,888 eta' -> pi(0)pi(0)pi(0) events are performed. The measured matrix elements

  3. On the B -> pi pi puzzle

    CERN Document Server

    Li, H; Li, Hsiang-nan; Mishima, Satoshi

    2006-01-01

    We investigate the resolutions in the literature to the B -> pi pi puzzle arising from the large observed B^0 -> pi^0 pi^0 branching ratio, and conclude that the puzzle still stands. The next-to-leading-order (NLO) contributions from the vertex corrections, the quark loops, and the magnetic penguin evaluated in the perturbative QCD approach, having saturated the experimental upper bound of the B^0 -> rho^0 rho^0 branching ratio, do not help. The inclusion of the NLO jet function from the soft-collinear effective theory into the QCD-improved factorization approach, though enhancing the B^0 -> pi^0 pi^0 branching ratio sufficiently, deteriorates the predictions for the B^\\pm -> pi^0 K^\\pm and B^0 -> pi^\\mp K^\\pm direct CP asymmetries, and overshoots the bound of the B^0 -> rho^0 rho^0 branching ratio. The effect of final-state interaction through either elastic or inelastic channels has been constrained by the B -> pi K data, and is not enough to resolve the B -> pi pi puzzle.

  4. pi pi correlations in gamma+A reactions

    NARCIS (Netherlands)

    Messchendorp, JG

    2003-01-01

    Preliminary differential cross-sections of the reactions A(gamma,pi(0)pi(0)) and A(gamma,pi(0)pi(+) + pi(0)pi(-)) with A = H-1, C-12, and Pb-nat are presented. A significant nuclear-mass dependence of the pipi invariant-mass distribution is found in the pi(0)pi(0) channel. The dependence is not obse

  5. Resolution of the B -> pi pi, pi K puzzles

    CERN Document Server

    Li, Hsiang-nan

    2009-01-01

    We show that there exist uncanceled soft divergences in the k_T factorization for nonfactorizable amplitudes of two-body nonleptonic B meson decays, similar to those identified in hadron-hadron collisions. Viewing the special role of the pion as a q qbar bound state and as a pseudo Nambu-Goldstone boson, we associate a soft factor with it in the perturbative QCD formalism. This soft factor enhances the nonfactorizable color-suppressed tree amplitudes, such that the branching ratios B(pi^0 pi^0) and B(pi^0 rho^0) are increased under the constraint of the B(rho^0 rho^0) data, the difference between the direct CP asymmetries A_{CP}(pi^\\mp K^\\pm) and A_{CP}(pi^0 K^\\pm) is enlarged, and the mixing-induced CP asymmetry S_{pi^0 K_S} is reduced. That is, the known pi pi and pi K puzzles can be resolved simultaneously.

  6. Extraction of the $\\pi^+\\pi^-$ Subsystem in Diffractively Produced $\\pi^-\\pi^+\\pi^-$ at COMPASS

    CERN Document Server

    Krinner, Fabian

    2017-01-01

    The COMPASS experiment at CERN has collected a large data sample of 50 million diffractively produced $\\pi^-\\pi^+\\pi^-$ events using a $190\\,$GeV$/c$ negatively charged hadron beam. The partial-wave analysis (PWA) of these high-precision data reveals previously unseen details. The PWA, which is currently limited by systematic uncertainties, is based on an isobar model, where multi-particle decays are described as subsequent two-body decays and where a prior-knowledge parametrization for the intermediate two-pion resonances has to be assumed -- usually a Breit-Wigner amplitude -- thus increasing systematic uncertainties, due to the concrete choice of the parametrization. We present a novel method, which allows to extract isobar amplitudes directly from the data in a less biased way. The focus lies on the scalar $\\pi^+\\pi^-$ subsystem, where a previous analysis found a signal for a new axial-vector state $a_1(1420)$ decaying into $f_0(980)\\pi$.

  7. Search for $CP$ violation in $D^{0} \\to \\pi^{-} \\pi^{+} \\pi^{+} \\pi^{-}$ decays

    CERN Document Server

    The LHCb Collaboration

    2012-01-01

    We perform the first model-independent search for $CP$ violating variations in the phase space distribution of a four-body decay. We study the singly Cabibbo suppressed decay $D^{0} \\to \\pi^{-} \\pi^{+} \\pi^{+} \\pi^{-}$, using approximately 180k signal events in LHCb's 2011 dataset of 1.0 fb^{-1}. No evidence for $CP$ violation is observed.

  8. $K \\to \\pi \\pi \\pi \\gamma$ in chiral perturbation theory

    CERN Document Server

    D'Ambrosio, G; Isidori, Gino; Neufeld, H

    1996-01-01

    We present a complete analysis of K -> 3 pi gamma decays to O(p^4) in the low-energy expansion of the Standard Model. We employ the notion of "generalized bremsstrahlung" to take full advantage of experimental information on the corresponding non-radiative K -> 3 pi decays.

  9. Determination of $\\pi\\pi$ scattering lengths from measurement of $\\pi^+\\pi^-$ atom lifetime

    CERN Document Server

    Adeva, B; Benayoun, M; Benelli, A; Berka, Z; Brekhovskikh, V; Caragheorgheopol, G; Cechak, T; Chiba, M; Chliapnikov, P V; Ciocarlan, C; Constantinescu, S; Costantini, S; Curceanu, C; Doskarova, P; Dreossi, D; Drijard, D; Dudarev, A; Ferro-Luzzi, M; Fungueiriño Pazos, J L; Gallas Torreira, M; Gerndt, J; Gianotti, P; Goldin, D; Gomez, F; Gorin, A; Gorchakov, O; Guaraldo, C; Gugiu, M; Hansroul, M; Hons, Z; Hosek, R; Iliescu, M; Karpukhin, V; Kluson, J; Kobayashi, M; Kokkas, P; Komarov, V; Kruglov, V; Kruglova, L; Kulikov, A; Kuptsov, A; Kuroda, K I; Lamberto, A; Lanaro, A; Lapshin, V; Lednicky, R; Leruste, P; Levi Sandri, P; Lopez Aguera, A; Lucherini, V; Maki, T; Manuilov, I; Marin, J; Narjoux, J L; Nemenov, L; Nikitin, M; Nunez Pardo, T; Okada, K; Olchevskii, V; Pazos, A; Pentia, M; Penzo, A; Perreau, J M; Plo, M; Ponta, T; Rappazzo, G F; Riazantsev, A; Rodriguez, J M; Rodriguez Fernandez, A; Romero Vidal, A; Ronjin, V.M.; Rykalin, V; Saborido, J; Santamarina, C; Schacher, J; Schuetz, C; Sidorov, A; Smolik, J; Takeutchi, F; Tarasov, A; Tauscher, L; Tobar, M J; Trojek, T; Trusov, S; Utkin, V; Vazquez Doce, O; Vlachos, S; Voskresenskaya, O; Vrba, T; Willmott, C; Yazkov, V; Yoshimura, Y; Zhabitsky, M; Zrelov, P

    2011-01-01

    The DIRAC experiment at CERN has achieved a sizeable production of $\\pi^+\\pi^-$ atoms and has significantly improved the precision on its lifetime determination. From a sample of 21227 atomic pairs, a 4% measurement of the S-wave $\\pi\\pi$ scattering length difference $|a_0-a_2| = (.0.2533^{+0.0080}_{-0.0078}|_\\mathrm{stat}.{}^{+0.0078}_{-0.0073}|_\\mathrm{syst})M_{\\pi^+}^{-1}$ has been attained, providing an important test of Chiral Perturbation Theory.

  10. Amplitude analysis of $D^{0} \\rightarrow \\pi^{+} \\pi^{-} \\pi^{+} \\pi^{-}$ decays using CLEO-c data

    CERN Document Server

    d'Argent, Philippe; Dalseno, Jeremy; Gersabeck, Evelina; Harnew, Sam; Naik, Paras; Prouve, Claire; Rademacker, Jonas; Skidmore, Nicola

    2016-01-01

    The resonant substructure of the decay $D^{0} \\rightarrow \\pi^{+} \\pi^{-} \\pi^{+} \\pi^{-}$ is studied by performing a full five-dimensional amplitude analysis. Preliminary results based on data collected by the CLEO-c detector are presented. This is the largest dataset of $D^{0} \\rightarrow \\pi^{+} \\pi^{-} \\pi^{+} \\pi^{-}$ decays analysed in this way to-date. The two most significant contributions are $D^{0} \\rightarrow a_{1}(1260)^{+} \\pi^{-}$ and $D^{0} \\rightarrow \\rho(770)^{0}\\rho(770)^{0}$. The line shape, mass and width of the $a_{1}(1260)$ resonance are determined, and model-independent studies of the line shapes of several resonant contributions are preformed.

  11. The pi-pi mass spectrum in Y(4260) -> pi-pi-J/psi

    CERN Document Server

    Bugg, D V

    2007-01-01

    Three ways of fitting the pi-pi mass spectrum in Y(4260) decays are studied. Data presented recently by Belle cannot be fitted by the pi-pi S-wave intensity for elastic scattering. They can be fitted by adding a rather arbitrary destructive interference with the sigma pole term. A better fit may be obtained with the decay sequence Y -> pi-H, H -> pi-J/psi, where H is a JPC=1-- hybrid or c-cbar-q-qbar state peaking at 4.0 GeV with a width ~280 MeV. A third possibility, involving a triangle diagram due to Y(4260)-> DD_1(2420), D_1->D*(2007)-pi, DD*->pi-J/psi fails to fit the data. The first and second possibilities could be resolved by analysis of the Y(4260) Dalitz plot and pi-J/psi mass projection, not presently publicly available.

  12. Study of $B^{0} \\rightarrow D^{*-}\\pi^{+}\\pi^{-}\\pi^{+}$ and $B^{0} \\rightarrow D^{*-}K^{+}\\pi^{-}\\pi^{+}$ decays

    CERN Document Server

    Aaij, R; Adametz, A; Adeva, B; Adinolfi, M; Adrover, C; Affolder, A; Ajaltouni, Z; Albrecht, J; Alessio, F; Alexander, M; Ali, S; Alkhazov, G; Alvarez Cartelle, P; Alves Jr, A A; Amato, S; Amhis, Y; Anderlini, L; Anderson, J; Andreassen, R; Appleby, R B; Aquines Gutierrez, O; Archilli, F; Artamonov, A; Artuso, M; Aslanides, E; Auriemma, G; Bachmann, S; Back, J J; Baesso, C; Balagura, V; Baldini, W; Barlow, R J; Barschel, C; Barsuk, S; Barter, W; Bauer, Th; Bay, A; Beddow, J; Bediaga, I; Belogurov, S; Belous, K; Belyaev, I; Ben-Haim, E; Benayoun, M; Bencivenni, G; Benson, S; Benton, J; Berezhnoy, A; Bernet, R; Bettler, M -O; van Beuzekom, M; Bien, A; Bifani, S; Bird, T; Bizzeti, A; Bjørnstad, P M; Blake, T; Blanc, F; Blanks, C; Blouw, J; Blusk, S; Bobrov, A; Bocci, V; Bondar, A; Bondar, N; Bonivento, W; Borghi, S; Borgia, A; Bowcock, T J V; Bowen, E; Bozzi, C; Brambach, T; van den Brand, J; Bressieux, J; Brett, D; Britsch, M; Britton, T; Brook, N H; Brown, H; Burducea, I; Bursche, A; Buytaert, J; Cadeddu, S; Callot, O; Calvi, M; Calvo Gomez, M; Camboni, A; Campana, P; Carbone, A; Carboni, G; Cardinale, R; Cardini, A; Carranza-Mejia, H; Carson, L; Carvalho Akiba, K; Casse, G; Cattaneo, M; Cauet, Ch; Charles, M; Charpentier, Ph; Chen, P; Chiapolini, N; Chrzaszcz, M; Ciba, K; Cid Vidal, X; Ciezarek, G; Clarke, P E L; Clemencic, M; Cliff, H V; Closier, J; Coca, C; Coco, V; Cogan, J; Cogneras, E; Collins, P; Comerma-Montells, A; Contu, A; Cook, A; Coombes, M; Coquereau, S; Corti, G; Couturier, B; Cowan, G A; Craik, D; Cunliffe, S; Currie, R; D'Ambrosio, C; David, P; David, P N Y; De Bonis, I; De Bruyn, K; De Capua, S; De Cian, M; De Miranda, J M; De Paula, L; De Silva, W; De Simone, P; Decamp, D; Deckenhoff, M; Degaudenzi, H; Del Buono, L; Deplano, C; Derkach, D; Deschamps, O; Dettori, F; Di Canto, A; Dickens, J; Dijkstra, H; Dogaru, M; Domingo Bonal, F; Donleavy, S; Dordei, F; Dosil Suárez, A; Dossett, D; Dovbnya, A; Dupertuis, F; Dzhelyadin, R; Dziurda, A; Dzyuba, A; Easo, S; Egede, U; Egorychev, V; Eidelman, S; van Eijk, D; Eisenhardt, S; Eitschberger, U; Ekelhof, R; Eklund, L; El Rifai, I; Elsasser, Ch; Elsby, D; Falabella, A; Färber, C; Fardell, G; Farinelli, C; Farry, S; Fave, V; Ferguson, D; Fernandez Albor, V; Ferreira Rodrigues, F; Ferro-Luzzi, M; Filippov, S; Fitzpatrick, C; Fontana, M; Fontanelli, F; Forty, R; Francisco, O; Frank, M; Frei, C; Frosini, M; Furcas, S; Furfaro, E; Gallas Torreira, A; Galli, D; Gandelman, M; Gandini, P; Gao, Y; Garofoli, J; Garosi, P; Garra Tico, J; Garrido, L; Gaspar, C; Gauld, R; Gersabeck, E; Gersabeck, M; Gershon, T; Ghez, Ph; Gibson, V; Gligorov, V V; Göbel, C; Golubkov, D; Golutvin, A; Gomes, A; Gordon, H; Grabalosa Gándara, M; Graciani Diaz, R; Granado Cardoso, L A; Graugés, E; Graziani, G; Grecu, A; Greening, E; Gregson, S; Grünberg, O; Gui, B; Gushchin, E; Guz, Yu; Gys, T; Hadjivasiliou, C; Haefeli, G; Haen, C; Haines, S C; Hall, S; Hampson, T; Hansmann-Menzemer, S; Harnew, N; Harnew, S T; Harrison, J; Harrison, P F; Hartmann, T; He, J; Heijne, V; Hennessy, K; Henrard, P; Hernando Morata, J A; van Herwijnen, E; Hicks, E; Hill, D; Hoballah, M; Hombach, C; Hopchev, P; Hulsbergen, W; Hunt, P; Huse, T; Hussain, N; Hutchcroft, D; Hynds, D; Iakovenko, V; Ilten, P; Jacobsson, R; Jaeger, A; Jans, E; Jansen, F; Jaton, P; Jing, F; John, M; Johnson, D; Jones, C R; Jost, B; Kaballo, M; Kandybei, S; Karacson, M; Karbach, T M; Kenyon, I R; Kerzel, U; Ketel, T; Keune, A; Khanji, B; Kochebina, O; Komarov, I; Koopman, R F; Koppenburg, P; Korolev, M; Kozlinskiy, A; Kravchuk, L; Kreplin, K; Kreps, M; Krocker, G; Krokovny, P; Kruse, F; Kucharczyk, M; Kudryavtsev, V; Kvaratskheliya, T; La Thi, V N; Lacarrere, D; Lafferty, G; Lai, A; Lambert, D; Lambert, R W; Lanciotti, E; Lanfranchi, G; Langenbruch, C; Latham, T; Lazzeroni, C; Le Gac, R; van Leerdam, J; Lees, J -P; Lefèvre, R; Leflat, A; Lefrançois, J; Leroy, O; Li, Y; Li Gioi, L; Liles, M; Lindner, R; Linn, C; Liu, B; Liu, G; von Loeben, J; Lopes, J H; Lopez Asamar, E; Lopez-March, N; Lu, H; Luisier, J; Luo, H; Machefert, F; Machikhiliyan, I V; Maciuc, F; Maev, O; Malde, S; Manca, G; Mancinelli, G; Mangiafave, N; Marconi, U; Märki, R; Marks, J; Martellotti, G; Martens, A; Martin, L; Martín Sánchez, A; Martinelli, M; Martinez Santos, D; Martins Tostes, D; Massafferri, A; Matev, R; Mathe, Z; Matteuzzi, C; Matveev, M; Maurice, E; Mazurov, A; McCarthy, J; McNulty, R; Meadows, B; Meier, F; Meissner, M; Merk, M; Milanes, D A; Minard, M -N; Molina Rodriguez, J; Monteil, S; Moran, D; Morawski, P; Mountain, R; Mous, I; Muheim, F; Müller, K; Muresan, R; Muryn, B; Muster, B; Naik, P; Nakada, T; Nandakumar, R; Nasteva, I; Needham, M; Neufeld, N; Nguyen, A D; Nguyen, T D; Nguyen-Mau, C; Nicol, M; Niess, V; Niet, R; Nikitin, N; Nikodem, T; Nisar, S; Nomerotski, A; Novoselov, A; Oblakowska-Mucha, A; Obraztsov, V; Oggero, S; Ogilvy, S; Okhrimenko, O; Oldeman, R; Orlandea, M; Otalora Goicochea, J M; Owen, P; Pal, B K; Palano, A; Palutan, M; Panman, J; Papanestis, A; Pappagallo, M; Parkes, C; Parkinson, C J; Passaleva, G; Patel, G D; Patel, M; Patrick, G N; Patrignani, C; Pavel-Nicorescu, C; Pazos Alvarez, A; Pellegrino, A; Penso, G; Pepe Altarelli, M; Perazzini, S; Perego, D L; Perez Trigo, E; Pérez-Calero Yzquierdo, A; Perret, P; Perrin-Terrin, M; Pessina, G; Petridis, K; Petrolini, A; Phan, A; Picatoste Olloqui, E; Pietrzyk, B; Pilař, T; Pinci, D; Playfer, S; Plo Casasus, M; Polci, F; Polok, G; Poluektov, A; Polycarpo, E; Popov, D; Popovici, B; Potterat, C; Powell, A; Prisciandaro, J; Pugatch, V; Puig Navarro, A; Qian, W; Rademacker, J H; Rakotomiaramanana, B; Rangel, M S; Raniuk, I; Rauschmayr, N; Raven, G; Redford, S; Reid, M M; dos Reis, A C; Ricciardi, S; Richards, A; Rinnert, K; Rives Molina, V; Roa Romero, D A; Robbe, P; Rodrigues, E; Rodriguez Perez, P; Rogers, G J; Roiser, S; Romanovsky, V; Romero Vidal, A; Rouvinet, J; Ruf, T; Ruiz, H; Sabatino, G; Saborido Silva, J J; Sagidova, N; Sail, P; Saitta, B; Salzmann, C; Sanmartin Sedes, B; Sannino, M; Santacesaria, R; Santamarina Rios, C; Santovetti, E; Sapunov, M; Sarti, A; Satriano, C; Satta, A; Savrie, M; Savrina, D; Schaack, P; Schiller, M; Schindler, H; Schleich, S; Schlupp, M; Schmelling, M; Schmidt, B; Schneider, O; Schopper, A; Schune, M -H; Schwemmer, R; Sciascia, B; Sciubba, A; Seco, M; Semennikov, A; Senderowska, K; Sepp, I; Serra, N; Serrano, J; Seyfert, P; Shapkin, M; Shapoval, I; Shatalov, P; Shcheglov, Y; Shears, T; Shekhtman, L; Shevchenko, O; Shevchenko, V; Shires, A; Silva Coutinho, R; Skwarnicki, T; Smith, N A; Smith, E; Smith, M; Sobczak, K; Sokoloff, M D; Soler, F J P; Soomro, F; Souza, D; Souza De Paula, B; Spaan, B; Sparkes, A; Spradlin, P; Stagni, F; Stahl, S; Steinkamp, O; Stoica, S; Stone, S; Storaci, B; Straticiuc, M; Straumann, U; Subbiah, V K; Swientek, S; Syropoulos, V; Szczekowski, M; Szczypka, P; Szumlak, T; T'Jampens, S; Teklishyn, M; Teodorescu, E; Teubert, F; Thomas, C; Thomas, E; van Tilburg, J; Tisserand, V; Tobin, M; Tolk, S; Tonelli, D; Topp-Joergensen, S; Torr, N; Tournefier, E; Tourneur, S; Tran, M T; Tresch, M; Tsaregorodtsev, A; Tsopelas, P; Tuning, N; Ubeda Garcia, M; Ukleja, A; Urner, D; Uwer, U; Vagnoni, V; Valenti, G; Vazquez Gomez, R; Vazquez Regueiro, P; Vecchi, S; Velthuis, J J; Veltri, M; Veneziano, G; Vesterinen, M; Viaud, B; Vieira, D; Vilasis-Cardona, X; Vollhardt, A; Volyanskyy, D; Voong, D; Vorobyev, A; Vorobyev, V; Voß, C; Voss, H; Waldi, R; Wallace, R; Wandernoth, S; Wang, J; Ward, D R; Watson, N K; Webber, A D; Websdale, D; Whitehead, M; Wicht, J; Wiechczynski, J; Wiedner, D; Wiggers, L; Wilkinson, G; Williams, M P; Williams, M; Wilson, F F; Wishahi, J; Witek, M; Wotton, S A; Wright, S; Wu, S; Wyllie, K; Xie, Y; Xing, F; Xing, Z; Yang, Z; Young, R; Yuan, X; Yushchenko, O; Zangoli, M; Zavertyaev, M; Zhang, F; Zhang, L; Zhang, W C; Zhang, Y; Zhelezov, A; Zhong, L; Zvyagin, A

    2013-01-01

    Using proton-proton collision data collected by the LHCb experiment at $\\sqrt{s} =$ 7 TeV, corresponding to an integrated luminosity of 1.0 fb$^{-1}$, the ratio of branching fractions of the $B^{0}\\rightarrow D^{*-}\\pi^{+}\\pi^{-}\\pi^{+}$ decay relative to the $B^{0} \\rightarrow D^{*-}\\pi^{+}$ decay is measured to be \\begin{equation*} \\frac{\\mathcal{B}(B^{0}\\rightarrow D^{*-}\\pi^{+}\\pi^{-}\\pi^{+})}{\\mathcal{B}(B^{0} \\rightarrow D^{*-}\\pi^{+})} = 2.64 \\pm 0.04\\,(\\text{stat.}) \\pm 0.13\\,(\\text{syst.})\\, . \\label{eq:CF_BF_ratio_result} \\end{equation*} The Cabibbo-suppressed decay $B^{0}\\rightarrow D^{*-}K^{+}\\pi^{-}\\pi^{+}$ is observed for the first time and the measured ratio of branching fractions is \\begin{equation*} \\frac{\\mathcal{B}(B^{0}\\rightarrow D^{*-}K^{+}\\pi^{-}\\pi^{+})}{\\mathcal{B}(B^{0} \\rightarrow D^{*-}\\pi^{+}\\pi^{-}\\pi^{+})} = (6.47 \\pm 0.37\\,(\\text{stat.}) \\pm 0.35\\,(\\text{syst.})) \\times 10^{-2} \\label{eq:CS_BF_ratio_result}\\, . \\end{equation*} A search for orbital excitations of charm mesons co...

  13. Raspberry Pi gaming

    CERN Document Server

    Silverman, Shea

    2015-01-01

    If you are someone who loves to play games and are interested in learning more about the capabilities of your Raspberry Pi, this book is for you. Basic knowledge of Raspberry Pi programming is expected.

  14. Study of B- -> DK-pi(+)pi(-) and B- -> D pi(-)pi(+)pi(-) decays and determination of the CKM angle gamma

    NARCIS (Netherlands)

    Aaij, R.; Adeva, B.; Adinolfi, M.; Affolder, A.; Ajaltouni, Z.; Akar, S.; Albrecht, J.; Alessio, F.; Alexander, M.; Ali, S.; Alkhazov, G.; Cartelle, P. Alvarez; Alves, A. A.; Amato, S.; Amerio, S.; Amhis, Y.; An, L.; Anderlini, L.; Anderson, J.; Andreotti, M.; Andrews, J. E.; Appleby, R. B.; Gutierrez, O. Aquines; Archilli, F.; d'Argent, P.; Artamonov, A.; Artuso, M.; Aslanides, E.; Auriemma, G.; Baalouch, M.; Bachmann, S.; Back, J. J.; Badalov, A.; Baesso, C.; Baldini, W.; Barlow, R. J.; Barschel, C.; Barsuk, S.; Barter, W.; Batozskaya, V.; Battista, V.; Bay, A.; Beaucourt, L.; Beddow, J.; Bedeschi, F.; Bediaga, I.; Bel, L. J.; Belyaev, I.; Ben-Haim, E.; Bencivenni, G.; Benson, S.; Benton, J.; Berezhnoy, A.; Bernet, R.; Bertolin, A.; Bettler, M. -O.; van Beuzekom, M.; Bien, A.; Bifani, S.; Bird, T.; Birnkraut, A.; Bizzeti, A.; Blake, T.; Blanc, F.; Blouw, J.; Blusk, S.; Bocci, V.; Bondar, A.; Bondar, N.; Bonivento, W.; Borghi, S.; Borsato, M.; Bowcock, T. J. V.; Bowen, E.; Bozzi, C.; Braun, S.; Brett, D.; Britsch, M.; Britton, T.; Brodzicka, J.; Brook, N. H.; Bursche, A.; Buytaert, J.; Cadeddu, S.; Calabrese, R.; Calvi, M.; Calvo Gomez, M.; Campana, P.; Perez, D. Campora; Capriotti, L.; Carbone, A.; Carboni, G.; Cardinale, R.; Cardini, A.; Carniti, P.; Carson, L.; Carvalho Akiba, K.; Casanova Mohr, R.; Casse, G.; Cassina, L.; Garcia, L. Castillo; Cattaneo, M.; Cauet, Ch.; Cavallero, G.; Cenci, R.; Charles, M.; Charpentier, Ph.; Chefdeville, M.; Chen, S.; Cheung, S. -F.; Chiapolini, N.; Chrzaszcz, M.; Vidal, X. Cid; Ciezarek, G.; Clarke, P. E. L.; Clemencic, M.; Cliff, H. V.; Closier, J.; Coco, V.; Cogan, J.; Cogneras, E.; Cogoni, V.; Cojocariu, L.; Collazuol, G.; Collins, P.; Comerma-Montells, A.; Contu, A.; Cook, A.; Coombes, M.; Coquereau, S.; Corti, G.; Corvo, M.; Couturier, B.; Cowan, G. A.; Craik, D. C.; Crocombe, A.; Torres, M. Cruz; Cunliffe, S.; Currie, R.; D'Ambrosio, C.; Dalseno, J.; David, P. N. Y.; Davis, A.; De Bruyn, K.; De Capua, S.; De Cian, M.; De Miranda, J. M.; De Paula, L.; De Silva, W.; De Simone, P.; Dean, C. -T.; Decamp, D.; Deckenhoff, M.; Del Buono, L.; Deleage, N.; Derkach, D.; Deschamps, O.; Dettori, F.; Dey, B.; Di Canto, A.; Di Ruscio, F.; Dijkstra, H.; Donleavy, S.; Dordei, F.; Dorigo, M.; Dosil Suarez, A.; Dossett, D.; Dovbnya, A.; Dreimanis, K.; Dufour, L.; Dujany, G.; Dupertuis, F.; Durante, P.; Dzhelyadin, R.; Dziurda, A.; Dzyuba, A.; Easo, S.; Egede, U.; Egorychev, V.; Eidelman, S.; Eisenhardt, S.; Eitschberger, U.; Ekelhof, R.; Eklund, L.; El Rifai, I.; Elsasser, Ch.; Ely, S.; Esen, S.; Evans, H. M.; Evans, T.; Falabella, A.; Faerber, C.; Farinelli, C.; Farley, N.; Farry, S.; Fay, R.; Ferguson, D.; Fernandez Albor, V.; Ferrari, F.; Ferreira Rodrigues, F.; Ferro-Luzzi, M.; Filippov, S.; Fiore, M.; Fiorini, M.; Firlej, M.; Fitzpatrick, C.; Fiutowski, T.; Fohl, K.; Fol, P.; Fontana, M.; Fontanelli, F.; Forty, R.; Francisco, O.; Frank, M.; Frei, C.; Frosini, M.; Fu, J.; Furfaro, E.; Gallas Torreira, A.; Galli, D.; Gallorini, S.; Gambetta, S.; Gandelman, M.; Gandini, P.; Gao, Y.; Garcia Pardinas, J.; Garofoli, J.; Tico, J. Garra; Garrido, L.; Gascon, D.; Gaspar, C.; Gastaldi, U.; Gauld, R.; Gavardi, L.; Gazzoni, G.; Geraci, A.; Gerick, D.; Gersabeck, E.; Gersabeck, M.; Gershon, T.; Ghez, Ph.; Gianelle, A.; Giani, S.; Gibson, V.; Girard, O. G.; Giubega, L.; Gligorov, V. V.; Goebel, C.; Golubkov, D.; Golutvin, A.; Gomes, A.; Gotti, C.; Gandara, M. Grabalosa; Graciani Diaz, R.; Cardoso, L. A. Granado; Grauges, E.; Graverini, E.; Graziani, G.; Grecu, A.; Greening, E.; Gregson, S.; Griffith, P.; Grillo, L.; Gruenberg, O.; Gui, B.; Gushchin, E.; Guz, Yu.; Gys, T.; Hadjivasiliou, C.; Haefeli, G.; Haen, C.; Haines, S. C.; Hall, S.; Hamilton, B.; Hampson, T.; Han, X.; Hansmann-Menzemer, S.; Harnew, N.; Harnew, S. T.; Harrison, J.; He, J.; Head, T.; Heijne, V.; Hennessy, K.; Henrard, P.; Henry, L.; Hernando Morata, J. A.; van Herwijnen, E.; Hess, M.; Hicheur, A.; Hill, D.; Hoballah, M.; Hombach, C.; Hulsbergen, W.; Humair, T.; Hussain, N.; Hutchcroft, D.; Hynds, D.; Idzik, M.; Ilten, P.; Jacobsson, R.; Jaeger, A.; Jalocha, J.; Jans, E.; Jawahery, A.; Jing, F.; John, M.; Johnson, D.; Jones, C. R.; Joram, C.; Jost, B.; Jurik, N.; Kandybei, S.; Kanso, W.; Karacson, M.; Karbach, T. M.; Karodia, S.; Kelsey, M.; Kenyon, I. R.; Kenzie, M.; Ketel, T.; Khanji, B.; Khurewathanakul, C.; Klaver, S.; Klimaszewski, K.; Kochebina, O.; Kolpin, M.; Komarov, I.; Koopman, R. F.; Koppenburg, P.; Korolev, M.; Kravchuk, L.; Kreplin, K.; Kreps, M.; Krocker, G.; Krokovny, P.; Kruse, F.; Kucewicz, W.; Kucharczyk, M.; Kudryavtsev, V.; Kuonen, A. K.; Kurek, K.; Kvaratskheliya, T.; La Thi, V. N.; Lacarrere, D.; Lafferty, G.; Lai, A.; Lambert, D.; Lambert, R. W.; Lanfranchi, G.; Langenbruch, C.; Langhans, B.; Latham, T.; Lazzeroni, C.; Le Gac, R.; van Leerdam, J.; Lees, J. -P.; Lefevre, R.; Leflat, A.; Lefrancois, J.; Leroy, O.; Lesiak, T.; Leverington, B.; Li, Y.; Likhomanenko, T.; Liles, M.; Lindner, R.; Linn, C.; Lionetto, F.; Liu, B.; Liu, X.; Lohn, S.; Longstaff, I.; Lopes, J. H.; Lucchesi, D.; Martinez, M. Lucio; Luo, H.; Lupato, A.; Luppi, E.; Lupton, O.; Machefert, F.; Maciuc, F.; Maev, O.; Maguire, K.; Malde, S.; Malinin, A.; Manca, G.; Mancinelli, G.; Manning, P.; Mapelli, A.; Maratas, J.; Marchand, J. F.; Marconi, U.; Marin Benito, C.; Marino, P.; Mareki, R.; Marks, J.; Martellotti, G.; Martinelli, M.; Santos, D. Martinez; Martinez Vidal, F.; Martins Tostes, D.; Massafferri, A.; Matev, R.; Mathad, A.; Mathe, Z.; Matteuzzi, C.; Matthieu, K.; Mauri, A.; Maurin, B.; Mazurov, A.; McCann, M.; McCarthy, J.; McNab, A.; McNulty, R.; Meadows, B.; Meier, F.; Meissner, M.; Merk, M.; Milanes, D. A.; Minard, M. -N.; Mitzel, D. S.; Molina Rodriguez, J.; Monteil, S.; Morandin, M.; Morawski, P.; Morda, A.; Morello, M. J.; Moron, J.; Morris, A. B.; Mountain, R.; Muheim, F.; Mueller, J.; Mueller, K.; Mueller, V.; Mussini, M.; Muster, B.; Naik, P.; Nakada, T.; Nandakumar, R.; Nasteva, I.; Needham, M.; Neri, N.; Neubert, S.; Neufeld, N.; Neuner, M.; Nguyen, A. D.; Nguyen, T. D.; Nguyen-Mau, C.; Niess, V.; Niet, R.; Nikitin, N.; Nikodem, T.; Ninci, D.; Novoselov, A.; O'Hanlon, D. P.; Oblakowska-Mucha, A.; Obraztsov, V.; Ogilvy, S.; Okhrimenko, O.; Oldeman, R.; Onderwater, C. J. G.; Osorio Rodrigues, B.; Otalora Goicochea, J. M.; Otto, A.; Owen, P.; Oyanguren, A.; Palano, A.; Palombo, F.; Palutan, M.; Panman, J.; Papanestis, A.; Pappagallo, M.; Pappalardo, L. L.; Parkes, C.; Passaleva, G.; Patel, G. D.; Patel, M.; Patrignani, C.; Pearce, A.; Pellegrino, A.; Penso, G.; Altarelli, M. Pepe; Perazzini, S.; Perret, P.; Pescatore, L.; Petridis, K.; Petrolini, A.; Petruzzo, M.; Picatoste Olloqui, E.; Pietrzyk, B.; Pilar, T.; Pinci, D.; Pistone, A.; Piucci, A.; Playfer, S.; Plo Casasus, M.; Poikela, T.; Polci, F.; Poluektov, A.; Polyakov, I.; Polycarpo, E.; Popov, A.; Popov, D.; Popovici, B.; Potterat, C.; Price, E.; Price, J. D.; Prisciandaro, J.; Pritchard, A.; Prouve, C.; Pugatch, V.; Navarro, A. Puig; Punzi, G.; Qian, W.; Quagliani, R.; Rachwal, B.; Rademacker, J. H.; Rakotomiaramanana, B.; Rama, M.; Rangel, M. S.; Raniuk, I.; Rauschmayr, N.; Raven, G.; Redi, F.; Reichert, S.; Reid, M. M.; dos Reis, A. C.; Ricciardi, S.; Richards, S.; Rihl, M.; Rinnert, K.; Rives Molina, V.; Robbe, P.; Rodrigues, A. B.; Rodrigues, E.; Lopez, J. A. Rodriguez; Perez, P. Rodriguez; Roiser, S.; Romanovsky, V.; Romero Vidal, A.; Rotondo, M.; Rouvinet, J.; Ruf, T.; Ruiz, H.; Ruiz Valls, P.; Saborido Silva, J. J.; Sagidova, N.; Sail, P.; Saitta, B.; Salustino Guimaraes, V.; Mayordomo, C. Sanchez; Sanmartin Sedes, B.; Santacesaria, R.; Santamarina Rios, C.; Santimaria, M.; Santovetti, E.; Sarti, A.; Satriano, C.; Satta, A.; Saunders, D. M.; Savrina, D.; Schiller, M.; Schindler, H.; Schlupp, M.; Schmelling, M.; Schmelzer, T.; Schmidt, B.; Schneider, O.; Schopper, A.; Schubiger, M.; Schune, M. -H.; Schwemmer, R.; Sciascia, B.; Sciubba, A.; Semennikov, A.; Sepp, I.; Serra, N.; Serrano, J.; Sestini, L.; Seyfert, P.; Shapkin, M.; Shapoval, I.; Shcheglov, Y.; Shears, T.; Shekhtman, L.; Shevchenko, V.; Shires, A.; Coutinho, R. Silva; Simi, G.; Sirendi, M.; Skidmore, N.; Skillicorn, I.; Skwarnicki, T.; Smith, E.; Smith, E.; Smith, I. T.; Smith, J.; Smith, M.; Snoek, H.; Sokoloff, M. D.; Soler, F. J. P.; Soomro, F.; Souza, D.; Souza De Paula, B.; Spaan, B.; Spradlin, P.; Sridharan, S.; Stagni, F.; Stahl, M.; Stahl, S.; Steinkamp, O.; Stenyakin, O.; Sterpka, F.; Stevenson, S.; Stoica, S.; Stone, S.; Storaci, B.; Stracka, S.; Straticiuc, M.; Straumann, U.; Sun, L.; Sutcliffe, W.; Swientek, K.; Swientek, S.; Syropoulos, V.; Szczekowski, M.; Szczypka, P.; Szumlak, T.; T'Jampens, S.; Tekampe, T.; Teklishyn, M.; Tellarini, G.; Teubert, F.; Thomas, C.; Thomas, E.; van Tilburg, J.; Tisserand, V.; Tobin, M.; Todd, J.; Tolk, S.; Tomassetti, L.; Tonelli, D.; Topp-Joergensen, S.; Torr, N.; Tournefier, E.; Tourneur, S.; Trabelsi, K.; Tran, M. T.; Tresch, M.; Trisovic, A.; Tsaregorodtsev, A.; Tsopelas, P.; Tuning, N.; Ukleja, A.; Ustyuzhanin, A.; Uwer, U.; Vacca, C.; Vagnoni, V.; Valenti, G.; Vallier, A.; Gomez, R. Vazquez; Vazquez Regueiro, P.; Vazquez Sierra, C.; Vecchi, S.; Velthuis, J. J.; Veltri, M.; Veneziano, G.; Vesterinen, M.; Viaud, B.; Vieira, D.; Vieites Diaz, M.; Vilasis-Cardona, X.; Vollhardt, A.; Volyanskyy, D.; Voong, D.; Vorobyev, A.; Vorobyev, V.; Voss, C.; de Vries, J. A.; Waldi, R.; Wallace, C.; Wallace, R.; Walsh, J.; Wandernoth, S.; Wang, J.; Ward, D. R.; Watson, N. K.; Websdale, D.; Weiden, A.; Whitehead, M.; Wiedner, D.; Wilkinson, G.; Wilkinson, M.; Williams, M.; Williams, M. P.; Williams, M.; Williams, T.; Wilson, F. F.; Wimberley, J.; Wishahi, J.; Wislicki, W.; Witek, M.; Wormser, G.; Wotton, S. A.; Wright, S.; Wyllie, K.; Xie, Y.; Xu, Z.; Yang, Z.; Yu, J.; Yuan, X.; Yushchenko, O.; Zangoli, M.; Zavertyaev, M.; Zhang, L.; Zhang, Y.; Zhelezov, A.; Zhokhov, A.; Zhong, L.

    2015-01-01

    We report a study of the suppressed B- -> DK-pi(+)pi(-) and favored B- -> D pi(-)pi(+)pi(-) decays, where the neutral D meson is detected through its decays to the K--/+pi(+/-) and CP -even K+K- and pi(+)pi(-) final states. The measurement is carried out using a proton-proton collision data sample c

  15. Finite volume corrections to pi pi scattering

    Energy Technology Data Exchange (ETDEWEB)

    Sato, Ikuro; Bedaque, Paulo F.; Walker-Loud, Andre

    2006-01-13

    Lattice QCD studies of hadron-hadron interactions are performed by computing the energy levels of the system in a finite box. The shifts in energy levels proportional to inverse powers of the volume are related to scattering parameters in a model independent way. In addition, there are non-universal exponentially suppressed corrections that distort this relation. These terms are proportional to e-m{sub pi} L and become relevant as the chiral limit is approached. In this paper we report on a one-loop chiral perturbation theory calculation of the leading exponential corrections in the case of I=2 pi pi scattering near threshold.

  16. pi-pi correlations in photon-induced reactions

    NARCIS (Netherlands)

    Messchendorp, J

    2003-01-01

    Differential cross sections of the-reactions A(gamma,pi(0) pi(0)) and A(gamma, pi(0) pi(+) + pi(0) pi(-)) with A=H-1, C-12, and Pb-nat are presented. A significant. nuclear-mass dependence of the pipi invariant-mass distribution is found in the pi(0) pi(0) channel. The dependence is not observed in

  17. Raspberry Pi user guide

    CERN Document Server

    Upton, Eben

    2013-01-01

    The essential guide to getting started with the Raspberry Pi ® The Raspberry Pi has been a success beyond the dream of its creators. Their goal, to encourage a new generation of computer programmers who understand how computers work, is well under way. Raspberry Pi User Guide 2e is the newest edition of the runaway bestseller written by the Pi's co-creator, Eben Upton, and tech writer Gareth Halfacree. It contains everything you need to know to get the Pi up and running, including how to: Connect a keyboard, mouse, monitor and other peripheralsInstall software and configure your Raspberry

  18. Raspberry Pi projects

    CERN Document Server

    Robinson, Andrew

    2013-01-01

    Learn to build software and hardware projects featuring the Raspberry Pi! Raspberry Pi represents a new generation of computers that encourages the user to play and to learn and this unique book is aimed at the beginner Raspberry Pi user who is eager to get started creating real-world projects. Taking you on a journey of creating 15 practical projects, this fun and informative resource introduces you to the skills you need to have in order to make the most of the Pi. The book begins with a quick look at how to get the Pi up and running and then encourages you to dive into the array of exciti

  19. First Measurement of Chiral Dynamics in $\\pi^-\\gamma \\to \\pi^-\\pi^-\\pi^+$

    CERN Document Server

    Adolph, C; Alexakhin, V Yu; Alexandrov, Yu; Alexeev, G D; Amoroso, A; Antonov, A A; Austregesilo, A; Badelek, B; Balestra, F; Barth, J; Baum, G; Bedfer, Y; Bernhard, J; Bertini, R; Bettinelli, M; Bicker, K A; Birsa, R; Bisplinghoff, J; Bordalo, P; Bradamante, F; Braun, C; Bravar, A; Bressan, A; Burtin, E; Chaberny, D; Chiosso, M; Chung, S U; Cicuttin, A; Crespo, M L; Dalla Torre, S; Das, S; Dasgupta, S S; Denisov, O Yu; Dhara, L; Donskov, S V; Doshita, N; Duic, V; Dunnweber, W; Dziewiecki, M; Efremov, A; Elia, C; Eversheim, P D; Eyrich, W; Faessler, M; Ferrero, A; Filin, A; Finger, M; Finger, M; Fischer, H; Franco, C; du Fresne von Hohenesche, N; Friedrich, J M; Garfagnini, R; Gautheron, F; Gavrichtchouk, O P; Gazda, R; Gerassimov, S; Geyer, R; Giorgi, M; Gnesi, I; Gobbo, B; Goertz, S; Grabmuller, S; Grasso, A; Grube, B; Gushterski, R; Guskov, A; Haas, F; von Harrach, D; Hasegawa, T; Heinsius, F H; Herrmann, F; Hess, C; Hinterberger, F; Horikawa, N; Hoppner, Ch; d'Hose, N; Huber, S; Ishimoto, S; Ivanov, O; Ivanshin, Yu; Iwata, T; Jahn, R; Jasinski, P; Jegou, G; Joosten, R; Kabuss, E; Kang, D; Ketzer, B; Khaustov, G V; Khokhlov, Yu A; Kisselev, Yu; Klein, F; Klimaszewski, K; Koblitz, S; Koivuniemi, J H; Kolosov, V N; Kondo, K; Konigsmann, K; Konorov, I; Konstantinov, V F; Korzenev, A; Kotzinian, A M; Kouznetsov, O; Kramer, M; Kroumchtein, Z V; Kunne, F; Kurek, K; Lauser, L; Lednev, A A; Lehmann, A; Levorato, S; Lichtenstadt, J; Maggiora, A; Magnon, A; Makke, N; Mallot, G K; Mann, A; Marchand, C; Martin, A; Marzec, J; Massmann, F; Matsuda, T; Meyer, W; Michigami, T; Mikhailov, Yu V; Moinester, M A; Morreale, A; Mutter, A; Nagaytsev, A; Nagel, T; Nerling, F; Neubert, S; Neyret, D; Nikolaenko, V I; Nowak, W D; Nunes, A S; Olshevsky, A G; Ostrick, M; Padee, A; Panknin, R; Panzieri, D; Parsamyan, B; Paul, S; Perevalova, E; Pesaro, G; Peshekhonov, D V; Piragino, G; Platchkov, S; Pochodzalla, J; Polak, J; Polyakov, V A; Pontecorvo, G; Pretz, J; Quintans, C; Rajotte, J F; Ramos, S; Rapatsky, V; Reicherz, G; Richter, A; Rocco, E; Rondio, E; Rossiyskaya, N S; Ryabchikov, D I; Samoylenko, V D; Sandacz, A; Sapozhnikov, M G; Sarkar, S; Savin, I A; Sbrizzai, G; Schiavon, P; Schill, C; Schluter, T; Schmitt, L; Schonning, K; Schopferer, S; Schroder, W; Shevchenko, O Yu; Siebert, H W; Silva, L; Sinha, L; Sissakian, A N; Slunecka, M; Smirnov, G I; Sosio, S; Sozzi, F; Srnka, A; Stolarski, M; Sulc, M; Sulej, R; Sznajder, P; Takekawa, S; Ter Wolbeek, J; Tessaro, S; Tessarotto, F; Teufel, A; Tkatchev, L G; Uhl, S; Uman, I; Vandenbroucke, M; Virius, M; Vlassov, N V; Windmolders, R; Wislicki, W; Wollny, H; Zaremba, K; Zavertyaev, M; Zemlyanichkina, E; Ziembicki, M; Zhuravlev, N; Zvyagin, A

    2012-01-01

    The COMPASS collaboration at CERN has investigated the $\\pi^-\\gamma \\to \\pi^-\\pi^-\\pi^+$ reaction at center-of-momentum energy below five pion masses, $\\sqrt{s} \\lt 5m_\\pi$ , embedded in the Primakoff reaction of 190 GeV pions impinging on a lead target. Exchange of quasi-real photons is selected by isolating the sharp Coulomb peak observed at smallest momentum transfers, $t' \\lt 0.001 GeV^2/c^2$. Using partial-wave analysis techniques, the scattering intensity of Coulomb production described in terms of chiral dynamics and its dependence on the 3pi-invariant mass $m_{3\\pi} = \\sqrt{s}$ were extracted. The absolute cross section was determined in seven bins of $\\sqrt{s}$ with an overall precision of 20%. At leading order, the result is found to be in good agreement with the prediction of chiral perturbation theory over the whole energy range investigated.

  20. First Measurements of eta_c Decaying into K^+K^-2(pi^+pi^-) and 3(pi^+pi^-)

    CERN Document Server

    Ablikim, M; Ban, Y; Bian, J G; Cai, X; Chang, J F; Chen, H F; Chen, H S; Chen, H X; Chen, J C; Chen Jin; Chen Jun; Chen, M L; Chen, Y B; Chi, S P; Chu, Y P; Cui, X Z; Dai, H L; Dai, Y S; Deng, Z Y; Dong, L Y; Dong, Q F; Du, S X; Du, Z Z; Fang, J; Fang, S S; Fu, C D; Fu, H Y; Gao, C S; Gao, Y N; Gong, M Y; Gong, W X; Gu, S D; Guo, Y N; Guo, Y Q; Guo, Z J; Harris, F A; He, K L; He, M; He, X; Heng, Y K; Hu, H M; Hu, T; Huang, G S; Huang, X P; Huang, X T; Ji, X B; Jiang, C H; Jiang, X S; Jin, D P; Jin, S; Jin, Y; Yi Jin; Lai, Y F; Li, F; Li, G; Li, H H; Li, J; Li, J C; Li, Q J; Li, R Y; Li, S M; Li, W D; Li, W G; Li, X L; Li, X Q; Li, Y L; Liang, Y F; Liao, H B; Liu, C X; Liu, F; Fang Liu; Liu, H H; Liu, H M; Liu, J; Liu, J B; Liu, J P; Liu, R G; Liu, Z A; Liu, Z X; Lu, F; Lu, G R; Lu, H J; Lu, J G; Luo, C L; Luo, L X; Luo, X L; Ma, F C; Ma, H L; Ma, J M; Ma, L L; Ma, Q M; Ma, X B; Ma, X Y; Mao, Z P; Mo, X H; Nie, J; Nie, Z D; Olsen, S L; Peng, H P; Qi, N D; Qian, C D; Qin, H; Qiu, J F; Ren, Z Y; Rong, G; Shan, L Y; Shang, L; Shen, D L; Shen, X Y; Sheng, H Y; Shi, F; Shi, X; Sun, H S; Sun, J F; Sun, S S; Sun, Y Z; Sun, Z J; Tang, X; Tao, N; Tian, Y R; Tong, G L; Varner, G S; Wang, D Y; Wang, J Z; Wang, K; Wang, L; Wang, L S; Wang, M; Wang, P; Wang, P L; Wang, S Z; Wang, W F; Wang, Y F; Wang, Z; Wang, Z Y; Wand, Zhe; Wang, Zheng; Wei, C L; Wei, D H; Wu, N; Wu, Y M; Xia, X M; Xie, X X; Xin, B; Xu, G F; Xu, H; Xue, S T; Yan, M L; Yang, F; Yang, H X; Yang, J; Yang, Y X; Ye, M; Ye, M H; Ye, Y X; Yi, L H; Yi, Z Y; Yu, C S; Yu, G W; Yuan, C Z; Yuan, J M; Yuan, Y; Zang, S L; Zeng, Y; Zeng, Yu; Zhang, B X; Zhang, B Y; Zhang, C C; Zhang, D H; Zhang, H Y; Zhang, J; Zhang, J W; Zhang, J Y; Zhang, Q J; Zhang, S Q; Zhang, X M; Zhang, X Y; Zhang, Y Y; Zahng, Yiyun; Zhang, Z P; Zhang, Z Q; Zhao, D X; Zhao, J B; Zhao, J W; Zhao, M G; Zhao, P P; Zhao, W R; Zhao, X J; Zhao, Y B; Zhao, Z G; Zheng, H Q; Zheng, J P; Zheng, L S; Zheng, Z P; Zhong, X C; Zhou, B Q; Zhou, G M; Zhou, L; Zhou, N F; Zhu, K J; Zhu, Q M; Zhu, Y C; Zhu, Y S; Zhu, Yingchun; Zhu, Z A; Zhuang, B A; Zhuang, X A; Zou, B S

    2006-01-01

    The decays of eta_c to K^+K^-2(pi^+pi^-) and 3(pi^+pi^-) are observed for the first time using a sample of 5.8X10^7 J/\\psi events collected by the BESII detector. The product branching fractions are determined to be B(J/\\psi-->gamma eta_c)*B(eta_c-->K^+K^-pi^+pi^-pi^+pi^-)=(1.21+-0.32+- 0.23)X10^{-4}$,B(J/\\psi-->gamma eta_c)*B(eta_c-->K^{*0}\\bar{K}^{*0}pi^+pi^-)= (1.29+-0.43+-0.32)X10^{-4}$, and (J/\\psi-->gamma eta_c)* B(eta_c-->pi^+pi^-pi^+pi^-pi^+pi^-)= (2.59+-0.32+-0.48)X10^{-4}. The upper limit for eta_c-->phi pi^+pi^-pi^+pi^- is also obtained as B(J/\\psi-->gamma eta_c)*B(eta_c--> phi pi^+pi^-pi^+pi^-)< 6.03 X10^{-5} at the 90% confidence level.

  1. Measurement of the Matrix Elements for the Decays $\\eta \\rightarrow \\pi^{+}\\pi^{-}\\pi^0$ and $\\eta/\\eta^{\\prime}\\rightarrow\\pi^0\\pi^0\\pi^0$

    CERN Document Server

    Ablikim, M; Ai, X C; Albayrak, O; Albrecht, M; Ambrose, D J; Amoroso, A; An, F F; An, Q; Bai, J Z; Ferroli, R Baldini; Ban, Y; Bennett, D W; Bennett, J V; Bertani, M; Bettoni, D; Bian, J M; Bianchi, F; Boger, E; Boyko, I; Briere, R A; Cai, H; Cai, X; Cakir, O; Calcaterra, A; Cao, G F; Cetin, S A; Chang, J F; Chelkov, G; Chen, G; Chen, H S; Chen, H Y; Chen, J C; Chen, M L; Chen, S J; Chen, X; Chen, X R; Chen, Y B; Cheng, H P; Chu, X K; Cibinetto, G; Dai, H L; Dai, J P; Dbeyssi, A; Dedovich, D; Deng, Z Y; Denig, A; Denysenko, I; Destefanis, M; De Mori, F; Ding, Y; Dong, C; Dong, J; Dong, L Y; Dong, M Y; Du, S X; Duan, P F; Eren, E E; Fan, J Z; Fang, J; Fang, S S; Fang, X; Fang, Y; Fava, L; Feldbauer, F; Felici, G; Feng, C Q; Fioravanti, E; Fritsch, M; Fu, C D; Gao, Q; Gao, X Y; Gao, Y; Gao, Z; Garzia, I; Geng, C; Goetzen, K; Gong, W X; Gradl, W; Greco, M; Gu, M H; Gu, Y T; Guan, Y H; Guo, A Q; Guo, L B; Guo, Y; Guo, Y P; Haddadi, Z; Hafner, A; Han, S; Han, Y L; Hao, X Q; Harris, F A; He, K L; He, Z Y; Held, T; Heng, Y K; Hou, Z L; Hu, C; Hu, H M; Hu, J F; Hu, T; Hu, Y; Huang, G M; Huang, G S; Huang, H P; Huang, J S; Huang, X T; Huang, Y; Hussain, T; Ji, Q; Ji, Q P; Ji, X B; Ji, X L; Jiang, L L; Jiang, L W; Jiang, X S; Jiang, X Y; Jiao, J B; Jiao, Z; Jin, D P; Jin, S; Johansson, T; Julin, A; Kalantar-Nayestanaki, N; Kang, X L; Kang, X S; Kavatsyuk, M; Ke, B C; Kiese, P; Kliemt, R; Kloss, B; Kolcu, O B; Kopf, B; Kornicer, M; Kühn, W; Kupsc, A; Lange, J S; Lara, M; Larin, P; Leng, C; Li, C; Li, C H; Li, Cheng; Li, D M; Li, F; Li, G; Li, H B; Li, J C; Li, Jin; Li, K; Li, Lei; Li, P R; Li, T; Li, W D; Li, W G; Li, X L; Li, X M; Li, X N; Li, X Q; Li, Z B; Liang, H; Liang, Y F; Liang, Y T; Liao, G R; Lin, D X; Liu, B J; Liu, C X; Liu, F H; Liu, Fang; Liu, Feng; Liu, H B; Liu, H H; Liu, H M; Liu, J; Liu, J B; Liu, J P; Liu, J Y; Liu, K; Liu, K Y; Liu, L D; Liu, P L; Liu, Q; Liu, S B; Liu, X; Liu, X X; Liu, Y B; Liu, Z A; Liu, Zhiqiang; Liu, Zhiqing; Loehner, H; Lou, X C; Lu, H J; Lu, J G; Lu, R Q; Lu, Y; Lu, Y P; Luo, C L; Luo, M X; Luo, T; Luo, X L; Lv, M; Lyu, X R; Ma, F C; Ma, H L; Ma, L L; Ma, Q M; Ma, T; Ma, X N; Ma, X Y; Maas, F E; Maggiora, M; Mao, Y J; Mao, Z P; Marcello, S; Messchendorp, J G; Min, J; Min, T J; Mitchell, R E; Mo, X H; Mo, Y J; Morales, C Morales; Moriya, K; Muchnoi, N Yu; Muramatsu, H; Nefedov, Y; Nerling, F; Nikolaev, I B; Ning, Z; Nisar, S; Niu, S L; Niu, X Y; Olsen, S L; Ouyang, Q; Pacetti, S; Patteri, P; Pelizaeus, M; Peng, H P; Peters, K; Pettersson, J; Ping, J L; Ping, R G; Poling, R; Prasad, V; Pu, Y N; Qi, M; Qian, S; Qiao, C F; Qin, L Q; Qin, N; Qin, X S; Qin, Y; Qin, Z H; Qiu, J F; Rashid, K H; Redmer, C F; Ren, H L; Ripka, M; Rong, G; Rosner, Ch; Ruan, X D; Santoro, V; Sarantsev, A; Savrié, M; Schoenning, K; Schumann, S; Shan, W; Shao, M; Shen, C P; Shen, P X; Shen, X Y; Sheng, H Y; Song, W M; Song, X Y; Sosio, S; Spataro, S; Sun, G X; Sun, J F; Sun, S S; Sun, Y J; Sun, Y Z; Sun, Z J; Sun, Z T; Tang, C J; Tang, X; Tapan, I; Thorndike, E H; Tiemens, M; Ullrich, M; Uman, I; Varner, G S; Wang, B; Wang, B L; Wang, D; Wang, D Y; Wang, K; Wang, L L; Wang, L S; Wang, M; Wang, P; Wang, P L; Wang, S G; Wang, W; Wang, X F; Wang, Y D; Wang, Y F; Wang, Y Q; Wang, Z; Wang, Z G; Wang, Z H; Wang, Z Y; Weber, T; Wei, D H; Wei, J B; Weidenkaff, P; Wen, S P; Wiedner, U; Wolke, M; Wu, L H; Wu, Z; Xia, L G; Xia, Y; Xiao, D; Xiao, Z J; Xie, Y G; Xiu, Q L; Xu, G F; Xu, L; Xu, Q J; Xu, Q N; Xu, X P; Yan, L; Yan, W B; Yan, W C; Yan, Y H; Yang, H J; Yang, H X; Yang, L; Yang, Y; Yang, Y X; Ye, H; Ye, M; Ye, M H; Yin, J H; Yu, B X; Yu, C X; Yu, H W; Yu, J S; Yuan, C Z; Yuan, W L; Yuan, Y; Yuncu, A; Zafar, A A; Zallo, A; Zeng, Y; Zhang, B X; Zhang, B Y; Zhang, C; Zhang, C C; Zhang, D H; Zhang, H H; Zhang, H Y; Zhang, J J; Zhang, J L; Zhang, J Q; Zhang, J W; Zhang, J Y; Zhang, J Z; Zhang, K; Zhang, L; Zhang, S H; Zhang, X Y; Zhang, Y; Zhang, Y N; Zhang, Y H; Zhang, Y T; Zhang, Yu; Zhang, Z H; Zhang, Z P; Zhang, Z Y; Zhao, G; Zhao, J W; Zhao, J Y; Zhao, J Z; Zhao, Lei; Zhao, Ling; Zhao, M G; Zhao, Q; Zhao, Q W; Zhao, S J; Zhao, T C; Zhao, Y B; Zhao, Z G; Zhemchugov, A; Zheng, B; Zheng, J P; Zheng, W J; Zheng, Y H; Zhong, B; Zhou, L; Zhou, Li; Zhou, X; Zhou, X K; Zhou, X R; Zhou, X Y; Zhu, K; Zhu, K J; Zhu, S; Zhu, X L; Zhu, Y C; Zhu, Y S; Zhu, Z A; Zhuang, J; Zotti, L; Zou, B S; Zou, J H

    2015-01-01

    Based on a sample of $1.31 \\times 10^9$ $J/\\psi$ events collected with the BESIII detector at the BEPCII collider, Dalitz plot analyses of selected 79,625 $\\eta\\rightarrow\\pi^{+}\\pi^{-}\\pi^0$ events, 33,908 $\\eta\\rightarrow\\pi^0\\pi^0\\pi^0$ events and 1,888 $\\eta^{\\prime}\\rightarrow\\pi^0\\pi^0\\pi^0$ events are performed. The measured matrix elements of $\\eta\\rightarrow\\pi^+\\pi^-\\pi^0$ are in reasonable agreement with previous measurements. The Dalitz plot slope parameters of $\\eta\\rightarrow\\pi^0\\pi^0\\pi^0$ and $\\eta^{\\prime}\\rightarrow\\pi^0\\pi^0\\pi^0$ are determined to be $-0.055 \\pm 0.014 \\pm 0.004$ and $-0.640 \\pm 0.046 \\pm 0.047$, respectively, where the first uncertainties are statistical and the second systematic. Both values are consistent with previous measurements, while the precision of the latter one is improved by a factor of three. Final state interactions are found to have an important role in those decays.

  2. The cusp effect in eta' --> eta pi pi decays

    CERN Document Server

    Kubis, Bastian

    2009-01-01

    Strong final-state interactions create a pronounced cusp in eta' --> eta pi0 pi0 decays. We adapt and generalize the non-relativistic effective field theory framework developed for the extraction of pi pi scattering lengths from K --> 3 pi decays to this case. The cusp effect is predicted to have an effect of more than 8% on the decay spectrum below the pi+ pi- threshold.

  3. Amplitude analysis of the decays $\\eta^\\prime\\rightarrow\\pi^+\\pi^-\\pi^0$ and $\\eta^\\prime\\rightarrow\\pi^0\\pi^0\\pi^0$

    CERN Document Server

    Ablikim, M; Ai, X C; Albayrak, O; Albrecht, M; Ambrose, D J; Amoroso, A; An, F F; An, Q; Bai, J Z; Ferroli, R Baldini; Ban, Y; Bennett, D W; Bennett, J V; Bertani, M; Bettoni, D; Bian, J M; Bianchi, F; Boger, E; Boyko, I; Briere, R A; Cai, H; Cai, X; Cakir, O; Calcaterra, A; Cao, G F; Cetin, S A; Chang, J F; Chelkov, G; Chen, G; Chen, H S; Chen, H Y; Chen, J C; Chen, M L; Chen, S; Chen, S J; Chen, X; Chen, X R; Chen, Y B; Cheng, H P; Chu, X K; Cibinetto, G; Dai, H L; Dai, J P; Dbeyssi, A; Dedovich, D; Deng, Z Y; Denig, A; Denysenko, I; Destefanis, M; De Mori, F; Ding, Y; Dong, C; Dong, J; Dong, L Y; Dong, M Y; Dou, Z L; Du, S X; Duan, P F; Fan, J Z; Fang, J; Fang, S S; Fang, X; Fang, Y; Farinelli, R; Fava, L; Fedorov, O; Feldbauer, F; Felici, G; Feng, C Q; Fioravanti, E; Fritsch, M; Fu, C D; Gao, Q; Gao, X L; Gao, X Y; Gao, Y; Gao, Z; Garzia, I; Goetzen, K; Gong, L; Gong, W X; Gradl, W; Greco, M; Gu, M H; Gu, Y T; Guan, Y H; Guo, A Q; Guo, L B; Guo, R P; Guo, Y; Guo, Y P; Haddadi, Z; Hafner, A; Han, S; Hao, X Q; Harris, F A; He, K L; Held, T; Heng, Y K; Hou, Z L; Hu, C; Hu, H M; Hu, J F; Hu, T; Hu, Y; Huang, G S; Huang, J S; Huang, X T; Huang, X Z; Huang, Y; Huang, Z L; Hussain, T; Ji, Q; Ji, Q P; Ji, X B; Ji, X L; Jiang, L W; Jiang, X S; Jiang, X Y; Jiao, J B; Jiao, Z; Jin, D P; Jin, S; Johansson, T; Julin, A; Kalantar-Nayestanaki, N; Kang, X L; Kang, X S; Kavatsyuk, M; Ke, B C; Kiese, P; Kliemt, R; Kloss, B; Kolcu, O B; Kopf, B; Kornicer, M; Kupsc, A; Kühn, W; Lange, J S; Lara, M; Larin, P; Leng, C; Li, C; Li, Cheng; Li, D M; Li, F; Li, F Y; Li, G; Li, H B; Li, H J; Li, J C; Li, Jin; Li, K; Li, K; Li, Lei; Li, P R; Li, Q Y; Li, T; Li, W D; Li, W G; Li, X L; Li, X N; Li, X Q; Li, Y B; Li, Z B; Liang, H; Liang, Y F; Liang, Y T; Liao, G R; Lin, D X; Liu, B; Liu, B J; Liu, C X; Liu, D; Liu, F H; Liu, Fang; Liu, Feng; Liu, H B; Liu, H H; Liu, H H; Liu, H M; Liu, J; Liu, J B; Liu, J P; Liu, J Y; Liu, K; Liu, K Y; Liu, L D; Liu, P L; Liu, Q; Liu, S B; Liu, X; Liu, Y B; Liu, Z A; Liu, Zhiqing; Loehner, H; Lou, X C; Lu, H J; Lu, J G; Lu, Y; Lu, Y P; Luo, C L; Luo, M X; Luo, T; Luo, X L; Lyu, X R; Ma, F C; Ma, H L; Ma, L L; Ma, M M; Ma, Q M; Ma, T; Ma, X N; Ma, X Y; Ma, Y M; Maas, F E; Maggiora, M; Mao, Y J; Mao, Z P; Marcello, S; Messchendorp, J G; Min, J; Min, T J; Mitchell, R E; Mo, X H; Mo, Y J; Morales, C Morales; Muchnoi, N Yu; Muramatsu, H; Nefedov, Y; Nerling, F; Nikolaev, I B; Ning, Z; Nisar, S; Niu, S L; Niu, X Y; Olsen, S L; Ouyang, Q; Pacetti, S; Pan, Y; Patteri, P; Pelizaeus, M; Peng, H P; Peters, K; Pettersson, J; Ping, J L; Ping, R G; Poling, R; Prasad, V; Qi, H R; Qi, M; Qian, S; Qiao, C F; Qin, L Q; Qin, N; Qin, X S; Qin, Z H; Qiu, J F; Rashid, K H; Redmer, C F; Ripka, M; Rong, G; Rosner, Ch; Ruan, X D; Sarantsev, A; Savrié, M; Schoenning, K; Schumann, S; Shan, W; Shao, M; Shen, C P; Shen, P X; Shen, X Y; Sheng, H Y; Shi, M; Song, W M; Song, X Y; Sosio, S; Spataro, S; Sun, G X; Sun, J F; Sun, S S; Sun, X H; Sun, Y J; Sun, Y Z; Sun, Z J; Sun, Z T; Tang, C J; Tang, X; Tapan, I; Thorndike, E H; Tiemens, M; Ullrich, M; Uman, I; Varner, G S; Wang, B; Wang, B L; Wang, D; Wang, D Y; Wang, K; Wang, L L; Wang, L S; Wang, M; Wang, P; Wang, P L; Wang, W; Wang, W P; Wang, X F; Wang, Y; Wang, Y D; Wang, Y F; Wang, Y Q; Wang, Z; Wang, Z G; Wang, Z H; Wang, Z Y; Wang, Z Y; Weber, T; Wei, D H; Weidenkaff, P; Wen, S P; Wiedner, U; Wolke, M; Wu, L H; Wu, L J; Wu, Z; Xia, L; Xia, L G; Xia, Y; Xiao, D; Xiao, H; Xiao, Z J; Xie, Y G; Xiu, Q L; Xu, G F; Xu, J J; Xu, L; Xu, Q J; Xu, Q N; Xu, X P; Yan, L; Yan, W B; Yan, W C; Yan, Y H; Yang, H J; Yang, H X; Yang, L; Yang, Y X; Ye, M; Ye, M H; Yin, J H; Yu, B X; Yu, C X; Yu, J S; Yuan, C Z; Yuan, W L; Yuan, Y; Yuncu, A; Zafar, A A; Zallo, A; Zeng, Y; Zeng, Z; Zhang, B X; Zhang, B Y; Zhang, C; Zhang, C C; Zhang, D H; Zhang, H H; Zhang, H Y; Zhang, J; Zhang, J J; Zhang, J L; Zhang, J Q; Zhang, J W; Zhang, J Y; Zhang, J Z; Zhang, K; Zhang, L; Zhang, S Q; Zhang, X Y; Zhang, Y; Zhang, Y H; Zhang, Y N; Zhang, Y T; Zhang, Yu; Zhang, Z H; Zhang, Z P; Zhang, Z Y; Zhao, G; Zhao, J W; Zhao, J Y; Zhao, J Z; Zhao, Lei; Zhao, Ling; Zhao, M G; Zhao, Q; Zhao, Q W; Zhao, S J; Zhao, T C; Zhao, Y B; Zhao, Z G; Zhemchugov, A; Zheng, B; Zheng, J P; Zheng, W J; Zheng, Y H; Zhong, B; Zhou, L; Zhou, X; Zhou, X K; Zhou, X R; Zhou, X Y; Zhu, K; Zhu, K J; Zhu, S; Zhu, S H; Zhu, X L; Zhu, Y C; Zhu, Y S; Zhu, Z A; Zhuang, J; Zotti, L; Zou, B S; Zou, J H

    2016-01-01

    Based on a sample of $1.31\\times10^9$ $J/\\psi$ events collected with the BESIII detector, an amplitude analysis of the isospin violating decays $\\eta^\\prime\\rightarrow\\pi^+\\pi^-\\pi^0$ and $\\eta^\\prime\\rightarrow\\pi^0\\pi^0\\pi^0$ is performed. Significant $P$-wave contribution from $\\eta^\\prime\\rightarrow\\rho^{\\pm}\\pi^{\\mp}$ is observed for the first time in $\\eta^\\prime\\rightarrow\\pi^+\\pi^-\\pi^0$. The branching fraction is determined to be ${\\mathcal B}(\\eta^\\prime\\rightarrow\\rho^{\\pm}\\pi^{\\mp})=(7.44\\pm0.60\\pm1.26\\pm1.84)\\times 10^{-4}$, where the first uncertainty is statistical, the second systematic and the third model dependent. In addition to the non-resonant $S$-wave component, a contribution from the $\\sigma$ meson is also essential. The branching fractions of the $S$-wave components are determined as ${\\mathcal B}(\\eta^\\prime\\rightarrow\\pi^+\\pi^-\\pi^0)_S=(37.63\\pm0.77\\pm2.22\\pm4.48)\\times 10^{-4}$ and ${\\mathcal B}(\\eta^\\prime\\rightarrow\\pi^0\\pi^0\\pi^0)=(35.22\\pm0.82\\pm2.60)\\times 10^{-4}$, respective...

  4. Study of reaction pi- A --> pi+pi-pi- A at VES setup

    CERN Document Server

    Kachaev, I A

    2002-01-01

    The results on partial wave analysis of 3pi system produced at beam momentum 36.6 GeV/c on beryllium target are presented. New method of amplitude analysis is suggested -- extraction of largest eigenvalue of density matrix. Exotic wave with JPC = 1-+ in rho pi system is studied in four t' regions. No narrow object around M = 1.6 GeV is found. Unusually steep t'-dependence for pi(1300) object is detected.

  5. Final state interactions and CP violation in K$_{L}$ --> $\\pi^{+}\\pi^{-}$e+e-

    CERN Document Server

    Elwood, J K; Savage, M J; Walden, J W; Elwood, John K; Wise, Mark B; Savage, Martin J; Walden, James W

    1996-01-01

    Using chiral perturbation theory we calculate the imaginary parts of the K_L \\rightarrow \\pi^+ \\pi^- e^+ e^- form factors that arise from \\pi \\pi \\rightarrow \\pi^+ \\pi^- and \\pi \\pi \\rightarrow \\pi^+ \\pi^- \\gamma^* rescattering. We discuss their influence on CP violating variables in K_L \\rightarrow \\pi^+ \\pi^- e^+ e^-.

  6. Dynamical coupled-channels study of pi N --> pi pi N reactions

    CERN Document Server

    Kamano, H; Lee, T -S H; Matsuyama, A; Sato, T

    2008-01-01

    As a step toward performing a complete coupled-channels analysis of the world data of pi N, gamma^* N --> pi N, eta N, pi pi N reactions, the pi N --> pi pi N reactions are investigated starting with the dynamical coupled-channels model developed in Phys. Rev. C76, 065201 (2007). The channels included are pi N, eta N, and pi pi N which has pi Delta, rho N, and sigma N resonant components. The non-resonant amplitudes are generated from solving a set of coupled-channels equations with the meson-baryon potentials defined by effective Lagrangians. The resonant amplitudes are generated from 16 bare excited nucleon (N^*) states which are dressed by the non-resonant interactions as constrained by the unitarity condition. The available total cross section data of pi^+ p --> pi^+ pi^+ n, pi^+ pi^0p and pi^- p --> pi^+ pi^- n, pi^- pi^0 n, pi^0 pi^0 n can be reproduced to a very large extent both in magnitudes and energy-dependence. Possible improvements of the model are investigated, in particular on the role of the n...

  7. Raspberry Pi for dummies

    CERN Document Server

    McManus, Sean

    2013-01-01

    Embrace the exciting new technology of Raspberry Pi! With the invention of the unique credit-card sized single-board computer, the Raspberry Pi, comes a new wave of hardware geeks, hackers, and hobbyists who are excited about the possibilities of the Raspberry Pi, and this is the perfect guide to get you started in this exhilarating new arena. With this fun and friendly book, you'll quickly discover why the supply for the Pi cannot keep up with the demand! Veteran tech authors Sean McManus and Mike Cook show you how to download and install the operating system, use the installe

  8. Meet the Raspberry Pi

    CERN Document Server

    Upton, Eben

    2012-01-01

    The essential preview guide to getting started with Raspberry Pi ʼ computing and programming Originally conceived of as a fun, easy way for kids (and curious adults) to learn computer programming, the Raspberry Pi quickly evolved into a remarkably robust, credit-card-size computer that can be used for everything from playing HD videos and hacking around with hardware to learning to program! Co-authored by one of the creators of the Raspberry Pi, this special preview eBook fills you in on everything you need to know to get up and running on your Raspberry Pi in no time, including how to:

  9. Adventures in Raspberry Pi

    CERN Document Server

    Philbin, Carrie Anne

    2015-01-01

    Start programming quickly with this super-fun guide to Raspberry Pi Adventures in Raspberry Pi, 2nd Edition includes 9 cool projects that show you how to set up and start developing on your Raspberry Pi. Updated for the release of the Rev 3 board, this second edition covers all the latest features and tells you everything you need to know. Written specifically for 11-15 year-olds, this book uses the wildly successful, Raspberry Pi to explain the fundamentals of computing. You'll have a blast learning basic programming and system administration skills, beginning with the very basics of how to p

  10. Reaction {pi}N {yields} {pi}{pi}N near threshold

    Energy Technology Data Exchange (ETDEWEB)

    Frlez, E.

    1993-11-01

    The LAMPF E1179 experiment used the {pi}{sup 0} spectrometer and an array of charged particle range counters to detect and record {pi}{sup +}{pi}{sup 0}, {pi}{sup 0}p, and {pi}{sup +}{pi}{sup 0}p coincidences following the reaction {pi}{sup +}p {yields} {pi}{sup 0}{pi}{sup +}p near threshold. The total cross sections for single pion production were measured at the incident pion kinetic energies 190, 200, 220, 240, and 260 MeV. Absolute normalizations were fixed by measuring {pi}{sup +}p elastic scattering at 260 MeV. A detailed analysis of the {pi}{sup 0} detection efficiency was performed using cosmic ray calibrations and pion single charge exchange measurements with a 30 MeV {pi}{sup {minus}} beam. All published data on {pi}N {yields} {pi}{pi}N, including our results, are simultaneously fitted to yield a common chiral symmetry breaking parameter {xi} ={minus}0.25{plus_minus}0.10. The threshold matrix element {vert_bar}{alpha}{sub 0}({pi}{sup 0}{pi}{sup +}p){vert_bar} determined by linear extrapolation yields the value of the s-wave isospin-2 {pi}{pi} scattering length {alpha}{sub 0}{sup 2}({pi}{pi}) = {minus}0.041{plus_minus}0.003 m{sub {pi}}{sup {minus}1}, within the framework of soft-pion theory.

  11. Study of $B^{-}\\to DK^-\\pi^+\\pi^-$ and $B^-\\to D\\pi^-\\pi^+\\pi^-$ decays and determination of the CKM angle $\\gamma$

    CERN Document Server

    Aaij, Roel; Adinolfi, Marco; Affolder, Anthony; Ajaltouni, Ziad; Akar, Simon; Albrecht, Johannes; Alessio, Federico; Alexander, Michael; Ali, Suvayu; Alkhazov, Georgy; Alvarez Cartelle, Paula; Alves Jr, Antonio Augusto; Amato, Sandra; Amerio, Silvia; Amhis, Yasmine; An, Liupan; Anderlini, Lucio; Anderson, Jonathan; Andreotti, Mirco; Andrews, Jason; Appleby, Robert; Aquines Gutierrez, Osvaldo; Archilli, Flavio; d'Argent, Philippe; Artamonov, Alexander; Artuso, Marina; Aslanides, Elie; Auriemma, Giulio; Baalouch, Marouen; Bachmann, Sebastian; Back, John; Badalov, Alexey; Baesso, Clarissa; Baldini, Wander; Barlow, Roger; Barschel, Colin; Barsuk, Sergey; Barter, William; Batozskaya, Varvara; Battista, Vincenzo; Bay, Aurelio; Beaucourt, Leo; Beddow, John; Bedeschi, Franco; Bediaga, Ignacio; Bel, Lennaert; Belyaev, Ivan; Ben-Haim, Eli; Bencivenni, Giovanni; Benson, Sean; Benton, Jack; Berezhnoy, Alexander; Bernet, Roland; Bertolin, Alessandro; Bettler, Marc-Olivier; van Beuzekom, Martinus; Bien, Alexander; Bifani, Simone; Bird, Thomas; Birnkraut, Alex; Bizzeti, Andrea; Blake, Thomas; Blanc, Frédéric; Blouw, Johan; Blusk, Steven; Bocci, Valerio; Bondar, Alexander; Bondar, Nikolay; Bonivento, Walter; Borghi, Silvia; Borsato, Martino; Bowcock, Themistocles; Bowen, Espen Eie; Bozzi, Concezio; Braun, Svende; Brett, David; Britsch, Markward; Britton, Thomas; Brodzicka, Jolanta; Brook, Nicholas; Bursche, Albert; Buytaert, Jan; Cadeddu, Sandro; Calabrese, Roberto; Calvi, Marta; Calvo Gomez, Miriam; Campana, Pierluigi; Campora Perez, Daniel; Capriotti, Lorenzo; Carbone, Angelo; Carboni, Giovanni; Cardinale, Roberta; Cardini, Alessandro; Carniti, Paolo; Carson, Laurence; Carvalho Akiba, Kazuyoshi; Casanova Mohr, Raimon; Casse, Gianluigi; Cassina, Lorenzo; Castillo Garcia, Lucia; Cattaneo, Marco; Cauet, Christophe; Cavallero, Giovanni; Cenci, Riccardo; Charles, Matthew; Charpentier, Philippe; Chefdeville, Maximilien; Chen, Shanzhen; Cheung, Shu-Faye; Chiapolini, Nicola; Chrzaszcz, Marcin; Cid Vidal, Xabier; Ciezarek, Gregory; Clarke, Peter; Clemencic, Marco; Cliff, Harry; Closier, Joel; Coco, Victor; Cogan, Julien; Cogneras, Eric; Cogoni, Violetta; Cojocariu, Lucian; Collazuol, Gianmaria; Collins, Paula; Comerma-Montells, Albert; Contu, Andrea; Cook, Andrew; Coombes, Matthew; Coquereau, Samuel; Corti, Gloria; Corvo, Marco; Couturier, Benjamin; Cowan, Greig; Craik, Daniel Charles; Crocombe, Andrew; Cruz Torres, Melissa Maria; Cunliffe, Samuel; Currie, Robert; D'Ambrosio, Carmelo; Dalseno, Jeremy; David, Pieter; Davis, Adam; De Bruyn, Kristof; De Capua, Stefano; De Cian, Michel; De Miranda, Jussara; De Paula, Leandro; De Silva, Weeraddana; De Simone, Patrizia; Dean, Cameron Thomas; Decamp, Daniel; Deckenhoff, Mirko; Del Buono, Luigi; Déléage, Nicolas; Derkach, Denis; Deschamps, Olivier; Dettori, Francesco; Dey, Biplab; Di Canto, Angelo; Di Ruscio, Francesco; Dijkstra, Hans; Donleavy, Stephanie; Dordei, Francesca; Dorigo, Mirco; Dosil Suárez, Alvaro; Dossett, David; Dovbnya, Anatoliy; Dreimanis, Karlis; Dufour, Laurent; Dujany, Giulio; Dupertuis, Frederic; Durante, Paolo; Dzhelyadin, Rustem; Dziurda, Agnieszka; Dzyuba, Alexey; Easo, Sajan; Egede, Ulrik; Egorychev, Victor; Eidelman, Semen; Eisenhardt, Stephan; Eitschberger, Ulrich; Ekelhof, Robert; Eklund, Lars; El Rifai, Ibrahim; Elsasser, Christian; Ely, Scott; Esen, Sevda; Evans, Hannah Mary; Evans, Timothy; Falabella, Antonio; Färber, Christian; Farinelli, Chiara; Farley, Nathanael; Farry, Stephen; Fay, Robert; Ferguson, Dianne; Fernandez Albor, Victor; Ferrari, Fabio; Ferreira Rodrigues, Fernando; Ferro-Luzzi, Massimiliano; Filippov, Sergey; Fiore, Marco; Fiorini, Massimiliano; Firlej, Miroslaw; Fitzpatrick, Conor; Fiutowski, Tomasz; Fohl, Klaus; Fol, Philip; Fontana, Marianna; Fontanelli, Flavio; Forty, Roger; Francisco, Oscar; Frank, Markus; Frei, Christoph; Frosini, Maddalena; Fu, Jinlin; Furfaro, Emiliano; Gallas Torreira, Abraham; Galli, Domenico; Gallorini, Stefano; Gambetta, Silvia; Gandelman, Miriam; Gandini, Paolo; Gao, Yuanning; García Pardiñas, Julián; Garofoli, Justin; Garra Tico, Jordi; Garrido, Lluis; Gascon, David; Gaspar, Clara; Gastaldi, Ugo; Gauld, Rhorry; Gavardi, Laura; Gazzoni, Giulio; Geraci, Angelo; Gerick, David; Gersabeck, Evelina; Gersabeck, Marco; Gershon, Timothy; Ghez, Philippe; Gianelle, Alessio; Gianì, Sebastiana; Gibson, Valerie; Girard, Olivier Göran; Giubega, Lavinia-Helena; Gligorov, Vladimir; Göbel, Carla; Golubkov, Dmitry; Golutvin, Andrey; Gomes, Alvaro; Gotti, Claudio; Grabalosa Gándara, Marc; Graciani Diaz, Ricardo; Granado Cardoso, Luis Alberto; Graugés, Eugeni; Graverini, Elena; Graziani, Giacomo; Grecu, Alexandru; Greening, Edward; Gregson, Sam; Griffith, Peter; Grillo, Lucia; Grünberg, Oliver; Gui, Bin; Gushchin, Evgeny; Guz, Yury; Gys, Thierry; Hadjivasiliou, Christos; Haefeli, Guido; Haen, Christophe; Haines, Susan; Hall, Samuel; Hamilton, Brian; Hampson, Thomas; Han, Xiaoxue; Hansmann-Menzemer, Stephanie; Harnew, Neville; Harnew, Samuel; Harrison, Jonathan; He, Jibo; Head, Timothy; Heijne, Veerle; Hennessy, Karol; Henrard, Pierre; Henry, Louis; Hernando Morata, Jose Angel; van Herwijnen, Eric; Heß, Miriam; Hicheur, Adlène; Hill, Donal; Hoballah, Mostafa; Hombach, Christoph; Hulsbergen, Wouter; Humair, Thibaud; Hussain, Nazim; Hutchcroft, David; Hynds, Daniel; Idzik, Marek; Ilten, Philip; Jacobsson, Richard; Jaeger, Andreas; Jalocha, Pawel; Jans, Eddy; Jawahery, Abolhassan; Jing, Fanfan; John, Malcolm; Johnson, Daniel; Jones, Christopher; Joram, Christian; Jost, Beat; Jurik, Nathan; Kandybei, Sergii; Kanso, Walaa; Karacson, Matthias; Karbach, Moritz; Karodia, Sarah; Kelsey, Matthew; Kenyon, Ian; Kenzie, Matthew; Ketel, Tjeerd; Khanji, Basem; Khurewathanakul, Chitsanu; Klaver, Suzanne; Klimaszewski, Konrad; Kochebina, Olga; Kolpin, Michael; Komarov, Ilya; Koopman, Rose; Koppenburg, Patrick; Korolev, Mikhail; Kravchuk, Leonid; Kreplin, Katharina; Kreps, Michal; Krocker, Georg; Krokovny, Pavel; Kruse, Florian; Kucewicz, Wojciech; Kucharczyk, Marcin; Kudryavtsev, Vasily; Kuonen, Axel Kevin; Kurek, Krzysztof; Kvaratskheliya, Tengiz; La Thi, Viet Nga; Lacarrere, Daniel; Lafferty, George; Lai, Adriano; Lambert, Dean; Lambert, Robert W; Lanfranchi, Gaia; Langenbruch, Christoph; Langhans, Benedikt; Latham, Thomas; Lazzeroni, Cristina; Le Gac, Renaud; van Leerdam, Jeroen; Lees, Jean-Pierre; Lefèvre, Regis; Leflat, Alexander; Lefrançois, Jacques; Leroy, Olivier; Lesiak, Tadeusz; Leverington, Blake; Li, Yiming; Likhomanenko, Tatiana; Liles, Myfanwy; Lindner, Rolf; Linn, Christian; Lionetto, Federica; Liu, Bo; Liu, Xuesong; Lohn, Stefan; Longstaff, Iain; Lopes, Jose; Lucchesi, Donatella; Lucio Martinez, Miriam; Luo, Haofei; Lupato, Anna; Luppi, Eleonora; Lupton, Oliver; Machefert, Frederic; Maciuc, Florin; Maev, Oleg; Maguire, Kevin; Malde, Sneha; Malinin, Alexander; Manca, Giulia; Mancinelli, Giampiero; Manning, Peter Michael; Mapelli, Alessandro; Maratas, Jan; Marchand, Jean François; Marconi, Umberto; Marin Benito, Carla; Marino, Pietro; Märki, Raphael; Marks, Jörg; Martellotti, Giuseppe; Martinelli, Maurizio; Martinez Santos, Diego; Martinez Vidal, Fernando; Martins Tostes, Danielle; Massafferri, André; Matev, Rosen; Mathad, Abhijit; Mathe, Zoltan; Matteuzzi, Clara; Matthieu, Kecke; Mauri, Andrea; Maurin, Brice; Mazurov, Alexander; McCann, Michael; McCarthy, James; McNab, Andrew; McNulty, Ronan; Meadows, Brian; Meier, Frank; Meissner, Marco; Merk, Marcel; Milanes, Diego Alejandro; Minard, Marie-Noelle; Mitzel, Dominik Stefan; Molina Rodriguez, Josue; Monteil, Stephane; Morandin, Mauro; Morawski, Piotr; Mordà, Alessandro; Morello, Michael Joseph; Moron, Jakub; Morris, Adam Benjamin; Mountain, Raymond; Muheim, Franz; Müller, Janine; Müller, Katharina; Müller, Vanessa; Mussini, Manuel; Muster, Bastien; Naik, Paras; Nakada, Tatsuya; Nandakumar, Raja; Nasteva, Irina; Needham, Matthew; Neri, Nicola; Neubert, Sebastian; Neufeld, Niko; Neuner, Max; Nguyen, Anh Duc; Nguyen, Thi-Dung; Nguyen-Mau, Chung; Niess, Valentin; Niet, Ramon; Nikitin, Nikolay; Nikodem, Thomas; Ninci, Daniele; Novoselov, Alexey; O'Hanlon, Daniel Patrick; Oblakowska-Mucha, Agnieszka; Obraztsov, Vladimir; Ogilvy, Stephen; Okhrimenko, Oleksandr; Oldeman, Rudolf; Onderwater, Gerco; Osorio Rodrigues, Bruno; Otalora Goicochea, Juan Martin; Otto, Adam; Owen, Patrick; Oyanguren, Maria Aranzazu; Palano, Antimo; Palombo, Fernando; Palutan, Matteo; Panman, Jacob; Papanestis, Antonios; Pappagallo, Marco; Pappalardo, Luciano; Parkes, Christopher; Passaleva, Giovanni; Patel, Girish; Patel, Mitesh; Patrignani, Claudia; Pearce, Alex; Pellegrino, Antonio; Penso, Gianni; Pepe Altarelli, Monica; Perazzini, Stefano; Perret, Pascal; Pescatore, Luca; Petridis, Konstantinos; Petrolini, Alessandro; Petruzzo, Marco; Picatoste Olloqui, Eduardo; Pietrzyk, Boleslaw; Pilař, Tomas; Pinci, Davide; Pistone, Alessandro; Piucci, Alessio; Playfer, Stephen; Plo Casasus, Maximo; Poikela, Tuomas; Polci, Francesco; Poluektov, Anton; Polyakov, Ivan; Polycarpo, Erica; Popov, Alexander; Popov, Dmitry; Popovici, Bogdan; Potterat, Cédric; Price, Eugenia; Price, Joseph David; Prisciandaro, Jessica; Pritchard, Adrian; Prouve, Claire; Pugatch, Valery; Puig Navarro, Albert; Punzi, Giovanni; Qian, Wenbin; Quagliani, Renato; Rachwal, Bartolomiej; Rademacker, Jonas; Rakotomiaramanana, Barinjaka; Rama, Matteo; Rangel, Murilo; Raniuk, Iurii; Rauschmayr, Nathalie; Raven, Gerhard; Redi, Federico; Reichert, Stefanie; Reid, Matthew; dos Reis, Alberto; Ricciardi, Stefania; Richards, Sophie; Rihl, Mariana; Rinnert, Kurt; Rives Molina, Vincente; Robbe, Patrick; Rodrigues, Ana Barbara; Rodrigues, Eduardo; Rodriguez Lopez, Jairo Alexis; Rodriguez Perez, Pablo; Roiser, Stefan; Romanovsky, Vladimir; Romero Vidal, Antonio; Rotondo, Marcello; Rouvinet, Julien; Ruf, Thomas; Ruiz, Hugo; Ruiz Valls, Pablo; Saborido Silva, Juan Jose; Sagidova, Naylya; Sail, Paul; Saitta, Biagio; Salustino Guimaraes, Valdir; Sanchez Mayordomo, Carlos; Sanmartin Sedes, Brais; Santacesaria, Roberta; Santamarina Rios, Cibran; Santimaria, Marco; Santovetti, Emanuele; Sarti, Alessio; Satriano, Celestina; Satta, Alessia; Saunders, Daniel Martin; Savrina, Darya; Schiller, Manuel; Schindler, Heinrich; Schlupp, Maximilian; Schmelling, Michael; Schmelzer, Timon; Schmidt, Burkhard; Schneider, Olivier; Schopper, Andreas; Schubiger, Maxime; Schune, Marie Helene; Schwemmer, Rainer; Sciascia, Barbara; Sciubba, Adalberto; Semennikov, Alexander; Sepp, Indrek; Serra, Nicola; Serrano, Justine; Sestini, Lorenzo; Seyfert, Paul; Shapkin, Mikhail; Shapoval, Illya; Shcheglov, Yury; Shears, Tara; Shekhtman, Lev; Shevchenko, Vladimir; Shires, Alexander; Silva Coutinho, Rafael; Simi, Gabriele; Sirendi, Marek; Skidmore, Nicola; Skillicorn, Ian; Skwarnicki, Tomasz; Smith, Edmund; Smith, Eluned; Smith, Iwan Thomas; Smith, Jackson; Smith, Mark; Snoek, Hella; Sokoloff, Michael; Soler, Paul; Soomro, Fatima; Souza, Daniel; Souza De Paula, Bruno; Spaan, Bernhard; Spradlin, Patrick; Sridharan, Srikanth; Stagni, Federico; Stahl, Marian; Stahl, Sascha; Steinkamp, Olaf; Stenyakin, Oleg; Sterpka, Christopher Francis; Stevenson, Scott; Stoica, Sabin; Stone, Sheldon; Storaci, Barbara; Stracka, Simone; Straticiuc, Mihai; Straumann, Ulrich; Sun, Liang; Sutcliffe, William; Swientek, Krzysztof; Swientek, Stefan; Syropoulos, Vasileios; Szczekowski, Marek; Szczypka, Paul; Szumlak, Tomasz; T'Jampens, Stephane; Tekampe, Tobias; Teklishyn, Maksym; Tellarini, Giulia; Teubert, Frederic; Thomas, Christopher; Thomas, Eric; van Tilburg, Jeroen; Tisserand, Vincent; Tobin, Mark; Todd, Jacob; Tolk, Siim; Tomassetti, Luca; Tonelli, Diego; Topp-Joergensen, Stig; Torr, Nicholas; Tournefier, Edwige; Tourneur, Stephane; Trabelsi, Karim; Tran, Minh Tâm; Tresch, Marco; Trisovic, Ana; Tsaregorodtsev, Andrei; Tsopelas, Panagiotis; Tuning, Niels; Ukleja, Artur; Ustyuzhanin, Andrey; Uwer, Ulrich; Vacca, Claudia; Vagnoni, Vincenzo; Valenti, Giovanni; Vallier, Alexis; Vazquez Gomez, Ricardo; Vazquez Regueiro, Pablo; Vázquez Sierra, Carlos; Vecchi, Stefania; Velthuis, Jaap; Veltri, Michele; Veneziano, Giovanni; Vesterinen, Mika; Viaud, Benoit; Vieira, Daniel; Vieites Diaz, Maria; Vilasis-Cardona, Xavier; Vollhardt, Achim; Volyanskyy, Dmytro; Voong, David; Vorobyev, Alexey; Vorobyev, Vitaly; Voß, Christian; de Vries, Jacco; Waldi, Roland; Wallace, Charlotte; Wallace, Ronan; Walsh, John; Wandernoth, Sebastian; Wang, Jianchun; Ward, David; Watson, Nigel; Websdale, David; Weiden, Andreas; Whitehead, Mark; Wiedner, Dirk; Wilkinson, Guy; Wilkinson, Michael; Williams, Mark Richard James; Williams, Matthew; Williams, Mike; Williams, Timothy; Wilson, Fergus; Wimberley, Jack; Wishahi, Julian; Wislicki, Wojciech; Witek, Mariusz; Wormser, Guy; Wotton, Stephen; Wright, Simon; Wyllie, Kenneth; Xie, Yuehong; Xu, Zhirui; Yang, Zhenwei; Yu, Jiesheng; Yuan, Xuhao; Yushchenko, Oleg; Zangoli, Maria; Zavertyaev, Mikhail; Zhang, Liming; Zhang, Yanxi; Zhelezov, Alexey; Zhokhov, Anatoly; Zhong, Liang

    2015-01-01

    We report a study of the suppressed $B^{-}\\to DK^-\\pi^+\\pi^-$ and favored $B^-\\to D\\pi^-\\pi^+\\pi^-$ decays, where the neutral $D$ meson is detected through its decays to the $K^{\\mp}\\pi^{\\pm}$ and $CP$-even $K^+K^-$ and $\\pi^+\\pi^-$ final states. The measurement is carried out using a proton-proton collision data sample collected by the LHCb experiment, corresponding to an integrated luminosity of 3.0 fb$^{-1}$. We observe the first significant signals in the $CP$-even final states of the $D$ meson for both the suppressed $B^{-}\\to DK^-\\pi^+\\pi^-$ and favored $B^-\\to D\\pi^-\\pi^+\\pi^-$ modes, as well as in the doubly Cabibbo-suppressed $D\\to K^+\\pi^-$ final state of the $B^-\\to D\\pi^-\\pi^+\\pi^-$ decay. Evidence for the ADS suppressed decay $B^{-}\\to DK^-\\pi^+\\pi^-$, with $D\\to K^+\\pi^-$, is also presented. From the observed yields in the $B^{-}\\to DK^-\\pi^+\\pi^-$, $B^-\\to D\\pi^-\\pi^+\\pi^-$ and their charge conjugate decay modes, we measure the value of the weak phase to be $\\gamma=(74^{+20}_{-18})^{\\rm o}$. Th...

  12. B -> pi pi Decays and New Physics

    CERN Document Server

    Baek, S; Baek, Seungwon; London, David

    2005-01-01

    We assume that new physics (NP) is present in B -> pi pi decays, affecting the I=2 and/or I=0 amplitudes. We show that, with two ingredients, one can detect either of these types of NP. These are: (i) the standard-model (SM) weak phases are assumed to be measured independently and (ii) it is argued that the NP strong phases are negligible compared to those of the SM. The theoretical uncertainty associated with the second point is only at the level of 5-10%. This analysis can be carried out with present B -> pi pi measurements, but the errors are too large to draw definitive conclusions about the presence/absence of NP. This situation will improve with future measurements. If NP is found, it is possible to measure its parameters with further theoretical input. Assuming that the NP is present in only one isospin channel, we make three theoretical assumptions and extract its parameters. Present data suggest the presence of I=2 NP, but this conclusion should be viewed with skepticism due to the high level of theo...

  13. AgPi: Agents on Raspberry Pi

    Directory of Open Access Journals (Sweden)

    Tushar Semwal

    2016-10-01

    Full Text Available The Raspberry Pi and its variants have brought with them an aura of change in the world of embedded systems. With their impressive computation and communication capabilities and low footprint, these devices have thrown open the possibility of realizing a network of things in a very cost-effective manner. While such networks offer good solutions to prominent issues, they are indeed a long way from being smart or intelligent. Most of the currently available implementations of such a network of devices involve a centralized cloud-based server that contributes to making the necessary intelligent decisions, leaving these devices fairly underutilized. Though this paradigm provides for an easy and rapid solution, they have limited scalability, are less robust and at times prove to be expensive. In this paper, we introduce the concept of Agents on Raspberry Pi (AgPi as a cyber solution to enhance the smartness and flexibility of such embedded networks of physical devices in a decentralized manner. The use of a Multi-Agent System (MAS running on Raspberry Pis aids agents, both static and mobile, to govern the various activities within the network. Agents can act autonomously or on behalf of a human user and can collaborate, learn, adapt and act, thus contributing to embedded intelligence. This paper describes how Tartarus, a multi-agent platform, embedded on Raspberry Pis that constitute a network, can bring the best out of the system. To reveal the versatility of the concept of AgPi, an application for a Location-Aware and Tracking Service (LATS is presented. The results obtained from a comparison of data transfer cost between the conventional cloud-based approach with AgPi have also been included.

  14. Measurement of the B^0 -> D^*- pi^+ pi^- pi^+ branching fraction

    CERN Document Server

    ,

    2016-01-01

    Using a sample of (470.9 +- 2.8) x 10^6 BB-bar pairs, we measure the decay branching fraction B(B^0 -> D^*- pi^+ pi^- pi^+) = (7.26 +- 0.11 +- 0.31) x 10^-3, where the first uncertainty is statistical and the second is systematic. Our measurement will be helpful in studies of lepton universality by measuring B(B^0 -> D^*- tau^+ nu_tau) using tau^+ -> pi^+ pi^- pi^+ nu-bar_tau decays, normalized to B(B^0 -> D^*- pi^+ pi^- pi^+.

  15. Measurement of \\Gamma(\\eta -> \\pi^+\\pi^-\\gamma)/\\Gamma(\\eta -> \\pi^+\\pi^-\\pi^0) with the KLOE Detector

    CERN Document Server

    Babusci, D; Balwierz-Pytko, I; Bencivenni, G; Bini, C; Bloise, C; Bocci, V; Bossi, F; Branchini, P; Budano, A; Caldeira Balkest, L; Capon, G; Ceradini, F; Ciambrone, P; Czerwinski, E; Dane, E; De Lucia, E; De Robertis, G; De Santis, A; De Simone, P; Di Domenico, A; Di Donato, C; Di Micco, B; Di Salvo, R; Domenici, D; Erriquez, O; Fanizzi, G; Fantini, A; Felici, G; Fiore, S; Franzini, P; Gauzzi, P; Giardina, G; Giovannella, S; Gonnella, F; Graziani, E; Happacher, F; Hoistad, B; Iafolla, L; Jacewicz, M; Johansson, T; Kupsc, A; Lee-Franzini, J; Leverington, B; Loddo, F; Loffredo, S; Mandaglio, G; Martemianov, M; Martini, M; Mascolo, M; Messi, R; Miscetti, S; Morello, G; Moricciani, D; Moskal, P; Nguyen, F; Passeri, A; Patera, V; Prado Longhi, I; Ranieri, A; Redmer, C.F; Santangelo, P; Sarra, I; Schioppa, M; Sciascia, B; Silarski, M; Taccini, C; Tortora, L; Venanzoni, G; Versaci, R; Wislicki, W; Wolke, M; Xu, G; Zdebik, J

    2013-01-01

    The ratio R_{\\eta}=\\Gamma(\\eta -> \\pi^+\\pi^-\\gamma)/\\Gamma(\\eta -> \\pi^+\\pi^-\\pi^0) has been measured by analyzing 22 million \\phi \\to \\eta \\gamma decays collected by the KLOE experiment at DA\\PhiNE, corresponding to an integrated luminosity of 558 pb^{-1}. The \\eta \\to \\pi^+\\pi^-\\gamma proceeds both via the \\rho resonant contribution, and possibly a non-resonant direct term, connected to the box anomaly. Our result, R_{\\eta}= 0.1856\\pm 0.0005_{stat} \\pm 0.0028_{syst}, points out a sizable contribution of the direct term to the total width. The di-pion invariant mass for the \\eta -> \\pi^+\\pi^-\\gamma decay could be described in a model-independent approach in terms of a single free parameter, \\alpha. The determined value of the parameter \\alpha is \\alpha = (1.32 \\pm 0.08_{stat} +0.10/-0.09_{syst}\\pm 0.02_{theo}) GeV^{-2}

  16. A study of 3pi production in gammap → npi+pi+pi- and gammap → Delta++pi+pi-pi- with CLAS at Jefferson Lab

    Science.gov (United States)

    Tsaris, Aristeidis

    Apart from the mesons that the constituent quark model predicts, QCD allows for additional states beyond the qq¯ system. Previous experiments have performed partial wave analysis on pion- production data and claim observation of an exotic JPC = 1-+ state decaying via rhopi. The g12 experiment took place at Jefferson Lab using the CLAS spectrometer, a liquid hydrogen target was used and a tagged photon beam. By studying the reactions gamma p → npi+pi+pi - and gammap → Delta++pi +pi-pi-, the photoproduction of mesons decaying to 3pi was studied using two different but complimentary channels. Events are selected with low four-momentum transfer to the baryon, in order to enhance one pion exchange production. For both 3pi systems the data exhibit two intermediate decays, rhopi and f 2pi. For the gammap → npi +pi+pi- reaction over 600k events were acquired resulting in the largest 3 photoproduction dataset to date. The exotic JPC = 1-+ partial wave does not show resonant behavior and more so it is strongly consistent with a non-resonant non-interfering wave relative to a resonant pi 2(1670). Furthermore, the partial wave analysis shows production of the a2(1320) and pi2(1670) mesons. For the first time we report observation of a photoproduced a 1(1260) meson. For the gammap → Delta ++pi+pi-pi- reaction nearly 350k events were analyzed. A partial wave analysis was performed for the first time on this channel. The a 1(1260), a2(1320), and the pi2(1670) mesons were observed. Observation of the a1(1260) confirms the result first reported in gammap → npi+pi+pi- reaction.

  17. Raspberry Pi user guide

    CERN Document Server

    Halfacree, Gareth

    2012-01-01

    Make the most out of the world’s first truly compact computer It's the size of a credit card, it can be charged like a smartphone, it runs on open-source Linux, and it holds the promise of bringing programming and playing to millions at low cost. And now you can learn how to use this amazing computer from its co-creator, Eben Upton, in Raspberry Pi User Guide. Cowritten with Gareth Halfacree, this guide gets you up and running on Raspberry Pi, whether you're an educator, hacker, hobbyist, or kid. Learn how to connect your Pi to other hardware, install software, write basic programs, an

  18. Raspberry Pi super cluster

    CERN Document Server

    Dennis, Andrew K

    2013-01-01

    This book follows a step-by-step, tutorial-based approach which will teach you how to develop your own super cluster using Raspberry Pi computers quickly and efficiently.Raspberry Pi Super Cluster is an introductory guide for those interested in experimenting with parallel computing at home. Aimed at Raspberry Pi enthusiasts, this book is a primer for getting your first cluster up and running.Basic knowledge of C or Java would be helpful but no prior knowledge of parallel computing is necessary.

  19. $\\gamma\\gamma$ \\to $\\pi\\pi\\pi$ to one loop in chiral perturbation theory

    CERN Document Server

    Talavera, P; Bijnens, J; Bramon, A; Cornet, F

    1995-01-01

    The \\gamma\\gamma \\to \\pi^0 \\pi^0 \\pi^0 and \\gamma\\gamma \\to \\pi^+ \\pi^- \\pi^0 amplitudes are discussed in the general context of Chiral Perturbation Theory (ChPT) to O(p^6). Chiral loops are found to play a major role. This makes these processes a good test of ChPT, mainly in its anomalous sector. We correct earlier numerical results at tree level and determine the one-loop results as well.

  20. Sharing the Pi

    DEFF Research Database (Denmark)

    Paramanathan, Achuthan; Pahlevani, Peyman; Thorsteinsson, Simon

    2014-01-01

    Abstract—This paper presents the design and performance evaluation of an inexpensive testbed for network coding protocols composed of Raspberry Pis. First, we show the performance of random linear network coding primitives on the Raspberry Pi in terms of processing speed and energy consumption...... under a variety of configuration setups. Our measurements show that processing rates of up to 230 Mbps are possible with the Raspberry Pi. Also, the energy consumption per bit can be as small as 3 nJ/bit, which is several orders of magnitude smaller than the transmission/reception energy use....... Surprisingly, overclocking the Raspberry Pi from 700 MHz to 1000 MHz not only produces an increase in processing speed of up to 68 % for large generation sizes, but also provides a reduction of 64 % in the processing energy per bit for most tested scenarios. Then, we show Raspberry Pi as an inexpensive, viable...

  1. Archimedes and Pi.

    Science.gov (United States)

    Shilgalis, Thomas W.

    1989-01-01

    Discusses a calculation method to approximate pi. Describes how to get an approximation to the circumscribed and inscribed perimeters of regular polygons of n sides. Presents the computer program and result of the approximation. (YP)

  2. Amplitude analyses of the decays chi_c1 -> eta pi+ pi- and chi_c1 -> eta' pi+ pi-

    CERN Document Server

    Adams, G S; Ecklund, K M; Insler, J; Muramatsu, H; Park, C S; Pearson, L J; Thorndike, E H; Ricciardi, S; Thomas, C; Artuso, M; Blusk, S; Mountain, R; Skwarnicki, T; Stone, S; Zhang, L M; Bonvicini, G; Cinabro, D; Lincoln, A; Smith, M J; Zhou, P; Zhu, J; Naik, P; Rademacker, J; Asner, D M; Edwards, K W; Randrianarivony, K; Tatishvili, G; Briere, R A; Vogel, H; Onyisi, P U E; Rosner, J L; Alexander, J P; Cassel, D G; Das, S; Ehrlich, R; Gibbons, L; Gray, S W; Hartill, D L; Heltsley, B K; Kreinick, D L; Kuznetsov, V E; Patterson, J R; Peterson, D; Riley, D; Ryd, A; Sadoff, A J; Shi, X; Sun, W M; Yelton, J; Rubin, P; Lowrey, N; Mehrabyan, S; Selen, M; Wiss, J; Libby, J; Kornicer, M; Mitchell, R E; Shepherd, M R; Szczepaniak, A; Besson, D; Pedlar, T K; Cronin-Hennessy, D; Hietala, J; Dobbs, S; Metreveli, Z; Seth, K K; Tomaradze, A; Xiao, T; Martin, L; Powell, A; Wilkinson, G; Ge, J Y; Miller, D H; Shipsey, I P J; Xin, B

    2011-01-01

    Using a data sample of 2.59 x 10^7 psi(2S) decays obtained with the CLEO-c detector, we perform amplitude analyses of the complementary decay chains chi_c1 -> eta pi+ pi- and chi_c1 -> eta' pi+ pi-. We find evidence for a P-wave eta' pi scattering amplitude, which, if interpreted as a resonance, would have exotic J^PC = 1^-+ and parameters consistent with the pi_1(1600) state reported in other production mechanisms. We also make the first observation of the decay a_0(980) -> eta' pi and measure the ratio of branching fractions B(a_0(980) -> eta' pi)/B(a_0(980) -> eta pi) = 0.064 +- 0.014 +- 0.014. The pi pi spectrum produced with a recoiling eta is compared to that with eta' recoil.

  3. Raspberry Pi robotics projects

    CERN Document Server

    Grimmett, Richard

    2015-01-01

    This book is for enthusiasts who want to use the Raspberry Pi to build complex robotics projects. With the aid of the step-by-step instructions in this book, you can construct complex robotics projects that can move, talk, listen, see, swim, or fly. No previous Raspberry Pi robotics experience is assumed, but even experts will find unexpected and interesting information in this invaluable guide.

  4. Resonance formation in the $\\pi^+\\pi^-\\pi^0$ final state in two-photon collisions

    CERN Document Server

    Acciarri, M; Aguilar-Benítez, M; Ahlen, S P; Alcaraz, J; Alemanni, G; Allaby, James V; Aloisio, A; Alverson, G; Alviggi, M G; Ambrosi, G; Anderhub, H; Andreev, V P; Angelescu, T; Anselmo, F; Arefev, A; Azemoon, T; Aziz, T; Bagnaia, P; Baksay, L; Ball, R C; Banerjee, S; Banerjee, Sw; Banicz, K; Barczyk, A; Barillère, R; Barone, L; Bartalini, P; Baschirotto, A; Basile, M; Battiston, R; Bay, A; Becattini, F; Becker, U; Behner, F; Berdugo, J; Berges, P; Bertucci, B; Betev, B L; Bhattacharya, S; Biasini, M; Biland, A; Bilei, G M; Blaising, J J; Blyth, S C; Bobbink, Gerjan J; Böck, R K; Böhm, A; Boldizsar, L; Borgia, B; Boucham, A; Bourilkov, D; Bourquin, Maurice; Boutigny, D; Braccini, S; Branson, J G; Brigljevic, V; Brock, I C; Buffini, A; Buijs, A; Burger, J D; Burger, W J; Busenitz, J K; Cai, X D; Campanelli, M; Capell, M; Cara Romeo, G; Carlino, G; Cartacci, A M; Casaus, J; Castellini, G; Cavallari, F; Cavallo, N; Cecchi, C; Cerrada-Canales, M; Cesaroni, F; Chamizo-Llatas, M; Chang, Y H; Chaturvedi, U K; Chekanov, S V; Chemarin, M; Chen, A; Chen, G; Chen, G M; Chen, H F; Chen, H S; Chen, M; Chiefari, G; Chien, C Y; Cifarelli, Luisa; Cindolo, F; Civinini, C; Clare, I; Clare, R; Cohn, H O; Coignet, G; Colijn, A P; Colino, N; Commichau, V; Costantini, S; Cotorobai, F; de la Cruz, B; Csilling, Akos; Dai, T S; D'Alessandro, R; De Asmundis, R; Degré, A; Deiters, K; Denes, P; De Notaristefani, F; DiBitonto, Daryl; Diemoz, M; Van Dierendonck, D N; Di Lodovico, F; Dionisi, C; Dittmar, Michael; Dominguez, A; Doria, A; Dorne, I; Dova, M T; Drago, E; Duchesneau, D; Duinker, P; Durán, I; Dutta, S; Easo, S; Efremenko, Yu V; El-Mamouni, H; Engler, A; Eppling, F J; Erné, F C; Ernenwein, J P; Extermann, Pierre; Fabre, M; Faccini, R; Falciano, S; Favara, A; Fay, J; Fedin, O; Felcini, Marta; Fenyi, B; Ferguson, T; Ferroni, F; Fesefeldt, H S; Fiandrini, E; Field, J H; Filthaut, Frank; Fisher, P H; Fisk, I; Forconi, G; Fredj, L; Freudenreich, Klaus; Furetta, C; Galaktionov, Yu; Ganguli, S N; García-Abia, P; Gau, S S; Gentile, S; Gerald, J; Gheordanescu, N; Giagu, S; Goldfarb, S; Goldstein, J; Gong, Z F; Gougas, Andreas; Gratta, Giorgio; Grünewald, M W; Gupta, V K; Gurtu, A; Gutay, L J; Hartmann, B; Hasan, A; Hatzifotiadou, D; Hebbeker, T; Hervé, A; Van Hoek, W C; Hofer, H; Hong, S J; Hoorani, H; Hou, S R; Hu, G; Innocente, Vincenzo; Janssen, H; Jenkes, K; Jin, B N; Jones, L W; de Jong, P; Josa-Mutuberria, I; Kasser, A; Khan, R A; Kamrad, D; Kamyshkov, Yu A; Kapustinsky, J S; Karyotakis, Yu; Kaur, M; Kienzle-Focacci, M N; Kim, D; Kim, D H; Kim, J K; Kim, S C; Kim, Y G; Kinnison, W W; Kirkby, A; Kirkby, D; Kirkby, Jasper; Kiss, D; Kittel, E W; Klimentov, A; König, A C; Kopp, A; Korolko, I; Koutsenko, V F; Krämer, R W; Krenz, W; Kunin, A; Ladrón de Guevara, P; Landi, G; Lapoint, C; Lassila-Perini, K M; Laurikainen, P; Lebeau, M; Lebedev, A; Lebrun, P; Lecomte, P; Lecoq, P; Le Coultre, P; Leggett, C; Le Goff, J M; Leiste, R; Leonardi, E; Levchenko, P M; Li Chuan; Lin, C H; Lin, W T; Linde, Frank L; Lista, L; Liu, Z A; Lohmann, W; Longo, E; Lu, W; Lü, Y S; Lübelsmeyer, K; Luci, C; Luckey, D; Luminari, L; Lustermann, W; Ma Wen Gan; Maity, M; Majumder, G; Malgeri, L; Malinin, A; Maña, C; Mangeol, D J J; Mangla, S; Marchesini, P A; Marin, A; Martin, J P; Marzano, F; Massaro, G G G; McNally, D; Mele, S; Merola, L; Meschini, M; Metzger, W J; Von der Mey, M; Mi, Y; Mihul, A; Van Mil, A J W; Mirabelli, G; Mnich, J; Molnár, P; Monteleoni, B; Moore, R; Morganti, S; Moulik, T; Mount, R; Müller, S; Muheim, F; Muijs, A J M; Nahn, S; Napolitano, M; Nessi-Tedaldi, F; Newman, H; Niessen, T; Nippe, A; Nisati, A; Nowak, H; Oh, Yu D; Opitz, H; Organtini, G; Ostonen, R; Palomares, C; Pandoulas, D; Paoletti, S; Paolucci, P; Park, H K; Park, I H; Pascale, G; Passaleva, G; Patricelli, S; Paul, T; Pauluzzi, M; Paus, C; Pauss, Felicitas; Peach, D; Pei, Y J; Pensotti, S; Perret-Gallix, D; Petersen, B; Petrak, S; Pevsner, A; Piccolo, D; Pieri, M; Pinto, J C; Piroué, P A; Pistolesi, E; Plyaskin, V; Pohl, M; Pozhidaev, V; Postema, H; Produit, N; Prokofev, D; Prokofiev, D O; Rahal-Callot, G; Raja, N; Rancoita, P G; Rattaggi, M; Raven, G; Razis, P A; Read, K; Ren, D; Rescigno, M; Reucroft, S; Van Rhee, T; Riemann, S; Riles, K; Robohm, A; Rodin, J; Roe, B P; Romero, L; Rosier-Lees, S; Rosselet, P; Van Rossum, W; Roth, S; Rubio, Juan Antonio; Ruschmeier, D; Rykaczewski, H; Salicio, J; Sánchez, E; Sanders, M P; Sarakinos, M E; Sarkar, S; Sassowsky, M; Sauvage, G; Schäfer, C; Shchegelskii, V; Schmidt-Kärst, S; Schmitz, D; Schmitz, P; Schneegans, M; Scholz, N; Schopper, Herwig Franz; Schotanus, D J; Schwenke, J; Schwering, G; Sciacca, C; Sciarrino, D; Servoli, L; Shevchenko, S; Shivarov, N; Shoutko, V; Shukla, J; Shumilov, E; Shvorob, A V; Siedenburg, T; Son, D; Sopczak, André; Soulimov, V; Smith, B; Spillantini, P; Steuer, M; Stickland, D P; Stone, H; Stoyanov, B; Strässner, A; Strauch, K; Sudhakar, K; Sultanov, G G; Sun, L Z; Susinno, G F; Suter, H; Swain, J D; Tang, X W; Tauscher, Ludwig; Taylor, L; Ting, Samuel C C; Ting, S M; Tonutti, M; Tonwar, S C; Tóth, J; Tully, C; Tuchscherer, H; Tung, K L; Uchida, Y; Ulbricht, J; Uwer, U; Valente, E; Van de Walle, R T; Vesztergombi, G; Vetlitskii, I; Viertel, Gert M; Vivargent, M; Völkert, R; Vogel, H; Vogt, H; Vorobev, I; Vorobyov, A A; Vorvolakos, A; Wadhwa, M; Wallraff, W; Wang, J C; Wang, X L; Wang, Z M; Weber, A; Wittgenstein, F; Wu, S X; Wynhoff, S; Xu, J; Xu, Z Z; Yang, B Z; Yang, C G; Yao, X Y; Ye, J B; Yeh, S C; You, J M; Zalite, A; Zalite, Yu; Zemp, P; Zeng, Y; Zhang, Z; Zhang, Z P; Zhou, B; Zhou, Y; Zhu, G Y; Zhu, R Y; Zichichi, Antonino; Ziegler, F

    1997-01-01

    A study of resonance formation is presented in the $\\pi^+\\pi^-\\pi^0$ final state in two-photon collisions at LEP. The $a_2(1320)$ radiative width is measured to be $\\Gamma_{\\gamma\\gamma}=0.98\\pm0.05\\pm0.09$ keV{}. The helicity 2 production is dominant. Exclusive $\\pi^+\\pi^-\\pi^0$ production has also been studied in the mass region above the $a_2$ in the $\\rho\\pi$ and $f_2\\pi$ channels. This region is dominated by a $\\rm J^P$=$2^+$ helicity 2 wave.

  5. Measurement of the ratios of branching fractions B(B0s --> Ds- pi+ pi+ pi-)/B(B0-->D- pi+ pi+ pi-) and B(B0s --> Ds- pi+)/B(B0-->D- pi+).

    Science.gov (United States)

    Abulencia, A; Adelman, J; Affolder, T; Akimoto, T; Albrow, M G; Ambrose, D; Amerio, S; Amidei, D; Anastassov, A; Anikeev, K; Annovi, A; Antos, J; Aoki, M; Apollinari, G; Arguin, J-F; Arisawa, T; Artikov, A; Ashmanskas, W; Attal, A; Azfar, F; Azzi-Bacchetta, P; Azzurri, P; Bacchetta, N; Badgett, W; Barbaro-Galtieri, A; Barnes, V E; Barnett, B A; Baroiant, S; Bartsch, V; Bauer, G; Bedeschi, F; Behari, S; Belforte, S; Bellettini, G; Bellinger, J; Belloni, A; Benjamin, D; Beretvas, A; Beringer, J; Berry, T; Bhatti, A; Binkley, M; Bisello, D; Blair, R E; Blocker, C; Blumenfeld, B; Bocci, A; Bodek, A; Boisvert, V; Bolla, G; Bolshov, A; Bortoletto, D; Boudreau, J; Boveia, A; Brau, B; Brigliadori, L; Bromberg, C; Brubaker, E; Budagov, J; Budd, H S; Budd, S; Budroni, S; Burkett, K; Busetto, G; Bussey, P; Byrum, K L; Cabrera, S; Campanelli, M; Campbell, M; Canelli, F; Canepa, A; Carillo, S; Carlsmith, D; Carosi, R; Casarsa, M; Castro, A; Catastini, P; Cauz, D; Cavalli-Sforza, M; Cerri, A; Cerrito, L; Chang, S H; Chen, Y C; Chertok, M; Chiarelli, G; Chlachidze, G; Chlebana, F; Cho, I; Cho, K; Chokheli, D; Chou, J P; Choudalakis, G; Chuang, S H; Chung, K; Chung, W H; Chung, Y S; Ciljak, M; Ciobanu, C I; Ciocci, M A; Clark, A; Clark, D; Coca, M; Compostella, G; Convery, M E; Conway, J; Cooper, B; Copic, K; Cordelli, M; Cortiana, G; Crescioli, F; Cuenca Almenar, C; Cuevas, J; Culbertson, R; Cully, J C; Cyr, D; DaRonco, S; D'Auria, S; Davies, T; D'Onofrio, M; Dagenhart, D; de Barbaro, P; De Cecco, S; Deisher, A; De Lentdecker, G; Dell'Orso, M; Delli Paoli, F; Demortier, L; Deng, J; Deninno, M; De Pedis, D; Derwent, P F; Di Giovanni, G P; Dionisi, C; Di Ruzza, B; Dittmann, J R; Dituro, P; Dörr, C; Donati, S; Donega, M; Dong, P; Donini, J; Dorigo, T; Dube, S; Efron, J; Erbacher, R; Errede, D; Errede, S; Eusebi, R; Fang, H C; Farrington, S; Fedorko, I; Fedorko, W T; Feild, R G; Feindt, M; Fernandez, J P; Field, R; Flanagan, G; Foland, A; Forrester, S; Foster, G W; Franklin, M; Freeman, J C; Furic, I; Gallinaro, M; Galyardt, J; Garcia, J E; Garberson, F; Garfinkel, A F; Gay, C; Gerberich, H; Gerdes, D; Giagu, S; Giannetti, P; Gibson, A; Gibson, K; Gimmell, J L; Ginsburg, C; Giokaris, N; Giordani, M; Giromini, P; Giunta, M; Giurgiu, G; Glagolev, V; Glenzinski, D; Gold, M; Goldschmidt, N; Goldstein, J; Gomez, G; Gomez-Ceballos, G; Goncharov, M; González, O; Gorelov, I; Goshaw, A T; Goulianos, K; Gresele, A; Griffiths, M; Grinstein, S; Grosso-Pilcher, C; Grundler, U; Guimaraes da Costa, J; Gunay-Unalan, Z; Haber, C; Hahn, K; Hahn, S R; Halkiadakis, E; Hamilton, A; Han, B-Y; Han, J Y; Handler, R; Happacher, F; Hara, K; Hare, M; Harper, S; Harr, R F; Harris, R M; Hartz, M; Hatakeyama, K; Hauser, J; Heijboer, A; Heinemann, B; Heinrich, J; Henderson, C; Herndon, M; Heuser, J; Hidas, D; Hill, C S; Hirschbuehl, D; Hocker, A; Holloway, A; Hou, S; Houlden, M; Hsu, S-C; Huffman, B T; Hughes, R E; Husemann, U; Huston, J; Incandela, J; Introzzi, G; Iori, M; Ishizawa, Y; Ivanov, A; Iyutin, B; James, E; Jang, D; Jayatilaka, B; Jeans, D; Jensen, H; Jeon, E J; Jindariani, S; Jones, M; Joo, K K; Jun, S Y; Jung, J E; Junk, T R; Kamon, T; Karchin, P E; Kato, Y; Kemp, Y; Kephart, R; Kerzel, U; Khotilovich, V; Kilminster, B; Kim, D H; Kim, H S; Kim, J E; Kim, M J; Kim, S B; Kim, S H; Kim, Y K; Kimura, N; Kirsch, L; Klimenko, S; Klute, M; Knuteson, B; Ko, B R; Kondo, K; Kong, D J; Konigsberg, J; Korytov, A; Kotwal, A V; Kovalev, A; Kraan, A C; Kraus, J; Kravchenko, I; Kreps, M; Kroll, J; Krumnack, N; Kruse, M; Krutelyov, V; Kubo, T; Kuhlmann, S E; Kuhr, T; Kusakabe, Y; Kwang, S; Laasanen, A T; Lai, S; Lami, S; Lammel, S; Lancaster, M; Lander, R L; Lannon, K; Lath, A; Latino, G; Lazzizzera, I; LeCompte, T; Lee, J; Lee, J; Lee, Y J; Lee, S W; Lefèvre, R; Leonardo, N; Leone, S; Levy, S; Lewis, J D; Lin, C; Lin, C S; Lindgren, M; Lipeles, E; Lister, A; Litvintsev, D O; Liu, T; Lockyer, N S; Loginov, A; Loreti, M; Loverre, P; Lu, R-S; Lucchesi, D; Lujan, P; Lukens, P; Lungu, G; Lyons, L; Lys, J; Lysak, R; Lytken, E; Mack, P; MacQueen, D; Madrak, R; Maeshima, K; Makhoul, K; Maki, T; Maksimovic, P; Malde, S; Manca, G; Margaroli, F; Marginean, R; Marino, C; Marino, C P; Martin, A; Martin, M; Martin, V; Martínez, M; Maruyama, T; Mastrandrea, P; Masubuchi, T; Matsunaga, H; Mattson, M E; Mazini, R; Mazzanti, P; McFarland, K S; McIntyre, P; McNulty, R; Mehta, A; Mehtala, P; Menzemer, S; Menzione, A; Merkel, P; Mesropian, C; Messina, A; Miao, T; Miladinovic, N; Miles, J; Miller, R; Mills, C; Milnik, M; Mitra, A; Mitselmakher, G; Miyamoto, A; Moed, S; Moggi, N; Mohr, B; Moore, R; Morello, M; Movilla Fernandez, P; Mülmenstädt, J; Mukherjee, A; Muller, Th; Mumford, R; Murat, P; Nachtman, J; Nagano, A; Naganoma, J; Nakano, I; Napier, A; Necula, V; Neu, C; Neubauer, M S; Nielsen, J; Nigmanov, T; Nodulman, L; Norniella, O; Nurse, E; Oh, S H; Oh, Y D; Oksuzian, I; Okusawa, T; Oldeman, R; Orava, R; Osterberg, K; Pagliarone, C; Palencia, E; Papadimitriou, V; Paramonov, A A; Parks, B; Pashapour, S; Patrick, J; Pauletta, G; Paulini, M; Paus, C; Pellett, D E; Penzo, A; Phillips, T J; Piacentino, G; Piedra, J; Pinera, L; Pitts, K; Plager, C; Pondrom, L; Portell, X; Poukhov, O; Pounder, N; Prakoshyn, F; Pronko, A; Proudfoot, J; Ptohos, F; Punzi, G; Pursley, J; Rademacker, J; Rahaman, A; Ranjan, N; Rappoccio, S; Reisert, B; Rekovic, V; Renton, P; Rescigno, M; Richter, S; Rimondi, F; Ristori, L; Robson, A; Rodrigo, T; Rogers, E; Rolli, S; Roser, R; Rossi, M; Rossin, R; Ruiz, A; Russ, J; Rusu, V; Saarikko, H; Sabik, S; Safonov, A; Sakumoto, W K; Salamanna, G; Saltó, O; Saltzberg, D; Sánchez, C; Santi, L; Sarkar, S; Sartori, L; Sato, K; Savard, P; Savoy-Navarro, A; Scheidle, T; Schlabach, P; Schmidt, E E; Schmidt, M P; Schmitt, M; Schwarz, T; Scodellaro, L; Scott, A L; Scribano, A; Scuri, F; Sedov, A; Seidel, S; Seiya, Y; Semenov, A; Sexton-Kennedy, L; Sfyrla, A; Shapiro, M D; Shears, T; Shepard, P F; Sherman, D; Shimojima, M; Shochet, M; Shon, Y; Shreyber, I; Sidoti, A; Sinervo, P; Sisakyan, A; Sjolin, J; Slaughter, A J; Slaunwhite, J; Sliwa, K; Smith, J R; Snider, F D; Snihur, R; Soderberg, M; Soha, A; Somalwar, S; Sorin, V; Spalding, J; Spinella, F; Spreitzer, T; Squillacioti, P; Stanitzki, M; Staveris-Polykalas, A; St Denis, R; Stelzer, B; Stelzer-Chilton, O; Stentz, D; Strologas, J; Stuart, D; Suh, J S; Sukhanov, A; Sun, H; Suzuki, T; Taffard, A; Takashima, R; Takeuchi, Y; Takikawa, K; Tanaka, M; Tanaka, R; Tecchio, M; Teng, P K; Terashi, K; Thom, J; Thompson, A S; Thomson, E; Tipton, P; Tiwari, V; Tkaczyk, S; Toback, D; Tokar, S; Tollefson, K; Tomura, T; Tonelli, D; Torre, S; Torretta, D; Tourneur, S; Trischuk, W; Tsuchiya, R; Tsuno, S; Turini, N; Ukegawa, F; Unverhau, T; Uozumi, S; Usynin, D; Vallecorsa, S; van Remortel, N; Varganov, A; Vataga, E; Vázquez, F; Velev, G; Veramendi, G; Veszpremi, V; Vidal, R; Vila, I; Vilar, R; Vine, T; Vollrath, I; Volobouev, I; Volpi, G; Würthwein, F; Wagner, P; Wagner, R G; Wagner, R L; Wagner, J; Wagner, W; Wallny, R; Wang, S M; Warburton, A; Waschke, S; Waters, D; Wester, W C; Whitehouse, B; Whiteson, D; Wicklund, A B; Wicklund, E; Williams, G; Williams, H H; Wilson, P; Winer, B L; Wittich, P; Wolbers, S; Wolfe, C; Wright, T; Wu, X; Wynne, S M; Yagil, A; Yamamoto, K; Yamaoka, J; Yamashita, T; Yang, C; Yang, U K; Yang, Y C; Yao, W M; Yeh, G P; Yoh, J; Yorita, K; Yoshida, T; Yu, G B; Yu, I; Yu, S S; Yun, J C; Zanello, L; Zanetti, A; Zaw, I; Zhang, X; Zhou, J; Zucchelli, S

    2007-02-09

    Using 355 pb;{-1} of data collected by the CDF II detector in pp[over ] collisions at sqrt[s]=1.96 TeV at the Fermilab Tevatron, we study the fully reconstructed hadronic decays B_{(s)};{0}-->D_{(s)};{-}pi;{+} and B_{(s)};{0}-->D_{(s)};{-}pi;{+}pi;{+}pi;{-}. We present the first measurement of the ratio of branching fractions B(B_{s};{0}-->D_{s};{-}pi;{+}pi;{+}pi;{-})/B(B;{0}-->D;{-}pi;{+}pi;{+}pi;{-})=1.05+/-0.10(stat)+/-0.22(syst). We also update our measurement of B(B_{s};{0}-->D_{s};{-}pi;{+})/B(B;{0}-->D;{-}pi;{+}) to 1.13+/-0.08(stat)+/-0.23(syst), improving the statistical uncertainty by more than a factor of 2. We find B(B_{s};{0}-->D_{s};{-}pi;{+})=[3.8+/-0.3(stat)+/-1.3(syst)]x10;{-3} and B(B_{s};{0}-->D_{s};{-}pi;{+}pi;{+}pi;{-})=[8.4+/-0.8(stat)+/-3.2(syst)]x10;{-3}.

  6. Perturbative framework for the pi(+)pi(-) atom

    OpenAIRE

    Lyubovitskij, V. E.; Lipartia, E. Z.; Rusetsky, A. G.

    1998-01-01

    The perturbative framework is developed for the calculation of the pi(+)pi(-) atom characteristics on the basis of the field-theoretical Bethe-Salpeter approach. A closed expression for the first-order correction to the pi(+)pi(-) atom lifetime has been obtained.

  7. pi-pi interaction amplitudes with chiral constraints

    OpenAIRE

    Kaminski, Robert

    2000-01-01

    The pi-pi interaction amplitudes have been calculated using a three coupled channel model both with and without constraints imposed by chiral models. Roy's equations have been used to compare the amplitudes and to study the role played by chiral constraints in the pi-pi interaction.

  8. Measurement of the Ratios of Branching Fractions B(Bs -> Ds pi pi pi) / B(Bd -> Dd pi pi pi) and B(Bs -> Ds pi) / B(Bd -> Dd pi)

    CERN Document Server

    Abulencia, A; Affolder, T; Akimoto, T; Albrow, M G; Ambrose, D; Amerio, S; Amidei, D; Anastassov, A; Anikeev, K; Annovi, A; Antos, J; Aoki, M; Apollinari, G; Arguin, J F; Arisawa, T; Artikov, A; Ashmanskas, W; Attal, A; Azfar, F; Azzi-Bacchetta, P; Azzurri, P; Bacchetta, N; Badgett, W; Barbaro-Galtieri, A; Barnes, V E; Barnett, B A; Baroiant, S; Bartsch, V; Bauer, G; Bedeschi, F; Behari, S; Belforte, S; Bellettini, G; Bellinger, J; Belloni, A; Benjamin, D; Beretvas, A; Beringer, J; Berry, T; Bhatti, A; Binkley, M; Bisello, D; Blair, R E; Blocker, C; Blumenfeld, B; Bocci, A; Bodek, A; Boisvert, V; Bölla, G; Bolshov, A; Bortoletto, D; Boudreau, J; Boveia, A; Brau, B; Brigliadori, L; Bromberg, C; Brubaker, E; Budagov, Yu A; Budd, H S; Budd, S; Budroni, S; Burkett, K; Busetto, G; Bussey, P; Byrum, K L; Cabrera, S; Campanelli, M; Campbell, M; Canelli, F; Canepa, A; Carillo, S; Carlsmith, D; Carosi, R; Casarsa, M; Castro, A; Catastini, P; Cauz, D; Cavalli-Sforza, M; Cerri, A; Cerrito, L; Chang, S H; Chen, Y C; Chertok, M; Chiarelli, G; Chlachidze, G; Chlebana, F; Cho, I; Cho, K; Chokheli, D; Chou, J P; Choudalakis, G; Chuang, S H; Chung, K; Chung, W H; Chung, Y S; Ciljak, M; Ciobanu, C I; Ciocci, M A; Clark, A; Clark, D; Coca, M; Compostella, G; Convery, M E; Conway, J; Cooper, B; Copic, K; Cordelli, M; Cortiana, G; Crescioli, F; Cuenca-Almenar, C; Cuevas-Maestro, J; Culbertson, R; Cully, J C; Cyr, D; D'Auria, S; D'Onofrio, M; Da Ronco, S; Dagenhart, D; Davies, T; De Barbaro, P; De Cecco, S; De Lentdecker, G; De Pedis, D; Deisher, A; Dell'Orso, Mauro; Delli Paoli, F; Demortier, L; Deng, J; Deninno, M; Derwent, P F; Di Giovanni, G P; Di Ruzza, B; Di Turo, P; Dionisi, C; Dittmann, J R; Donati, S; Donega, M; Dong, P; Donini, J; Dorigo, T; Dorr, C; Dube, S; Efron, J; Erbacher, R; Errede, D; Errede, S; Eusebi, R; Fang, H C; Farrington, S; Fedorko, I; Fedorko, W T; Feild, R G; Feindt, M; Fernández, J P; Field, R; Flanagan, G; Foland, A; Forrester, S; Foster, G W; Franklin, M; Freeman, J C; Furic, I; Gallinaro, M; Galyardt, J; Garberson, F; García, J E; Garfinkel, A F; Gay, C; Gerberich, H; Gerdes, D; Giagu, S; Giannetti, P; Gibson, A; Gibson, K; Gimmell, J L; Ginsburg, C; Giokaris, N; Giordani, M; Giromini, P; Giunta, M; Giurgiu, G; Glagolev, V; Glenzinski, D; Gold, M; Goldschmidt, N; Goldstein, J; Goncharov, M; González, O; Gorelov, I; Goshaw, A T; Goulianos, K; Gresele, A; Griffiths, M; Grinstein, S; Grosso-Pilcher, C; Group, R C; Grundler, U; Guimarães da Costa, J; Gunay-Unalan, Z; Gómez, G; Gómez-Ceballos, G; Haber, C; Hahn, K; Hahn, S R; Halkiadakis, E; Hamilton, A; Han, B Y; Han, J Y; Handler, R; Happacher, F; Hara, K; Hare, M; Harper, S; Harr, R F; Harris, R M; Hartz, M; Hatakeyama, K; Hauser, J; Heijboer, A; Heinemann, B; Heinrich, J; Henderson, C; Herndon, M; Heuser, J; Hidas, D; Hill, C S; Hirschbuehl, D; Holloway, A; Hou, S; Houlden, M; Hsu, S C; Huffman, B T; Hughes, R E; Husemann, U; Huston, J; Höcker, A; Incandela, J R; Introzzi, G; Iori, M; Ishizawa, Y; Ivanov, A; Iyutin, B; James, E; Jang, D; Jayatilaka, B; Jeans, D; Jensen, H; Jeon, E J; Jindariani, S; Jones, M; Joo, K K; Jun, S Y; Jung, J E; Junk, T R; Kamon, T; Karchin, P E; Kato, Y; Kemp, Y; Kephart, R; Kerzel, U; Khotilovich, V; Kilminster, B; Kim, D H; Kim, H S; Kim, J E; Kim, M J; Kim, S B; Kim, S H; Kim, Y K; Kimura, N; Kirsch, L; Klimenko, S; Klute, M; Knuteson, B; Ko, B R; Kondo, K; Kong, D J; Konigsberg, J; Korytov, A; Kotwal, A V; Kovalev, A; Kraan, A C; Kraus, J; Kravchenko, I; Kreps, M; Kroll, J; Krumnack, N; Kruse, M; Krutelyov, V; Kubo, T; Kuhlmann, S E; Kuhr, T; Kusakabe, Y; Kwang, S; Laasanen, A T; Lai, S; Lami, S; Lammel, S; Lancaster, M; Lander, R L; Lannon, K; Lath, A; Latino, G; Lazzizzera, I; LeCompte, T; Lee, J; Lee, S W; Lee, Y J; Lefèvre, R; Leonardo, N; Leone, S; Levy, S; Lewis, J D; Lin, C; Lin, C S; Lindgren, M; Lipeles, E; Lister, A; Litvintsev, D O; Liu, T; Lockyer, N S; Loginov, A; Loreti, M; Loverre, P F; Lu, R S; Lucchesi, D; Lujan, P; Lukens, P; Lungu, G; Lyons, L; Lys, J; Lysak, R; Lytken, E; MacQueen, D; Mack, P; Madrak, R; Maeshima, K; Makhoul, K; Maksimovic, P; Malde, S; Manca, G; Margaroli, F; Marginean, R; Marino, C; Marino, C P; Martin, A; Martin, M; Martin, V; Martínez, M; Maruyama, T; Mastrandrea, P; Masubuchi, T; Matsunaga, H; Mattson, M E; Mazini, R; Mazzanti, P; McFarland, K S; McIntyre, P; McNulty, R; Mehta, A; Mehtälä, P; Menzemer, S; Menzione, A; Merkel, P; Mesropian, C; Messina, A; Miao, T; Miladinovic, N; Miles, J; Miller, R; Mills, C; Milnik, M; Mitra, A; Mitselmakher, G; Miyamoto, A; Moed, S; Moggi, N; Mohr, B; Moore, R; Morello, M; Movilla-Fernández, P A; Mukherjee, A; Mumford, R; Murat, P; Mäki, T; Müller, T; Mülmenstädt, J; Nachtman, J; Nagano, A; Naganoma, J; Nakano, I; Napier, A; Necula, V; Neu, C; Neubauer, M S; Nielsen, J; Nigmanov, T; Nodulman, L; Norniella, O; Nurse, E; Oh, S H; Oh, Y D; Oksuzian, I; Okusawa, T; Oldeman, R; Orava, R; Pagliarone, C; Palencia, E; Papadimitriou, V; Paramonov, A A; Parks, B; Pashapour, S; Patrick, J; Pauletta, G; Paulini, M; Paus, C; Pellett, D E; Penzo, Aldo L; Phillips, T J; Piacentino, G; Piedra, J; Pinera, L; Pitts, K; Plager, C; Pondrom, L; Portell, X; Poukhov, O; Pounder, N; Prakoshyn, F; Pronko, A; Proudfoot, J; Ptohos, F; Punzi, G; Pursley, J; Rademacker, J; Rahaman, A; Ranjan, N; Rappoccio, S; Reisert, B; Rekovic, V; Renton, P B; Rescigno, M; Richter, S; Rimondi, F; Ristori, L; Robson, A; Rodrigo, T; Rogers, E; Rolli, S; Roser, R; Rossi, M; Rossin, R; Ruiz, A; Russ, J; Rusu, V; Saarikko, H; Sabik, S; Safonov, A; Saint-Denis, R; Sakumoto, W K; Salamanna, G; Salto, O; Saltzberg, D; Santi, L; Sarkar, S; Sartori, L; Sato, K; Savard, P; Savoy-Navarro, A; Scheidle, T; Schlabach, P; Schmidt, E E; Schmidt, M P; Schmitt, M; Schwarz, T; Scodellaro, L; Scott, A L; Scribano, A; Scuri, F; Sedov, A; Seidel, S; Seiya, Y; Semenov, A; Sexton-Kennedy, L; Sfyrla, A; Shapiro, M D; Shears, T G; Shepard, P F; Sherman, D; Shimojima, M; Shochet, M; Shon, Y; Shreyber, I; Sidoti, A; Sinervo, P; Sisakian, A; Sjölin, J; Slaughter, A J; Slaunwhite, J; Sliwa, K; Smith, J R; Snider, F D; Snihur, R; Soha, A; Somalwar, S; Sorin, V; Spalding, J; Spinella, F; Spreitzer, T; Squillacioti, P; Stanitzki, M; Staveris-Polykalas, A; Stelzer, B; Stelzer-Chilton, O; Stentz, D; Strologas, J; Stuart, D; Suh, J S; Sukhanov, A; Sun, H; Suzuki, T; Sánchez, C; Söderberg, M; Taffard, A; Takashima, R; Takeuchi, Y; Takikawa, K; Tanaka, M; Tanaka, R; Tecchio, M; Teng, P K; Terashi, K; Thom, J; Thompson, A S; Thomson, E; Tipton, P; Tiwari, V; Tkaczyk, S; Toback, D; Tokar, S; Tollefson, K; Tomura, T; Tonelli, D; Torre, S; Torretta, D; Tourneur, S; Trischuk, W; Tsuchiya, R; Tsuno, S; Turini, N; Ukegawa, F; Unverhau, T; Uozumi, S; Usynin, D; Vallecorsa, S; Van Remortel, N; Varganov, A; Vataga, E; Velev, G; Veramendi, G; Veszpremi, V; Vidal, R; Vila, I; Vilar, R; Vine, T; Vollrath, I; Volobuev, I P; Volpi, G; Vázquez, F; Wagner, J; Wagner, P; Wagner, R G; Wagner, R L; Wagner, W; Wallny, R; Wang, S M; Warburton, A; Waschke, S; Waters, D; Wester, W C; Whitehouse, B; Whiteson, D; Wicklund, A B; Wicklund, E; Williams, G; Williams, H H; Wilson, P; Winer, B L; Wittich, P; Wolbers, S; Wolfe, C; Wright, T; Wu, X; Wynne, S M; Würthwein, F; Yagil, A; Yamamoto, K; Yamaoka, J; Yamashita, T; Yang, C; Yang, U K; Yang, Y C; Yao, W M; Yeh, G P; Yoh, J; Yorita, K; Yoshida, T; Yu, G B; Yu, I; Yu, S S; Yun, J C; Zanello, L; Zanetti, A; Zaw, I; Zhang, X; Zhou, J; Zucchelli, S; Österberg, K

    2006-01-01

    Using 355 pb^-1 of data collected by the CDF II detector in \\ppbar collisions at sqrt{s} = 1.96 TeV at the Fermilab Tevatron, we study the fully reconstructed hadronic decays B -> D pi and B -> D pi pi pi. We present the first measurement of the ratio of branching fractions B(Bs -> Ds pi pi pi) / B(Bd -> Dd pi pi pi) = 1.05 pm 0.10 (stat) pm 0.22 (syst). We also update our measurement of B(Bs -> Ds pi) / B(Bd -> Dd pi) to 1.13 pm 0.08 (stat) pm 0.23 (syst) improving the statistical uncertainty by more than a factor of two. We find B(Bs -> Ds pi) = [3.8 pm 0.3 (stat) pm 1.3 (syst)] \\times 10^{-3} and B(Bs -> Ds pi pi pi) = [8.4 pm 0.8 (stat) pm 3.2 (syst)] \\times 10^{-3}.

  9. Measurements of the Branching fractions for $B_{(s)} \\to D_{(s)}\\pi\\pi\\pi$ and $\\Lambda_b^0 \\to \\Lambda_c^+\\pi\\pi\\pi$

    CERN Document Server

    Aaij, R; Adinolfi, M; Adrover, C; Affolder, A; Ajaltouni, Z; Albrecht, J; Alessio, F; Alexander, M; Alkhazov, G; Alvarez Cartelle, P; Alves, A A; Amato, S; Amhis, Y; Anderson, J; Appleby, R B; Aquines Gutierrez, O; Archilli, F; Arrabito, L; Artamonov, A; Artuso, M; Aslanides, E; Auriemma, G; Bachmann, S; Back, J J; Bailey, D S; Balagura, V; Baldini, W; Barlow, R J; Barschel, C; Barsuk, S; Barter, W; Bates, A; Bauer, C; Bauer, Th; Bay, A; Bediaga, I; Belous, K; Belyaev, I; Ben-Haim, E; Benayoun, M; Bencivenni, G; Benson, S; Benton, J; Bernet, R; Bettler, M-O; van Beuzekom, M; Bien, A; Bifani, S; Bizzeti, A; Bjørnstad, P M; Blake, T; Blanc, F; Blanks, C; Blouw, J; Blusk, S; Bobrov, A; Bocci, V; Bondar, A; Bondar, N; Bonivento, W; Borghi, S; Borgia, A; Bowcock, T J V; Bozzi, C; Brambach, T; van den Brand, J; Bressieux, J; Brett, D; Brisbane, S; Britsch, M; Britton, T; Brook, N H; Brown, H; Büchler-Germann, A; Burducea, I; Bursche, A; Buytaert, J; Cadeddu, S; Caicedo Carvajal, J M; Callot, O; Calvi, M; Calvo Gomez, M; Camboni, A; Campana, P; Carbone, A; Carboni, G; Cardinale, R; Cardini, A; Carson, L; Carvalho Akiba, K; Casse, G; Cattaneo, M; Charles, M; Charpentier, Ph; Chiapolini, N; Ciba, K; Cid Vidal, X; Ciezarek, G; Clarke, P E L; Clemencic, M; Cliff, H V; Closier, J; Coca, C; Coco, V; Cogan, J; Collins, P; Constantin, F; Conti, G; Contu, A; Cook, A; Coombes, M; Corti, G; Cowan, G A; Currie, R; D'Almagne, B; D'Ambrosio, C; David, P; De Bonis, I; De Capua, S; De Cian, M; De Lorenzi, F; De Miranda, J M; De Paula, L; De Simone, P; Decamp, D; Deckenhoff, M; Degaudenzi, H; Deissenroth, M; Del Buono, L; Deplano, C; Deschamps, O; Dettori, F; Dickens, J; Dijkstra, H; Diniz Batista, P; Donleavy, S; Dosil Suárez, A; Dossett, D; Dovbnya, A; Dupertuis, F; Dzhelyadin, R; Eames, C; Easo, S; Egede, U; Egorychev, V; Eidelman, S; van Eijk, D; Eisele, F; Eisenhardt, S; Ekelhof, R; Eklund, L; Elsasser, Ch; d'Enterria, D G; Esperante Pereira, D; Estéve, L; Falabella, A; Fanchini, E; Färber, C; Fardell, G; Farinelli, C; Farry, S; Fave, V; Fernandez Albor, V; Ferro-Luzzi, M; Filippov, S; Fitzpatrick, C; Fontana, M; Fontanelli, F; Forty, R; Frank, M; Frei, C; Frosini, M; Furcas, S; Gallas Torreira, A; Galli, D; Gandelman, M; Gandini, P; Gao, Y; Garnier, J-C; Garofoli, J; Garra Tico, J; Garrido, L; Gaspar, C; Gauvin, N; Gersabeck, M; Gershon, T; Ghez, Ph; Gibson, V; Gligorov, V V; Göbel, C; Golubkov, D; Golutvin, A; Gomes, A; Gordon, H; Grabalosa Gándara, M; Graciani Diaz, R; Granado Cardoso, L A; Graugés, E; Graziani, G; Grecu, A; Gregson, S; Gui, B; Gushchin, E; Guz, Yu; Gys, T; Haefeli, G; Haen, C; Haines, S C; Hampson, T; Hansmann-Menzemer, S; Harji, R; Harnew, N; Harrison, J; Harrison, P F; He, J; Heijne, V; Hennessy, K; Henrard, P; Hernando Morata, J A; van Herwijnen, E; Hicks, E; Hofmann, W; Holubyev, K; Hopchev, P; Hulsbergen, W; Hunt, P; Huse, T; Huston, R S; Hutchcroft, D; Hynds, D; Iakovenko, V; Ilten, P; Imong, J; Jacobsson, R; Jaeger, A; Jahjah Hussein, M; Jans, E; Jansen, F; Jaton, P; Jean-Marie, B; Jing, F; John, M; Johnson, D; Jones, C R; Jost, B; Kandybei, S; Karacson, M; Karbach, T M; Keaveney, J; Kerzel, U; Ketel, T; Keune, A; Khanji, B; Kim, Y M; Knecht, M; Koblitz, S; Koppenburg, P; Kozlinskiy, A; Kravchuk, L; Kreplin, K; Kreps, M; Krocker, G; Krokovny, P; Kruse, F; Kruzelecki, K; Kucharczyk, M; Kukulak, S; Kumar, R; Kvaratskheliya, T; La Thi, V N; Lacarrere, D; Lafferty, G; Lai, A; Lambert, D; Lambert, R W; Lanciotti, E; Lanfranchi, G; Langenbruch, C; Latham, T; Le Gac, R; van Leerdam, J; Lees, J-P; Lefévre, R; Leflat, A; Lefrançois, J; Leroy, O; Lesiak, T; Li, L; Li Gioi, L; Lieng, M; Liles, M; Lindner, R; Linn, C; Liu, B; Liu, G; Lopes, J H; Lopez Asamar, E; Lopez-March, N; Luisier, J; Machefert, F; Machikhiliyan, I V; Maciuc, F; Maev, O; Magnin, J; Malde, S; Mamunur, R M D; Manca, G; Mancinelli, G; Mangiafave, N; Marconi, U; Märki, R; Marks, J; Martellotti, G; Martens, A; Martin, L; Martín Sánchez, A; Martinez Santos, D; Massafferri, A; Mathe, Z; Matteuzzi, C; Matveev, M; Maurice, E; Maynard, B; Mazurov, A; McGregor, G; McNulty, R; Mclean, C; Meissner, M; Merk, M; Merkel, J; Messi, R; Miglioranzi, S; Milanes, D A; Minard, M-N; Monteil, S; Moran, D; Morawski, P; Mountain, R; Mous, I; Muheim, F; Müller, K; Muresan, R; Muryn, B; Musy, M; Mylroie-Smith, J; Naik, P; Nakada, T; Nandakumar, R; Nardulli, J; Nasteva, I; Nedos, M; Needham, M; Neufeld, N; Nguyen-Mau, C; Nicol, M; Nies, S; Niess, V; Nikitin, N; Oblakowska-Mucha, A; Obraztsov, V; Oggero, S; Ogilvy, S; Okhrimenko, O; Oldeman, R; Orlandea, M; Otalora Goicochea, J M; Owen, P; Pal, B; Palacios, J; Palutan, M; Panman, J; Papanestis, A; Pappagallo, M; Parkes, C; Parkinson, C J; Passaleva, G; Patel, G D; Patel, M; Paterson, S K; Patrick, G N; Patrignani, C; Pavel-Nicorescu, C; Pazos Alvarez, A; Pellegrino, A; Penso, G; Pepe Altarelli, M; Perazzini, S; Perego, D L; Perez Trigo, E; Pérez-Calero Yzquierdo, A; Perret, P; Perrin-Terrin, M; Pessina, G; Petrella, A; Petrolini, A; Pie Valls, B; Pietrzyk, B; Pilar, T; Pinci, D; Plackett, R; Playfer, S; Plo Casasus, M; Polok, G; Poluektov, A; Polycarpo, E; Popov, D; Popovici, B; Potterat, C; Powell, A; du Pree, T; Prisciandaro, J; Pugatch, V; Puig Navarro, A; Qian, W; Rademacker, J H; Rakotomiaramanana, B; Rangel, M S; Raniuk, I; Raven, G; Redford, S; Reid, M M; dos Reis, A C; Ricciardi, S; Rinnert, K; Roa Romero, D A; Robbe, P; Rodrigues, E; Rodrigues, F; Rodriguez Perez, P; Rogers, G J; Roiser, S; Romanovsky, V; Rouvinet, J; Ruf, T; Ruiz, H; Sabatino, G; Saborido Silva, J J; Sagidova, N; Sail, P; Saitta, B; Salzmann, C; Sannino, M; Santacesaria, R; Santinelli, R; Santovetti, E; Sapunov, M; Sarti, A; Satriano, C; Satta, A; Savrie, M; Savrina, D; Schaack, P; Schiller, M; Schleich, S; Schmelling, M; Schmidt, B; Schneider, O; Schopper, A; Schune, M-H; Schwemmer, R; Sciubba, A; Seco, M; Semennikov, A; Senderowska, K; Sepp, I; Serra, N; Serrano, J; Seyfert, P; Shao, B; Shapkin, M; Shapoval, I; Shatalov, P; Shcheglov, Y; Shears, T; Shekhtman, L; Shevchenko, O; Shevchenko, V; Shires, A; Silva Coutinho, R; Skottowe, H P; Skwarnicki, T; Smith, A C; Smith, N A; Sobczak, K; Soler, F J P; Solomin, A; Soomro, F; Souza De Paula, B; Spaan, B; Sparkes, A; Spradlin, P; Stagni, F; Stahl, S; Steinkamp, O; Stoica, S; Stone, S; Storaci, B; Straticiuc, M; Straumann, U; Styles, N; Subbiah, V K; Swientek, S; Szczekowski, M; Szczypka, P; Szumlak, T; T'Jampens, S; Teodorescu, E; Teubert, F; Thomas, C; Thomas, E; van Tilburg, J; Tisserand, V; Tobin, M; Topp-Joergensen, S; Tran, M T; Tsaregorodtsev, A; Tuning, N; Ukleja, A; Urquijo, P; Uwer, U; Vagnoni, V; Valenti, G; Vazquez Gomez, R; Vazquez Regueiro, P; Vecchi, S; Velthuis, J J; Veltri, M; Vervink, K; Viaud, B; Videau, I; Vilasis-Cardona, X; Visniakov, J; Vollhardt, A; Voong, D; Vorobyev, A; Voss, H; Wacker, K; Wandernoth, S; Wang, J; Ward, D R; Webber, A D; Websdale, D; Whitehead, M; Wiedner, D; Wiggers, L; Wilkinson, G; Williams, M P; Williams, M; Wilson, F F; Wishahi, J; Witek, M; Witzeling, W; Wotton, S A; Wyllie, K; Xie, Y; Xing, F; Yang, Z; Young, R; Yushchenko, O; Zavertyaev, M; Zhang, L; Zhang, W C; Zhang, Y; Zhelezov, A; Zhong, L; Zverev, E; Zvyagin, A

    2011-01-01

    Branching fractions of the decays $H_b\\to H_c\\pi^-\\pi^+\\pi^-$ relative to $H_b\\to H_c\\pi^-$ are presented, where $H_b$ ($H_c$) represents $\\overline{B^0}$ ($D^+$), $B^-$ ($D^0$), $\\overline{B_s^0}$ ($D_s^+$) and $\\Lambda_b^0$ ($\\Lambda_c^+$). The measurements are performed with the LHCb detector using 35~${\\rm pb^{-1}}$ of data collected at $\\sqrt{s}=7$~TeV. The ratios of branching fractions are measured to be \\begin{eqnarray*} {{\\cal{B}}(\\overline{B^0}\\to D^+\\pi^-\\pi^+\\pi^-)\\over{\\cal{B}}(\\overline{B^0}\\to D^+\\pi^-)} = 2.38\\pm0.11\\pm0.21 \

  10. The $2\\pi$ Subsystem in Diffractively Produced $\\pi^-\\pi^+\\pi^-$ at COMPASS

    CERN Document Server

    ,

    2015-01-01

    The COMPASS experiment at CERN has collected a large dataset of $50$ million $\\pi^-\\pi^+\\pi^-$ events produced diffractively from a proton target using a $190\\,\\mathrm{GeV}/c$ pion beam. The partial-wave analysis (PWA) of these high-precision data reveals previously unseen details but is limited in parts by systematic effects. The PWA is based on the isobar model, in which multi-particle decays are described as a chain of subsequent two-body decays. Here, fixed mass distributions for the appearing intermediate resonances, the so-called isobars, are assumed. These shapes, which e.g. may be parametrized by Breit-Wigner amplitudes, represent prior knowledge that has to be put into the analysis model and may therefore introduce a model dependence, thus increasing systematic uncertainties. We present a novel method, which allows to extract isobar amplitudes directly from the data in a more model-independent way. As a first application, diffractively produced $\\pi^-\\pi^+\\pi^-$ events are analyzed. Here, the focus l...

  11. Precision measurement of the ratio BR($K_{S} \\to \\pi^{+}\\pi^{-}e^{+}e^{-}$)/BR($K_{L} \\to \\pi^{+}\\pi^{-}\\pi^{0}_{D}$)

    CERN Document Server

    Batley, J R; Lazzeroni, C; Munday, D J; Patel, M; Slater, M W; Wotton, S A; Arcidiacono, R; Bocquet, G; Ceccucci, A; Cundy, D; Doble, N; Falaleev, V; Gatignon, L; Gonidec, A; Grafström, P; Kubischta, W; Marchetto, F; Mikulec, I; Norton, A; Panzer-Steindel, B; Rubin, P; Wahl, H; Goudzovski, E; Hristov, P; Kekelidze, V; Kozhuharov, V; Litov, L; Madigozhin, D; Molokanova, N; Potrebenikov, Yu.; Stoynev, S; Zinchenko, A; Monnier, E; Swallow, E C; Winston, R; Sacco, R; Walker, A; Baldini, W; Dalpiaz, P; Frabetti, P L; Gianoli, A; Martini, M; Petrucci, F; Scarpa, M; Savrié, M; Bizzeti, A; Calvetti, M; Collazuol, E; Iacopini, E; Lenti, M; Ruggiero, G; Veltri, M; Behler, M; Eppard, K; Eppard, M; Hirstius, A; Kleinknecht, K; Koch, U; Marouelli, P; Masetti, L; Moosbrugger, U; Morales Morales, C; Peters, A; Wanke, R; Winhart, A; Dabrowski, A; Fonseca Martin, T; Szleper, M; Velasco, M; Anzivino, G; Cenci, P; Imbergamo, E; Lamanna, G; Lubrano, P; Michetti, A; Nappi, A; Pepe, M; Petrucci, M C; Piccini, M; Valdata, M; Cerri, C; Costantini, F; Fantechi, R; Fiorini, L; Giudici, S; Mannelli, I; Pierazzini, G; Sozzi, M; Cheshkov, C; Chèze, J B; De Beer, M; Debu, P; Gouge, G; Marel, G; Mazzucato, E; Peyaud, B; Vallage, B; Holder, M; Maier, A; Ziolkowski, M; Biino, C; Cartiglia, N; Clemencic, M; Goy Lopez, S; Menichetti, E; Pastrone, N; Wislicki, W; Dibon, H; Jeitler, M; Markytan, M; Neuhofer, G; Widhalm, L

    2011-01-01

    The $K_{S} \\rightarrow \\pi^{+}\\pi^{-}e^{+}e^{-}$ decay mode was investigated using the data collected in 2002 by the NA48/1 collaboration. With about 23,k $K_{S} \\rightarrow \\pi^{+}\\pi^{-}e^{+}e^{-}$ events and 59,k $K_{L} \\rightarrow \\pi^{+}\\pi^{-}\\pi^{0}_{D}$ normalization decays, the $K_{S} \\rightarrow \\pi^{+}\\pi^{-}e^{+}e^{-}$ branching ratio relative to the $K_{L}\\rightarrow \\pi^{+}\\pi^{-}\\pi^{0}_{D}$ one was determined to be BR($K_{S} \\rightarrow \\pi^{+}\\pi^{-}e^{+}e^{-}$)/BR($K_{L} \\rightarrow \\pi^{+}\\pi^{-}\\pi^{0}_{D}$) = $ (3.28 \\pm 0.06_{stat}\\pm 0.04_{syst})\\times 10^{-2}$. This result was used to set the upper limit $|g_{E1}/g_{BR}| \\lt 3.0$ at $90%$ CL on the presence, in the decay amplitude, of an E1 direct emission ($g_{E1}$) term relative to the dominant inner bremsstrahlung ($g_{BR}$) term. The CP-violating asymmetry ${cal A}_{\\phi}$ in the sin$\\phi$,cos$\\phi$ distribution of $K_{S} \\rightarrow \\pi^{+}\\pi^{-}e^{+}e^{-}$ events, where $\\phi$ is the angle between the $\\pi^{+} \\pi^{-}$ and the $...

  12. Search for hadronic transition $\\chi_{cJ}\\to\\eta_{c}\\pi^{+}\\pi^{-}$ and observation of $\\chi_{cJ}\\to K\\bar{K}\\pi\\pi\\pi$

    CERN Document Server

    Ablikim, M; Ambrose, D J; An, F F; An, Q; An, Z H; Bai, J Z; Ban, Y; Becker, J; Bertani, M; Bian, J M; Boger, E; Bondarenko, O; Boyko, I; Briere, R A; Bytev, V; Cai, X; Cakir, O; Calcaterra, A; Cao, G F; Cetin, S A; Chang, J F; Chelkov, G; Chen, G; Chen, H S; Chen, J C; Chen, M L; Chen, S J; Chen, Y B; Cheng, H P; Chu, Y P; Cronin-Hennessy, D; Dai, H L; Dai, J P; Dedovich, D; Deng, Z Y; Denig, A; Denysenko, I; Destefanis, M; Ding, W M; Ding, Y; Dong, L Y; Dong, M Y; Du, S X; Fang, J; Fang, S S; Fava, L; Feldbauer, F; Feng, C Q; Ferroli, R B; Fu, C D; Fu, J L; Gao, Y; Geng, C; Goetzen, K; Gong, W X; Gradl, W; Greco, M; Gu, M H; Gu, Y T; Guan, Y H; Guo, A Q; Guo, L B; Guo, Y P; Han, Y L; Harris, F A; He, K L; He, M; He, Z Y; Held, T; Heng, Y K; Hou, Z L; Hu, H M; Hu, J F; Hu, T; Huang, G M; Huang, J S; Huang, X T; Huang, Y P; Hussain, T; Ji, C S; Ji, Q; Ji, X B; Ji, X L; Jiang, L L; Jiang, X S; Jiao, J B; Jiao, Z; Jin, D P; Jin, S; Jing, F F; Kalantar-Nayestanaki, N; Kavatsyuk, M; Kuehn, W; Lai, W; Lange, J S; Li, C H; Li, Cheng; Li, Cui; Li, D M; Li, F; Li, G; Li, H B; Li, J C; Li, K; Li, Lei; Li, Q J; Li, S L; Li, W D; Li, W G; Li, X L; Li, X N; Li, X Q; Li, X R; Li, Z B; Liang, H; Liang, Y F; Liang, Y T; Liao, G R; Liao, X T; Liu, B J; Liu, C L; Liu, C X; Liu, C Y; Liu, F H; Liu, Fang; Liu, Feng; Liu, H; Liu, H B; Liu, H H; Liu, H M; Liu, H W; Liu, J P; Liu, K Y; Liu, Kai; Liu, P L; Liu, Q; Liu, S B; Liu, X; Liu, X H; Liu, Y B; Liu, Z A; Liu, Zhiqiang; Liu, Zhiqing; Loehner, H; Lu, G R; Lu, H J; Lu, J G; Lu, Q W; Lu, X R; Lu, Y P; Luo, C L; Luo, M X; Luo, T; Luo, X L; Lv, M; Ma, C L; Ma, F C; Ma, H L; Ma, Q M; Ma, S; Ma, T; Ma, X Y; Ma, Y; Maas, F E; Maggiora, M; Malik, Q A; Mao, Y J; Mao, Z P; Messchendorp, J G; Min, J; Min, T J; Mitchell, R E; Mo, X H; Morales, C Morales; Motzko, C; Muchnoi, N Yu; Muramatsu, H; Nefedov, Y; Nicholson, C; Nikolaev, I B; Ning, Z; Olsen, S L; Ouyang, Q; Pacetti, S; Park, J W; Pelizaeus, M; Peng, H P; Peters, K; Ping, J L; Ping, R G; Poling, R; Prencipe, E; Qi, M; Qian, S; Qiao, C F; Qin, X S; Qin, Y; Qin, Z H; Qiu, J F; Rashid, K H; Rong, G; Ruan, X D; Sarantsev, A; Schaefer, B D; Schulze, J; Shao, M; Shen, C P; Shen, X Y; Sheng, H Y; Shepherd, M R; Song, X Y; Spataro, S; Spruck, B; Sun, D H; Sun, G X; Sun, J F; Sun, S S; Sun, Y J; Sun, Y Z; Sun, Z J; Sun, Z T; Tang, C J; Tang, X; Tapan, I; Thorndike, E H; Toth, D; Ullrich, M; Varner, G S; Wang, B; Wang, B Q; Wang, K; Wang, L L; Wang, L S; Wang, M; Wang, P; Wang, P L; Wang, Q; Wang, Q J; Wang, S G; Wang, X L; Wang, Y D; Wang, Y F; Wang, Y Q; Wang, Z; Wang, Z G; Wang, Z Y; Wei, D H; Weidenkaff, P; Wen, Q G; Wen, S P; Werner, M; Wiedner, U; Wu, L H; Wu, N; Wu, S X; Wu, W; Wu, Z; Xia, L G; Xiao, Z J; Xie, Y G; Xiu, Q L; Xu, G F; Xu, G M; Xu, H; Xu, Q J; Xu, X P; Xu, Z R; Xue, F; Xue, Z; Yan, L; Yan, W B; Yan, Y H; Yang, H X; Yang, Y; Yang, Y X; Ye, H; Ye, M; Ye, M H; Yu, B X; Yu, C X; Yu, J S; Yu, S P; Yuan, C Z; Yuan, Y; Zafar, A A; Zallo, A; Zeng, Y; Zhang, B X; Zhang, B Y; Zhang, C C; Zhang, D H; Zhang, H H; Zhang, H Y; Zhang, J Q; Zhang, J W; Zhang, J Y; Zhang, J Z; Zhang, S H; Zhang, X J; Zhang, X Y; Zhang, Y; Zhang, Y H; Zhang, Y S; Zhang, Z P; Zhang, Z Y; Zhao, G; Zhao, H S; Zhao, J W; Zhao, K X; Zhao, Lei; Zhao, Ling; Zhao, M G; Zhao, Q; Zhao, S J; Zhao, T C; Zhao, X H; Zhao, Y B; Zhao, Z G; Zhemchugov, A; Zheng, B; Zheng, J P; Zheng, Y H; Zhong, B; Zhong, J; Zhou, L; Zhou, X K; Zhou, X R; Zhu, C; Zhu, K; Zhu, K J; Zhu, S H; Zhu, X L; Zhu, X W; Zhu, Y C; Zhu, Y M; Zhu, Y S; Zhu, Z A; Zhuang, J; Zou, B S; Zou, J H

    2012-01-01

    Hadronic transitions of $\\chi_{cJ}\\to \\eta_{c}\\pi^{+}\\pi^{-}$ (J=0, 1, 2) are searched for using a sample of $1.06\\times 10^{8}$ $\\psi(3686)$ events collected with the BESIII detector at the BEPCII storage ring. The $\\etac$ is reconstructed with $K_{S}^{0}K^{+}\\pi^{-}+c.c.$ and $K^{+}K^{-}\\pi^{0}$ final states. No signals are observed in any of the three $\\chi_{cJ}$ states in either $\\etac$ decay mode. At the 90% confidence level, the upper limits are determined to be $\\BR(\\chi_{c0}\\to \\eta_{c}\\pi^{+}\\pi^{-})<0.07%$, $\\BR(\\chi_{c1}\\to \\eta_{c}\\pi^{+}\\pi^{-})<0.32%$, and $\\BR(\\chi_{c2}\\to \\eta_{c}\\pi^{+}\\pi^{-})<0.54%$. The upper limit of $\\BR(\\chi_{c1}\\to \\eta_{c}\\pi^{+}\\pi^{-}$ is lower than the existing theoretical prediction by almost an order of magnitude. The branching fractions of $\\chi_{cJ}\\to K_{S}^{0}K^{+}\\pi^{-}\\pi^{+}\\pi^{-}+c.c.$, $K^{+}K^{-}\\pi^{+}\\pi^{-}\\pi^{0}$, $\\omega K^{+}K^{-}$ and $\\phi\\pi^{+}\\pi^{-}\\pi^{0}$ (J=0, 1, 2) are measured for the first time.

  13. Low-energy pi pi photoproduction off nuclei

    CERN Document Server

    Mühlich, P; Buss, O; Mosel, U

    2004-01-01

    In the present paper we investigate pi0 pi0 and pi(+/-)pi0 photoproduction off complex nuclei at incident beam energies of 400-460 MeV. Simulations of two pion photoproduction on protons and nuclei are performed by means of a semi-classical BUU transport model including a full coupled-channel treatment of the final state interactions. Elastic scattering of the final state pions with the nucleons in the surrounding nuclear medium is found to yield a downward shift of the pi pi invariant mass distribution. We show that the target mass dependence of the pi0 pi0 invariant mass spectrum as measured by the TAPS collaboration can be explained without introducing medium effects beyond absorption and quasi-elastic scattering of the final state particles. On the other hand, we find considerable discrepancies with the data in the pi(+/-)pi0 channel, which are not understood.

  14. Search for direct CP violating charge asymmetries in $K^\\pm\\to\\pi^\\pm\\pi^+\\pi^-$ and $K^\\pm\\to\\pi^\\pm\\pi^0\\pi^0$ decays

    CERN Document Server

    Batley, J Richard; Kalmus, George Ernest; Lazzeroni, C; Munday, D J; Slater, M W; Wotton, S A; Arcidiacono, R; Bocquet, G; Cabibbo, Nicola; Ceccucci, A; Cundy, Donald C; Falaleev, V; Fidecaro, Maria; Gatignon, L; Gonidec, A; Kubischta, Werner; Norton, A; Maier, A; Patel, M; Peters, A; Balev, S; Frabetti, P L; Goudzovski, E; Khristov, P Z; Kekelidze, V D; Kozhuharov, V; Litov, L; Madigozhin, D T; Marinova, E; Molokanova, N A; Polenkevich, I; Potrebenikov, Yu K; Stoynev, S; Zinchenko, A I; Monnier, E; Swallow, E; Winston, R; Rubin, P; Walker, A; Baldini, W; Cotta-Ramusino, A; Dalpiaz, P; Damiani, C; Fiorini, M; Gianoli, A; Martini, M; Petrucci, F; Savrié, M; Scarpa, M; Wahle, H; Bizzeti, A; Calvetti, M; Celeghini, E; Iacopini, E; Lenti, M; Martelli, F; Ruggiero, G; Veltri, M; Behler, M; Eppard, K; Kleinknecht, K; Marouelli, P; Masetti, L; Moosbrugger, U; Morales-Morales, C; Renk, B; Wache, M; Wanke, R; Winhart, A; Coward, D; Dabrowski, A; Fonseca-Martin, T; Shieh, M; Szleper, M; Velasco, M; Wood, M D; Anzivino, Giuseppina; Cenci, P; Imbergamo, E; Nappi, A; Pepé, M; Petrucci, M C; Piccini, M; Raggi, M; Valdata-Nappi, M; Cerri, C; Collazuol, G; Costantini, F; Di Lella, L; Doble, N; Fantechi, R; Fiorini, L; Giudici, S; Lamanna, G; Mannelli, I; Michetti, A; Pierazzini, G M; Sozzi, M; Bloch-Devaux, B; Cheshkov, C; Chèze, J B; De Beer, M; Derré, J; Marel, Gérard; Mazzucato, E; Peyaud, B; Vallage, B; Holder, M; Ziolkowski, M; Bifani, S; Biino, C; Cartiglia, N; Clemencic, M; Goy-Lopez, S; Marchetto, F; Dibon, Heinz; Jeitler, Manfred; Markytan, Manfred; Mikulec, I; Neuhofer, G; Widhalm, L

    2007-01-01

    A measurement of the direct CP violating charge asymmetries of the Dalitz plot linear slopes $A_g=(g^+-g^-)/(g^++g^-)$ in $K^\\pm\\to\\pi^\\pm\\pi^+\\pi^-$ and $K^\\pm\\to\\pi^\\pm\\pi^0\\pi^0$ decays by the NA48/2 experiment at CERN SPS is presented. A new technique of asymmetry measurement involving simultaneous $K^+$ and $K^-$ beams and a large data sample collected allowed a result of an unprecedented precision. The charge asymmetries were measured to be $A^c_g=(-1.5\\pm2.1)\\times10^{-4}$ with $3.11\\times 10^9$ $K^{\\pm}\\to\\pi^\\pm\\pi^+\\pi^-$ decays, and $A^n_g=(1.8\\pm1.8)\\times10^{-4}$ with $9.13\\times 10^7$ $K^{\\pm}\\to\\pi^\\pm\\pi^0\\pi^0$ decays. The precision of the results is limited mainly by the size of the data sample.

  15. Model-independent search for $CP$ violation in $D^{0} \\to K^{-}K^{+}\\pi^{-}\\pi^{+}$ and $D^{0} \\to \\pi^{-}\\pi^{+}\\pi^{+}\\pi^{-}$ decays

    CERN Document Server

    Aaij, R; Adinolfi, M; Adrover, C; Affolder, A; Ajaltouni, Z; Albrecht, J; Alessio, F; Alexander, M; Ali, S; Alkhazov, G; Alvarez Cartelle, P; Alves Jr, A A; Amato, S; Amerio, S; Amhis, Y; Anderlini, L; Anderson, J; Andreassen, R; Andrews, J E; Appleby, R B; Aquines Gutierrez, O; Archilli, F; Artamonov, A; Artuso, M; Aslanides, E; Auriemma, G; Baalouch, M; Bachmann, S; Back, J J; Baesso, C; Balagura, V; Baldini, W; Barlow, R J; Barschel, C; Barsuk, S; Barter, W; Bauer, Th; Bay, A; Beddow, J; Bedeschi, F; Bediaga, I; Belogurov, S; Belous, K; Belyaev, I; Ben-Haim, E; Bencivenni, G; Benson, S; Benton, J; Berezhnoy, A; Bernet, R; Bettler, M -O; van Beuzekom, M; Bien, A; Bifani, S; Bird, T; Bizzeti, A; Bjørnstad, P M; Blake, T; Blanc, F; Blouw, J; Blusk, S; Bocci, V; Bondar, A; Bondar, N; Bonivento, W; Borghi, S; Borgia, A; Bowcock, T J V; Bowen, E; Bozzi, C; Brambach, T; van den Brand, J; Bressieux, J; Brett, D; Britsch, M; Britton, T; Brook, N H; Brown, H; Burducea, I; Bursche, A; Busetto, G; Buytaert, J; Cadeddu, S; Callot, O; Calvi, M; Calvo Gomez, M; Camboni, A; Campana, P; Campora Perez, D; Carbone, A; Carboni, G; Cardinale, R; Cardini, A; Carranza-Mejia, H; Carson, L; Carvalho Akiba, K; Casse, G; Castillo Garcia, L; Cattaneo, M; Cauet, Ch; Cenci, R; Charles, M; Charpentier, Ph; Chen, P; Chiapolini, N; Chrzaszcz, M; Ciba, K; Cid Vidal, X; Ciezarek, G; Clarke, P E L; Clemencic, M; Cliff, H V; Closier, J; Coca, C; Coco, V; Cogan, J; Cogneras, E; Collins, P; Comerma-Montells, A; Contu, A; Cook, A; Coombes, M; Coquereau, S; Corti, G; Couturier, B; Cowan, G A; Cowie, E; Craik, D C; Cunliffe, S; Currie, R; D'Ambrosio, C; David, P; David, P N Y; Davis, A; De Bonis, I; De Bruyn, K; De Capua, S; De Cian, M; De Miranda, J M; De Paula, L; De Silva, W; De Simone, P; Decamp, D; Deckenhoff, M; Del Buono, L; Déléage, N; Derkach, D; Deschamps, O; Dettori, F; Di Canto, A; Dijkstra, H; Dogaru, M; Donleavy, S; Dordei, F; Dosil Suárez, A; Dossett, D; Dovbnya, A; Dupertuis, F; Durante, P; Dzhelyadin, R; Dziurda, A; Dzyuba, A; Easo, S; Egede, U; Egorychev, V; Eidelman, S; van Eijk, D; Eisenhardt, S; Eitschberger, U; Ekelhof, R; Eklund, L; El Rifai, I; Elsasser, Ch; Falabella, A; Färber, C; Fardell, G; Farinelli, C; Farry, S; Ferguson, D; Fernandez Albor, V; Ferreira Rodrigues, F; Ferro-Luzzi, M; Filippov, S; Fiore, M; Fitzpatrick, C; Fontana, M; Fontanelli, F; Forty, R; Francisco, O; Frank, M; Frei, C; Frosini, M; Furcas, S; Furfaro, E; Gallas Torreira, A; Galli, D; Gandelman, M; Gandini, P; Gao, Y; Garofoli, J; Garosi, P; Garra Tico, J; Garrido, L; Gaspar, C; Gauld, R; Gersabeck, E; Gersabeck, M; Gershon, T; Ghez, Ph; Gibson, V; Giubega, L; Gligorov, V V; Göbel, C; Golubkov, D; Golutvin, A; Gomes, A; Gorbounov, P; Gordon, H; Gotti, C; Grabalosa Gándara, M; Graciani Diaz, R; Granado Cardoso, L A; Graugés, E; Graziani, G; Grecu, A; Greening, E; Gregson, S; Griffith, P; Grünberg, O; Gui, B; Gushchin, E; Guz, Yu; Gys, T; Hadjivasiliou, C; Haefeli, G; Haen, C; Haines, S C; Hall, S; Hamilton, B; Hampson, T; Hansmann-Menzemer, S; Harnew, N; Harnew, S T; Harrison, J; Hartmann, T; He, J; Head, T; Heijne, V; Hennessy, K; Henrard, P; Hernando Morata, J A; van Herwijnen, E; Hess, M; Hicheur, A; Hicks, E; Hill, D; Hoballah, M; Hombach, C; Hopchev, P; Hulsbergen, W; Hunt, P; Huse, T; Hussain, N; Hutchcroft, D; Hynds, D; Iakovenko, V; Idzik, M; Ilten, P; Jacobsson, R; Jaeger, A; Jans, E; Jaton, P; Jawahery, A; Jing, F; John, M; Johnson, D; Jones, C R; Joram, C; Jost, B; Kaballo, M; Kandybei, S; Kanso, W; Karacson, M; Karbach, T M; Kenyon, I R; Ketel, T; Keune, A; Khanji, B; Kochebina, O; Komarov, I; Koopman, R F; Koppenburg, P; Korolev, M; Kozlinskiy, A; Kravchuk, L; Kreplin, K; Kreps, M; Krocker, G; Krokovny, P; Kruse, F; Kucharczyk, M; Kudryavtsev, V; Kurek, K; Kvaratskheliya, T; La Thi, V N; Lacarrere, D; Lafferty, G; Lai, A; Lambert, D; Lambert, R W; Lanciotti, E; Lanfranchi, G; Langenbruch, C; Latham, T; Lazzeroni, C; Le Gac, R; van Leerdam, J; Lees, J -P; Lefèvre, R; Leflat, A; Lefrançois, J; Leo, S; Leroy, O; Lesiak, T; Leverington, B; Li, Y; Li Gioi, L; Liles, M; Lindner, R; Linn, C; Liu, B; Liu, G; Lohn, S; Longstaff, I; Lopes, J H; Lopez-March, N; Lu, H; Lucchesi, D; Luisier, J; Luo, H; Machefert, F; Machikhiliyan, I V; Maciuc, F; Maev, O; Malde, S; Manca, G; Mancinelli, G; Maratas, J; Marconi, U; Marino, P; Märki, R; Marks, J; Martellotti, G; Martens, A; Martín Sánchez, A; Martinelli, M; Martinez Santos, D; Martins Tostes, D; Martynov, A; Massafferri, A; Matev, R; Mathe, Z; Matteuzzi, C; Maurice, E; Mazurov, A; McCarthy, J; McNab, A; McNulty, R; McSkelly, B; Meadows, B; Meier, F; Meissner, M; Merk, M; Milanes, D A; Minard, M -N; Molina Rodriguez, J; Monteil, S; Moran, D; Morawski, P; Mordà, A; Morello, M J; Mountain, R; Mous, I; Muheim, F; Müller, K; Muresan, R; Muryn, B; Muster, B; Naik, P; Nakada, T; Nandakumar, R; Nasteva, I; Needham, M; Neubert, S; Neufeld, N; Nguyen, A D; Nguyen, T D; Nguyen-Mau, C; Nicol, M; Niess, V; Niet, R; Nikitin, N; Nikodem, T; Nomerotski, A; Novoselov, A; Oblakowska-Mucha, A; Obraztsov, V; Oggero, S; Ogilvy, S; Okhrimenko, O; Oldeman, R; Orlandea, M; Otalora Goicochea, J M; Owen, P; Oyanguren, A; Pal, B K; Palano, A; Palczewski, T; Palutan, M; Panman, J; Papanestis, A; Pappagallo, M; Parkes, C; Parkinson, C J; Passaleva, G; Patel, G D; Patel, M; Patrick, G N; Patrignani, C; Pavel-Nicorescu, C; Pazos Alvarez, A; Pellegrino, A; Penso, G; Pepe Altarelli, M; Perazzini, S; Perez Trigo, E; Pérez-Calero Yzquierdo, A; Perret, P; Perrin-Terrin, M; Pescatore, L; Pesen, E; Petridis, K; Petrolini, A; Phan, A; Picatoste Olloqui, E; Pietrzyk, B; Pilař, T; Pinci, D; Playfer, S; Plo Casasus, M; Polci, F; Polok, G; Poluektov, A; Polycarpo, E; Popov, A; Popov, D; Popovici, B; Potterat, C; Powell, A; Prisciandaro, J; Pritchard, A; Prouve, C; Pugatch, V; Puig Navarro, A; Punzi, G; Qian, W; Rademacker, J H; Rakotomiaramanana, B; Rangel, M S; Raniuk, I; Rauschmayr, N; Raven, G; Redford, S; Reid, M M; dos Reis, A C; Ricciardi, S; Richards, A; Rinnert, K; Rives Molina, V; Roa Romero, D A; Robbe, P; Roberts, D A; Rodrigues, E; Rodriguez Perez, P; Roiser, S; Romanovsky, V; Romero Vidal, A; Rouvinet, J; Ruf, T; Ruffini, F; Ruiz, H; Ruiz Valls, P; Sabatino, G; Saborido Silva, J J; Sagidova, N; Sail, P; Saitta, B; Salustino Guimaraes, V; Sanmartin Sedes, B; Sannino, M; Santacesaria, R; Santamarina Rios, C; Santovetti, E; Sapunov, M; Sarti, A; Satriano, C; Satta, A; Savrie, M; Savrina, D; Schaack, P; Schiller, M; Schindler, H; Schlupp, M; Schmelling, M; Schmidt, B; Schneider, O; Schopper, A; Schune, M -H; Schwemmer, R; Sciascia, B; Sciubba, A; Seco, M; Semennikov, A; Senderowska, K; Sepp, I; Serra, N; Serrano, J; Seyfert, P; Shapkin, M; Shapoval, I; Shatalov, P; Shcheglov, Y; Shears, T; Shekhtman, L; Shevchenko, O; Shevchenko, V; Shires, A; Silva Coutinho, R; Sirendi, M; Skidmore, N; Skwarnicki, T; Smith, N A; Smith, E; Smith, J; Smith, M; Sokoloff, M D; Soler, F J P; Soomro, F; Souza, D; Souza De Paula, B; Spaan, B; Sparkes, A; Spradlin, P; Stagni, F; Stahl, S; Steinkamp, O; Stevenson, S; Stoica, S; Stone, S; Storaci, B; Straticiuc, M; Straumann, U; Subbiah, V K; Sun, L; Swientek, S; Syropoulos, V; Szczekowski, M; Szczypka, P; Szumlak, T; T'Jampens, S; Teklishyn, M; Teodorescu, E; Teubert, F; Thomas, C; Thomas, E; van Tilburg, J; Tisserand, V; Tobin, M; Tolk, S; Tonelli, D; Topp-Joergensen, S; Torr, N; Tournefier, E; Tourneur, S; Tran, M T; Tresch, M; Tsaregorodtsev, A; Tsopelas, P; Tuning, N; Ubeda Garcia, M; Ukleja, A; Urner, D; Ustyuzhanin, A; Uwer, U; Vagnoni, V; Valenti, G; Vallier, A; Van Dijk, M; Vazquez Gomez, R; Vazquez Regueiro, P; Vázquez Sierra, C; Vecchi, S; Velthuis, J J; Veltri, M; Veneziano, G; Vesterinen, M; Viaud, B; Vieira, D; Vilasis-Cardona, X; Vollhardt, A; Volyanskyy, D; Voong, D; Vorobyev, A; Vorobyev, V; Voß, C; Voss, H; Waldi, R; Wallace, C; Wallace, R; Wandernoth, S; Wang, J; Ward, D R; Watson, N K; Webber, A D; Websdale, D; Whitehead, M; Wicht, J; Wiechczynski, J; Wiedner, D; Wiggers, L; Wilkinson, G; Williams, M P; Williams, M; Wilson, F F; Wimberley, J; Wishahi, J; Wislicki, W; Witek, M; Wotton, S A; Wright, S; Wu, S; Wyllie, K; Xie, Y; Xing, Z; Yang, Z; Young, R; Yuan, X; Yushchenko, O; Zangoli, M; Zavertyaev, M; Zhang, F; Zhang, L; Zhang, W C; Zhang, Y; Zhelezov, A; Zhokhov, A; Zhong, L; Zvyagin, A

    2013-01-01

    A search for $CP$ violation in the phase-space structures of $D^{0}$ and $\\bar{D^{0}}$ decays to the final states $K^{-}K^{+}\\pi^{-}\\pi^{+}$ and $\\pi^{-}\\pi^{+}\\pi^{+}\\pi^{-}$ is presented. The search is carried out with a data set corresponding to an integrated luminosity of 1.0 fb$^{−1}$ collected in 2011 by the LHCb experiment in $pp$ collisions at a centre-of-mass energy of 7 TeV. For the $K^{-}K^{+}\\pi^{-}\\pi^{+}$ final state, the four-body phase space is divided into 32 bins, each bin with approximately 1800 decays. The $p$-value under the hypothesis of no $CP$ violation is 9.1 %, and in no bin is a $CP$ asymmetry greater than 6.5 % observed. The phase space of the $\\pi^{-}\\pi^{+}\\pi^{+}\\pi^{-}$ final state is partitioned into 128 bins, each bin with approximately 2500 decays. The p-value under the hypothesis of no $CP$ violation is 41 %, and in no bin is a $CP$ asymmetry greater than 5.5 % observed. All results are consistent with the hypothesis of no $CP$ violation at the current sensitivity.

  16. Measurement of CP Asymmetries and Branching Fractions in B0 -> pi+ pi-, B0 -> K+ pi-, B0 -> pi0 pi0, B0 -> K0 pi0 and Isospin Analysis of B -> pi pi Decays

    Energy Technology Data Exchange (ETDEWEB)

    Aubert, Bernard; Bona, M.; Karyotakis, Y.; Lees, J.P.; Poireau, V.; Prencipe, E.; Prudent, X.; Tisserand, V.; /Annecy, LAPP; Garra Tico, J.; Grauges, E.; /Barcelona U., ECM; Lopez, L.; Palano, Antimo; Pappagallo, M.; /Bari U. /INFN, Bari; Eigen, G.; Stugu, Bjarne; Sun, L.; /Bergen U.; Abrams, G.S.; Battaglia, M.; Brown, D.N.; Cahn, Robert N.; Jacobsen, R.G.; /LBL, Berkeley /Birmingham U. /Ruhr U., Bochum /Bristol U. /British Columbia U. /Brunel U. /Novosibirsk, IYF /UC, Irvine /UCLA /UC, Riverside /UC, San Diego /UC, Santa Barbara /UC, Santa Cruz /Caltech /Cincinnati U. /Colorado U. /Colorado State U. /Dortmund U. /Dresden, Tech. U. /Ecole Polytechnique /Edinburgh U. /Ferrara U. /INFN, Ferrara /Frascati /Genoa U. /INFN, Genoa /Harvard U. /Heidelberg U. /Humboldt U., Berlin /Imperial Coll., London /Iowa U. /Iowa State U. /Johns Hopkins U. /Orsay, LAL /LLNL, Livermore /Liverpool U. /Queen Mary, U. of London /Royal Holloway, U. of London /Louisville U. /Mainz U., Inst. Kernphys. /Manchester U. /Maryland U. /Massachusetts U., Amherst /MIT /McGill U. /Consorzio Milano Ricerche /INFN, Milan /Mississippi U. /Montreal U. /Mt. Holyoke Coll. /Napoli Seconda U. /INFN, Naples /NIKHEF, Amsterdam /Notre Dame U. /Ohio State U. /Oregon U. /Padua U. /INFN, Padua /Paris U., VI-VII /Pennsylvania U. /Perugia U. /INFN, Perugia /INFN, Pisa /Princeton U. /Banca di Roma /Frascati /Rostock U. /Rutherford /DAPNIA, Saclay /South Carolina U. /SLAC /Stanford U., Phys. Dept. /SUNY, Albany /Tennessee U. /Texas U. /Texas U., Dallas /Turin U. /INFN, Turin /Trieste U. /INFN, Trieste /Valencia U., IFIC /Victoria U. /Warwick U. /Wisconsin U., Madison

    2008-08-01

    The authors present preliminary results of improved measurements of the CP-violating asymmetries and branching fractions in the decays B{sup 0} {yields} {pi}{sup +}{pi}{sup -}, B{sup 0} {yields} K{sup +}{pi}{sup -}, B{sup 0} {yields} {pi}{sup 0}{pi}{sup 0}, and B{sup 0} {yields} K{sup 0}{pi}{sup 0}. This update includes all data taken at the {Upsilon}(4S) resonance by the BABAR experiment at the asymmetric PEP-II B-meson factory at SLAC, corresponding to 467 {+-} 5 million B{bar B} pairs. They find S{sub {pi}{pi}} = -0.68 {+-} 0.10 {+-} 0.03, C{sub {pi}{pi}} = -0.25 {+-} 0.08 {+-} 0.02, {Alpha}{sub K{sub {pi}}} = -0.107 {+-} 0.016{sub -0.004},{sup +0.006}, C{sub {pi}{sup 0}{pi}{sup 0}} = -0.43 {+-} 0.26 {+-} 0.05, {Beta}(B{sup 0} {yields} {pi}{sup 0}{pi}{sup 0}) = (1.83 {+-} 0.21 {+-} 0.13) x 10{sup -6}, {Beta}(B{sup 0} {yields} K{sup 0}{pi}{sup 0}) = (10.1 {+-} 0.6 {+-} 0.4) x 10{sup -6}, where the first error is statistical and the second is systematic. They observe CP violation with a significance of 6.7{sigma} in B{sup 0} {yields} {pi}{sup -} and 6.1{sigma} in B{sup 0} {yields} K{sup +}{pi}{sup -}. Constraints on the Unitarity Triangle angle {alpha} are determined from the isospin relation between all B {yields} {pi}{pi} rates and asymmetries.

  17. Precise Branching Ratio Measurements of the Decays D0-->pi- pi+ pi0 and D0-->K- K+ pi0

    CERN Document Server

    Aubert, B; Bóna, M; Boutigny, D; Couderc, F; Karyotakis, Yu; Lees, J P; Poireau, V; Tisserand, V; Zghiche, A; Graugès-Pous, E; Palano, A; Chen, J C; Qi, N D; Rong, G; Wang, P; Zhu, Y S; Eigen, G; Ofte, I; Stugu, B; Abrams, G S; Battaglia, M; Brown, D N; Button-Shafer, J; Cahn, R N; Charles, E; Gill, M S; Groysman, Y; Jacobsen, R G; Kadyk, J A; Kerth, L T; Kolomensky, Yu G; Kukartsev, G; Lynch, G; Mir, L M; Orimoto, T J; Pripstein, M; Roe, N A; Ronan, M T; Wenzel, W A; Del Amo-Sánchez, P; Barrett, M; Ford, K E; Harrison, T J; Hart, A J; Hawkes, C M; Morgan, S E; Watson, A T; Held, T; Koch, H; Lewandowski, B; Pelizaeus, M; Peters, K; Schröder, T; Steinke, M; Boyd, J T; Burke, J P; Cottingham, W N; Walker, D; Çuhadar-Dönszelmann, T; Fulsom, B G; Hearty, C; Knecht, N S; Mattison, T S; McKenna, J A; Khan, A; Kyberd, P; Saleem, M; Sherwood, D J; Teodorescu, L; Blinov, V E; Bukin, A D; Druzhinin, V P; Golubev, V B; Onuchin, A P; Serednyakov, S I; Skovpen, Yu I; Solodov, E P; Todyshev, K Yu; Best, D S; Bondioli, M; Bruinsma, M; Chao, M; Curry, S; Eschrich, I; Kirkby, D; Lankford, A J; Lund, P; Mandelkern, M A; Mommsen, R K; Röthel, W; Stoker, D P; Abachi, S; Buchanan, C; Foulkes, S D; Gary, J W; Long, O; Shen, B C; Wang, K; Zhang, L; Hadavand, H K; Hill, E J; Paar, H P; Rahatlou, S; Sharma, V; Berryhill, J W; Campagnari, C; Cunha, A; Dahmes, B; Hong, T M; Kovalskyi, D; Richman, J D; Beck, T W; Eisner, A M; Flacco, C J; Heusch, C A; Kroseberg, J; Lockman, W S; Nesom, G; Schalk, T; Schumm, B A; Seiden, A; Spradlin, P; Williams, D C; Wilson, M G; Albert, J; Chen, E; Dvoretskii, A; Fang, F; Hitlin, D G; Narsky, I; Piatenko, T; Porter, F C; Ryd, A; Samuel, A; Mancinelli, G; Meadows, B T; Mishra, K; Sokoloff, M D; Blanc, F; Bloom, P C; Chen, S; Ford, W T; Hirschauer, J F; Kreisel, A; Nagel, M; Nauenberg, U; Olivas, A; Ruddick, W O; Smith, J G; Ulmer, K A; Wagner, S R; Zhang, J; Chen, A; Eckhart, E A; Soffer, A; Toki, W H; Wilson, R J; Winklmeier, F; Zeng, Q; Altenburg, D D; Feltresi, E; Hauke, A; Jasper, H; Petzold, A; Spaan, B; Brandt, T; Klose, V; Lacker, H M; Mader, W F; Nogowski, R; Schubert, J; Schubert, K R; Schwierz, R; Sundermann, J E; Volk, A; Bernard, D; Bonneaud, G R; Grenier, P; Latour, E; Thiebaux, C; Verderi, M; Clark, P J; Gradl, W; Muheim, F; Playfer, S; Robertson, A I; Xie, Y; Andreotti, M; Bettoni, D; Bozzi, C; Calabrese, R; Cibinetto, G; Luppi, E; Negrini, M; Petrella, A; Piemontese, L; Prencipe, E; Anulli, F; Baldini-Ferroli, R; Calcaterra, A; De Sangro, R; Finocchiaro, G; Pacetti, S; Patteri, P; Peruzzi, I M; Piccolo, M; Rama, M; Zallo, A; Buzzo, A; Capra, R; Contri, R; Lo Vetere, M; Macri, M M; Monge, M R; Passaggio, S; Patrignani, C; Robutti, E; Santroni, A; Tosi, S; Brandenburg, G; Chaisanguanthum, K S; Morii, M; Wu, J; Dubitzky, R S; Marks, J; Schenk, S; Uwer, U; Bard, D J; Bhimji, W; Bowerman, D A; Dauncey, P D; Egede, U; Flack, R L; Nash, J A; Nikolich, M B; Panduro-Vazquez, W; Behera, P K; Chai, X; Charles, M J; Mallik, U; Meyer, N T; Ziegler, V; Cochran, J; Crawley, H B; Dong, L; Eyges, V; Meyer, W T; Prell, S; Rosenberg, E I; Rubin, A E; Gritsan, A V; Denig, A G; Fritsch, M; Schott, G; Arnaud, N; Davier, M; Grosdidier, G; Höcker, A; Le Diberder, F R; Lepeltier, V; Lutz, A M; Oyanguren, A; Pruvot, S; Rodier, S; Roudeau, P; Schune, M H; Stocchi, A; Wang, W F; Wormser, G; Cheng, C H; Lange, D J; Wright, D M; Chavez, C A; Forster, I J; Fry, J R; Gabathuler, E; Gamet, R; George, K A; Hutchcroft, D E; Payne, D J; Schofield, K C; Touramanis, C; Bevan, A J; Di Lodovico, F; Menges, W; Sacco, R; Cowan, G; Flächer, H U; Hopkins, D A; Jackson, P S; McMahon, T R; Ricciardi, S; Salvatore, F; Wren, A C; Davis, C L; Allison, J; Barlow, N R; Barlow, R J; Chia, Y M; Edgar, C L; Lafferty, G D; Naisbit, M T; Williams, J C; Yi, J I; Chen, C; Hulsbergen, W D; Jawahery, A; Lae, C K; Roberts, D A; Simi, G; Blaylock, G; Dallapiccola, C; Hertzbach, S S; Li, X; Moore, T B; Saremi, S; Stängle, H; Cowan, R; Sciolla, G; Sekula, S J; Spitznagel, M; Taylor, F; Yamamoto, R K; Kim, H; Mclachlin, S E; Patel, P M; Robertson, S H; Lazzaro, A; Lombardo, V; Palombo, F; Bauer, J M; Cremaldi, L; Eschenburg, V; Godang, R; Kroeger, R; Sanders, D A; Summers, D J; Zhao, H W; Brunet, S; Côté, D; Simard, M; Taras, P; Viaud, F B; Nicholson, H; Cavallo, N; De Nardo, Gallieno; Fabozzi, F; Gatto, C; Lista, L; Monorchio, D; Paolucci, P; Piccolo, D; Sciacca, C; Baak, M; Raven, G; Snoek, H L; Jessop, C P; LoSecco, J M; Allmendinger, T; Benelli, G; Gan, K K; Honscheid, K; Hufnagel, D; Jackson, P D; Kagan, H; Kass, R; Rahimi, A M; Ter-Antonian, R; Wong, Q K; Blount, N L; Brau, J E; Frey, R; Igonkina, O; Lu, M; Rahmat, R; Sinev, N B; Strom, D; Strube, J; Torrence, E; Gaz, A; Margoni, M; Morandin, M; Pompili, A; Posocco, M; Rotondo, M; Simonetto, F; Stroili, R; Voci, C; Benayoun, M; Chauveau, J; Briand, H; David, P; Del Buono, L; La Vaissière, C de; Hamon, O; Hartfiel, B L; John, M J J; Leruste, P; Malcles, J; Ocariz, J; Roos, L; Therin, G; Gladney, L; Panetta, J; Biasini, M; Covarelli, R; Angelini, C; Batignani, G; Bettarini, S; Bucci, F; Calderini, G; Carpinelli, M; Cenci, R; Forti, F; Giorgi, M A; Lusiani, A; Marchiori, G; Mazur, M A; Morganti, M; Neri, N; Paoloni, E; Rizzo, G; Walsh, J J; Haire, M; Judd, D; Wagoner, D E; Biesiada, J; Danielson, N; Elmer, P; Lau, Y P; Lü, C; Olsen, J; Smith, A J S; Telnov, A V; Bellini, F; Cavoto, G; D'Orazio, A; Del Re, D; Di Marco, E; Faccini, R; Ferrarotto, F; Ferroni, F; Gaspero, M; Li Gioi, L; Mazzoni, M A; Morganti, S; Piredda, G; Polci, F; Safai-Tehrani, F; Voena, C; Ebert, M; Schröder, H; Waldi, R; Adye, T; De, N; Groot; Franek, B; Olaiya, E O; Wilson, F F; Aleksan, R; Emery, S; Gaidot, A; Ganzhur, S F; Hamel de Monchenault, G; Kozanecki, Witold; Legendre, M; Vasseur, G; Yéche, C; Zito, M; Chen, X R; Liu, H; Park, W; Purohit, M V; Wilson, J R; Allen, M T; Aston, D; Bartoldus, R; Bechtle, P; Berger, N; Claus, R; Coleman, J P; Convery, M R; Cristinziani, M; Dingfelder, J C; Dorfan, J; Dubois-Felsmann, G P; Dujmic, D; Dunwoodie, W M; Field, R C; Glanzman, T; Gowdy, S J; Graham, M T; Halyo, V; Hast, C; Hrynóva, T; Innes, W R; Kelsey, M H; Kim, P; Leith, D W G S; Li, S; Luitz, S; Lüth, V; Lynch, H L; MacFarlane, D B; Marsiske, H; Messner, R; Müller, D R; O'Grady, C P; Ozcan, V E; Perazzo, A; Perl, M; Pulliam, T; Ratcliff, B N; Roodman, A; Salnikov, A A; Schindler, R H; Schwiening, J; Snyder, A; Stelzer, J; Su, D; Sullivan, M K; Suzuki, K; Swain, S K; Thompson, J M; Vavra, J; Van Bakel, N; Weaver, M; Weinstein, A J R; Wisniewski, W J; Wittgen, M; Wright, D H; Yarritu, A K; Yi, K; Young, C C; Burchat, P R; Edwards, A J; Majewski, S A; Petersen, B A; Roat, C; Wilden, L; Ahmed, S; Alam, M S; Bula, R; Ernst, J A; Jain, V; Pan, B; Saeed, M A; Wappler, F R; Zain, S B; Bugg, W; Krishnamurthy, M; Spanier, S M; Eckmann, R; Ritchie, J L; Satpathy, A; Schilling, C J; Schwitters, R F; Izen, J M; Lou, X C; Ye, S; Bianchi, F; Gallo, F; Gamba, D; Bomben, M; Bosisio, L; Cartaro, C; Cossutti, F; Della Ricca, G; Dittongo, S; Lanceri, L; Vitale, L; Azzolini, V; Martínez-Vidal, F; Banerjee, Sw; Bhuyan, B; Brown, C M; Fortin, D; Hamano, K; Kowalewski, R V; Nugent, I M; Roney, J M; Sobie, R J; Back, J J; Harrison, P F; Latham, T E; Mohanty, G B; Pappagallo, M; Band, H R; Chen, X; Cheng, B; Dasu, S; Datta, M; Flood, K T; Hollar, J J; Kutter, P E; Mellado, B; Mihályi, A; Pan, Y; Pierini, M; Prepost, R; Wu, S L; Yu, Z; Neal, H

    2006-01-01

    Using 232 fb-1 of e+e- collision data recorded by the BaBar experiment, we measure the ratios of three-body Cabibbo-suppressed decay rates of the D^0 meson relative to that of the Cabibbo-favored decay: B(D0 --> pi- pi+ pi0)/ B(D0 --> K- pi+ pi0) = (10.59 +/- 0.06 +/- 0.13).10^{-2} and B(D0 --> K- K+ pi0)/ B(D0 --> K- pi+ pi0) = (2.37 +/- 0.03 +/- 0.04). 10^{-2}, where the errors are statistical and systematic respectively. The precisions of these measurements are significantly better than those of the current world average values.We note that the second result differs significantly from the current world average value. Using the PDG-2006 value for D0 --> K- pi+ pi0 branching fraction, we obtain, B(D0 --> pi- pi+ pi0) = (1.493 +/- 0.008 +/- 0.018 +/- 0.053). 10^{-2}, B(D0 --> K- K+ pi0) = (0.334 +/- 0.004 +/- 0.006 +/- 0.012). 10^{-2}, where the errors are statistical, systematic, and due to the uncertainty of B(D0 --> K- pi+ pi0). The average squared matrix elements for both of the singly Cabibbo-suppressed ...

  18. Raspberry Pi hardware projects 1

    CERN Document Server

    Robinson, Andrew

    2013-01-01

    Learn how to take full advantage of all of Raspberry Pi's amazing features and functions-and have a blast doing it! Congratulations on becoming a proud owner of a Raspberry Pi, the credit-card-sized computer! If you're ready to dive in and start finding out what this amazing little gizmo is really capable of, this ebook is for you. Taken from the forthcoming Raspberry Pi Projects, Raspberry Pi Hardware Projects 1 contains three cool hardware projects that let you have fun with the Raspberry Pi while developing your Raspberry Pi skills. The authors - PiFace inventor, Andrew Robinson and Rasp

  19. Pi a source book

    CERN Document Server

    Berggren, Lennart; Borwein, Peter

    2004-01-01

    This book documents the history of pi from the dawn of mathematical time to the present. One of the beauties of the literature on pi is that it allows for the inclusion of very modern, yet accessible, mathematics. The articles on pi collected herein include selections from the mathematical and computational literature over four millennia, a variety of historical studies on the cultural significance of the number, and an assortment of anecdotal, fanciful, and simply amusing pieces. For this new edition, the authors have updated the original material while adding new material of historical and cultural interest. There is a substantial exposition of the recent history of the computation of digits of pi, a discussion of the normality of the distribution of the digits, new translations of works by Viete and Huygen, as well as Kaplansky's never-before-published "Song of Pi." From the reviews of earlier editions: "Few mathematics books serve a wider potential readership than does a source book and this particular on...

  20. Measurement of CP violation parameters with a Dalitz plot analysis of B{+/-}-->D{pi{+}pi{-}pi{0}}K{+/-}.

    Science.gov (United States)

    Aubert, B; Bona, M; Boutigny, D; Karyotakis, Y; Lees, J P; Poireau, V; Prudent, X; Tisserand, V; Zghiche, A; Grauges, E; Lopez, L; Palano, A; Chen, J C; Qi, N D; Rong, G; Wang, P; Zhu, Y S; Eigen, G; Ofte, I; Stugu, B; Abrams, G S; Battaglia, M; Brown, D N; Button-Shafer, J; Cahn, R N; Groysman, Y; Jacobsen, R G; Kadyk, J A; Kerth, L T; Kolomensky, Yu G; Kukartsev, G; Pegna, D Lopes; Lynch, G; Mir, L M; Orimoto, T J; Pripstein, M; Roe, N A; Ronan, M T; Tackmann, K; Wenzel, W A; Del Amo Sanchez, P; Barrett, M; Harrison, T J; Hart, A J; Hawkes, C M; Watson, A T; Held, T; Koch, H; Lewandowski, B; Pelizaeus, M; Schroeder, T; Steinke, M; Boyd, J T; Burke, J P; Cottingham, W N; Walker, D; Asgeirsson, D J; Cuhadar-Donszelmann, T; Fulsom, B G; Hearty, C; Knecht, N S; Mattison, T S; McKenna, J A; Khan, A; Kyberd, P; Saleem, M; Sherwood, D J; Teodorescu, L; Blinov, V E; Bukin, A D; Druzhinin, V P; Golubev, V B; Onuchin, A P; Serednyakov, S I; Skovpen, Yu I; Solodov, E P; Todyshev, K Yu; Bondioli, M; Bruinsma, M; Chao, M; Curry, S; Eschrich, I; Kirkby, D; Lankford, A J; Lund, P; Mandelkern, M; Martin, E C; Stoker, D P; Abachi, S; Buchanan, C; Foulkes, S D; Gary, J W; Liu, F; Long, O; Shen, B C; Zhang, L; Hill, E J; Paar, H P; Rahatlou, S; Sharma, V; Berryhill, J W; Campagnari, C; Cunha, A; Dahmes, B; Hong, T M; Kovalskyi, D; Richman, J D; Beck, T W; Eisner, A M; Flacco, C J; Heusch, C A; Kroseberg, J; Lockman, W S; Schalk, T; Schumm, B A; Seiden, A; Williams, D C; Wilson, M G; Winstrom, L O; Chen, E; Cheng, C H; Dvoretskii, A; Fang, F; Hitlin, D G; Narsky, I; Piatenko, T; Porter, F C; Mancinelli, G; Meadows, B T; Mishra, K; Sokoloff, M D; Blanc, F; Bloom, P C; Chen, S; Ford, W T; Hirschauer, J F; Kreisel, A; Nagel, M; Nauenberg, U; Olivas, A; Smith, J G; Ulmer, K A; Wagner, S R; Zhang, J; Chen, A; Eckhart, E A; Soffer, A; Toki, W H; Wilson, R J; Winklmeier, F; Zeng, Q; Altenburg, D D; Feltresi, E; Hauke, A; Jasper, H; Merkel, J; Petzold, A; Spaan, B; Wacker, K; Brandt, T; Klose, V; Lacker, H M; Mader, W F; Nogowski, R; Schubert, J; Schubert, K R; Schwierz, R; Sundermann, J E; Volk, A; Bernard, D; Bonneaud, G R; Latour, E; Thiebaux, Ch; Verderi, M; Clark, P J; Gradl, W; Muheim, F; Playfer, S; Robertson, A I; Xie, Y; Andreotti, M; Bettoni, D; Bozzi, C; Calabrese, R; Cibinetto, G; Luppi, E; Negrini, M; Petrella, A; Piemontese, L; Prencipe, E; Anulli, F; Baldini-Ferroli, R; Calcaterra, A; de Sangro, R; Finocchiaro, G; Pacetti, S; Patteri, P; Peruzzi, I M; Piccolo, M; Rama, M; Zallo, A; Buzzo, A; Contri, R; Lo Vetere, M; Macri, M M; Monge, M R; Passaggio, S; Patrignani, C; Robutti, E; Santroni, A; Tosi, S; Chaisanguanthum, K S; Morii, M; Wu, J; Dubitzky, R S; Marks, J; Schenk, S; Uwer, U; Bard, D J; Dauncey, P D; Flack, R L; Nash, J A; Nikolich, M B; Vazquez, W Panduro; Behera, P K; Chai, X; Charles, M J; Mallik, U; Meyer, N T; Ziegler, V; Cochran, J; Crawley, H B; Dong, L; Eyges, V; Meyer, W T; Prell, S; Rosenberg, E I; Rubin, A E; Gritsan, A V; Lae, C K; Denig, A G; Fritsch, M; Schott, G; Arnaud, N; Béquilleux, J; Davier, M; Grosdidier, G; Höcker, A; Lepeltier, V; Le Diberder, F; Lutz, A M; Pruvot, S; Rodier, S; Roudeau, P; Schune, M H; Serrano, J; Sordini, V; Stocchi, A; Wang, W F; Wormser, G; Lange, D J; Wright, D M; Chavez, C A; Forster, I J; Fry, J R; Gabathuler, E; Gamet, R; Hutchcroft, D E; Payne, D J; Schofield, K C; Touramanis, C; Bevan, A J; George, K A; Di Lodovico, F; Menges, W; Sacco, R; Cowan, G; Flaecher, H U; Hopkins, D A; Jackson, P S; McMahon, T R; Salvatore, F; Wren, A C; Brown, D N; Davis, C L; Allison, J; Barlow, N R; Barlow, R J; Chia, Y M; Edgar, C L; Lafferty, G D; West, T J; Yi, J I; Chen, C; Hulsbergen, W D; Jawahery, A; Roberts, D A; Simi, G; Blaylock, G; Dallapiccola, C; Hertzbach, S S; Li, X; Moore, T B; Salvati, E; Saremi, S; Cowan, R; Sciolla, G; Sekula, S J; Spitznagel, M; Taylor, F; Yamamoto, R K; Kim, H; McLachlin, S E; Patel, P M; Robertson, S H; Lazzaro, A; Lombardo, V; Palombo, F; Bauer, J M; Cremaldi, L; Eschenburg, V; Godang, R; Kroeger, R; Sanders, D A; Summers, D J; Zhao, H W; Brunet, S; Côté, D; Simard, M; Taras, P; Viaud, F B; Nicholson, H; Cavallo, N; De Nardo, G; Fabozzi, F; Gatto, C; Lista, L; Monorchio, D; Paolucci, P; Piccolo, D; Sciacca, C; Baak, M A; Raven, G; Snoek, H L; Jessop, C P; Losecco, J M; Benelli, G; Corwin, L A; Gan, K K; Honscheid, K; Hufnagel, D; Kagan, H; Kass, R; Morris, J P; Rahimi, A M; Regensburger, J J; Ter-Antonyan, R; Wong, Q K; Blount, N L; Brau, J; Frey, R; Igonkina, O; Kolb, J A; Lu, M; Rahmat, R; Sinev, N B; Strom, D; Strube, J; Torrence, E; Gaz, A; Margoni, M; Morandin, M; Pompili, A; Posocco, M; Rotondo, M; Simonetto, F; Stroili, R; Voci, C; Ben-Haim, E; Briand, H; Chauveau, J; David, P; Del Buono, L; de la Vaissière, Ch; Hamon, O; Hartfiel, B L; Leruste, Ph; Malclès, J; Ocariz, J; Perez, A; Prendki, J; Gladney, L; Biasini, M; Covarelli, R; Manoni, E; Angelini, C; Batignani, G; Bettarini, S; Calderini, G; Carpinelli, M; Cenci, R; Forti, F; Giorgi, M A; Lusiani, A; Marchiori, G; Mazur, M A; Morganti, M; Neri, N; Paoloni, E; Rizzo, G; Walsh, J J; Haire, M; Biesiada, J; Elmer, P; Lau, Y P; Lu, C; Olsen, J; Smith, A J S; Telnov, A V; Baracchini, E; Bellini, F; Cavoto, G; D'Orazio, A; Del Re, D; Di Marco, E; Faccini, R; Ferrarotto, F; Ferroni, F; Gaspero, M; Jackson, P D; Gioi, L Li; Mazzoni, M A; Morganti, S; Piredda, G; Polci, F; Renga, F; Voena, C; Ebert, M; Schröder, H; Waldi, R; Adye, T; Castelli, G; Franek, B; Olaiya, E O; Ricciardi, S; Roethel, W; Wilson, F F; Aleksan, R; Emery, S; Escalier, M; Gaidot, A; Ganzhur, S F; de Monchenault, G Hamel; Kozanecki, W; Legendre, M; Vasseur, G; Yèche, Ch; Zito, M; Chen, X R; Liu, H; Park, W; Purohit, M V; Wilson, J R; Allen, M T; Aston, D; Bartoldus, R; Bechtle, P; Berger, N; Claus, R; Coleman, J P; Convery, M R; Dingfelder, J C; Dorfan, J; Dubois-Felsmann, G P; Dujmic, D; Dunwoodie, W; Field, R C; Glanzman, T; Gowdy, S J; Graham, M T; Grenier, P; Halyo, V; Hast, C; Hryn'ova, T; Innes, W R; Kelsey, M H; Kim, P; Leith, D W G S; Li, S; Luitz, S; Luth, V; Lynch, H L; Macfarlane, D B; Marsiske, H; Messner, R; Muller, D R; O'Grady, C P; Ozcan, V E; Perazzo, A; Perl, M; Pulliam, T; Ratcliff, B N; Roodman, A; Salnikov, A A; Schindler, R H; Schwiening, J; Snyder, A; Stelzer, J; Su, D; Sullivan, M K; Suzuki, K; Swain, S K; Thompson, J M; Va'vra, J; van Bakel, N; Wagner, A P; Weaver, M; Wisniewski, W J; Wittgen, M; Wright, D H; Wulsin, H W; Yarritu, A K; Yi, K; Young, C C; Burchat, P R; Edwards, A J; Majewski, S A; Petersen, B A; Wilden, L; Ahmed, S; Alam, M S; Bula, R; Ernst, J A; Jain, V; Pan, B; Saeed, M A; Wappler, F R; Zain, S B; Bugg, W; Krishnamurthy, M; Spanier, S M; Eckmann, R; Ritchie, J L; Schilling, C J; Schwitters, R F; Izen, J M; Lou, X C; Ye, S; Bianchi, F; Gallo, F; Gamba, D; Pelliccioni, M; Bomben, M; Bosisio, L; Cartaro, C; Cossutti, F; Della Ricca, G; Lanceri, L; Vitale, L; Azzolini, V; Lopez-March, N; Martinez-Vidal, F; Oyanguren, A; Albert, J; Banerjee, Sw; Bhuyan, B; Hamano, K; Kowalewski, R; Nugent, I M; Roney, J M; Sobie, R J; Back, J J; Harrison, P F; Latham, T E; Mohanty, G B; Pappagallo, M; Band, H R; Chen, X; Dasu, S; Flood, K T; Hollar, J J; Kutter, P E; Mellado, B; Pan, Y; Pierini, M; Prepost, R; Wu, S L; Yu, Z; Neal, H

    2007-12-21

    We report the results of a CP violation analysis of the decay B{+/-}-->D{pi{+}pi{-}pi;{0}}K{+/-}, where D{pi{+}pi{-}pi{0}} indicates a neutral D meson detected in the final state pi{+}pi{-}pi{0}, excluding K{S}{0}pi{0}. The analysis makes use of 324 x 10{6}e{+}e{-}-->BB[over ] events recorded by the BABAR experiment at the PEP-II e;{+}e;{-} storage ring. Analyzing the pi;{+}pi;{-}pi;{0} Dalitz plot distribution and the B{+/-}-->D{pi{+}pi{-}pi{0}}K{+/-} branching fraction and decay rate asymmetry, we find the following one-standard-deviation constraints on the amplitude ratio and on the weak and strong phases: 0.06pi{+}pi{-}pi{0} decay amplitude.

  1. First observation of decay $B_c^+\\to J/\\psi \\pi^+\\pi^-\\pi^+$

    CERN Document Server

    Aaij, R; Adeva, B; Adinolfi, M; Adrover, C; Affolder, A; Ajaltouni, Z; Albrecht, J; Alessio, F; Alexander, M; Ali, S; Alkhazov, G; Alvarez Cartelle, P; Alves Jr, A A; Amato, S; Amhis, Y; Anderson, J; Appleby, R B; Aquines Gutierrez, O; Archilli, F; Artamonov, A; Artuso, M; Aslanides, E; Auriemma, G; Bachmann, S; Back, J J; Balagura, V; Baldini, W; Barlow, R J; Barschel, C; Barsuk, S; Barter, W; Bates, A; Bauer, C; Bauer, Th; Bay, A; Bediaga, I; Belogurov, S; Belous, K; Belyaev, I; Ben-Haim, E; Benayoun, M; Bencivenni, G; Benson, S; Benton, J; Bernet, R; Bettler, M-O; van Beuzekom, M; Bien, A; Bifani, S; Bird, T; Bizzeti, A; Bjørnstad, P M; Blake, T; Blanc, F; Blanks, C; Blouw, J; Blusk, S; Bobrov, A; Bocci, V; Bondar, A; Bondar, N; Bonivento, W; Borghi, S; Borgia, A; Bowcock, T J V; Bozzi, C; Brambach, T; van den Brand, J; Bressieux, J; Brett, D; Britsch, M; Britton, T; Brook, N H; Brown, H; Büchler-Germann, A; Burducea, I; Bursche, A; Buytaert, J; Cadeddu, S; Callot, O; Calvi, M; Calvo Gomez, M; Camboni, A; Campana, P; Carbone, A; Carboni, G; Cardinale, R; Cardini, A; Carson, L; Carvalho Akiba, K; Casse, G; Cattaneo, M; Cauet, Ch; Charles, M; Charpentier, Ph; Chiapolini, N; Ciba, K; Cid Vidal, X; Ciezarek, G; Clarke, P E L; Clemencic, M; Cliff, H V; Closier, J; Coca, C; Coco, V; Cogan, J; Collins, P; Comerma-Montells, A; Contu, A; Cook, A; Coombes, M; Corti, G; Couturier, B; Cowan, G A; Currie, R; D'Ambrosio, C; David, P; David, P N Y; De Bonis, I; De Bruyn, K; De Capua, S; De Cian, M; De Miranda, J M; De Paula, L; De Simone, P; Decamp, D; Deckenhoff, M; Degaudenzi, H; Del Buono, L; Deplano, C; Derkach, D; Deschamps, O; Dettori, F; Dickens, J; Dijkstra, H; Diniz Batista, P; Domingo Bonal, F; Donleavy, S; Dordei, F; Dosil Suárez, A; Dossett, D; Dovbnya, A; Dupertuis, F; Dzhelyadin, R; Dziurda, A; Easo, S; Egede, U; Egorychev, V; Eidelman, S; van Eijk, D; Eisele, F; Eisenhardt, S; Ekelhof, R; Eklund, L; Elsasser, Ch; Elsby, D; Esperante Pereira, D; Falabella, A; Färber, C; Fardell, G; Farinelli, C; Farry, S; Fave, V; Fernandez Albor, V; Ferro-Luzzi, M; Filippov, S; Fitzpatrick, C; Fontana, M; Fontanelli, F; Forty, R; Francisco, O; Frank, M; Frei, C; Frosini, M; Furcas, S; Gallas Torreira, A; Galli, D; Gandelman, M; Gandini, P; Gao, Y; Garnier, J-C; Garofoli, J; Garra Tico, J; Garrido, L; Gascon, D; Gaspar, C; Gauld, R; Gauvin, N; Gersabeck, M; Gershon, T; Ghez, Ph; Gibson, V; Gligorov, V V; Göbel, C; Golubkov, D; Golutvin, A; Gomes, A; Gordon, H; Grabalosa Gándara, M; Graciani Diaz, R; Granado Cardoso, L A; Graugés, E; Graziani, G; Grecu, A; Greening, E; Gregson, S; Gui, B; Gushchin, E; Guz, Yu; Gys, T; Hadjivasiliou, C; Haefeli, G; Haen, C; Haines, S C; Hampson, T; Hansmann-Menzemer, S; Harji, R; Harnew, N; Harrison, J; Harrison, P F; Hartmann, T; He, J; Heijne, V; Hennessy, K; Henrard, P; Hernando Morata, J A; van Herwijnen, E; Hicks, E; Holubyev, K; Hopchev, P; Hulsbergen, W; Hunt, P; Huse, T; Huston, R S; Hutchcroft, D; Hynds, D; Iakovenko, V; Ilten, P; Imong, J; Jacobsson, R; Jaeger, A; Jahjah Hussein, M; Jans, E; Jansen, F; Jaton, P; Jean-Marie, B; Jing, F; John, M; Johnson, D; Jones, C R; Jost, B; Kaballo, M; Kandybei, S; Karacson, M; Karbach, T M; Keaveney, J; Kenyon, I R; Kerzel, U; Ketel, T; Keune, A; Khanji, B; Kim, Y M; Knecht, M; Koopman, R F; Koppenburg, P; Korolev, M; Kozlinskiy, A; Kravchuk, L; Kreplin, K; Kreps, M; Krocker, G; Krokovny, P; Kruse, F; Kruzelecki, K; Kucharczyk, M; Kudryavtsev, V; Kvaratskheliya, T; La Thi, V N; Lacarrere, D; Lafferty, G; Lai, A; Lambert, D; Lambert, R W; Lanciotti, E; Lanfranchi, G; Langenbruch, C; Latham, T; Lazzeroni, C; Le Gac, R; van Leerdam, J; Lees, J-P; Lefèvre, R; Leflat, A; Lefrançois, J; Leroy, O; Lesiak, T; Li, L; Li Gioi, L; Lieng, M; Liles, M; Lindner, R; Linn, C; Liu, B; Liu, G; von Loeben, J; Lopes, J H; Lopez Asamar, E; Lopez-March, N; Lu, H; Luisier, J; Mac Raighne, A; Machefert, F; Machikhiliyan, I V; Maciuc, F; Maev, O; Magnin, J; Malde, S; Mamunur, R M D; Manca, G; Mancinelli, G; Mangiafave, N; Marconi, U; Märki, R; Marks, J; Martellotti, G; Martens, A; Martin, L; Martín Sánchez, A; Martinelli, M; Martinez Santos, D; Massafferri, A; Mathe, Z; Matteuzzi, C; Matveev, M; Maurice, E; Maynard, B; Mazurov, A; McGregor, G; McNulty, R; Meissner, M; Merk, M; Merkel, J; Miglioranzi, S; Milanes, D A; Minard, M-N; Molina Rodriguez, J; Monteil, S; Moran, D; Morawski, P; Mountain, R; Mous, I; Muheim, F; Müller, K; Muresan, R; Muryn, B; Muster, B; Mylroie-Smith, J; Naik, P; Nakada, T; Nandakumar, R; Nasteva, I; Needham, M; Neufeld, N; Nguyen, A D; Nguyen-Mau, C; Nicol, M; Niess, V; Nikitin, N; Nikodem, T; Nomerotski, A; Novoselov, A; Oblakowska-Mucha, A; Obraztsov, V; Oggero, S; Ogilvy, S; Okhrimenko, O; Oldeman, R; Orlandea, M; Otalora Goicochea, J M; Owen, P; Pal, B K; Palacios, J; Palano, A; Palutan, M; Panman, J; Papanestis, A; Pappagallo, M; Parkes, C; Parkinson, C J; Passaleva, G; Patel, G D; Patel, M; Paterson, S K; Patrick, G N; Patrignani, C; Pavel-Nicorescu, C; Pazos Alvarez, A; Pellegrino, A; Penso, G; Pepe Altarelli, M; Perazzini, S; Perego, D L; Perez Trigo, E; Pérez-Calero Yzquierdo, A; Perret, P; Perrin-Terrin, M; Pessina, G; Petrolini, A; Phan, A; Picatoste Olloqui, E; Pie Valls, B; Pietrzyk, B; Pilař, T; Pinci, D; Plackett, R; Playfer, S; Plo Casasus, M; Polok, G; Poluektov, A; Polycarpo, E; Popov, D; Popovici, B; Potterat, C; Powell, A; Prisciandaro, J; Pugatch, V; Puig Navarro, A; Qian, W; Rademacker, J H; Rakotomiaramanana, B; Rangel, M S; Raniuk, I; Raven, G; Redford, S; Reid, M M; dos Reis, A C; Ricciardi, S; Richards, A; Rinnert, K; Roa Romero, D A; Robbe, P; Rodrigues, E; Rodrigues, F; Rodriguez Perez, P; Rogers, G J; Roiser, S; Romanovsky, V; Rosello, M; Rouvinet, J; Ruf, T; Ruiz, H; Sabatino, G; Saborido Silva, J J; Sagidova, N; Sail, P; Saitta, B; Salzmann, C; Sannino, M; Santacesaria, R; Santamarina Rios, C; Santinelli, R; Santovetti, E; Sapunov, M; Sarti, A; Satriano, C; Satta, A; Savrie, M; Savrina, D; Schaack, P; Schiller, M; Schindler, H; Schleich, S; Schlupp, M; Schmelling, M; Schmidt, B; Schneider, O; Schopper, A; Schune, M-H; Schwemmer, R; Sciascia, B; Sciubba, A; Seco, M; Semennikov, A; Senderowska, K; Sepp, I; Serra, N; Serrano, J; Seyfert, P; Shapkin, M; Shapoval, I; Shatalov, P; Shcheglov, Y; Shears, T; Shekhtman, L; Shevchenko, O; Shevchenko, V; Shires, A; Silva Coutinho, R; Skwarnicki, T; Smith, N A; Smith, E; Sobczak, K; Soler, F J P; Solomin, A; Soomro, F; Souza De Paula, B; Spaan, B; Sparkes, A; Spradlin, P; Stagni, F; Stahl, S; Steinkamp, O; Stoica, S; Stone, S; Storaci, B; Straticiuc, M; Straumann, U; Subbiah, V K; Swientek, S; Szczekowski, M; Szczypka, P; Szumlak, T; T'Jampens, S; Teodorescu, E; Teubert, F; Thomas, C; Thomas, E; van Tilburg, J; Tisserand, V; Tobin, M; Tolk, S; Topp-Joergensen, S; Torr, N; Tournefier, E; Tourneur, S; Tran, M T; Tsaregorodtsev, A; Tuning, N; Ubeda Garcia, M; Ukleja, A; Uwer, U; Vagnoni, V; Valenti, G; Vazquez Gomez, R; Vazquez Regueiro, P; Vecchi, S; Velthuis, J J; Veltri, M; Viaud, B; Videau, I; Vieira, D; Vilasis-Cardona, X; Visniakov, J; Vollhardt, A; Volyanskyy, D; Voong, D; Vorobyev, A; Vorobyev, V; Voss, H; Waldi, R; Wandernoth, S; Wang, J; Ward, D R; Watson, N K; Webber, A D; Websdale, D; Whitehead, M; Wiedner, D; Wiggers, L; Wilkinson, G; Williams, M P; Williams, M; Wilson, F F; Wishahi, J; Witek, M; Witzeling, W; Wotton, S A; Wyllie, K; Xie, Y; Xing, F; Xing, Z; Yang, Z; Young, R; Yushchenko, O; Zangoli, M; Zavertyaev, M; Zhang, F; Zhang, L; Zhang, W C; Zhang, Y; Zhelezov, A; Zhong, L; Zvyagin, A

    2012-01-01

    The decay $B_c^+\\to J/\\psi \\pi^+\\pi^-\\pi^+$ is observed for the first time, using 0.8 fb$^{-1}$ of $pp$ collisions at $\\sqrt{s}=7$ TeV collected by the LHCb experiment. The ratio of branching fractions ${\\cal B}(B_c^+\\to J/\\psi \\pi^+\\pi^-\\pi^+)/{\\cal B}(B_c^+\\to J/\\psi \\pi^+)$ is measured to be $2.41\\pm0.30\\pm0.33$, where the first uncertainty is statistical and the second systematic. The result is in agreement with theoretical predictions.

  2. Measurement of $\\Gamma(\\eta \\to \\pi^+\\pi^-\\gamma)/\\Gamma(\\eta \\to \\pi^+\\pi^-\\pi^0)$ with KLOE experiment

    CERN Document Server

    Ambrosino, F; Antonelli, M; Archilli, F; Balwierz, I; Bencivenni, G; Bini, C; Bloise, C; Bocchetta, S; Bossi, F; Branchini, P; Capon, G; Capussela, T; Ceradini, F; Ciambrone, P; Czerwiski, E; De Lucia, E; De Santis, A; De Simone, P; De Zorzi, G; Denig, A; Di Domenico, A; Di Donato, C; Di Micco, B; Dreucci, M; Felici, G; Fiore, S; Franzini, P; Gatti, C; Gauzzi, P; Giovannella, S; Graziani, E; Jacewicz, M; Lee-Franzini, J; Martemianov, M; Martini, M; Massarotti, P; Meola, S; Miscetti, S; Morello, G; Moulson, M; Muller, S; Napolitano, M; Nguyen, F; Palutan, M; Passeri, A; Patera, V; Longhi, I Prado; Santangelo, P; Sciascia, B; Silarski, M; Spadaro, T; Taccini, C; Tortora, L; Venanzoni, G; Versaci, R; Xu, G; Zdebik, J; Badoni, D; Bocci, V; Budano, A; Bulychjev, S A; Campana, P; Dané, E; De Robertis, G; Domenici, D; Erriquez, O; Fanizzi, G; Gonnella, F; Happacher, F; Höistad, B; Iarocci, E; Johansson, T; Kulikov, V; Kupsc, A; Loddo, F; Matsyuk, M; Messi, R; Moricciani, D; Moskal, P; Ranieri, A; Sarra, I; Schioppa, M; Sciubba, A; Wiślicki, W; Wolke, M

    2011-01-01

    We report the measurement of the ratio $\\Gamma(\\eta \\to \\pi^+\\pi^-\\gamma)/\\Gamma(\\eta \\to \\pi^+\\pi^-\\pi^0)$ analyzing a large sample of $\\phi \\to \\eta \\gamma$ decays recorded with the KLOE experiment at the DA$\\Phi$NE $e^+ e^-$ collider, corresponding to an integrated luminosity of 558 pb$^{-1}$. The $\\eta \\to \\pi^+\\pi^-\\gamma$ process is supposed to proceed both via a resonant contribution, mediated by the $\\rho$ meson, and a non resonant direct term, connected to the box anomaly. The presence of the direct term affects the partial width value. Our result $R_{\\eta}=\\Gamma(\\eta \\to \\pi^+ \\pi^- \\gamma)/\\Gamma(\\eta \\to \\pi^+ \\pi^- \\pi^0)= 0.1838\\pm 0.0005_{stat} \\pm 0.0030_{syst}$ is in agreement with a recent CLEO measurement, which differs by more 3 $\\sigma$ from the average of previous results.

  3. Empirical parameterization of the $K^{+-} \\to \\pi^{+-}\\pi^{0}\\pi^{0}$ decay Dalitz plot

    CERN Document Server

    Batley, J R

    2010-01-01

    As first observed by the NA48/2 experiment at the CERN SPS, the $\\pi^{0}\\pi^{0}$ invariant mass ($M_{00}$) distribution from $K^{\\+-} -> \\pi^{+-}\\pi^{0}\\pi^{0}$ decay shows a cusp-like anomaly at $M_{00}=2m_{+}$, where $m_+$ is the charged pion mass. An analysis to extract the $\\pi\\pi$ scattering lengths in the isospin $I=0$ and $I=2$ states, $a_0$ and $a_2$, respectively, has been recently reported. In the present work the Dalitz plot of this decay is fitted to a new empirical parameterization suitable for practical purposes, such as Monte Carlo simulations of $K^{+-}->\\pi^{+-}\\pi^{0}\\pi^{0}$ decays.

  4. Study of the reaction $\\pi^{-} Be \\to \\omega \\pi^{-} \\pi^{0} Be$

    CERN Document Server

    IHEP. Protvino

    1998-01-01

    The results of patial wave analysis of the omega pi- pi0 system, produced in the reaction pi- Be --> pi+ 2pi- 2pi0 Be at beam momentum of 37 GeV are presented. An indication of the resonant type structure with mass near 1.74 GeV and JpMetha=0-0+ in the omega rho- system was found. The decay branching ratio of a2(1320)- to omega pi- pi0 was measured. A wave with JpMetha=2+1+ shows a broad bump at M near 1.7 GeV. The decays pi2(1670)- --> omega rho- and a4(2040)- --> omega rho- were observed for the first time. The bump in the b1(1235)pi wave with exotic quantum numbers Jpc=1-+ at M near 1.7 GeV was observed.

  5. Pi in the sky

    CERN Document Server

    Frolop, Ali

    2016-01-01

    Deviations of the observed cosmic microwave background (CMB) from the standard model, known as "anomalies", are obviously highly significant and deserve to be pursued more aggressively in order to discover the physical phenomena underlying them. Through intensive investigation we have discovered that there are equally surprising features in the digits of the number $\\pi$, and moreover there is a remarkable correspondence between each type of peculiarity in the digits of $\\pi$ and the anomalies in the CMB. Putting aside the unreasonable possibility that these are just the sort of flukes that appear when one looks hard enough, the only conceivable conclusion is that, however the CMB anomalies were created, a similar process imprinted patterns in the digits of $\\pi$.

  6. K$_{L}$ --> $\\pi^{+}\\pi^{-}$e+e-

    CERN Document Server

    Elwood, J K; Savage, M J; Elwood, John K; Wise, Mark B; Savage, Martin J

    1995-01-01

    We calculate all of the form factors for the one-photon, K_L \\rightarrow \\pi^+ \\pi^- \\gamma^* \\rightarrow \\pi^+ \\pi^- e^+e^- contribution to the K_L \\rightarrow \\pi^+ \\pi^- e^+e^- decay amplitude at leading order in chiral perturbation theory. These form factors depend on one unknown constant that is a linear combination of coefficients of local {\\cal O}(p^4) operators in the chiral lagrangian for weak radiative kaon decay. We determine the differential rate for \\K and also the magnitude of two CP violating observables.

  7. Observation of $\\pi^- K^+$ and $\\pi^+ K^-$ atoms

    CERN Document Server

    Adeva, B; The PS212 collaboration; Allkofer, Y.; Amsler, C.; Anania, A.; Aogaki, S.; Benelli, A.; Brekhovskikh, V.; Cechak, T.; Chiba, M.; Chliapnikov, P.; Doskarova, P.; Drijard, D.; Dudarev, A.; Dumitriu, D.; Fluerasu, D.; Gorin, A.; Gorchakov, O.; Gritsay, K.; Guaraldo, C.; Gugiu, M.; Hansroul, M.; Hons, Z.; Horikawa, S.; Iwashita, Y.; Karpukhin, V.; Kluson, J.; Kobayashi, M.; Kruglov, V.; Kruglova, L.; Kulikov, A.; Kulish, E.; Kuptsov, A.; Lamberto, A.; Lanaro, A.; Lednicky, R.; Marinas, C.; Martincik, J.; Nikitin, M.; Okada, K.; Olchevskii, V.; Pentia, M.; Penzo, A.; Plo, M.; Prusa, P.; Rappazzo, G.; Vidal, A.Romero; Ryazantsev, A.; Rykalin, V.; Saborido, J.; Sidorov, A.; Smolik, J.; Takeutchi, F.; Tauscher, L.; Trojek, T.; Trusov, S.; Urban, T.; Vrba, T.; Yazkov, V.; Yoshimura, Y.; Zhabitsky, M.; Zrelov, P.

    2016-01-01

    The observation of hydrogen-like $\\pi K$ atoms, consisting of $\\pi^- K^+$ or $\\pi^+ K^-$ mesons, is presented. The atoms have been produced by 24 GeV/$c$ protons from the CERN PS accelerator, interacting with platinum or nickel foil targets. The breakup (ionisation) of $\\pi K$ atoms in the same targets yields characteristic $\\pi K$ pairs, called ``atomic pairs'', with small relative momenta in the pair centre-of-mass system. The upgraded DIRAC experiment has observed $349\\pm62$ such atomic $\\pi K$ pairs, corresponding to a signal of 5.6 standard deviations.

  8. Observation of the decay rho. --> pi. /sup +/. pi. /sup -/. gamma

    Energy Technology Data Exchange (ETDEWEB)

    Vasserman, I.B.; Golubev, V.B.; Dolinskii, S.I.; Druzhinin, V.P.; Dubrovin, M.S.; Ivanov, P.M.; Ivanchenko, V.N.; Pakhtusova, E.V.; Peryshkin, A.N.; Serednyakov, S.I.; and others

    1988-06-01

    The Neutral Detector at the electron-positron collidor VEPP-2M has been used to observe the rare decay rho..--> pi../sup +/..pi../sup -/..gamma.. with a relative probability BR(rho..--> pi../sup +/..pi../sup -/..gamma..) = (1.11 + 0.14).10/sup -2/ for photon energy >50 MeV. The decay probability and the shape of the photon energy spectrum agree with the bremsstrahlung mechanism of decay. A limit is established on the probability of structure radiation: BR(rho..--> pi../sup +/..pi../sup -/..gamma..)/sub s/<5x10/sup -3/ at the 90% confidence level.

  9. Study of e+e- --> pi+ pi- pi0 process using initial state radiation with BABAR

    CERN Document Server

    Aubert, B; Abrams, G S; Adye, T; Ahmed, S; Alam, M S; Albert, J; Aleksan, Roy; Allison, J; Allmendinger, T; Altenburg, D; Andreotti, M; Angelini, C; Anulli, F; Aston, D; Azzolini, V; Baak, M; Back, J J; Bailey, S; Baldini-Ferroli, R; Band, H R; Banerjee, Sw; Barate, R; Bard, D J; Barlow, N R; Barlow, R J; Barrett, M; Bartoldus, R; Batignani, G; Bauer, J M; Beck, T W; Behera, P K; Bellini, F; Benayoun, M; Berger, N; Bernard, D; Berryhill, J W; Best, D; Bettarini, S; Bettoni, D; Bevan, A J; Bhimji, W; Bianchi, F; Biasini, M; Blanc, F; Blaylock, G; Blinov, A E; Blinov, V E; Bloom, P; Bóna, M; Bondioli, M; Bonneaud, G R; Borgland, A W; Bosisio, L; Boutigny, D; Bowerman, D A; Boyarski, A M; Boyd, J T; Bozzi, C; Brandenburg, G; Brandt, T; Brau, J E; Breon, A B; Briand, H; Brochard, F; Brose, J; Brown, C L; Brown, C M; Brown, D; Brown, D N; Bruinsma, M; Brunet, S; Bucci, F; Buchanan, C; Buchmüller, O L; Bugg, W; Bulten, H; Burchat, Patricia R; Button-Shafer, J; Buzzo, A; Côté, D; Cahn, R N; Calabrese, R; Calcaterra, A; Calderini, G; Campagnari, C; Capra, R; Carpinelli, M; Cartaro, C; Cavallo, N; Cavoto, G; Chaisanguanthum, K S; Chao, M; Charles, E; Charles, M J; Chauveau, J; Chavez, C A; Chen, A; Chen, E; Chen, J C; Chen, S; Cheng, B; Cheng, C H; Chevalier, N; Christ, S; Cibinetto, G; Clark, P J; Claus, R; Cochran, J; Colecchia, F; Coleman, J P; Contri, R; Convery, M R; Cormack, C M; Cossutti, F; Cottingham, W N; Couderc, F; Covarelli, R; Cowan, G; Cowan, R; Crawley, H B; Cremaldi, L M; Cristinziani, M; Crosetti, G; Çuhadar-Dönszelmann, T; Dahmes, B; Dallapiccola, C; Danielson, N; Dasu, S; Datta, M; Dauncey, P D; David, P; Davier, M; Davis, C L; Day, C T; De Groot, N; De Nardo, Gallieno; Del Buono, L; Della Ricca, G; Di Lodovico, F; Dickopp, M; Dittongo, S; Dong, D; Dorfan, J; Dorigo, A; Druzhinin, V P; Dubitzky, R S; Dubois-Felsmann, G P; Dujmic, D; Dunwoodie, W M; Dvoretskii, A; Eckmann, R; Edwards, A J; Egede, U; Eichenbaum, A M; Eigen, G; Eisner, A M; Elmer, P; Elsen, E E; Emery, S; Ernst, J A; Eschenburg, V; Eschrich, I; Fabozzi, F; Faccini, R; Fan, S; Farbin, A; Feltresi, E; Ferrarotto, F; Ferroni, F; Field, R C; Finocchiaro, G; Flack, R L; Flächer, H U; Flood, K T; Ford, K E; Ford, W T; Forster, I J; Forti, F; Fortin, D; Foulkes, S D; Franek, B J; Frey, R; Fritsch, M; Fry, J R; Gabathuler, Erwin; Gaidot, A; Gaillard, J M; Gaillard, J R; Galeazzi, F; Gallo, F; Gamba, D; Gamet, R; Gan, K K; Ganzhur, S F; Gary, J W; Gaspero, M; Gatto, C; Geddes, N I; Gill, M S; Giorgi, M A; Giraud, P F; Giroux, X; Gladney, L; Glanzman, T; Godang, R; Goetzen, K; Golubev, V B; Gopal, G P; Gowdy, S J; Graham, M; Grancagnolo, S; Green, M G; Greene, M G; Grenier, G J; Grenier, P; Gritsan, A V; Grosdidier, G; Groysman, Y; Guo, Q H; Hadavand, H K; Hadig, T; Haire, M; Halyo, V; Hamel de Monchenault, G; Hamon, O; Harrison, P F; Harrison, T J; Hart, A J; Hart, P A; Hartfiel, B L; Harton, J L; Hast, C; Hauke, A; Hawkes, C M; Hearty, C; Held, T; Hertzbach, S S; Heusch, C A; Hicheur, A; Hill, E J; Hitlin, D G; Höcker, A; Hodgkinson, M C; Hollar, J J; Honscheid, K; Hrynóva, T; Hufnagel, D; Hulsbergen, W D; Hutchcroft, D E; Igonkina, O; Innes, W R; Ivanchenko, V N; Izen, J M; Jackson, P D; Jackson, P S; Jacobsen, R G; Jawahery, A; Jayatilleke, S M; Jessop, C P; John, M J J; Johnson, J R; Judd, D; Kadel, R W; Kadyk, J; Kagan, H; Karyotakis, Yu; Kass, R; Kelly, M P; Kelsey, M H; Kerth, L T; Khan, A; Kim, H; Kim, P; Kirkby, D; Kitayama, I; Knecht, N S; Koch, H; Kocian, M L; Kofler, R; Kolomensky, Yu G; Koptchev, V B; Kovalskyi, D; Kowalewski, R V; Kozanecki, Witold; Kravchenko, E A; Krishnamurthy, M; Kroeger, R; Kroseberg, J; Kukartsev, G; Kutter, P E; Kyberd, P; Lacker, H M; Lae, C K; Lafferty, G D; Lamsa, J; Lanceri, L; Lange, D J; Langenegger, U; Lankford, A J; Laplace, S; Latham, T E; Lau, Y P; Lavin, D; Lazzaro, A; Le Diberder, F R; Lees, J P; Legendre, M; Leith, D W G S; Lepeltier, V; Leruste, P; Lewandowski, B; Li Gioi, L; Li, H; Libby, J; Lillard, V; Lista, L; Liu, R; LoSecco, J M; Lo Vetere, M; Lockman, W S; Lombardo, V; London, G W; Long, O; Lou, X C; Lu, A; Lü, C; Luitz, S; Luppi, E; Lusiani, A; Lüth, V; Lutz, A M; Lynch, G; Lynch, H L; Lyon, A J; MacFarlane, D B; Macri, M; Malcles, J; Mallik, U; Mancinelli, G; Mandelkern, M A; Manfredi, P F; Mangeol, D J J; Marchiori, G; Margoni, M; Marsiske, H; Martínez-Vidal, F; Mattison, T S; Mayer, B; Mazur, M A; Mazzoni, M A; McKenna, J A; McMahon, T R; Meadows, B T; Messner, R; Meyer, T I; Meyer, W T; Miftakov, V; Mihályi, A; Mir, L M; Mohanty, G B; Mohapatra, A K; Mommsen, R K; Monge, M R; Monorchio, D; Moore, T B; Morandin, M; Morgan, S E; Morganti, M; Morganti, S; Morii, M; Morton, G W; Muheim, F; Müller, D R; Müller-Pfefferkorn, R; Narsky, I; Nash, J A; Nauenberg, U; Neal, H; Negrini, M; Neri, N; Nesom, G; Nicholson, H; Nikolich, M B; Nogowski, R; O'Grady, C P; Ocariz, J; Oddone, P J; Ofte, I; Olaiya, E O; Olivas, A; Olsen, J; Onuchin, A P; Orimoto, T J; Otto, S; Ozcan, V E; Paar, H P; Paick, K; Palano, A; Palombo, F; Pan, Y; Panetta, J; Panvini, R S; Paoloni, E; Paolucci, P; Parry, R J; Passaggio, S; Patel, P M; Patrignani, C; Patteri, P; Payne, D J; Pelizaeus, M; Perazzo, A; Perl, M; Peruzzi, I M; Petersen, B A; Petersen, T C; Petrak, S; Petzold, A; Piatenko, T; Piccolo, D; Piccolo, M; Piemontese, L; Pierini, M; Pioppi, M; Piredda, G; Pivk, M; Plaszczynski, S; Playfer, S; Pompili, A; Poropat, P; Porter, F C; Posocco, M; Potter, C T; Prell, S; Prepost, R; Pripstein, M; Pulliam, T; Purohit, M V; Qi, N D; Rahatlou, S; Rahimi, A M; Rama, M; Rankin, P; Ratcliff, B N; Raven, G; Re, V; Reidy, J; Ricciardi, S; Richman, J D; Ritchie, J L; Rizzo, G; Roat, C; Roberts, D A; Robertson, S H; Robutti, E; Roe, N A; Röthel, W; Ronan, Michael T; Roney, J M; Rong, G; Roodman, A; Roos, L; Rosenberg, E I; Rotondo, M; Rubin, A E; Ryd, A; Saeed, M A; Safai-Tehrani, F; Saleem, M; Salnikov, A A; Salvatore, F; Samuel, A; Sanders, D A; Sandrelli, F; Santroni, A; Saremi, S; Sarti, A; Satpathy, A; Schalk, T; Schindler, R H; Schott, G; Schrenk, S; Schubert, J; Schubert, Klaus R; Schumm, B A; Schune, M H; Schwiening, J; Schwierz, R; Schwitters, R F; Sciacca, C; Sciolla, G; Seiden, A; Sekula, S J; Serednyakov, S I; Sharma, V; Shelkov, V G; Shen, B C; Simani, M C; Simi, G; Simonetto, F; Sinev, N B; Skovpen, Yu I; Sloane, R J; Smith, A J S; Smith, J G; Snoek, H L; Snyder, A; Sobie, R J; Soffer, A; Soha, A; Sokoloff, M D; Solodov, E P; Spaan, B; Spanier, S M; Spradlin, P; Stängle, H; Steinke, M; Stelzer, J; Stoker, D P; Stroili, R; Strom, D; Stugu, B; Su, D; Sullivan, M K; Summers, D J; Sundermann, J E; T'Jampens, S; Tan, P; Tantot, L; Taras, P; Taylor, F; Taylor, G P; Telnov, A V; Teodorescu, L; Ter-Antonian, R; Therin, G; Thiebaux, C; Thiessen, D; Tiozzo, G; Tisserand, V; Toki, W H; Torrence, E; Tosi, S; Touramanis, C; Treadwell, E; Vasileiadis, G; Vasseur, G; Vavra, J; Verderi, M; Verkerke, W; Vitale, L; Voci, C; Voena, C; Vuagnin, G; Wagner, G; Wagner, S R; Wagoner, D E; Waldi, R; Walsh, J; Wang, K; Wang, P; Wappler, F R; Watson, A T; Weaver, M; Weidemann, A W; Weinstein, A J R; Wenzel, W A; Wilden, L; Williams, D C; Williams, J C; Willocq, S; Wilson, F F; Wilson, J R; Wilson, M G; Wilson, R J; Winter, M A; Wisniewski, W J; Wittgen, M; Won, E; Wong, Q K; Wormser, G; Wright, D H; Wright, D M; Wu, J; Wu, S L; Xie, Y; Yamamoto, R K; Yang, S; Yarritu, A K; Ye, S; Yéche, C; Yi, J; Young, C C; Yu, Z; Yumiceva, F X; Yushkov, A N; Zallo, A; Zeng, Q; Zghiche, A; Zhang, J; Zhang, L; Zhao, H W; Zhu, Y S; Zito, M; De Sangro, R; Del Re, D; La Vaissière, C de

    2004-01-01

    The process e+e- --> pi+ pi- pi0 gamma has been studied at a center-of-mass energy near the Y(4S) resonance using a 89.3 fb-1 data sample collected with the BaBar detector at the PEP-II collider. From the measured 3pi mass spectrum we have obtained the products of branching fractions for the omega and phi mesons, B(omega --> e+e-)B(omega --> 3pi)=(6.70 +/- 0.06 +/- 0.27)10-5 and B(phi --> e+e-)B(phi --> 3pi)=(4.30 +/- 0.08 +/- 0.21)10-5, and evaluated the e+e- --> pi+ pi- pi0 cross section for the e+e- center-of-mass energy range 1.05 to 3.00 GeV. About 900 e+e- --> J/psi gamma --> pi+ pi- pi0 gamma events have been selected and the branching fraction B(J/psi --> pi+ pi- pi0)=(2.18 +/- 0.19)% has been measured.

  10. Study of J/psi pi+ pi- states produced in B0 --> J/psi pi+ pi- K0 and B- --> J/psi pi+ pi- K-

    CERN Document Server

    Aubert, B; Boutigny, D; Couderc, F; Karyotakis, Yu; Lees, J P; Poireau, V; Tisserand, V; Zghiche, A; Graugès-Pous, E; Palano, A; Pappagallo, M; Pompili, A; Chen, J C; Qi, N D; Rong, G; Wang, P; Zhu, Y S; Eigen, G; Ofte, I; Stugu, B; Abrams, G S; Battaglia, M; Breon, A B; Brown, D N; Button-Shafer, J; Cahn, R N; Charles, E; Day, C T; Gill, M S; Gritsan, A V; Groysman, Y; Jacobsen, R G; Kadel, R W; Kadyk, J; Kerth, L T; Kolomensky, Yu G; Kukartsev, G; Lynch, G; Mir, L M; Oddone, P J; Orimoto, T J; Pripstein, M; Roe, N A; Ronan, M T; Wenzel, W A; Barrett, M; Ford, K E; Harrison, T J; Hart, A J; Hawkes, C M; Morgan, S E; Watson, A T; Fritsch, M; Goetzen, K; Held, T; Koch, H; Lewandowski, B; Pelizaeus, M; Peters, K; Schröder, T; Steinke, M; Boyd, J T; Burke, J P; Chevalier, N; Cottingham, W N; Çuhadar-Dönszelmann, T; Fulsom, B G; Hearty, C; Knecht, N S; Mattison, T S; McKenna, J A; Khan, A; Kyberd, P; Saleem, M; Teodorescu, L; Blinov, A E; Blinov, V E; Bukin, A D; Druzhinin, V P; Golubev, V B; Kravchenko, E A; Onuchin, A P; Serednyakov, S I; Skovpen, Yu I; Solodov, E P; Yushkov, A N; Best, D; Bondioli, M; Bruinsma, M; Chao, M; Curry, S; Eschrich, I; Kirkby, D; Lankford, A J; Lund, P; Mandelkern, M A; Mommsen, R K; Röthel, W; Stoker, D P; Buchanan, C; Hartfiel, B L; Weinstein, A J R; Foulkes, S D; Gary, J W; Long, O; Shen, B C; Wang, K; Zhang, L; Del Re, D; Hadavand, H K; Hill, E J; MacFarlane, D B; Paar, H P; Rahatlou, S; Sharma, V; Berryhill, J W; Campagnari, C; Cunha, A; Dahmes, B; Hong, T M; Mazur, M A; Richman, J D; Verkerke, W; Beck, T W; Eisner, A M; Flacco, C J; Heusch, C A; Kroseberg, J; Lockman, W S; Nesom, G; Schalk, T; Schumm, B A; Seiden, A; Spradlin, P; Williams, D C; Wilson, M G; Albert, J; Chen, E; Dubois-Felsmann, G P; Dvoretskii, A; Hitlin, D G; Narsky, I; Piatenko, T; Porter, F C; Ryd, A; Samuel, A; Andreassen, R; Jayatilleke, S M; Mancinelli, G; Meadows, B T; Sokoloff, M D; Blanc, F; Bloom, P; Chen, S; Ford, W T; Hirschauer, J F; Kreisel, A; Nauenberg, U; Olivas, A; Rankin, P; Ruddick, W O; Smith, J G; Ulmer, K A; Wagner, S R; Zhang, J; Chen, A; Eckhart, E A; Soffer, A; Toki, W H; Wilson, R J; Winklmeier, F; Zeng, Q; Altenburg, D; Feltresi, E; Hauke, A; Spaan, B; Brandt, T; Brose, J; Dickopp, M; Klose, V; Lacker, H M; Nogowski, R; Otto, S; Petzold, A; Schott, G; Schubert, J; Schubert, K R; Schwierz, R; Sundermann, J E; Bernard, D; Bonneaud, G R; Grenier, P; Schrenk, S; Thiebaux, C; Vasileiadis, G; Verderi, M; Bard, D J; Clark, P J; Gradl, W; Muheim, F; Playfer, S; Xie, Y; Andreotti, M; Azzolini, V; Bettoni, D; Bozzi, C; Calabrese, R; Cibinetto, G; Luppi, E; Negrini, M; Piemontese, L; Anulli, F; Baldini-Ferroli, R; Calcaterra, A; De Sangro, R; Finocchiaro, G; Patteri, P; Peruzzi, I M; Piccolo, M; Zallo, A; Buzzo, A; Capra, R; Contri, R; Lo Vetere, M; Macri, M; Monge, M R; Passaggio, S; Patrignani, C; Robutti, E; Santroni, A; Tosi, S; Brandenburg, G; Chaisanguanthum, K S; Morii, M; Won, E; Wu, J; Dubitzky, R S; Langenegger, U; Marks, J; Schenk, S; Uwer, U; Bhimji, W; Bowerman, D A; Dauncey, P D; Egede, U; Flack, R L; Gaillard, J R; Morton, G W; Nash, J A; Nikolich, M B; Taylor, G P; Vazquez, W P; Charles, M J; Mader, W F; Mallik, U; Mohapatra, A K; Cochran, J; Crawley, H B; Eyges, V; Meyer, W T; Prell, S; Rosenberg, E I; Rubin, A E; Yi, J; Arnaud, N; Davier, M; Giroux, X; Grosdidier, G; Höcker, A; Le Diberder, F R; Lepeltier, V; Lutz, A M; Oyanguren, A; Petersen, T C; Pierini, M; Plaszczynski, S; Rodier, S; Roudeau, P; Schune, M H; Stocchi, A; Wormser, G; Cheng, C H; Lange, D J; Simani, M C; Wright, D M; Bevan, A J; Chavez, C A; Forster, I J; Fry, J R; Gabathuler, E; Gamet, R; George, K A; Hutchcroft, D E; Parry, R J; Payne, D J; Schofield, K C; Touramanis, C; Cormack, C M; Di Lodovico, F; Menges, W; Sacco, R; Brown, C L; Cowan, G; Flächer, H U; Green, M G; Hopkins, D A; Jackson, P S; McMahon, T R; Ricciardi, S; Salvatore, F; Brown, D; Davis, C L; Allison, J; Barlow, N R; Barlow, R J; Edgar, C L; Hodgkinson, M C; Kelly, M P; Lafferty, G D; Naisbit, M T; Williams, J C; Chen, C; Hulsbergen, W D; Jawahery, A; Kovalskyi, D; Lae, C K; Roberts, D A; Simi, G; Blaylock, G; Dallapiccola, C; Hertzbach, S S; Kofler, R; Koptchev, V B; Li, X; Moore, T B; Saremi, S; Stängle, H; Willocq, S; Cowan, R; Koeneke, K; Sciolla, G; Sekula, S J; Spitznagel, M; Taylor, F; Yamamoto, R K; Kim, H; Patel, P M; Robertson, S H; Lazzaro, A; Lombardo, V; Palombo, F; Bauer, J M; Cremaldi, L; Eschenburg, V; Godang, R; Kroeger, R; Reidy, J; Sanders, D A; Summers, D J; Zhao, H W; Brunet, S; Côté, D; Taras, P; Viaud, B; Nicholson, H; Cavallo, N; De Nardo, Gallieno; Fabozzi, F; Gatto, C; Lista, L; Monorchio, D; Paolucci, P; Piccolo, D; Sciacca, C; Baak, M; Bulten, H; Raven, G; Snoek, H L; Wilden, L; Jessop, C P; LoSecco, J M; Allmendinger, T; Benelli, G; Gan, K K; Honscheid, K; Hufnagel, D; Jackson, P D; Kagan, H; Kass, R; Pulliam, T; Rahimi, A M; Ter-Antonian, R; Wong, Q K; Brau, J E; Frey, R; Igonkina, O; Lu, M; Potter, C T; Sinev, N B; Strom, D; Strube, J; Torrence, E; Galeazzi, F; Margoni, M; Morandin, M; Posocco, M; Rotondo, M; Simonetto, F; Stroili, R; Voci, C; Benayoun, M; Briand, H; Chauveau, J; David, P; Del Buono, L; La Vaissière, C de; Hamon, O; John, M J J; Leruste, P; Malcles, J; Ocariz, J; Roos, L; Therin, G; Behera, P K; Gladney, L; Guo, Q H; Panetta, J; Biasini, M; Covarelli, R; Pacetti, S; Pioppi, M; Angelini, C; Batignani, G; Bettarini, S; Bucci, F; Calderini, G; Carpinelli, M; Cenci, R; Forti, F; Giorgi, M A; Lusiani, A; Marchiori, G; Morganti, M; Neri, N; Paoloni, E; Rama, M; Rizzo, G; Walsh, J; Haire, M; Judd, D; Wagoner, D E; Biesiada, J; Danielson, N; Elmer, P; Lau, Y P; Lü, C; Olsen, J; Smith, A J S; Telnov, A V; Bellini, F; Cavoto, G; D'Orazio, A; Di Marco, E; Faccini, R; Ferrarotto, F; Ferroni, F; Gaspero, M; Li Gioi, L; Mazzoni, M A; Morganti, S; Piredda, G; Polci, F; Safai-Tehrani, F; Voena, C; Schröder, H; Wagner, G; Waldi, R; Adye, T; De Groot, N; Franek, B; Gopal, G P; Olaiya, E O; Wilson, F F; Aleksan, Roy; Emery, S; Gaidot, A; Ganzhur, S F; Giraud, P F; Graziani, G; Hamel de Monchenault, G; Kozanecki, Witold; Legendre, M; London, G W; Mayer, B; Vasseur, G; Yéche, C; Zito, M; Purohit, M V; Weidemann, A W; Wilson, J R; Yumiceva, F X; Abe, T; Allen, M T; Aston, D; Van Bakel, N; Bartoldus, R; Berger, N; Boyarski, A M; Buchmüller, O L; Claus, R; Coleman, J P; Convery, M R; Cristinziani, M; Dingfelder, J C; Dong, D; Dorfan, J; Dujmic, D; Dunwoodie, W M; Fan, S; Field, R C; Glanzman, T; Gowdy, S J; Hadig, T; Halyo, V; Hast, C; Hrynóva, T; Innes, W R; Kelsey, M H; Kim, P; Kocian, M L; Leith, D W G S; Libby, J; Luitz, S; Lüth, V; Lynch, H L; Marsiske, H; Messner, R; Müller, D R; O'Grady, C P; Ozcan, V E; Perazzo, A; Perl, M; Ratcliff, B N; Roodman, A; Salnikov, A A; Schindler, R H; Schwiening, J; Snyder, A; Stelzer, J; Su, D; Sullivan, M K; Suzuki, K; Swain, S; Thompson, J M; Vavra, J; Weaver, M; Wisniewski, W J; Wittgen, M; Wright, D H; Yarritu, A K; Yi, K; Young, C C; Burchat, P R; Edwards, A J; Majewski, S A; Petersen, B A; Roat, C; Ahmed, M; Ahmed, S; Alam, M S; Ernst, J A; Saeed, M A; Wappler, F R; Zain, S B; Bugg, W; Krishnamurthy, M; Spanier, S M; Eckmann, R; Ritchie, J L; Satpathy, A; Schwitters, R F; Izen, J M; Kitayama, I; Lou, X C; Williams, G; Ye, S; Bianchi, F; Bóna, M; Gallo, F; Gamba, D; Bomben, M; Bosisio, L; Cartaro, C; Cossutti, F; Della Ricca, G; Dittongo, S; Grancagnolo, S; Lanceri, L; Vitale, L; Martínez-Vidal, F; Panvini, R S; Banerjee, S; Bhuyan, B; Brown, C M; Fortin, D; Hamano, K; Kowalewski, R V; Roney, J M; Sobie, R J; Back, J J; Harrison, P F; Latham, T E; Mohanty, G B; Band, H R; Chen, X; Cheng, B; Dasu, S; Datta, M; Eichenbaum, A M; Flood, K T; Graham, M; Hollar, J J; Johnson, J R; Kutter, P E; Li, H; Liu, R; Mellado, B; Mihályi, A; Pan, Y; Prepost, R; Tan, P; Von Wimmersperg-Töller, J H; Wu, S L; Yu, Z; Neal, H

    2006-01-01

    We present results of a search for the X(3872) in B0 --> X(3872) K0_S, X(3872) --> J/\\psi pi+ pi-, improved measurements of B- --> X(3872) K-, and a study of the J/psi pi+ pi- mass region above the X(3872). We use 232 million BBbar pairs collected at the Upsilon(4S) resonance with the BaBar detector at the PEP-II e+e- asymmetric-energy storage rings. The results include the 90% confidence interval 1.34 x 10^{-6} X(3872)K0, X --> J/psi pi+ pi-) X(3872)K-, X --> J/psi pi+ pi-)=(10.1\\pm 2.5\\pm 1.0) x 10^{-6}. We observe a (2.7\\pm 1.3 \\pm 0.2) MeV/c^2 mass difference of the X(3872) produced in the two decay modes. Furthermore, we find an excess of J/psi pi+ pi- events with an invariant mass just above 4.2 GeV/c^2 that is consistent with recent observations in initial state radiation events.

  11. Observation of Upsilon(4S) decays to pi(+)pi(-)Upsilon(1S) and pi(+)pi(-)Upsilon(2S).

    Science.gov (United States)

    Aubert, B; Barate, R; Bona, M; Boutigny, D; Couderc, F; Karyotakis, Y; Lees, J P; Poireau, V; Tisserand, V; Zghiche, A; Grauges, E; Palano, A; Chen, J C; Qi, N D; Rong, G; Wang, P; Zhu, Y S; Eigen, G; Ofte, I; Stugu, B; Abrams, G S; Battaglia, M; Brown, D N; Button-Shafer, J; Cahn, R N; Charles, E; Gill, M S; Groysman, Y; Jacobsen, R G; Kadyk, J A; Kerth, L T; Kolomensky, Yu G; Kukartsev, G; Lynch, G; Mir, L M; Oddone, P J; Orimoto, T J; Pripstein, M; Roe, N A; Ronan, M T; Wenzel, W A; Barrett, M; Ford, K E; Harrison, T J; Hart, A J; Hawkes, C M; Morgan, S E; Watson, A T; Goetzen, K; Held, T; Koch, H; Lewandowski, B; Pelizaeus, M; Peters, K; Schroeder, T; Steinke, M; Boyd, J T; Burke, J P; Cottingham, W N; Walker, D; Cuhadar-Donszelmann, T; Fulsom, B G; Hearty, C; Knecht, N S; Mattison, T S; McKenna, J A; Khan, A; Kyberd, P; Saleem, M; Teodorescu, L; Blinov, V E; Bukin, A D; Druzhinin, V P; Golubev, V B; Onuchin, A P; Serednyakov, S I; Skovpen, Yu I; Solodov, E P; Todyshev, K Yu; Best, D S; Bondioli, M; Bruinsma, M; Chao, M; Curry, S; Eschrich, I; Kirkby, D; Lankford, A J; Lund, P; Mandelkern, M; Mommsen, R K; Roethel, W; Stoker, D P; Abachi, S; Buchanan, C; Foulkes, S D; Gary, J W; Long, O; Shen, B C; Wang, K; Zhang, L; Hadavand, H K; Hill, E J; Paar, H P; Rahatlou, S; Sharma, V; Berryhill, J W; Campagnari, C; Cunha, A; Dahmes, B; Hong, T M; Kovalskyi, D; Richman, J D; Beck, T W; Eisner, A M; Flacco, C J; Heusch, C A; Kroseberg, J; Lockman, W S; Nesom, G; Schalk, T; Schumm, B A; Seiden, A; Spradlin, P; Williams, D C; Wilson, M G; Albert, J; Chen, E; Dvoretskii, A; Hitlin, D G; Narsky, I; Piatenko, T; Porter, F C; Ryd, A; Samuel, A; Andreassen, R; Mancinelli, G; Meadows, B T; Sokoloff, M D; Blanc, F; Bloom, P C; Chen, S; Ford, W T; Hirschauer, J F; Kreisel, A; Nauenberg, U; Olivas, A; Ruddick, W O; Smith, J G; Ulmer, K A; Wagner, S R; Zhang, J; Chen, A; Eckhart, E A; Soffer, A; Toki, W H; Wilson, R J; Winklmeier, F; Zeng, Q; Altenburg, D D; Feltresi, E; Hauke, A; Jasper, H; Spaan, B; Brandt, T; Klose, V; Lacker, H M; Mader, W F; Nogowski, R; Petzold, A; Schubert, J; Schubert, K R; Schwierz, R; Sundermann, J E; Volk, A; Bernard, D; Bonneaud, G R; Grenier, P; Latour, E; Thiebaux, Ch; Verderi, M; Bard, D J; Clark, P J; Gradl, W; Muheim, F; Playfer, S; Robertson, A I; Xie, Y; Andreotti, M; Bettoni, D; Bozzi, C; Calabrese, R; Cibinetto, G; Luppi, E; Negrini, M; Petrella, A; Piemontese, L; Prencipe, E; Anulli, F; Baldini-Ferroli, R; Calcaterra, A; de Sangro, R; Finocchiaro, G; Pacetti, S; Patteri, P; Peruzzi, I M; Piccolo, M; Rama, M; Zallo, A; Buzzo, A; Capra, R; Contri, R; Lo Vetere, M; Macri, M M; Monge, M R; Passaggio, S; Patrignani, C; Robutti, E; Santroni, A; Tosi, S; Brandenburg, G; Chaisanguanthum, K S; Morii, M; Wu, J; Dubitzky, R S; Marks, J; Schenk, S; Uwer, U; Bhimji, W; Bowerman, D A; Dauncey, P D; Egede, U; Flack, R L; Gaillard, J R; Nash, J A; Nikolich, M B; Panduro Vazquez, W; Chai, X; Charles, M J; Mallik, U; Meyer, N T; Ziegler, V; Cochran, J; Crawley, H B; Dong, L; Eyges, V; Meyer, W T; Prell, S; Rosenberg, E I; Rubin, A E; Gritsan, A V; Fritsch, M; Schott, G; Arnaud, N; Davier, M; Grosdidier, G; Höcker, A; Le Diberder, F; Lepeltier, V; Lutz, A M; Oyanguren, A; Pruvot, S; Rodier, S; Roudeau, P; Schune, M H; Stocchi, A; Wang, W F; Wormser, G; Cheng, C H; Lange, D J; Wright, D M; Chavez, C A; Forster, I J; Fry, J R; Gabathuler, E; Gamet, R; George, K A; Hutchcroft, D E; Payne, D J; Schofield, K C; Touramanis, C; Bevan, A J; Di Lodovico, F; Menges, W; Sacco, R; Brown, C L; Cowan, G; Flaecher, H U; Hopkins, D A; Jackson, P S; McMahon, T R; Ricciardi, S; Salvatore, F; Brown, D N; Davis, C L; Allison, J; Barlow, N R; Barlow, R J; Chia, Y M; Edgar, C L; Kelly, M P; Lafferty, G D; Naisbit, M T; Williams, J C; Yi, J I; Chen, C; Hulsbergen, W D; Jawahery, A; Lae, C K; Roberts, D A; Simi, G; Blaylock, G; Dallapiccola, C; Hertzbach, S S; Li, X; Moore, T B; Saremi, S; Staengle, H; Willocq, S Y; Cowan, R; Koeneke, K; Sciolla, G; Sekula, S J; Spitznagel, M; Taylor, F; Yamamoto, R K; Kim, H; Patel, P M; Robertson, S H; Lazzaro, A; Lombardo, V; Palombo, F; Bauer, J M; Cremaldi, L; Eschenburg, V; Godang, R; Kroeger, R; Reidy, J; Sanders, D A; Summers, D J; Zhao, H W; Brunet, S; Côté, D; Taras, P; Viaud, F B; Nicholson, H; Cavallo, N; De Nardo, G; Del Re, D; Fabozzi, F; Gatto, C; Lista, L; Monorchio, D; Paolucci, P; Piccolo, D; Sciacca, C; Baak, M; Bulten, H; Raven, G; Snoek, H L; Jessop, C P; Losecco, J M; Allmendinger, T; Benelli, G; Gan, K K; Honscheid, K; Hufnagel, D; Jackson, P D; Kagan, H; Kass, R; Pulliam, T; Rahimi, A M; Ter-Antonyan, R; Wong, Q K; Blount, N L; Brau, J; Frey, R; Igonkina, O; Lu, M; Potter, C T; Rahmat, R; Sinev, N B; Strom, D; Strube, J; Torrence, E; Galeazzi, F; Gaz, A; Margoni, M; Morandin, M; Pompili, A; Posocco, M; Rotondo, M; Simonetto, F; Stroili, R; Voci, C; Benayoun, M; Chauveau, J; David, P; Del Buono, L; de la Vaissière, Ch; Hamon, O; Hartfiel, B L; John, M J J; Malclès, J; Ocariz, J; Roos, L; Therin, G; Behera, P K; Gladney, L; Panetta, J; Biasini, M; Covarelli, R; Pioppi, M; Angelini, C; Batignani, G; Bettarini, S; Bucci, F; Calderini, G; Carpinelli, M; Cenci, R; Forti, F; Giorgi, M A; Lusiani, A; Marchiori, G; Mazur, M A; Morganti, M; Neri, N; Rizzo, G; Walsh, J; Haire, M; Judd, D; Wagoner, D E; Biesiada, J; Danielson, N; Elmer, P; Lau, Y P; Lu, C; Olsen, J; Smith, A J S; Telnov, A V; Bellini, F; Cavoto, G; D'Orazio, A; Di Marco, E; Faccini, R; Ferrarotto, F; Ferroni, F; Gaspero, M; Li Gioi, L; Mazzoni, M A; Morganti, S; Piredda, G; Polci, F; Safai Tehrani, F; Voena, C; Ebert, M; Schröder, H; Waldi, R; Adye, T; De Groot, N; Franek, B; Olaiya, E O; Wilson, F F; Emery, S; Gaidot, A; Ganzhur, S F; Hamel de Monchenault, G; Kozanecki, W; Legendre, M; Vasseur, G; Yèche, Ch; Zito, M; Park, W; Purohit, M V; Wilson, J R; Allen, M T; Aston, D; Bartoldus, R; Bechtle, P; Berger, N; Boyarski, A M; Claus, R; Coleman, J P; Convery, M R; Cristinziani, M; Dingfelder, J C; Dong, D; Dorfan, J; Dubois-Felsmann, G P; Dujmic, D; Dunwoodie, W; Field, R C; Glanzman, T; Gowdy, S J; Graham, M T; Halyo, V; Hast, C; Hryn'ova, T; Innes, W R; Kelsey, M H; Kim, P; Kocian, M L; Leith, D W G S; Li, S; Libby, J; Luitz, S; Luth, V; Lynch, H L; Macfarlane, D B; Marsiske, H; Messner, R; Muller, D R; O'grady, C P; Ozcan, V E; Perl, M; Perazzo, A; Ratcliff, B N; Roodman, A; Salnikov, A A; Schindler, R H; Schwiening, J; Snyder, A; Stelzer, J; Su, D; Sullivan, M K; Suzuki, K; Swain, S K; Thompson, J M; Va'vra, J; van Bakel, N; Weaver, M; Weinstein, A J R; Wisniewski, W J; Wittgen, M; Wright, D H; Yarritu, A K; Yi, K; Young, C C; Burchat, P R; Edwards, A J; Majewski, S A; Petersen, B A; Roat, C; Wilden, L; Ahmed, S; Alam, M S; Bula, R; Ernst, J A; Jain, V; Pan, B; Saeed, M A; Wappler, F R; Zain, S B; Bugg, W; Krishnamurthy, M; Spanier, S M; Eckmann, R; Ritchie, J L; Satpathy, A; Schilling, C J; Schwitters, R F; Izen, J M; Kitayama, I; Lou, X C; Ye, S; Bianchi, F; Gallo, F; Gamba, D; Bomben, M; Bosisio, L; Cartaro, C; Cossutti, F; Della Ricca, G; Dittongo, S; Grancagnolo, S; Lanceri, L; Vitale, L; Azzolini, V; Martinez-Vidal, F; Banerjee, Sw; Bhuyan, B; Brown, C M; Fortin, D; Hamano, K; Kowalewski, R; Nugent, I M; Roney, J M; Sobie, R J; Back, J J; Harrison, P F; Latham, T E; Mohanty, G B; Pappagallo, M; Band, H R; Chen, X; Cheng, B; Dasu, S; Datta, M; Eichenbaum, A M; Flood, K T; Hollar, J J; Kutter, P E; Li, H; Liu, R; Mellado, B; Mihalyi, A; Mohapatra, A K; Pan, Y; Pierini, M; Prepost, R; Tan, P; Wu, S L; Yu, Z; Neal, H

    2006-06-16

    Observation of Upsilon(4S) decays to pi(+)pi(-)C and pi(+)pi(-)Upsilon(2S)We present the first measurement of Upsilon(4S) decays to pi(+)pi(-)Upsilon(1S) based on a sample of 230 x 106(4S) mesons collected with the BABAR detector. We measure the product branching fractions Beta(Upsilon(4S) --> pi(+)pi(-)Upsilon(1S)) x BetaUpsilon(1S) --> mu(+)mu(-) = (2.23 +/- 0.25(stat) +/- 0.27(syst))x 10(-6) and Beta(Upsilon(4S) --> pi(+)pi(-)Upsilon(2S) x Beta(Upsilon(2S) --> mu(+)mu(-))=(1.69 +/-0.26(stat) +/- 0.20(syst)) x 10(-)6, from which we derive the partial widths Gamma(Upsilon(4S) --> pi(+)pi(-)Upsilon(1S))=(1.8 +/-0.4) keV and Gamma(Upsilon(4S) --> pi(+)pi(-)Upsilon(2S))=(2.7 +/- 0.8) keV.

  12. Measurement of CP Asymmetries and Branching Fractions in B0 -> pi+ pi-, B0 -> K+ pi-, B0 -> pi0 pi0, B0 -> K0 pi0 and Isospin Analysis of B -> pi pi Decays

    CERN Document Server

    Aubert, B

    2008-01-01

    We present preliminary results of improved measurements of the CP-violating asymmetries and branching fractions in the decays B0 -> pi+ pi-, B0 -> K+ pi-, B0 -> pi0 pi0, and B0 -> K0 pi0. This update includes all data taken at the Y(4S) resonance by the BaBar experiment at the asymmetric PEP-II B-meson factory at SLAC, corresponding to 467 +- 5 million BBbar pairs. We find Spipi = -0.68 +- 0.10 +- 0.03, Cpipi = -0.25 +- 0.08 +- 0.02, AKpi = -0.107 +- 0.016 +0.006-0.004, Cpi0pi0 = -0.43 +- 0.26 +- 0.05, BF(B0 -> pi0 pi0) = (1.83 +- 0.21 +- 0.13) x 10^-6, BF(B0 -> K0 pi0) = (10.1 +- 0.6 +- 0.4) x 10^-6, where the first error is statistical and the second is systematic. We observe CP violation with a significance of 6.7 sigma in B0 -> pi+ pi- and 6.1 sigma in B0 -> K+ pi-. Constraints on the Unitarity Triangle angle alpha are determined from the isospin relation between all B -> pipi rates and asymmetries.

  13. Experimental studies of the $\\pi^+\\pi^-\\pi^+\\pi^-\\pi^0$, $K^+K^-\\pi^+\\pi^-\\pi^0$ and $p\\bar p\\pi^+\\pi^-\\pi^0$ final states produced in $e^+e^-$ annihilation at $\\sqrt{s}=$ 3.773 and 3.650 GeV

    CERN Document Server

    Ablikim, M; Ban, Y; Cai, X; Chen, H F; Chen, H S; Chen, H X; Chen, J C; Jin Chen; Chen, Y B; Chu, Y P; Dai, Y S; Diao, L Y; Deng, Z Y; Dong, Q F; Du, S X; Fang, J; Fang, S S; Fu, C D; Gao, C S; Gao, Y N; Gu, S D; Gu, Y T; Guo, Y N; He, K L; He, M; Heng, Y K; Hou, J; Hu, H M; Hu, J H; Hu, T; Huang, X T; Ji, X B; Jiang, X S; Jiang, X Y; Jiao, J B; Jin, D P; Jin, S; Lai, Y F; Li, G; Li, H B; Li, J; Li, R Y; Li, S M; Li, W D; Li, W G; Li, X L; Li, X N; Li, X Q; Liang, Y F; Liao, H B; Liu, B J; Liu, C X; Liu, F; Fang Liu; Liu, H H; Liu, H M; Liu, J; Liu, J B; Liu, J P; Jian Liu; Liu, Q; Liu, R G; Liu, Z A; Lou, Y C; Lu, F; Lu, G R; Lu, J G; Luo, C L; Ma, F C; Ma, H L; Ma, L L; Ma, Q M; Mao, Z P; Mo, X H; Nie, J; Ping, R G; Qi, N D; Qin, H; Qiu, J F; Ren, Z Y; Rong, G; Ruan, X D; Shan, L Y; Shang, L; Shen, D L; Shen, X Y; Sheng, H Y; Sun, H S; Sun, S S; Sun, Y Z; Sun, Z J; Tang, X; Tong, G L; Wang, D Y; Wang, L; Wang, L L; Wang, L S; Wang, M; Wang, P; Wang, P L; Wang, Y F; Wang, Z; Wang, Z Y; Wang, Zheng; Wei, C L; Wei, D H; Weng, Y; Wu, N; Xia, X M; Xie, X X; Xu, G F; Xu, X P; Xu, Y; Yan, M L; Yang, H X; Yang, Y X; Ye, M H; Ye, Y X; Yu, G W; Yuan, C Z; Yuan, Y; Zang, S L; Zeng, Y; Zhang, B X; Zhang, B Y; Zhang, C C; Zhang, D H; Zhang, H Q; Zhang, H Y; Zhang, J W; Zhang, J Y; Zhang, S H; Zhang, X Y; Zhang, Yiyun; Zhang, Z X; Zhang, Z P; Zhao, D X; Zhao, J W; Zhao, M G; Zhao, P P; Zhao, W R; Zhao, Z G; Zheng, H Q; Zheng, J P; Zheng, Z P; Zhou, L; Zhu, K J; Zhu, Q M; Zhu, Y C; Zhu, Y S; Zhu, Z A; Zhuang, B A; Zhuang, X A; Zou, B S

    2007-01-01

    We report measurements of the observed cross sections for $e^+e^-\\to\\omega \\pi^+\\pi^-$, $\\omega K^+K^-$, $\\omega p\\bar p$, $K^+K^-\\rho^0\\pi^0$, $K^+K^-\\rho^+\\pi^-+c.c.$, $K^{*0}K^-\\pi^+\\pi^0+c.c.$, $K^{*+}K^-\\pi^+\\pi^-+c.c.$, $\\phi\\pi^+\\pi^-\\pi^0$ and $\\Lambda \\bar \\Lambda \\pi^0$ at $\\sqrt s=$ 3.773 and 3.650 GeV. Upper limits (90% C.L.) are given for observed cross sections and for $\\psi(3770)$ decay branching fractions for production of these final states. These measurements are made by analyzing the data sets of 17.3 pb$^{-1}$ collected at $\\sqrt{s}=3.773$ GeV and 6.5 pb$^{-1}$ collected at $\\sqrt{s}=3.650$ GeV with the BES-II detector at the BEPC collider.

  14. Analysis of the pi^+pi^-pi^+pi^- and pi^+pi^0pi^-pi^0 Final States in Quasi-Real Two-Photon Collisions at LEP

    OpenAIRE

    L3 Collaboration

    2006-01-01

    The reactions gamma gamma -> pi^+pi^-pi^+pi^- and gamma gamma -> pi^+pi^0pi^-pi^0 are studied with the L3 detector at LEP in a data sample collected at centre-of-mass energies from 161GeV to 209GeV with a total integrated luminosity of 698/pb. A spin-parity-helicity analysis of the rho^0 rho^0 and rho^+ rho^- systems for two-photon centre-of-mass energies between 1GeV and 3GeV shows the dominance of the spin-parity state 2+ with helicity 2. The contribution of 0+ and 0- spin-parity states is ...

  15. The resonant $\\pi^+\\gamma\\to\\pi^+\\pi^0$ amplitude from Quantum Chromodynamics

    CERN Document Server

    Briceno, Raul A; Edwards, Robert G; Shultz, Christian J; Thomas, Christopher E; Wilson, David J

    2015-01-01

    We present the first ab initio calculation of a radiative transition of a hadronic resonance within Quantum Chromodynamics (QCD). We compute the amplitude for $\\pi\\pi \\to \\pi\\gamma^\\star$, as a function of the energy of the $\\pi\\pi$ pair and the virtuality of the photon, in the kinematic regime where $\\pi\\pi$ couples strongly to the unstable $\\rho$ resonance. This exploratory calculation is performed using a lattice discretization of QCD with quark masses corresponding to $m_\\pi \\approx 400$ MeV. We obtain a description of the energy dependence of the transition amplitude, constrained at 48 kinematic points, that we can analytically continue to the $\\rho$ pole and identify from its residue the $\\rho \\to \\pi\\gamma^\\star$ form-factor.

  16. Non-resonant four-body decay of $B \\to D^- \\pi^+\\pi^+\\pi^- $

    CERN Document Server

    Talebtash, Mohammad Rahim

    2015-01-01

    We calculate the branching ratio of the non-resonant $B \\to D^- \\pi^+\\pi^+\\pi^- $ decay using a simple model based on the framework of the factorization approach. In naive factorization approach, there are only tow tree diagrams for this decay mode. In the first diagram, the matrix element of decay mode is factorized into a $B\\to D$ form factor multiplied by a $3\\pi$ decay constant and in the second diagram, the matrix element is factorized into a $B\\to D\\pi$ form factor multiplied by a $2\\pi$ decay constant, We assume that in the rest frame of B meson, the $D$ meson remains stationary, so we obtain the value $(3.47\\pm0.14)\\times 10^{-3}$ for the branching ration of the $B \\to D^- \\pi^+\\pi^+\\pi^- $ decay mode, while the experimental results are $(3.9\\pm1.9)\\times10^{-3}$.

  17. Observation of CP Violation in B0 -> K+pi- and B0 -> pi+pi-

    CERN Document Server

    Aubert, B; Boutigny, D; Karyotakis, Yu; Lees, J P; Poireau, V; Prudent, X; Tisserand, V; Zghiche, A; Garra Tico, J; Graugès-Pous, E; López, L; Palano, A; Eigen, G; Ofte, I; Stugu, B; Sun, L; Abrams, G S; Battaglia, M; Brown, D N; Button-Shafer, J; Cahn, R N; Groysman, Y; Jacobsen, R G; Kadyk, J A; Kerth, L T; Kolomensky, Yu G; Kukartsev, G; Lopes-Pegna, D; Lynch, G; Mir, L M; Orimoto, T J; Pripstein, M; Roe, N A; Ronan, M T; Tackmann, K; Wenzel, W A; Del Amo-Sánchez, P; Hawkes, C M; Watson, A T; Held, T; Koch, H; Lewandowski, B; Pelizaeus, M; Schröder, T; Steinke, M; Cottingham, W N; Walker, D; Asgeirsson, D J; Çuhadar-Dönszelmann, T; Fulsom, B G; Hearty, C; Knecht, N S; Mattison, T S; McKenna, J A; Khan, A; Saleem, M; Teodorescu, L; Blinov, V E; Bukin, A D; Druzhinin, V P; Golubev, V B; Onuchin, A P; Serednyakov, S I; Skovpen, Yu I; Solodov, E P; Todyshev, K Yu; Bondioli, M; Curry, S; Eschrich, I; Kirkby, D; Lankford, A J; Lund, P; Mandelkern, M A; Martin, E C; Stoker, D P; Abachi, S; Buchanan, C; Foulkes, S D; Gary, J W; Liu, F; Long, O; Shen, B C; Zhang, L; Paar, H P; Rahatlou, S; Sharma, V; Berryhill, J W; Campagnari, C; Cunha, A; Dahmes, B; Hong, T M; Kovalskyi, D; Richman, J D; Beck, T W; Eisner, A M; Flacco, C J; Heusch, C A; Kroseberg, J; Lockman, W S; Schalk, T; Schumm, B A; Seiden, A; Williams, D C; Wilson, M G; Winstrom, L O; Chen, E; Cheng, C H; Dvoretskii, A; Fang, F; Hitlin, D G; Narsky, I; Piatenko, T; Porter, F C; Mancinelli, G; Meadows, B T; Mishra, K; Sokoloff, M D; Blanc, F; Bloom, P C; Chen, S; Ford, W T; Hirschauer, J F; Kreisel, A; Nagel, M; Nauenberg, U; Olivas, A; Smith, J G; Ulmer, K A; Wagner, S R; Zhang, J; Gabareen, A M; Soffer, A; Toki, W H; Wilson, R J; Winklmeier, F; Zeng, Q; Altenburg, D D; Feltresi, E; Hauke, A; Jasper, H; Merkel, J; Petzold, A; Spaan, B; Wacker, K; Brandt, T; Klose, V; Lacker, H M; Mader, W F; Nogowski, R; Schubert, J; Schubert, K R; Schwierz, R; Sundermann, J E; Volk, A; Bernard, D; Bonneaud, G R; Latour, E; Lombardo, V; Thiebaux, C; Verderi, M; Clark, P J; Gradl, W; Muheim, F; Playfer, S; Robertson, A I; Xie, Y; Andreotti, M; Bettoni, D; Bozzi, C; Calabrese, R; Cecchi, A; Cibinetto, G; Franchini, P; Luppi, E; Negrini, M; Petrella, A; Piemontese, L; Prencipe, E; Santoro, V; Anulli, F; Baldini-Ferroli, R; Calcaterra, A; De Sangro, R; Finocchiaro, G; Pacetti, S; Patteri, P; Peruzzi, I M; Piccolo, M; Rama, M; Zallo, A; Buzzo, A; Contri, R; Lo Vetere, M; Macri, M M; Monge, M R; Passaggio, S; Patrignani, C; Robutti, E; Santroni, A; Tosi, S; Chaisanguanthum, K S; Morii, M; Wu, J; Dubitzky, R S; Marks, J; Schenk, S; Uwer, U; Bard, D J; Dauncey, P D; Flack, R L; Nash, J A; Nikolich, M B; Panduro-Vazquez, W; Behera, P K; Chai, X; Charles, M J; Mallik, U; Meyer, N T; Ziegler, V; Cochran, J; Crawley, H B; Dong, L; Eyges, V; Meyer, W T; Prell, S; Rosenberg, E I; Rubin, A E; Gritsan, A V; Guo, Z J; Lae, C K; Denig, A G; Fritsch, M; Schott, G; Arnaud, N; Bequilleux, J; Davier, M; Grosdidier, G; Höcker, A; Lepeltier, V; Le Diberder, F R; Lutz, A M; Pruvot, S; Rodier, S; Roudeau, P; Schune, M H; Serrano, J; Sordini, V; Stocchi, A; Wang, W F; Wormser, G; Lange, D J; Wright, D M; Chavez, C A; Forster, I J; Fry, J R; Gabathuler, E; Gamet, R; Hutchcroft, D E; Payne, D J; Schofield, K C; Touramanis, C; Bevan, A J; George, K A; Di Lodovico, F; Menges, W; Sacco, R; Cowan, G; Flächer, H U; Hopkins, D A; Jackson, P S; McMahon, T R; Salvatore, F; Wren, A C; Davis, C L; Allison, J; Barlow, N R; Barlow, R J; Chia, Y M; Edgar, C L; Lafferty, G D; West, T J; Yi, J I; Anderson, J; Chen, C; Jawahery, A; Roberts, D A; Simi, G; Tuggle, J M; Blaylock, G; Dallapiccola, C; Hertzbach, S S; Li, X; Moore, T B; Salvati, E; Saremi, S; Cowan, R; Fisher, P H; Sciolla, G; Sekula, S J; Spitznagel, M; Taylor, F; Yamamoto, R K; Mclachlin, S E; Patel, P M; Robertson, S H; Lazzaro, A; Palombo, F; Bauer, J M; Cremaldi, L; Eschenburg, V; Godang, R; Kroeger, R; Sanders, D A; Summers, D J; Zhao, H W; Brunet, S; Côté, D; Simard, M; Taras, P; Viaud, F B; Nicholson, H; De Nardo, Gallieno; Fabozzi, F; Lista, L; Monorchio, D; Sciacca, C; Baak, M A; Raven, G; Snoek, H L; Jessop, C P; LoSecco, J M; Benelli, G; Corwin, L A; Gan, K K; Honscheid, K; Hufnagel, D; Kagan, H; Kass, R; Morris, J P; Rahimi, A M; Regensburger, J J; Ter-Antonian, R; Wong, Q K; Blount, N L; Brau, J E; Frey, R; Igonkina, O; Kolb, J A; Lu, M; Rahmat, R; Sinev, N B; Strom, D; Strube, J; Torrence, E; Gagliardi, N; Gaz, A; Margoni, M; Morandin, M; Pompili, A; Posocco, M; Rotondo, M; Simonetto, F; Stroili, R; Voci, C; Ben-Haim, E; Briand, H; Chauveau, J; David, P; Del Buono, L; De La Vaissière, C; Hamon, O; Hartfiel, B L; Leruste, P; Malcles, J; Ocariz, J; Pérez, A; Gladney, L; Biasini, M; Covarelli, R; Manoni, E; Angelini, C; Batignani, G; Bettarini, S; Calderini, G; Carpinelli, M; Cenci, R; Cervelli, A; Forti, F; Giorgi, M A; Lusiani, A; Marchiori, G; Mazur, M A; Morganti, M; Neri, N; Paoloni, E; Rizzo, G; Walsh, J J; Haire, M; Biesiada, J; Elmer, P; Lau, Y P; Lü, C; Olsen, J; Smith, A J S; Telnov, A V; Baracchini, E; Bellini, F; Cavoto, G; D'Orazio, A; Del Re, D; Di, E; Marco; Faccini, R; Ferrarotto, F; Ferroni, F; Gaspero, M; Jackson, P D; Li Gioi, L; Mazzoni, M A; Morganti, S; Piredda, G; Polci, F; Renga, F; Voena, C; Ebert, M; Schröder, H; Waldi, R; Adye, T; Castelli, G; Franek, B; Olaiya, E O; Ricciardi, S; Röthel, W; Wilson, F F; Aleksan, R; Emery, S; Escalier, M; Gaidot, A; Ganzhur, S F; Hamel de Monchenault, G; Kozanecki, W; Legendre, M; Vasseur, G; Yéche, C; Zito, M; Chen, X R; Liu, H; Park, W; Purohit, M V; Wilson, J R; Allen, M T; Aston, D; Bartoldus, R; Bechtle, P; Berger, N; Claus, R; Coleman, J P; Convery, M R; Dingfelder, J C; Dorfan, J; Dubois-Felsmann, G P; Dujmic, D; Dunwoodie, W; Field, R C; Glanzman, T; Gowdy, S J; Graham, M T; Grenier, P; Hast, C; Hrynóva, T; Innes, W R; Kelsey, M H; Kim, H; Kim, P; Leith, D W G S; Li, S; Luitz, S; Lüth, V; Lynch, H L; MacFarlane, D B; Marsiske, H; Messner, R; Müller, D R; O'Grady, C P; Perazzo, A; Perl, M; Pulliam, T; Ratcliff, B N; Roodman, A; Salnikov, A A; Schindler, R H; Schwiening, J; Snyder, A; Stelzer, J; Su, D; Sullivan, M K; Suzuki, K; Swain, S K; Thompson, J M; Vavra, J; Van Bakel, N; Wagner, A P; Weaver, M; Wisniewski, W J; Wittgen, M; Wright, D H; Yarritu, A K; Yi, K; Young, C C; Burchat, P R; Edwards, A J; Majewski, S A; Petersen, B A; Wilden, L; Ahmed, S; Alam, M S; Bula, R; Ernst, J A; Jain, V; Pan, B; Saeed, M A; Wappler, F R; Zain, S B; Bugg, W; Krishnamurthy, M; Spanier, S M; Eckmann, R; Ritchie, J L; Ruland, A M; Schilling, C J; Schwitters, R F; Izen, J M; Lou, X C; Ye, S; Bianchi, F; Gallo, F; Gamba, D; Pelliccioni, M; Bomben, M; Bosisio, L; Cartaro, C; Cossutti, F; Della Ricca, G; Lanceri, L; Vitale, L; Azzolini, V; Lopez-March, N; Martínez-Vidal, F; Milanes, D A; Oyanguren, A; Albert, J; Banerjee, Sw; Bhuyan, B; Hamano, K; Kowalewski, R V; Nugent, I M; Roney, J M; Sobie, R J; Back, J J; Harrison, P F; Latham, T E; Mohanty, G B; Pappagallo, M; Band, H R; Chen, X; Dasu, S; Flood, K T; Hollar, J J; Kutter, P E; Pan, Y; Pierini, M; Prepost, R; Wu, S L; Yu, Z; Neal, H; al, et

    2007-01-01

    We report observations of CP violation in the decays B0 -> K+pi- and B0 -> pi+pi- in a sample of 383 million Y4S -> BBbar events. We find 4372 +/- pi+82 B0 -> K+pi- decays and measure the direct CP-violating charge asymmetry -> K+Akpi = -0.107 +/- 0.018 (stat) +0.007-0.004 (syst), which excludes the CP-conserving hypothesis with a significance of 5.5 standard deviations. In the same sample we find 1139 +/- 49 B0 -> pi+pi- decays and measure the CP-violating asymmetries Spipi = -0.60 +/- 0.11 (stat) +/- 0.03 (syst) and Cpipi = -0.21 +/- 0.09 (stat) +/- 0.02 (syst). CP conservation in B0 -> pi+pi- (Spipi=Cpipi=0) is excluded at a confidence level 1-C.L. = 8 * 10^{-8}, corresponding to 5.4 standard deviations.

  18. Measurement of the Ratios of Branching Fractions B(Bs -> Ds pi pi pi) / B(Bd -> Dd pi pi pi) and B(Bs -> Ds pi) / B(Bd -> Dd pi)

    Energy Technology Data Exchange (ETDEWEB)

    Abulencia, A.; /Illinois U., Urbana; Adelman, J.; /Chicago U.; Affolder, T.; /UC, Santa Barbara; Akimoto, T.; /Tsukuba U.; Albrow, M.G.; /Fermilab; Ambrose, D.; /Fermilab; Amerio, S.; /Padua U.; Amidei, D.; /Michigan U.; Anastassov, A.; /Rutgers U., Piscataway; Anikeev, K.; /Fermilab; Annovi, A.; /Frascati /Taiwan, Inst. Phys.

    2006-10-01

    Using 355 pb{sup -1} of data collected by the CDF II detector in p{bar p} collisions at {radical}s = 1.96 TeV at the Fermilab Tevatron, they study the fully reconstructed hadronic decays B{sub (s)}{sup 0} {yields} D{sub (s)}{sup -}{pi}{sup +} and B{sub (s)}{sup 0} {yields} D{sub (s)}{sup -} {pi}{sup +}{pi}{sup +}{pi}{sup -}. They present the first measurement of the ratio of branching fractions {Beta}(B{sub s}{sup 0} {yields} D{sub s}{sup -}{pi}{sup +}{pi}{sup +}{pi}{sup -})/{Beta}(B{sup 0} {yields} D{sup -} {pi}{sup +}{pi}{sup +}{pi}{sup -}) = 1.05 {+-} 0.10(stat.) {+-} 0.22(syst.). They also update their measurement of {Beta}(B{sub s}{sup 0} {yields} D{sub s}{sup -} {pi}{sup +})/{Beta}(B{sup 0} {yields} D{sup -} {pi}{sup +}) to 1.13 {+-} 0.08(stat.) {+-} 0.23(syst.) improving the statistical uncertainty by more than a factor of two. They find {Beta}(B{sub s}{sup 0} {yields} D{sub s}{sup -} {pi}{sup +}) = [3.8 {+-} 0.3(stat.) {+-} 1.3(syst.)] x 10{sup -3} and {Beta}(B{sub s}{sup 0} {yields} D{sub s}{sup -} {pi}{sup +}{pi}{sup +}{pi}{sup -}) = [8.4 {+-} 0.8(stat.) {+-} 3.2(syst.)] x 10{sup -3}.

  19. Observation of a cusp-like structure in the $\\pi^{0}\\pi^{0}$ invariant mass distribution from $K^{+-} \\to \\pi^{+-}\\pi^{0}\\pi^{0}$ decay and determination of the $\\pi\\pi$ scattering lengths

    CERN Document Server

    Batley, J Richard; Arcidiacono, R; Baldini, W; Balev, S; Behler, M; Biino, C; Bizzeti, A; Bloch-Devaux, B; Bocquet, G; Cabibbo, Nicola; Calvetti, M; Cartiglia, N; Ceccucci, A; Celeghini, E; Cenci, P; Cerri, C; Cheshkov, C; Chèze, J B; Clemencic, M; Collazuol, G; Costantini, F; Cotta-Ramusino, A; Coward, D; Cundy, Donald C; Dabrowski, A; Dalpiaz, P; Damiani, C; De Beer, M; Derré, J; Di Lella, Luigi; Dibon, Heinz; Doble, Niels T; Eppard, K; Falaleev, V; Fantechi, R; Fidecaro, Maria; Fiorini, L; Fiorini, M; Fonseca-Martin, T; Frabetti, P L; Gatignon, L; Gianoli, A; Giudici, Sergio; Gonidec, A; Goudzovski, E; Goy-Lopez, S; Holder, M; Iacopini, E; Imbergamo, E; Jeitler, Manfred; Kekelidze, V D; Khristov, P Z; Kleinknecht, K; Kozhuharov, V; Kubischta, Werner; Lamanna, G; Lazzeroni, Cristina; Lenti, M; Litov, L; Madigozhin, D T; Maier, A; Mannelli, I; Marchetto, F; Marel, Gérard; Marinova, E; Markytan, Manfred; Marouelli, P; Martelli, F; Martini, M; Masetti, L; Mazzucato, E; Michetti, A; Mikulec, I; Molokanova, N A; Monnier, E; Moosbrugger, U; Morales-Morales, C; Munday, D J; Neuhofer, G; Norton, A; Patel, M; Pepé, M; Peters, A; Petrucci, F; Petrucci, M C; Peyaud, B; Piccini, M; Pierazzini, G M; Polenkevich, I; Potrebenikov, Yu K; Raggi, M; Renk, B; Rubin, P; Ruggiero, G; Savrié, M; Scarpa, M; Shieh, M; Slater, M W; Sozzi, M; Stoynev, S; Swallow, E; Szleper, M; Valdata-Nappi, M; Vallage, B; Velasco, M; Veltri, M; Wache, M; Wahl, H; Walker, A; Wanke, R; Widhalm, L; Winhart, A; Winston, R; Wood, M D; Wotton, S A; Zinchenko, A I; Ziolkowski, M

    2006-01-01

    We report the results from a study of ~23 Million K+- ==> pi+- pizero pizero decays recorded by the NA48/2 experiment at the CERN SPS, showing an anomaly in the pizero pizero invariant mass distribution in the region around 2m+, where m+ is the charged pion mass. This anomaly, never observed in previous experiments, can be interpreted as an effect due mainly to the final state charge exchange scattering process pi+ pi- ==> pizero pizero in K+- ==> pi+- pi+ pi- decay. It provides a precise determination of a0 - a2, the difference between the pi-pi scattering lengths in the isospin I=0 and I=2 states.

  20. Precision measurement of the branching fractions of J/psi -> pi+pi-pi0 and psi' -> pi+pi-pi0

    CERN Document Server

    Ablikim, M; Ambrose, D J; An, F F; An, Q; An, Z H; Bai, J Z; Ferroli, R B F Baldini; Ban, Y; Becker, J; Berger, N; Bertani, M B; Bian, J M; Boger, E; Bondarenko, O; Boyko, I; Briere, R A; Bytev, V; Cai, X; Calcaterra, A C; Cao, G F; Chang, J F; Chelkov, G; Chen, G; Chen, H S; Chen, J C; Chen, M L; Chen, S J; Chen, Y; Chen, Y B; Cheng, H P; Chu, Y P; Cronin-Hennessy, D; Dai, H L; Dai, J P; Dedovich, D; Deng, Z Y; Denig, G; Denysenko, I; Destefanis, M; Ding, W M Ding; Ding, Y; Dong, L Y; Dong, M Y; Du, S X; Fang, J; Fang, S S; Fava, L; Feldbauer, F; Feng, C Q; Fu, C D; Fu, J L; Gao, Y; Geng, C; Goetzen, K; Gong, W X; Greco, M; Gu, M H; Gu, Y T; Guan, Y H; Guo, A Q; Guo, L B; Guo, Y P; Han, Y L; Hao, X Q; Harris, F A; He, K L; He, M; He, Z Y; Held, T; Heng, Y K; Hou, Z L; Hu, H M; Hu, J F; Hu, T; Huang, B; Huang, G M; Huang, J S; Huang, X T; Huang, Y P; Hussain, T; Ji, C S; Ji, Q; Ji, X B; Ji, X L; Jia, L K; Jiang, L L; Jiang, X S; Jiao, J B; Jiao, Z; Jin, D P; Jin, S; Jing, F F; Kalantar-Nayestanaki, N; Kavatsyuk, M; Kuehn, W; Lai, W; Lange, J S; Leung, J K C; Li, C H; Li, Cheng; Li, Cui; Li, D M; Li, F; Li, G; Li, H B; Li, J C; Li, K; Li, Lei; Li, N B; Li, Q J; Li, S L; Li, W D; Li, W G; Li, X L; Li, X N; Li, X Q; Li, X R; Li, Z B; Liang, H; Liang, Y F; Liang, Y T; Liao, G R; Liao, X T; Liu, B J; Liu, B J; Liu, C L; Liu, C X; Liu, C Y; Liu, F H; Liu, Fang; Liu, Feng; Liu, H; Liu, H B; Liu, H H; Liu, H M; Liu, H W; Liu, J P; Liu, K; Liu, K; Liu, K Y; Liu, S B; Liu, X; Liu, X H; Liu, Y B; Liu, Yong; Liu, Z A; Liu, Zhiqiang; Liu, Zhiqing; Loehner, H; Lu, G R; Lu, H J; Lu, J G; Lu, Q W; Lu, X R; Lu, Y P; Luo, C L; Luo, M X; Luo, T; Luo, X L; Lv, M; Ma, C L; Ma, F C; Ma, H L; Ma, Q M; Ma, S; Ma, T; Ma, X Y; Maas, F E; Maggiora, M; Malik, Q A; Mao, H; Mao, Y J; Mao, Z P; Messchendorp, J G; Min, J; Min, T J; Mitchell, R E; Mo, X H; Motzko, C; Muchnoi, N Yu; Nefedov, Y; Nikolaev, I B; Ning, Z; Olsen, S L; Ouyang, Q; Pacetti, S P; Park, J W; Pelizaeus, M; Peters, K; Ping, J L; Ping, R G; Poling, R; Pun, C S J; Qi, M; Qian, S; Qiao, C F; Qin, X S; Qin, Y; Qin, Z H; Qiu, J F; Rashid, K H; Rong, G; Ruan, X D; Sarantsev, A; Schulze, J; Shao, M; Shen, C P; Shen, X Y; Sheng, H Y; Shepherd, M R; Song, X Y; Spataro, S; Spruck, B; Sun, D H; Sun, G X; Sun, J F; Sun, S S; Sun, X D; Sun, Y J; Sun, Y Z; Sun, Z J; Sun, Z T; Tang, C J; Tang, X; Thorndike, E H; Tian, H L; Toth, D; Ulrich, M U; Varner, G S; Wang, B; Wang, B Q; Wang, K; Wang, L L; Wang, L S; Wang, M; Wang, P; Wang, P L; Wang, Q; Wang, Q J; Wang, S G; Wang, X F; Wang, X L; Wang, Y D; Wang, Y F; Wang, Y Q; Wang, Z; Wang, Z G; Wang, Z Y; Wei, D H; Wen, Q G; Wen, S P; Werner, M W; Wiedner, U; Wu, L H; Wu, N; Wu, S X; Wu, W; Wu, Z; Xia, L G; Xiao, Z J; Xie, Y G; Xiu, Q L; Xu, G F; Xu, G M; Xu, H; Xu, Q J; Xu, X P; Xu, Y; Xu, Z R; Xue, F; Xue, Z; Yan, L; Yan, W B; Yan, Y H; Yang, H X; Yang, T; Yang, Y; Yang, Y X; Ye, H; Ye, M; Ye, M H; Yu, B X; Yu, C X; Yu, J S; Yu, S P; Yuan, C Z; Yuan, W L; Yuan, Y; Zafar, A A; Zallo, A Z; Zeng, Y; Zhang, B X; Zhang, B Y; Zhang, C C; Zhang, D H; Zhang, H H; Zhang, H Y; Zhang, J; Zhang, J Q; Zhang, J W; Zhang, J Y; Zhang, J Z; Zhang, L; Zhang, S H; Zhang, T R; Zhang, X J; Zhang, X Y; Zhang, Y; Zhang, Y H; Zhang, Y S; Zhang, Z P; Zhang, Z Y; Zhao, G; Zhao, H S; Zhao, Jingwei; Zhao, K X; Zhao, Lei; Zhao, Ling; Zhao, M G; Zhao, Q; Zhao, S J; Zhao, T C; Zhao, X H; Zhao, Y B; Zhao, Z G; Zhemchugov, A; Zheng, B; Zheng, J P; Zheng, Y H; Zheng, Z P; Zhong, B; Zhong, J; Zhou, L; Zhou, X K; Zhou, X R; Zhu, C; Zhu, K; Zhu, K J; Zhu, S H; Zhu, X L; Zhu, X W; Zhu, Y M; Zhu, Y S; Zhu, Z A; Zhuang, J; Zou, B S; Zou, J H; Zuo, J X

    2012-01-01

    We study the decays of the J/psi and psi' mesons to pi+pi-pi0 using data samples at both resonances collected with the BES III detector in 2009. We measure the corresponding branching fractions with unprecedented precision and provide mass spectra and Dalitz plots. The branching fraction for J/psi -> pi+pi-pi0 is determined to be (2.137 +- 0.004 (stat.) +0.058-0.056 (syst.) +0.027-0.026 (norm.))*10-2, and the branching fraction for psi' -> pi+pi-pi0 is measured as (2.14 +- 0.03 (stat.) +0.08-0.07 (syst.) +0.09-0.08 (norm.))*10-4. The J/psi decay is found to be dominated by an intermediate rho(770) state, whereas the psi' decay is dominated by di-pion masses around 2.2 GeV/c2, leading to strikingly different Dalitz distributions.

  1. $B \\to \\pi\\pi, K \\pi$ Decays in QCD Improved Factorization Approach

    CERN Document Server

    Muta, T; Yang Mao Zhi; Yang, Y D; Muta, Taizo; Sugamoto, Akio; Yang, Mao-Zhi; Yang, Ya-Dong

    2000-01-01

    Motivated by recent measurements, we investigate $B\\to \\pi \\pi, K \\pi$ decay modes in the framework of QCD improved factorization, which was recently proposed by Beneke et. al. We find that all the measured branching ratios are well accommodated in the reasonable parameter space except for $B\\to K^0 \\pi^0 $. We also discuss in detail the strong penguin contributions and the ${\\cal O}(\\alpha_s)$ corrections to the chirally enhanced terms. We find that the weak phase $\\gamma$ lies in the region $120^{\\circ}<\\gamma<240^{\\circ}$, which is mainly constrained by $B\\to \\pi^- \\pi^+ $.

  2. The History of Delta Pi Epsilon, 1936-1986--A Golden Past: Foundation for the Future.

    Science.gov (United States)

    Crank, Floyd L.

    1986-01-01

    The history of Delta Pi Epsilon (1936-1986) is presented, citing such highlights as research awards, new chapters, publications, annual conferences, organization of new committees, and conventions. Facts about Delta Pi Epsilon and a list of references are included also. (CT)

  3. Determination of the S-Wave Pi Pi Scattering Lengths From a Study of K - to Pi - Pi0 Pi0 Decays

    Energy Technology Data Exchange (ETDEWEB)

    Batley, J.R.; Culling, A.J.; Kalmus, G.; /Cambridge U.; Lazzeroni, C.; /Cambridge U. /Birmingham U.; Munday, D.J.; /Cambridge U.; Slater, M.W.; /Cambridge U. /Birmingham U.; Wotton, S.A.; /Cambridge U.; Arcidiacono, R.; /CERN /Turin U. /INFN, Turin; Bocquet, G.; /CERN; Cabibbo, N.; /CERN /Rome U. /INFN, Rome; Ceccucci, A.; /CERN; Cundy, D.; /CERN /Turin, Cosmo-Geofisica Lab; Falaleev, V.; Fidecaro, M.; Gatignon, L.; Gonidec, A.; Kubischta, W.; /CERN; Norton, A.; /CERN /Ferrara U. /INFN, Ferrara; Maier, A.; Patel, M.; Peters, A.; /CERN /Dubna, JINR /Pisa, Scuola Normale Superiore /Dubna, JINR /Dubna, JINR /Birmingham U. /Dubna, JINR /CERN /Dubna, JINR /Dubna, JINR /Sofiya U. /Dubna, JINR /Dubna, JINR /Dubna, JINR /INFN, Perugia /Dubna, JINR /Dubna, JINR /Northwestern U. /Dubna, JINR /Chicago U., EFI /Marseille, CPPM /Chicago U., EFI /Edinburgh U. /George Mason U. /Edinburgh U. /Ferrara U. /INFN, Ferrara /Florence U. /INFN, Florence /Florence U. /INFN, Florence /Pisa, Scuola Normale Superiore /INFN, Florence /Modena U. /INFN, Florence /INFN, Florence /Urbino U. /INFN, Florence /Mainz U., Inst. Phys. /Bonn U. /Mainz U., Inst. Phys. /Northwestern U. /SLAC /Northwestern U. /Northwestern U. /Royal Holloway, U. of London /Northwestern U. /Northwestern U. /UCLA /Perugia U. /INFN, Perugia /Frascati /Perugia U. /INFN, Perugia /INFN, Perugia /INFN, Pisa /Pisa, Scuola Normale Superiore /INFN, Pisa /Pisa U. /INFN, Pisa /Pisa U. /INFN, Pisa /Barcelona, IFAE /Pisa U. /INFN, Pisa /DSM, DAPNIA, Saclay /DSM, DAPNIA, Saclay /CERN /DSM, DAPNIA, Saclay /Siegen U. /INFN, Turin /Turin U. /INFN, Turin /Bern U. /Turin U. /INFN, Turin /CERN /Turin U. /INFN, Turin /Madrid, CIEMAT /Vienna, OAW

    2012-03-29

    We report the results from a study of the full sample of {approx}6.031 x 10{sup 7} K{sup {+-}} {yields} {pi}{sup {+-}}{pi}{sup 0}{pi}{sup 0} decays recorded by the NA48/2 experiment at the CERN SPS. As first observed in this experiment, the {pi}{sup 0}{pi}{sup 0} invariant mass (M{sub 00}) distribution shows a cusp-like anomaly in the region around M{sub 00} = 2m{sub +}, where m{sub +} is the charged pion mass. This anomaly has been interpreted as an effect due mainly to the final state charge exchange scattering process {pi}{sup +}{pi}{sup -} {yields} {pi}{sup 0}{pi}{sup 0} in K{sup {+-}} {yields} {pi}{sup {+-}}{pi}{sup +}{pi}{sup -} decay. Fits to the M{sub 00} distribution using two different theoretical formulations provide the presently most precise determination of a{sub 0} - a{sub 2}, the difference between the {pi}{pi} S-wave scattering lengths in the isospin I = 0 and I = 2 states. Higher-order {pi}{pi} rescattering terms, included in the two formulations, allow also an independent, though less precise, determination of a{sub 2}.

  4. Determination of the S-wave $\\pi \\pi$ scattering lengths from a study of $K^{\\pm} \\to \\pi^{\\pm} \\pi^{0} \\pi^{0}$ decays

    CERN Document Server

    Batley, J R; Kalmus, G; Lazzeroni, C; Munday, D J; Slater, M W; Wotton, S A; Arcidiacono, R; Bocquet, G; Cabibbo, N; Ceccucci, A; Cundy, D; Falaleev, V; Fidecaro, Maria; Gatignon, L; Gonidec, A; Kubischta, W; Norton, A; Maier, A; Patel, M; Peters, A; Balev, S; Frabetti, P L; Goudzovski, E; Khristov, P Z; Kekelidze, V; Kozhuharov, V; Litov, L; Madigozhin, D T; Marinova, E; Molokanova, N; Polenkevich, I; Potrebenikov, Yu; Stoynev, S; Zinchenko, A; Monnier, E; Swallow, E; Winston, R; Rubin, P; Walker, A; Baldini, W; Cotta-Ramusino, A; Dalpiaz, P; Damiani, C; Fiorini, M; Gianoli, A; Martini, M; Petrucci, F; Savrié, M; Scarpa, M; Wahl, H; Calvetti, M; Iacopini, E; Ruggiero, G; Bizzeti, A; Lenti, M; Veltri, M; Behler, M; Eppard, K; Kleinknecht, K; Marouelli, P; Masetti, L; Moosbrugger, U; Morales-Morales, C; Renk, B; Wache, M; Wanke, R; Winhart, A; Coward, D; Dabrowski, A; Fonseca-Martin, T; Shieh, M; Szleper, M; Velasco, M; Wood, M D; Anzivino, G; Imbergamo, E; Nappi, A; Piccini, M; Raggi, M; Valdata-Nappi, M; Cenci, P; Pepé, M; Pettrucci, M C; Cerri, C; Fantechi, R; Collazuol, G; Di Lella, L; Lamanna, G; Mannelli, I; Michetti, A; Costantini, F; Doble, N; Fiorini, L; Giudici, S; Pierazzini, G; Sozzi, M; Venditti, S; Bloch-Devaux, B; Cheshkov, C; Chèze, J B; De Beer, M; Derré, J; Marel, G; Mazzucato, E; Peyaud, B; Vallage, B; Holder, M; Ziolkowski, M; Bifani, S; Biino, C; Cartiglia, N; Marchetto, F; Bifani, S; Clemencic, M; Goy-Lopez, S; Dibon, H; Jeitler, M; Markytan, M; Mikulec, I; Neuhofer, G; Widhalm, L

    2009-01-01

    We report the results from a study of the full sample of $~6.031 x 10^{7} K^{\\pm} \\to \\pi^{\\pm} \\pi^{0} \\pi^{0}$ decays recorded by the NA48/2 experiment at the CERN SPS. As first observed in this experiment, the $\\pi^{0} \\pi^{0}$ invariant mass (M_00) distribution shows a cusp-like anomaly in the region around $M_{00} = 2m_{+}$, where m_{+} is the charged pion mass. This anomaly has been interpreted as an effect due mainly to the final state charge exchange scattering process $\\pi^{+}\\pi^{-} \\to \\pi^{0} \\pi^{0}$ in $K^{\\pm} \\to \\pi^{\\pm} \\pi^{+} \\pi^{-}$ decay. Fits to the M_{00} distribution using two different theoretical models provide the presently most precise determination of $a_{0}-a_{2}$, the difference between the pi pi S-wave scattering lengths in the isospin I = 0 and I = 2 states. Higher-order pi pi rescattering terms, included in the two models, allow also an independent, though less precise, determination of a_2.

  5. Observation of $\\Upsilon(4S) decays to $\\pi^+pi^-\\Upsilon(1S)$ and $\\pi^+pi^-\\Upsilon(2S)

    CERN Document Server

    Aubert, B; Bóna, M; Boutigny, D; Couderc, F; Karyotakis, Yu; Lees, J P; Poireau, V; Tisserand, V; Zghiche, A; Graugès-Pous, E; Palano, A; Chen, J C; Qi, N D; Rong, G; Wang, P; Zhu, Y S; Eigen, G; Ofte, I; Stugu, B; Abrams, G S; Battaglia, M; Brown, D N; Button-Shafer, J; Cahn, R N; Charles, E; Gill, M S; Groysman, Y; Jacobsen, R G; Kadyk, J A; Kerth, L T; Kolomensky, Yu G; Kukartsev, G; Lynch, G; Mir, L M; Oddone, P J; Orimoto, T J; Pripstein, M; Roe, N A; Ronan, M T; Wenzel, W A; Barrett, M; Ford, K E; Harrison, T J; Hart, A J; Hawkes, C M; Morgan, S E; Watson, A T; Goetzen, K; Held, T; Koch, H; Lewandowski, B; Pelizaeus, M; Peters, K; Schröder, T; Steinke, M; Boyd, J T; Burke, J P; Cottingham, W N; Walker, D; Çuhadar-Dönszelmann, T; Fulsom, B G; Hearty, C; Knecht, N S; Mattison, T S; McKenna, J A; Khan, A; Kyberd, P; Saleem, M; Teodorescu, L; Blinov, V E; Bukin, A D; Druzhinin, V P; Golubev, V B; Onuchin, A P; Serednyakov, S I; Skovpen, Yu I; Solodov, E P; Todyshev, K Yu; Best, D S; Bondioli, M; Bruinsma, M; Chao, M; Curry, S; Eschrich, I; Kirkby, D; Lankford, A J; Lund, P; Mandelkern, M A; Mommsen, R K; Röthel, W; Stoker, D P; Abachi, S; Buchanan, C; Foulkes, S D; Gary, J W; Long, O; Shen, B C; Wang, K; Zhang, L; Hadavand, H K; Hill, E J; Paar, H P; Rahatlou, S; Sharma, V; Berryhill, J W; Campagnari, C; Cunha, A; Dahmes, B; Hong, T M; Kovalskyi, D; Richman, J D; Beck, T W; Eisner, A M; Flacco, C J; Heusch, C A; Kroseberg, J; Lockman, W S; Nesom, G; Schalk, T; Schumm, B A; Seiden, A; Spradlin, P; Williams, D C; Wilson, M G; Albert, J; Chen, E; Dvoretskii, A; Hitlin, D G; Narsky, I; Piatenko, T; Porter, F C; Ryd, A; Samuel, A; Andreassen, R; Mancinelli, G; Meadows, B T; Sokoloff, M D; Blanc, F; Bloom, P C; Chen, S; Ford, W T; Hirschauer, J F; Kreisel, A; Nauenberg, U; Olivas, A; Ruddick, W O; Smith, J G; Ulmer, K A; Wagner, S R; Zhang, J; Chen, A; Eckhart, E A; Soffer, A; Toki, W H; Wilson, R J; Winklmeier, F; Zeng, Q; Altenburg, D D; Feltresi, E; Hauke, A; Jasper, H; Spaan, B; Brandt, T; Klose, V; Lacker, H M; Mader, W F; Nogowski, R; Petzold, A; Schubert, J; Schubert, K R; Schwierz, R; Sundermann, J E; Volk, A; Bernard, D; Bonneaud, G R; Grenier, P; Latour, E; Thiebaux, C; Verderi, M; Bard, D J; Clark, P J; Gradl, W; Muheim, F; Playfer, S; Robertson, A I; Xie, Y; Andreotti, M; Bettoni, D; Bozzi, C; Calabrese, R; Cibinetto, G; Luppi, E; Negrini, M; Petrella, A; Piemontese, L; Prencipe, E; Anulli, F; Baldini-Ferroli, R; Calcaterra, A; De Sangro, R; Finocchiaro, G; Pacetti, S; Patteri, P; Peruzzi, I M; Piccolo, M; Rama, M; Zallo, A; Buzzo, A; Capra, R; Contri, R; Lo Vetere, M; Macri, M M; Monge, M R; Passaggio, S; Patrignani, C; Robutti, E; Santroni, A; Tosi, S; Brandenburg, G; Chaisanguanthum, K S; Morii, M; Wu, J; Dubitzky, R S; Marks, J; Schenk, S; Uwer, U; Bhimji, W; Bowerman, D A; Dauncey, P D; Egede, U; Flack, R L; Gaillard, J R; Nash, J A; Nikolich, M B; Panduro-Vazquez, W; Chai, X; Charles, M J; Mallik, U; Meyer, N T; Ziegler, V; Cochran, J; Crawley, H B; Dong, L; Eyges, V; Meyer, W T; Prell, S; Rosenberg, E I; Rubin, A E; Gritsan, A V; Fritsch, M; Schott, G; Arnaud, N; Davier, M; Grosdidier, G; Höcker, A; Le Diberder, F R; Lepeltier, V; Lutz, A M; Oyanguren, A; Pruvot, S; Rodier, S; Roudeau, P; Schune, M H; Stocchi, A; Wang, W F; Wormser, G; Cheng, C H; Lange, D J; Wright, D M; Chavez, C A; Forster, I J; Fry, J R; Gabathuler, E; Gamet, R; George, K A; Hutchcroft, D E; Payne, D J; Schofield, K C; Touramanis, C; Bevan, A J; Di Lodovico, F; Menges, W; Sacco, R; Brown, C L; Cowan, G; Flächer, H U; Hopkins, D A; Jackson, P S; McMahon, T R; Ricciardi, S; Salvatore, F; Davis, C L; Allison, J; Barlow, N R; Barlow, R J; Chia, Y M; Edgar, C L; Kelly, M P; Lafferty, G D; Naisbit, M T; Williams, J C; Yi, J I; Chen, C; Hulsbergen, W D; Jawahery, A; Lae, C K; Roberts, D A; Simi, G; Blaylock, G; Dallapiccola, C; Hertzbach, S S; Li, X; Moore, T B; Saremi, S; Stängle, H; Willocq, S Y; Cowan, R; Koeneke, K; Sciolla, G; Sekula, S J; Spitznagel, M; Taylor, F; Yamamoto, R K; Kim, H; Patel, P M; Robertson, S H; Lazzaro, A; Lombardo, V; Palombo, F; Bauer, J M; Cremaldi, L; Eschenburg, V; Godang, R; Kroeger, R; Reidy, J; Sanders, D A; Summers, D J; Zhao, H W; Brunet, S; Côté, D; Taras, P; Viaud, F B; Nicholson, H; Cavallo, N; De Nardo, Gallieno; Del Re, D; Fabozzi, F; Gatto, C; Lista, L; Monorchio, D; Paolucci, P; Piccolo, D; Sciacca, C; Baak, M; Bulten, H; Raven, G; Snoek, H L; Jessop, C P; LoSecco, J M; Allmendinger, T; Benelli, G; Gan, K K; Honscheid, K; Hufnagel, D; Jackson, P D; Kagan, H; Kass, R; Pulliam, T; Rahimi, A M; Ter-Antonian, R; Wong, Q K; Blount, N L; Brau, J E; Frey, R; Igonkina, O; Lu, M; Potter, C T; Rahmat, R; Sinev, N B; Strom, D; Strube, J; Torrence, E; Galeazzi, F; Gaz, A; Margoni, M; Morandin, M; Pompili, A; Posocco, M; Rotondo, M; Simonetto, F; Stroili, R; Voci, C; Benayoun, M; Chauveau, J; David, P; Del Buono, L; La Vaissière, C de; Hamon, O; Hartfiel, B L; John, M J J; Malcles, J; Ocariz, J; Roos, L; Therin, G; Behera, P K; Gladney, L; Panetta, J; Biasini, M; Covarelli, R; Pioppi, M; Angelini, C; Batignani, G; Bettarini, S; Bucci, F; Calderini, G; Carpinelli, M; Cenci, R; Forti, F; Giorgi, M A; Lusiani, A; Marchiori, G; Mazur, M A; Morganti, M; Neri, N; Rizzo, G; Walsh, J; Haire, M; Judd, D; Wagoner, D E; Biesiada, J; Danielson, N; Elmer, P; Lau, Y P; Lü, C; Olsen, J; Smith, A J S; Telnov, A V; Bellini, F; Cavoto, G; D'Orazio, A; Di Marco, E; Faccini, R; Ferrarotto, F; Ferroni, F; Gaspero, M; Li Gioi, L; Mazzoni, M A; Morganti, S; Piredda, G; Polci, F; Safai-Tehrani, F; Voena, C; Ebert, M; Schröder, H; Waldi, R; Adye, T; De Groot, N; Franek, B; Olaiya, E O; Wilson, F F; Emery, S; Gaidot, A; Ganzhur, S F; Hamel de Monchenault, G; Kozanecki, Witold; Legendre, M; Vasseur, G; Yéche, C; Zito, M; Park, W; Purohit, M V; Wilson, J R; Allen, M T; Aston, D; Bartoldus, R; Bechtle, P; Berger, N; Boyarski, A M; Claus, R; Coleman, J P; Convery, M R; Cristinziani, M; Dingfelder, J C; Dong, D; Dorfan, J; Dubois-Felsmann, G P; Dujmic, D; Dunwoodie, W M; Field, R C; Glanzman, T; Gowdy, S J; Graham, M T; Halyo, V; Hast, C; Hrynóva, T; Innes, W R; Kelsey, M H; Kim, P; Kocian, M L; Leith, D W G S; Li, S; Libby, J; Luitz, S; Lüth, V; Lynch, H L; MacFarlane, D B; Marsiske, H; Messner, R; Müller, D R; O'Grady, C P; Ozcan, V E; Perl, M; Perazzo, A; Ratcliff, B N; Roodman, A; Salnikov, A A; Schindler, R H; Schwiening, J; Snyder, A; Stelzer, J; Su, D; Sullivan, M K; Suzuki, K; Swain, S K; Thompson, J M; Vavra, J; Van Bakel, N; Weaver, M; Weinstein, A J R; Wisniewski, W J; Wittgen, M; Wright, D H; Yarritu, A K; Yi, K; Young, C C; Burchat, P R; Edwards, A J; Majewski, S A; Petersen, B A; Roat, C; Wilden, L; Ahmed, S; Alam, M S; Bula, R; Ernst, J A; Jain, V; Pan, B; Saeed, M A; Wappler, F R; Zain, S B; Bugg, W; Krishnamurthy, M; Spanier, S M; Eckmann, R; Ritchie, J L; Satpathy, A; Schilling, C J; Schwitters, R F; Izen, J M; Kitayama, I; Lou, X C; Ye, S; Bianchi, F; Gallo, F; Gamba, D; Bomben, M; Bosisio, L; Cartaro, C; Cossutti, F; Della Ricca, G; Dittongo, S; Grancagnolo, S; Lanceri, L; Vitale, L; Azzolini, V; Martínez-Vidal, F; Banerjee, Sw; Bhuyan, B; Brown, C M; Fortin, D; Hamano, K; Kowalewski, R V; Nugent, I M; Roney, J M; Sobie, R J; Back, J J; Harrison, P F; Latham, T E; Mohanty, G B; Pappagallo, M; Band, H R; Chen, X; Cheng, B; Dasu, S; Datta, M; Eichenbaum, A M; Flood, K T; Hollar, J J; Kutter, P E; Li, H; Liu, R; Mellado, B; Mihályi, A; Mohapatra, A K; Pan, Y; Pierini, M; Prepost, R; Tan, P; Wu, S L; Yu, Z; Neal, H

    2006-01-01

    We present the first measurement of $\\Upsilon(4S)$ decays to $\\pi^+pi^-\\Upsilon(1S)$ and $\\pi^+pi^-\\Upsilon(2S)$ based on a sample of 230$\\times10^6$ $\\Upsilon(4S)$ mesons collected with the BABAR detector. We measure the product branching fractions ${\\cal B}(\\Upsilon(4S)\\to \\pi^+pi^-\\Upsilon(1S))\\times{\\cal B}(\\Upsilon(1S)\\to\\mu^+\\mu^-)=(2.23\\pm0.25_{stat} \\pm0.27_{sys})\\times 10^{-6}$ and ${\\cal B}(\\Upsilon(4S)\\to \\pi^+pi^-\\Upsilon(2S))\\times{\\cal B}(\\Upsilon(2S)\\to\\mu^+\\mu^-)=(1.69\\pm0.26_{stat}\\pm0.20_{sys})\\times 10^{-6}$, from which we derive the partial widths $\\Gamma(\\Upsilon(4S)\\to \\pi^+pi^-\\Upsilon(1S))=(1.8\\pm0.4)$~keV and $\\Gamma(\\Upsilon(4S)\\to \\pi^+pi^-\\Upsilon(2S))=(2.7\\pm0.8)$~keV.

  6. Fault detection using (PI) observers

    DEFF Research Database (Denmark)

    Niemann, Hans Henrik; Stoustrup, J.; Shafai, B.

    The fault detection and isolation (FDI) problem in connection with Proportional Integral (PI) Observers is considered in this paper. A compact formulation of the FDI design problem using PI observers is given. An analysis of the FDI design problem is derived with respectt to the time domain...... properties. A method for design of PI observers applied to FDI is given....

  7. Study of B ->K pi pi gamma Decays

    CERN Document Server

    Eigen, Gerald

    2015-01-01

    Using $471 \\times 10^6 ~B \\bar B$ decays recorded with the \\babar\\ detector at the PEP-II $e^+ e^-$ storage ring, we present the time-dependent \\CP\\ asymmetry measurement in the radiative penguin decay mode $B^0 \\ra K^0_S \\rho(770)^0 \\gamma$, yielding $S_{K^0_S \\rho^0 \\gamma} =-0.17\\pm 0.32^{+0.07}_{-0.06}$. Since the result is extracted from the time-dependent \\CP~asymmetry parameters $S_{K^0_S \\pi^+ \\pi^- \\gamma} =0.14\\pm 0.25^{+0.04}_{-0.03}$ and $C _{K^0_S \\pi^+ \\pi^- \\gamma} =-0.39\\pm $ measured in the neutral decay $B^0 \\ra K^0_S \\pi^+ \\pi^- \\gamma$, we need to correct for the dilution of $K^*(892) \\pi \\gamma$ in $K \\rho \\gamma$. The dilution factor $ D_{K^0_S \\rho \\gamma} =-0.79^{+0.18}_{-0.17}$ is determined from a study of the charged mode $B^+ \\ra K^+ \\pi^+\\pi^-\\gamma$, which produces more signal events and is related to the neutral mode by isospin. We need detailed knowledge of the resonance structure in the $K^+ \\pi^+ \\pi^-$ mass spectrum and measure branching fractions of different resonances to ...

  8. Study of the D0 ---> K+ K- pi+ pi-

    Energy Technology Data Exchange (ETDEWEB)

    Link, J.M.; Yager, P.M.; /UC, Davis; Anjos, J.C.; Bediaga, I.; Gobel, C.; Machado, A.A.; Magnin, J.; Massafferri, A.; de Miranda, J.M.; Pepe, I.M.; Polycarpo, E.; dos; /Rio de Janeiro, CBPF; Carrillo, S.; Casimiro, E.; Cuautle, E.; Sanchez-Hernandez, A.; Uribe, C.; Vazquez, F.; /CINVESTAV, IPN; Agostino, L.; Cinquini, L.; Cumalat, J.P.

    2004-11-01

    Using data from the FOCUS (E831) experiment at Fermilab, the authors present a new measurement for the Cabibbo-suppressed decay mode D{sup 0} {yields} K{sup +}K{sup -}{pi}{sup +}{pi}{sup -}. They measure: {Lambda}(D{sup 0} {yields} K{sup +}K{sup -}{pi}{sup +}{pi}{sup -})/{Lambda}(D{sup 0} {yields} K{sup -}{pi}{sup -}{pi}{sup +}{pi}{sup +}) = 0.0295 {+-} 0.0011 {+-} 0.0008. An amplitude analysis has been performed in order to determine the resonant substructure of this decay mode. The dominant components are the decays D{sup 0} {yields} K{sub 1}(1270){sup +} K{sup -}, D{sup 0} {yields} K{sub 1}(1400){sup +}K{sup -} and D{sup 0} {yields} {rho}(770){sup 0}{phi}(1020).

  9. Dalitz plot analysis of the D+ -> K- pi+ pi+ decay

    CERN Document Server

    Bonvicini, G; Dubrovin, M; Lincoln, A; Asner, D M; Edwards, K W; Naik, P; Briere, R A; Ferguson, T; Tatishvili, G; Vogel, H; Watkins, M E; Rosner, J L; Adam, N E; Alexander, J P; Cassel, D G; Duboscq, J E; Ehrlich, R; Fields, L; Gibbons, L; Gray, R; Gray, S W; Hartill, D L; Heltsley, B K; Hertz, D; Jones, C D; Kandaswamy, J; Kreinick, D L; Kuznetsov, V E; Mahlke-Krüger, H; Mohapatra, D; Onyisi, P U E; Patterson, J R; Peterson, D; Riley, D; Ryd, A; Sadoff, A J; Shi, X; Stroiney, S; Sun, W M; Wilksen, T; Athar, S B; Patel, R; Yelton, J; Rubin, P; Eisenstein, B I; Karliner, I; Mehrabyan, S; Lowrey, N; Selen, M; White, E J; Wiss, J; Mitchell, R E; Shepherd, M R; Besson, D; Pedlar, T K; Cronin-Hennessy, D; Gao, K Y; Hietala, J; Kubota, Y; Klein, T; Lang, B W; Poling, R; Scott, A W; Zweber, P; Dobbs, S; Metreveli, Z; Seth, K K; Tomaradze, A G; Ecklund, K M; Love, W; Savinov, V; López, A; Mehrabyan, S; Méndez, H; Ramírez, J; Ge, J Y; Miller, D H; Sanghi, B; Shipsey, I P J; Xin, B; Adams, G S; Anderson, M; Cummings, J P; Danko, I; Hu, D; Moziak, B; Napolitano, J; He, Q; Insler, J; Muramatsu, H; Park, C S; Thorndike, E H; Yang, F; Artuso, M; Blusk, S; Horwitz, N; Khalil, S; Li, J; Menaa, N; Mountain, R; Nisar, S; Randrianarivony, K; Sia, R; Sultana, N; Skwarnicki, T; Stone, S; Wang, J C; Zhang, L M

    2007-01-01

    We present a Dalitz plot analysis of the decay D+ -> K- pi+ pi+ based on 281 pb-1 of e+e- collision data produced at the psi(3770) by CESR and observed with the CLEO-c detector. We select 67086 candidate events with a small, ~1.1%, background for this analysis. When using a simple isobar model our results are consistent with the previous measurements done by E791. Since our sample is considerably larger we can explore alternative models. We find better agreement with data when we include an isospin-two pi+pi+ S-wave contribution. We apply a quasi model-independent partial wave analysis and measure the amplitude and phase of the K pi and pi+pi+ S waves in the range of invariant masses from the threshold to the maximum in this decay.

  10. B^0 --> K^+ \\pi^- \\pi^0 Dalitz Plot Analysis

    CERN Document Server

    Aubert, B; Abrams, G S; Adye, T; Ahmed, S; Alam, M S; Albert, J; Aleksan, Roy; Allison, J; Allmendinger, T; Altenburg, D; Andreotti, M; Angelini, C; Anulli, F; Aston, D; Azzolini, V; Baak, M; Back, J J; Bailey, S; Baldini-Ferroli, R; Band, H R; Banerjee, Sw; Barate, R; Bard, D J; Barlow, N R; Barlow, R J; Barrett, M; Bartoldus, R; Batignani, G; Bauer, J M; Beck, T W; Behera, P K; Bellini, F; Benayoun, M; Berger, N; Bernard, D; Berryhill, J W; Best, D; Bettarini, S; Bettoni, D; Bevan, A J; Bhimji, W; Bianchi, F; Biasini, M; Blanc, F; Blaylock, G; Blinov, A E; Blinov, V E; Bloom, P; Bóna, M; Bondioli, M; Bonneaud, G R; Borgland, A W; Bosisio, L; Boutigny, D; Bowerman, D A; Boyarski, A M; Boyd, J T; Bozzi, C; Brandenburg, G; Brandt, T; Brau, J E; Breon, A B; Briand, H; Brochard, F; Brose, J; Brown, C L; Brown, C M; Brown, D; Brown, D N; Bruinsma, M; Brunet, S; Bucci, F; Buchanan, C; Buchmüller, O L; Bugg, W; Bulten, H; Burchat, Patricia R; Button-Shafer, J; Buzzo, A; Côté, D; Cahn, R N; Calabrese, R; Calcaterra, A; Calderini, G; Campagnari, C; Capra, R; Carpinelli, M; Cartaro, C; Cavallo, N; Cavoto, G; Chaisanguanthum, K S; Chao, M; Charles, E; Charles, M J; Chauveau, J; Chavez, C A; Chen, A; Chen, E; Chen, J C; Chen, S; Cheng, B; Cheng, C H; Chevalier, N; Christ, S; Cibinetto, G; Clark, P J; Claus, R; Cochran, J; Colecchia, F; Coleman, J P; Contri, R; Convery, M R; Cormack, C M; Cossutti, F; Cottingham, W N; Couderc, F; Covarelli, R; Cowan, G; Cowan, R; Crawley, H B; Cremaldi, L M; Cristinziani, M; Crosetti, G; Çuhadar-Dönszelmann, T; Dahmes, B; Dallapiccola, C; Danielson, N; Dasu, S; Datta, M; Dauncey, P D; David, P; Davier, M; Davis, C L; Day, C T; De Groot, N; De Nardo, Gallieno; Del Buono, L; Della Ricca, G; Di Lodovico, F; Dickopp, M; Dittongo, S; Dong, D; Dorfan, J; Dorigo, A; Druzhinin, V P; Dubitzky, R S; Dubois-Felsmann, G P; Dujmic, D; Dunwoodie, W M; Dvoretskii, A; Eckmann, R; Edwards, A J; Egede, U; Eichenbaum, A M; Eigen, G; Eisner, A M; Elmer, P; Elsen, E E; Emery, S; Ernst, J A; Eschenburg, V; Eschrich, I; Fabozzi, F; Faccini, R; Fan, S; Farbin, A; Feltresi, E; Ferrarotto, F; Ferroni, F; Field, R C; Finocchiaro, G; Flack, R L; Flächer, H U; Flood, K T; Ford, K E; Ford, W T; Forster, I J; Forti, F; Fortin, D; Foulkes, S D; Franek, B J; Frey, R; Fritsch, M; Fry, J R; Gabathuler, Erwin; Gaidot, A; Gaillard, J M; Gaillard, J R; Galeazzi, F; Gallo, F; Gamba, D; Gamet, R; Gan, K K; Ganzhur, S F; Gary, J W; Gaspero, M; Gatto, C; Geddes, N I; Gill, M S; Giorgi, M A; Giraud, P F; Giroux, X; Gladney, L; Glanzman, T; Godang, R; Goetzen, K; Golubev, V B; Gopal, G P; Gowdy, S J; Graham, M; Grancagnolo, S; Green, M G; Greene, M G; Grenier, G J; Grenier, P; Gritsan, A V; Grosdidier, G; Groysman, Y; Guo, Q H; Hadavand, H K; Hadig, T; Haire, M; Halyo, V; Hamel de Monchenault, G; Hamon, O; Harrison, P F; Harrison, T J; Hart, A J; Hart, P A; Hartfiel, B L; Harton, J L; Hast, C; Hauke, A; Hawkes, C M; Hearty, C; Held, T; Hertzbach, S S; Heusch, C A; Hicheur, A; Hill, E J; Hitlin, D G; Höcker, A; Hodgkinson, M C; Hollar, J J; Honscheid, K; Hrynóva, T; Hufnagel, D; Hulsbergen, W D; Hutchcroft, D E; Igonkina, O; Innes, W R; Ivanchenko, V N; Izen, J M; Jackson, P D; Jackson, P S; Jacobsen, R G; Jawahery, A; Jayatilleke, S M; Jessop, C P; John, M J J; Johnson, J R; Judd, D; Kadel, R W; Kadyk, J; Kagan, H; Karyotakis, Yu; Kass, R; Kelly, M P; Kelsey, M H; Kerth, L T; Khan, A; Kim, H; Kim, P; Kirkby, D; Kitayama, I; Knecht, N S; Koch, H; Kocian, M L; Kofler, R; Kolomensky, Yu G; Koptchev, V B; Kovalskyi, D; Kowalewski, R V; Kozanecki, Witold; Kravchenko, E A; Krishnamurthy, M; Kroeger, R; Kroseberg, J; Kukartsev, G; Kutter, P E; Kyberd, P; Lacker, H M; Lae, C K; Lafferty, G D; Lamsa, J; Lanceri, L; Lange, D J; Langenegger, U; Lankford, A J; Laplace, S; Latham, T E; Lau, Y P; Lavin, D; Lazzaro, A; Le Diberder, F R; Lees, J P; Legendre, M; Leith, D W G S; Lepeltier, V; Leruste, P; Lewandowski, B; Li Gioi, L; Li, H; Libby, J; Lillard, V; Lista, L; Liu, R; LoSecco, J M; Lo Vetere, M; Lockman, W S; Lombardo, V; London, G W; Long, O; Lou, X C; Lu, A; Lü, C; Luitz, S; Luppi, E; Lusiani, A; Lüth, V; Lutz, A M; Lynch, G; Lynch, H L; Lyon, A J; MacFarlane, D B; Macri, M; Malcles, J; Mallik, U; Mancinelli, G; Mandelkern, M A; Manfredi, P F; Mangeol, D J J; Marchiori, G; Margoni, M; Marsiske, H; Martínez-Vidal, F; Mattison, T S; Mayer, B; Mazur, M A; Mazzoni, M A; McKenna, J A; McMahon, T R; Meadows, B T; Messner, R; Meyer, T I; Meyer, W T; Miftakov, V; Mihályi, A; Mir, L M; Mohanty, G B; Mohapatra, A K; Mommsen, R K; Monge, M R; Monorchio, D; Moore, T B; Morandin, M; Morgan, S E; Morganti, M; Morganti, S; Morii, M; Morton, G W; Muheim, F; Müller, D R; Müller-Pfefferkorn, R; Narsky, I; Nash, J A; Nauenberg, U; Neal, H; Negrini, M; Neri, N; Nesom, G; Nicholson, H; Nikolich, M B; Nogowski, R; O'Grady, C P; Ocariz, J; Oddone, P J; Ofte, I; Olaiya, E O; Olivas, A; Olsen, J; Onuchin, A P; Orimoto, T J; Otto, S; Ozcan, V E; Paar, H P; Paick, K; Palano, A; Palombo, F; Pan, Y; Panetta, J; Panvini, R S; Paoloni, E; Paolucci, P; Parry, R J; Passaggio, S; Patel, P M; Patrignani, C; Patteri, P; Payne, D J; Pelizaeus, M; Perazzo, A; Perl, M; Peruzzi, I M; Petersen, B A; Petersen, T C; Petrak, S; Petzold, A; Piatenko, T; Piccolo, D; Piccolo, M; Piemontese, L; Pierini, M; Pioppi, M; Piredda, G; Pivk, M; Plaszczynski, S; Playfer, S; Pompili, A; Poropat, P; Porter, F C; Posocco, M; Potter, C T; Prell, S; Prepost, R; Pripstein, M; Pulliam, T; Purohit, M V; Qi, N D; Rahatlou, S; Rahimi, A M; Rama, M; Rankin, P; Ratcliff, B N; Raven, G; Re, V; Reidy, J; Ricciardi, S; Richman, J D; Ritchie, J L; Rizzo, G; Roat, C; Roberts, D A; Robertson, S H; Robutti, E; Roe, N A; Röthel, W; Ronan, Michael T; Roney, J M; Rong, G; Roodman, A; Roos, L; Rosenberg, E I; Rotondo, M; Rubin, A E; Ryd, A; Saeed, M A; Safai-Tehrani, F; Saleem, M; Salnikov, A A; Salvatore, F; Samuel, A; Sanders, D A; Sandrelli, F; Santroni, A; Saremi, S; Sarti, A; Satpathy, A; Schalk, T; Schindler, R H; Schott, G; Schrenk, S; Schubert, J; Schubert, Klaus R; Schumm, B A; Schune, M H; Schwiening, J; Schwierz, R; Schwitters, R F; Sciacca, C; Sciolla, G; Seiden, A; Sekula, S J; Serednyakov, S I; Sharma, V; Shelkov, V G; Shen, B C; Simani, M C; Simi, G; Simonetto, F; Sinev, N B; Skovpen, Yu I; Sloane, R J; Smith, A J S; Smith, J G; Snoek, H L; Snyder, A; Sobie, R J; Soffer, A; Soha, A; Sokoloff, M D; Solodov, E P; Spaan, B; Spanier, S M; Spradlin, P; Stängle, H; Steinke, M; Stelzer, J; Stoker, D P; Stroili, R; Strom, D; Stugu, B; Su, D; Sullivan, M K; Summers, D J; Sundermann, J E; T'Jampens, S; Tan, P; Tantot, L; Taras, P; Taylor, F; Taylor, G P; Telnov, A V; Teodorescu, L; Ter-Antonian, R; Therin, G; Thiebaux, C; Thiessen, D; Tiozzo, G; Tisserand, V; Toki, W H; Torrence, E; Tosi, S; Touramanis, C; Treadwell, E; Vasileiadis, G; Vasseur, G; Vavra, J; Verderi, M; Verkerke, W; Vitale, L; Voci, C; Voena, C; Vuagnin, G; Wagner, G; Wagner, S R; Wagoner, D E; Waldi, R; Walsh, J; Wang, K; Wang, P; Wappler, F R; Watson, A T; Weaver, M; Weidemann, A W; Weinstein, A J R; Wenzel, W A; Wilden, L; Williams, D C; Williams, J C; Willocq, S; Wilson, F F; Wilson, J R; Wilson, M G; Wilson, R J; Winter, M A; Wisniewski, W J; Wittgen, M; Won, E; Wong, Q K; Wormser, G; Wright, D H; Wright, D M; Wu, J; Wu, S L; Xie, Y; Yamamoto, R K; Yang, S; Yarritu, A K; Ye, S; Yéche, C; Yi, J; Young, C C; Yu, Z; Yumiceva, F X; Yushkov, A N; Zallo, A; Zeng, Q; Zghiche, A; Zhang, J; Zhang, L; Zhao, H W; Zhu, Y S; Zito, M; De Sangro, R; Del Re, D; La Vaissière, C de

    2004-01-01

    We present preliminary results on the Dalitz plot analysis of $B^0 \\to K^+ \\pi^- \\pi^0$ decays. The data sample comprises 213 million $\\Upsilon(4S) \\to B {\\bar B}$ decays collected with the BaBar detector at the PEP-II asymmetric-energy $B$ Factory at SLAC. We report measurements of the inclusive branching fraction, quasi-two-body fractions and CP-violating charge asymmetries for intermediate states including $K^*(892)^+ \\pi^-$ and $\\rho(770)^- K^+$. Observations of $B^0$ decays to the $K\\pi$ $S$-wave intermediate states, $K_0^*(1430)^+ \\pi^-$ and $K_0^*(1430)^0 \\pi^0$, are reported. Evidence of the decay $B^0 \\to K^*(892)^0 \\pi^0$ is seen. We set upper limits at 90% confidence level on branching fractions of the nonresonant and other less significant intermediate states.

  11. Measurement of the D+ --> pi+ pi0 and D+ --> K+ pi0 Branching Fractions

    CERN Document Server

    Aubert, B; Bóna, M; Boutigny, D; Couderc, F; Karyotakis, Yu; Lees, J P; Poireau, V; Tisserand, V; Zghiche, A; Graugès-Pous, E; Palano, A; Chen, J C; Qi, N D; Rong, G; Wang, P; Zhu, Y S; Eigen, G; Ofte, I; Stugu, B; Abrams, G S; Battaglia, M; Brown, D N; Button-Shafer, J; Cahn, R N; Charles, E; Gill, M S; Groysman, Y; Jacobsen, R G; Kadyk, J A; Kerth, L T; Kolomensky, Yu G; Kukartsev, G; Lynch, G; Mir, L M; Oddone, P J; Orimoto, T J; Pripstein, M; Roe, N A; Ronan, M T; Wenzel, W A; Barrett, M; Ford, K E; Harrison, T J; Hart, A J; Hawkes, C M; Morgan, S E; Watson, A T; Goetzen, K; Held, T; Koch, H; Lewandowski, B; Pelizaeus, M; Peters, K; Schröder, T; Steinke, M; Boyd, J T; Burke, J P; Cottingham, W N; Walker, D; Çuhadar-Dönszelmann, T; Fulsom, B G; Hearty, C; Knecht, N S; Mattison, T S; McKenna, J A; Khan, A; Kyberd, P; Saleem, M; Teodorescu, L; Blinov, V E; Bukin, A D; Druzhinin, V P; Golubev, V B; Onuchin, A P; Serednyakov, S I; Skovpen, Yu I; Solodov, E P; Todyshev, Yu K; Best, D S; Bondioli, M; Bruinsma, M; Chao, M; Curry, S; Eschrich, I; Kirkby, D; Lankford, A J; Lund, P; Mandelkern, M A; Mommsen, R K; Röthel, W; Stoker, D P; Abachi, S; Buchanan, C; Foulkes, S D; Gary, J W; Long, O; Shen, B C; Wang, K; Zhang, L; Hadavand, H K; Hill, E J; Paar, H P; Rahatlou, S; Sharma, V; Berryhill, J W; Campagnari, C; Cunha, A; Dahmes, B; Hong, T M; Kovalskyi, D; Richman, J D; Beck, T W; Eisner, A M; Flacco, C J; Heusch, C A; Kroseberg, J; Lockman, W S; Nesom, G; Schalk, T; Schumm, B A; Seiden, A; Spradlin, P; Williams, D C; Wilson, M G; Albert, J; Chen, E; Dvoretskii, A; Hitlin, D G; Narsky, I; Piatenko, T; Porter, F C; Ryd, A; Samuel, A; Andreassen, R; Mancinelli, G; Meadows, B T; Sokoloff, M D; Blanc, F; Bloom, P C; Chen, S; Ford, W T; Hirschauer, J F; Kreisel, A; Nauenberg, U; Olivas, A; Ruddick, W O; Smith, J G; Ulmer, K A; Wagner, S R; Zhang, J; Chen, A; Eckhart, E A; Soffer, A; Toki, W H; Wilson, R J; Winklmeier, F; Zeng, Q; Altenburg, D D; Feltresi, E; Hauke, A; Jasper, H; Spaan, B; Brandt, T; Klose, V; Lacker, H M; Mader, W F; Nogowski, R; Petzold, A; Schubert, J; Schubert, K R; Schwierz, R; Sundermann, J E; Volk, A; Bernard, D; Bonneaud, G R; Grenier, P; Latour, E; Thiebaux, C; Verderi, M; Bard, D J; Clark, P J; Gradl, W; Muheim, F; Playfer, S; Robertson, A I; Xie, Y; Andreotti, M; Bettoni, D; Bozzi, C; Calabrese, R; Cibinetto, G; Luppi, E; Negrini, M; Petrella, A; Piemontese, L; Prencipe, E; Anulli, F; Baldini-Ferroli, R; Calcaterra, A; De Sangro, R; Finocchiaro, G; Pacetti, S; Patteri, P; Peruzzi, I M; Piccolo, M; Rama, M; Zallo, A; Buzzo, A; Capra, R; Contri, R; Lo Vetere, M; Macri, M M; Monge, M R; Passaggio, S; Patrignani, C; Robutti, E; Santroni, A; Tosi, S; Brandenburg, G; Chaisanguanthum, K S; Morii, M; Wu, J; Dubitzky, R S; Marks, J; Schenk, S; Uwer, U; Bhimji, W; Bowerman, D A; Dauncey, P D; Egede, U; Flack, R L; Gaillard, J R; Nash, J A; Nikolich, M B; Panduro-Vazquez, W; Chai, X; Charles, M J; Mallik, U; Meyer, N T; Ziegler, V; Cochran, J; Crawley, H B; Dong, L; Eyges, V; Meyer, W T; Prell, S; Rosenberg, E I; Rubin, A E; Gritsan, A V; Fritsch, M; Schott, G; Arnaud, N; Davier, M; Grosdidier, G; Höcker, A; Le, F; Diberder; Lepeltier, V; Lutz, A M; Oyanguren, A; Pruvot, S; Rodier, S; Roudeau, P; Schune, M H; Stocchi, A; Wang, W F; Wormser, G; Cheng, C H; Lange, D J; Wright, D M; Chavez, C A; Forster, I J; Fry, J R; Gabathuler, E; Gamet, R; George, K A; Hutchcroft, D E; Payne, D J; Schofield, K C; Touramanis, C; Bevan, A J; Di Lodovico, F; Menges, W; Sacco, R; Brown, C L; Cowan, G; Flächer, H U; Hopkins, D A; Jackson, P S; McMahon, T R; Ricciardi, S; Salvatore, F; Davis, C L; Allison, J; Barlow, N R; Barlow, R J; Chia, Y M; Edgar, C L; Kelly, M P; Lafferty, G D; Naisbit, M T; Williams, J C; Yi, J I; Chen, C; Hulsbergen, W D; Jawahery, A; Lae, C K; Roberts, D A; Simi, G; Blaylock, G; Dallapiccola, C; Hertzbach, S S; Li, X; Moore, T B; Saremi, S; Stängle, H; Willocq, S Y; Cowan, R; Koeneke, K; Sciolla, G; Sekula, S J; Spitznagel, M; Taylor, F; Yamamoto, R K; Kim, H; Patel, P M; Robertson, S H; Lazzaro, A; Lombardo, V; Palombo, F; Bauer, J M; Cremaldi, L; Eschenburg, V; Godang, R; Kroeger, R; Reidy, J; Sanders, D A; Summers, D J; Zhao, H W; Brunet, S; Côté, D; Taras, P; Viaud, F B; Nicholson, H; Cavallo, N; De Nardo, Gallieno; Del Re, D; Fabozzi, F; Gatto, C; Lista, L; Monorchio, D; Paolucci, P; Piccolo, D; Sciacca, C; Baak, M; Bulten, H; Raven, G; Snoek, H L; Jessop, C P; LoSecco, J M; Allmendinger, T; Benelli, G; Gan, K K; Honscheid, K; Hufnagel, D; Jackson, P D; Kagan, H; Kass, R; Pulliam, T; Rahimi, A M; Ter-Antonian, R; Wong, Q K; Blount, N L; Brau, J E; Frey, R; Igonkina, O; Lu, M; Potter, C T; Rahmat, R; Sinev, N B; Strom, D; Strube, J; Torrence, E; Galeazzi, F; Gaz, A; Margoni, M; Morandin, M; Pompili, A; Posocco, M; Rotondo, M; Simonetto, F; Stroili, R; Voci, C; Benayoun, M; Chauveau, J; David, P; Del Buono, L; La Vaissière, C de; Hamon, O; Hartfiel, B L; John, M J J; Malcles, J; Ocariz, J; Roos, L; Therin, G; Behera, P K; Gladney, L; Panetta, J; Biasini, M; Covarelli, R; Pioppi, M; Angelini, C; Batignani, G; Bettarini, S; Bucci, F; Calderini, G; Carpinelli, M; Cenci, R; Forti, F; Giorgi, M A; Lusiani, A; Marchiori, G; Mazur, M A; Morganti, M; Neri, N; Rizzo, G; Walsh, J; Haire, M; Judd, D; Wagoner, D E; Biesiada, J; Danielson, N; Elmer, P; Lau, Y P; Lü, C; Olsen, J; Smith, A J S; Telnov, A V; Bellini, F; Cavoto, G; D'Orazio, A; Di Marco, E; Faccini, R; Ferrarotto, F; Ferroni, F; Gaspero, M; Li Gioi, L; Mazzoni, M A; Morganti, S; Piredda, G; Polci, F; Safai-Tehrani, F; Voena, C; Ebert, M; Schröder, H; Waldi, R; Adye, T; De Groot, N; Franek, B; Olaiya, E O; Wilson, F F; Emery, S; Gaidot, A; Ganzhur, S F; Hamel de Monchenault, G; Kozanecki, Witold; Legendre, M; Vasseur, G; Yéche, C; Zito, M; Park, W; Purohit, M V; Wilson, J R; Allen, M T; Aston, D; Bartoldus, R; Bechtle, P; Berger, N; Boyarski, A M; Claus, R; Coleman, J P; Convery, M R; Cristinziani, M; Dingfelder, J C; Dong, D; Dorfan, J; Dubois-Felsmann, G P; Dujmic, D; Dunwoodie, W M; Field, R C; Glanzman, T; Gowdy, S J; Graham, M T; Halyo, V; Hast, C; Hrynóva, T; Innes, W R; Kelsey, M H; Kim, P; Kocian, M L; Leith, D W G S; Li, S; Libby, J; Luitz, S; Lüth, V; Lynch, H L; MacFarlane, D B; Marsiske, H; Messner, R; Müller, D R; O'Grady, C P; Ozcan, V E; Perl, M; Perazzo, A; Ratcliff, B N; Roodman, A; Salnikov, A A; Schindler, R H; Schwiening, J; Snyder, A; Stelzer, J; Su, D; Sullivan, M K; Suzuki, K; Swain, S K; Thompson, J M; Vavra, J; Van Bakel, N; Weaver, M; Weinstein, A J R; Wisniewski, W J; Wittgen, M; Wright, D H; Yarritu, A K; Yi, K; Young, C C; Burchat, P R; Edwards, A J; Majewski, S A; Petersen, B A; Roat, C; Wilden, L; Ahmed, S; Alam, M S; Bula, R; Ernst, J A; Jain, V; Pan, B; Saeed, M A; Wappler, F R; Zain, S B; Bugg, W; Krishnamurthy, M; Spanier, S M; Eckmann, R; Ritchie, J L; Satpathy, A; Schilling, C J; Schwitters, R F; Izen, J M; Kitayama, I; Lou, X C; Ye, S; Bianchi, F; Gallo, F; Gamba, D; Bomben, M; Bosisio, L; Cartaro, C; Cossutti, F; Della Ricca, G; Dittongo, S; Grancagnolo, S; Lanceri, L; Vitale, L; Azzolini, V; Martínez-Vidal, F; Banerjee, Sw; Bhuyan, B; Brown, C M; Fortin, D; Hamano, K; Kowalewski, R V; Nugent, I M; Roney, J M; Sobie, R J; Back, J J; Harrison, P F; Latham, T E; Mohanty, G B; Pappagallo, M; Band, H R; Chen, X; Cheng, B; Dasu, S; Datta, M; Eichenbaum, A M; Flood, K T; Hollar, J J; Kutter, P E; Li, H; Liu, R; Mellado, B; Mihályi, A; Mohapatra, A K; Pan, Y; Pierini, M; Prepost, R; Tan, P; Wu, S L; Yu, Z

    2006-01-01

    We present measurements of the branching fractions for the Cabbibo suppressed decays D+ --> pi+ pi0 and D+ --> K+ pi0 based on a data sample corresponding to an integrated luminosity of 124.3 fb-1. The data were taken with the BABAR detector at the PEP-II B Factory operating on and near the Y(4S) resonance. We find BR(D+ --> pi+ pi0) = (1.22 +/- 0.10 +/- 0.08 +/- 0.08) * 10^(-3) and BR(D+ --> K+ pi0) = (2.46 +/- 0.46 +/- 0.24 +/- 0.16) * 10^(-4), where the first uncertainty is statistical, the second systematic and the last error is due to the uncertainties in the absolute branching fraction scale for D+ mesons. This represents the first observation of the doubly Cabibbo-suppressed D+ --> K+ pi0 decay mode and an improved measurement of the D+ --> K+ pi0 branching fraction.

  12. Study of B0 -> pi0 pi0, B -> pi pi0, and B -> K pi0 Decays, and Isospin Analysis of B -> pipi Decays

    CERN Document Server

    Aubert, B; Boutigny, D; Karyotakis, Yu; Lees, J P; Poireau, V; Prudent, X; Tisserand, V; Zghiche, A; Garra Tico, J; Graugès-Pous, E; López, L; Palano, A; Pappagallo, M; Eigen, G; Stugu, B; Sun, L; Abrams, G S; Battaglia, M; Brown, D N; Button-Shafer, J; Cahn, R N; Groysman, Y; Jacobsen, R G; Kadyk, J A; Kerth, L T; Kolomensky, Yu G; Kukartsev, G; Lopes-Pegna, D; Lynch, G; Mir, L M; Orimoto, T J; Osipenkov, I L; Ronan, M T; Tackmann, K; Tanabé, T; Wenzel, W A; Del Amo-Sánchez, P; Hawkes, C M; Watson, A T; Held, T; Koch, H; Pelizaeus, M; Schröder, T; Steinke, M; Walker, D; Asgeirsson, D J; Çuhadar-Dönszelmann, T; Fulsom, B G; Hearty, C; Mattison, T S; McKenna, J A; Khan, A; Saleem, M; Teodorescu, L; Blinov, V E; Bukin, A D; Druzhinin, V P; Golubev, V B; Onuchin, A P; Serednyakov, S I; Skovpen, Yu I; Solodov, E P; Todyshev, K Yu; Bondioli, M; Curry, S; Eschrich, I; Kirkby, D; Lankford, A J; Lund, P; Mandelkern, M; Martin, E C; Stoker, D P; Abachi, S; Buchanan, C; Foulkes, S D; Gary, J W; Liu, F; Long, O; Shen, B C; Zhang, L; Paar, H P; Rahatlou, S; Sharma, V; Berryhill, J W; Campagnari, C; Cunha, A; Dahmes, B; Hong, T M; Kovalskyi, D; Richman, J D; Beck, T W; Eisner, A M; Flacco, C J; Heusch, C A; Kroseberg, J; Lockman, W S; Schalk, T; Schumm, B A; Seiden, A; Wilson, M G; Winstrom, L O; Chen, E; Cheng, C H; Fang, F; Hitlin, D G; Narsky, I; Piatenko, T; Porter, F C; Andreassen, R; Mancinelli, G; Meadows, B T; Mishra, K; Sokoloff, M D; Blanc, F; Bloom, P C; Chen, S; Ford, W T; Hirschauer, J F; Kreisel, A; Nagel, M; Nauenberg, U; Olivas, A; Smith, J G; Ulmer, K A; Wagner, S R; Zhang, J; Gabareen, A M; Soffer, A; Toki, W H; Wilson, R J; Winklmeier, F; Altenburg, D D; Feltresi, E; Hauke, A; Jasper, H; Merkel, J; Petzold, A; Spaan, B; Wacker, K; Klose, V; Kobel, M J; Lacker, H M; Mader, W F; Nogowski, R; Schubert, J; Schubert, K R; Schwierz, R; Sundermann, J E; Volk, A; Bernard, D; Bonneaud, G R; Latour, E; Lombardo, V; Thiebaux, C; Verderi, M; Clark, P J; Gradl, W; Muheim, F; Playfer, S; Robertson, A I; Watson, J E; Xie, Y; Andreotti, M; Bettoni, D; Bozzi, C; Calabrese, R; Cecchi, A; Cibinetto, G; Franchini, P; Luppi, E; Negrini, M; Petrella, A; Piemontese, L; Prencipe, E; Santoro, V; Anulli, F; Baldini-Ferroli, R; Calcaterra, A; De Sangro, R; Finocchiaro, G; Pacetti, S; Patteri, P; Peruzzi, I M; Piccolo, M; Rama, M; Zallo, A; Buzzo, A; Contri, R; Lo Vetere, M; Macri, M M; Monge, M R; Passaggio, S; Patrignani, C; Robutti, E; Santroni, A; Tosi, S; Chaisanguanthum, K S; Morii, M; Wu, J; Dubitzky, R S; Marks, J; Schenk, S; Uwer, U; Bard, D J; Dauncey, P D; Flack, R L; Nash, J A; Panduro-Vazquez, W; Tibbetts, M; Behera, P K; Chai, X; Charles, M J; Mallik, U; Ziegler, V; Cochran, J; Crawley, H B; Dong, L; Eyges, V; Meyer, W T; Prell, S; Rosenberg, E I; Rubin, A E; Gao, Y Y; Gritsan, A V; Guo, Z J; Lae, C K; Denig, A G; Fritsch, M; Schott, G; Arnaud, N; Bequilleux, J; D'Orazio, A; Davier, M; Grosdidier, G; Höcker, A; Lepeltier, V; Le Diberder, F; Lutz, A M; Pruvot, S; Rodier, S; Roudeau, P; Schune, M H; Serrano, J; Sordini, V; Stocchi, A; Wang, W F; Wormser, G; Lange, D J; Wright, D M; Bingham, I; Chavez, C A; Forster, I J; Fry, J R; Gabathuler, E; Gamet, R; Hutchcroft, D E; Payne, D J; Schofield, K C; Touramanis, C; Bevan, A J; George, K A; Di Lodovico, F; Menges, W; Sacco, R; Cowan, G; Flächer, H U; Hopkins, D A; Paramesvaran, S; Salvatore, F; Wren, A C; Brown, D N; Davis, C L; Allison, J; Barlow, N R; Barlow, R J; Chia, Y M; Edgar, C L; Lafferty, G D; West, T J; Yi, J I; Anderson, J; Chen, C; Jawahery, A; Roberts, D A; Simi, G; Tuggle, J M; Blaylock, G; Dallapiccola, C; Hertzbach, S S; Li, X; Moore, T B; Salvati, E; Saremi, S; Cowan, R; Dujmic, D; Fisher, P H; Koeneke, K; Sciolla, G; Sekula, S J; Spitznagel, M; Taylor, F; Yamamoto, R K; Zhao, M; Zheng, Y; Mclachlin, S E; Patel, P M; Robertson, S H; Lazzaro, A; Palombo, F; Bauer, J M; Cremaldi, L; Eschenburg, V; Godang, R; Kroeger, R; Sanders, D A; Summers, D J; Zhao, H W; Brunet, S; Côté, D; Simard, M; Taras, P; Viaud, F B; Nicholson, H; De Nardo, Gallieno; Fabozzi, F; Lista, L; Monorchio, D; Sciacca, C; Baak, M A; Raven, G; Snoek, H L; Jessop, C P; Knoepfel, K J; LoSecco, J M; Benelli, G; Corwin, L A; Honscheid, K; Kagan, H; Kass, R; Morris, J P; Rahimi, A M; Regensburger, J J; Wong, Q K; Blount, N L; Brau, J E; Frey, R; Igonkina, O; Kolb, J A; Lu, M; Rahmat, R; Sinev, N B; Strom, D; Strube, J; Torrence, E; Gagliardi, N; Gaz, A; Margoni, M; Morandin, M; Pompili, A; Posocco, M; Rotondo, M; Simonetto, F; Stroili, R; Voci, C; Ben-Haim, E; Briand, H; Calderini, G; Chauveau, J; David, P; Del Buono, L; De La Vaissière, C; Hamon, O; Leruste, P; Malcles, J; Ocariz, J; Pérez, A; Prendki, J; Gladney, L; Biasini, M; Covarelli, R; Manoni, E; Angelini, C; Batignani, G; Bettarini, S; Carpinelli, M; Cenci, R; Cervelli, A; Forti, F; Giorgi, M A; Lusiani, A; Marchiori, G; Mazur, M A; Morganti, M; Neri, N; Paoloni, E; Rizzo, G; Walsh, J J; Haire, M; Biesiada, J; Elmer, P; Lau, Y P; Lü, C; Olsen, J; Smith, A J S; Telnov, A V; Baracchini, E; Bellini, F; Cavoto, G; Del Re, D; Di Marco, E; Faccini, R; Ferrarotto, F; Ferroni, F; Gaspero, M; Jackson, P D; Li Gioi, L; Mazzoni, M A; Morganti, S; Piredda, G; Polci, F; Renga, F; Voena, C; Ebert, M; Hartmann, T; Schröder, H; Waldi, R; Adye, T; Castelli, G; Franek, B; Olaiya, E O; Ricciardi, S; Röthel, W; Wilson, F F; Emery, S; Escalier, M; Gaidot, A; Ganzhur, S F; Hamel de Monchenault, G; Kozanecki, W; Vasseur, G; Yéche, C; Zito, M; Chen, X R; Liu, H; Park, W; Purohit, M V; Wilson, J R; Allen, M T; Aston, D; Bartoldus, R; Bechtle, P; Berger, N; Claus, R; Coleman, J P; Convery, M R; Dingfelder, J C; Dorfan, J; Dubois-Felsmann, G P; Dunwoodie, W; Field, R C; Glanzman, T; Gowdy, S J; Graham, M T; Grenier, P; Hast, C; Hrynóva, T; Innes, W R; Kaminski, J; Kelsey, M H; Kim, H; Kim, P; Kocian, M L; Leith, D W G S; Li, S; Luitz, S; Lüth, V; Lynch, H L; MacFarlane, D B; Marsiske, H; Messner, R; Müller, D R; O'Grady, C P; Ofte, I; Perazzo, A; Perl, M; Pulliam, T; Ratcliff, B N; Roodman, A; Salnikov, A A; Schindler, R H; Schwiening, J; Snyder, A; Stelzer, J; Su, D; Sullivan, M K; Suzuki, K; Swain, S K; Thompson, J M; Vavra, J; Van Bakel, N; Wagner, A P; Weaver, M; Wisniewski, W J; Wittgen, M; Wright, D H; Yarritu, A K; Yi, K; Young, C C; Burchat, P R; Edwards, A J; Majewski, S A; Petersen, B A; Wilden, L; Ahmed, S; Alam, M S; Bula, R; Ernst, J A; Jain, V; Pan, B; Saeed, M A; Wappler, F R; Zain, S B; Krishnamurthy, M; Spanier, S M; Eckmann, R; Ritchie, J L; Ruland, A M; Schilling, C J; Schwitters, R F; Izen, J M; Lou, X C; Ye, S; Bianchi, F; Gallo, F; Gamba, D; Pelliccioni, M; Bomben, M; Bosisio, L; Cartaro, C; Cossutti, F; Della Ricca, G; Lanceri, L; Vitale, L; Azzolini, V; Lopez-March, N; Martínez-Vidal, F; Milanes, D A; Oyanguren, A; Albert, J; Banerjee, Sw; Bhuyan, B; Hamano, K; Kowalewski, R; Nugent, I M; Roney, J M; Sobie, R J; Harrison, P F; Ilic, J; Latham, T E; Mohanty, G B; Band, H R; Chen, X; Dasu, S; Flood, K T; Hollar, J J; Kutter, P E; Pan, Y; Pierini, M; Prepost, R; Wu, S L; Neal, H

    2007-01-01

    We present updated measurements of the branching fractions and CP asymmetries for B0 -> pi0 pi0, B+ -> pi+ pi0, and B+ -> K+ pi0. Based on a sample of 383 x 10^6 Upsilon(4S) -> B Bbar decays collected by the BABAR detector at the PEP-II asymmetric-energy B factory at SLAC, we measure B(B0 -> pi0 pi0) =(1.47 +/- 0.25 +/- 0.12) x 10^-6, B(B+ -> pi+ pi0)= (5.02 +/- 0.46 +/- 0.29) x 10^-6, and B(B+ -> K+ pi0) = (13.6 +/- 0.6 +/- 0.7) x 10^-6. We also measure the CP asymmetries C(pi0 pi0) = -0.49 +/- 0.35 +/- 0.05, A(pi+ pi0) = 0.03 +/- 0.08 +/- 0.01, and A(K+ pi0) = 0.030 +/- 0.039 +/- 0.010. Finally, we present bounds on the CKM angle $\\alpha$ using isospin relations.

  13. Effective action for. omega. -> 3. pi. ,. omega. ->. pi gamma. and rho ->. pi gamma

    Energy Technology Data Exchange (ETDEWEB)

    Golterman, M.F.L.

    1988-10-31

    It is argued that the decay widths for ..omega.. -> 3..pi.., ..omega.. -> ..pi gamma.. and rho -> ..pi gamma.. do not follow from the gauged Wess-Zumino-Witten action. An alternative effective action for these decays is constructed and its parameters are fitted to the experimental values of the widths.

  14. Resonance Chiral Lagrangian Currents and Experimental Data for $\\tau^-\\to\\pi^{-}\\pi^{-}\\pi^{+}\

    CERN Document Server

    Nugent, I M; Roig, P; Shekhovtsova, O; Was, Z

    2013-01-01

    In this paper we document the modifications introduced to the previous version of the Resonance Chiral Lagrangian current ({\\it Phys.Rev.} {\\bf D86} (2012) 113008) of the $\\tau^\\pm \\to \\pi^\\pm \\pi^\\pm \\pi^\\mp \

  15. Study of the D0 --> pi+ pi- pi0 decay at BABAR

    CERN Document Server

    Gaspero, Mario

    2010-01-01

    The Dalitz-plot of the Decay D0 --> pi+ pi- pi0 measured by the BABAR Collaboration shows the structure of a final state having quantum numbers IG JPC = 0- 0--. An isospin analysis of the Daliz-plot finds that the I = 0 contribution is about 96%. This high I = 0 contribution is unexpected because the weak interaction violates the isospin.

  16. Measurement of the $\\eta\\to\\pi^+\\pi^-\\pi^0$ Dalitz plot distribution

    CERN Document Server

    Adlarson, P; Bardan, W; Bashkanov, M; Bergmann, F S; Berłowski, M; Bhatt, H; Bondar, A; Büscher, M; Calén, H; Ciepał, I; Clement, H; Coderre, D; Czerwiński, E; Demmich, K; Doroshkevich, E; Engels, R; Erven, A; Erven, W; Eyrich, W; Fedorets, P; Föhl, K; Fransson, K; Goldenbaum, F; Goslawski, P; Goswami, A; Grigoryev, K; Gullström, C -O; Hauenstein, F; Heijkenskjöld, L; Hejny, V; Hodana, M; Höistad, B; Hüsken, N; Jany, A; Jany, B R; Jarczyk, L; Johansson, T; Kamys, B; Kemmerling, G; Khan, F A; Khoukaz, A; Kirillov, D A; Kistryn, S; Kleines, H; Kłos, B; Krzemień, W; Kulessa, P; Kupść, A; Kuzmin, A; Lalwani, K; Lersch, D; Lorentz, B; Magiera, A; Maier, R; Marciniewski, P; Mariański, B; Martemyanov, B V; Meißner, U -G; Mikirtychiants, M; Morsch, H -P; Moskal, P; Ohm, H; Ozerianska, I; del Rio, E Perez; Piskunov, N M; Podkopał, P; Prasuhn, D; Pricking, A; Pszczel, D; Pysz, K; Pyszniak, A; Redmer, C F; Ritman, J; Roy, A; Rudy, Z; Sawant, S; Schadmand, S; Sefzick, T; Serdyuk, V; Shwartz, B; Siudak, R; Skorodko, T; Skurzok, M; Smyrski, J; Sopov, V; Stassen, R; Stepaniak, J; Stephan, E; Sterzenbach, G; Stockhorst, H; Ströher, H; Szczurek, A; Täschner, A; Trzciński, A; Varma, R; Wolke, M; Wrońska, A; Wüstner, P; Wurm, P; Yamamoto, A; Yuan, X; Yurev, L; Zabierowski, J; Zheng, C; Zieliński, M J; Zink, A; Złomańczuk, J; Żuprański, P; Żurek, M

    2014-01-01

    Dalitz plot distribution of the $\\eta\\to\\pi^+\\pi^-\\pi^0$ decay is determined using a data sample of $1.2\\cdot 10^7$ $\\eta$ mesons from $pd\\to ^3\\textrm{He}\\eta$ reaction at 1 GeV collected by the WASA detector at COSY.

  17. Low-energy {pi}{pi} photoproduction off nuclei

    Energy Technology Data Exchange (ETDEWEB)

    Muehlich, P.; Alvarez-Ruso, L.; Buss, O.; Mosel, U

    2004-08-12

    In the present Letter we investigate {pi}{sup 0}{pi}{sup 0} and {pi}{sup {+-}}{pi}{sup 0} photoproduction off complex nuclei at incident beam energies of 400-460 MeV. Simulations of two pion photoproduction on protons and nuclei are performed by means of a semi-classical BUU transport model including a full coupled-channel treatment of the final state interactions. Elastic scattering of the final state pions with the nucleons in the surrounding nuclear medium is found to yield a downward shift of the {pi}{pi} invariant mass distribution. We show that the target mass dependence of the {pi}{sup 0}{pi}{sup 0} invariant mass spectrum as measured by the TAPS Collaboration can be explained without introducing medium effects beyond absorption and quasi-elastic scattering of the final state particles. On the other hand, we find considerable discrepancies with the data in the {pi}{sup {+-}}{pi}{sup 0} channel, which are not understood.

  18. Resonances of the systems $\\pi^- \\eta$ and $\\pi^- \\eta'$ in the reactions $\\pi^- p --> \\pi^- \\eta p$ and $\\pi^- p --> \\pi^- \\eta' p$ at COMPASS

    CERN Document Server

    Schlüter, T; Dünnweber, W; Faessler, M

    2012-01-01

    We describe partial-wave analyses of the systems \\pi-\\eta and \\pi-\\eta' produced in interactions of a \\pi- beam (190 GeV/c) with a liquid hydrogen target. The data were recorded during the 2008 COMPASS run, where a slow recoiling proton (|t|>0.1 GeV^2) was required by the trigger. We compare analyses of the \\pi-\\eta and \\pi-\\eta' data. Significant contributions can be attributed to the resonances a_2(1320), observed in the D_+-wave, and a_4(2040), observed in the G_+-wave. Between the two systems, we find similar compositions of the even partial waves D_+ and G_+ after taking phase-space factors into account, but a much enhanced P_+-wave in \\pi-\\eta'. Relative phase-differences indicate a large incoherent contribution of in the P_+-wave of the \\eta'\\pi- system, but other interpretations are not excluded. The known resonances a_2(1320), a_4(2040) and their parameters could be extracted from the data; their branchings are found to roughly agree with predictions from \\eta\\eta' mixing.

  19. Measurement of CP Asymmetries and Branching Fractions in B -> pi pi and B -> K pi decays

    CERN Document Server

    Aubert, B; Bóna, M; Boutigny, D; Couderc, F; Karyotakis, Yu; Lees, J P; Poireau, V; Tisserand, V; Zghiche, A; Graugès-Pous, E; Palano, A; Chen, J C; Qi, N D; Rong, G; Wang, P; Zhu, Y S; Eigen, G; Ofte, I; Stugu, B; Abrams, G S; Battaglia, M; Brown, D N; Button-Shafer, J; Cahn, R N; Charles, E; Gill, M S; Groysman, Y; Jacobsen, R G; Kadyk, J A; Kerth, L T; Kolomensky, Yu G; Kukartsev, G; Lynch, G; Mir, L M; Orimoto, T J; Pripstein, M; Roe, N A; Ronan, M T; Wenzel, W A; Del Amo-Sánchez, P; Barrett, M; Ford, K E; Hart, A J; Harrison, T J; Hawkes, C M; Morgan, S E; Watson, A T; Held, T; Koch, H; Lewandowski, B; Pelizaeus, M; Peters, K; Schröder, T; Steinke, M; Boyd, J T; Burke, J P; Cottingham, W N; Walker, D; Asgeirsson, D J; Çuhadar-Dönszelmann, T; Fulsom, B G; Hearty, C; Knecht, N S; Mattison, T S; McKenna, J A; Khan, A; Kyberd, P; Saleem, M; Sherwood, D J; Teodorescu, L; Blinov, V E; Bukin, A D; Druzhinin, V P; Golubev, V B; Onuchin, A P; Serednyakov, S I; Skovpen, Yu I; Solodov, E P; Todyshev, K Y; Best, D S; Bondioli, M; Bruinsma, M; Chao, M; Curry, S; Eschrich, I; Kirkby, D; Lankford, A J; Lund, P; Mandelkern, M A; Mommsen, R K; Röthel, W; Stoker, D P; Abachi, S; Buchanan, C; Foulkes, S D; Gary, J W; Long, O; Shen, B C; Wang, K; Zhang, L; Hadavand, H K; Hill, E J; Paar, H P; Rahatlou, S; Sharma, V; Berryhill, J W; Campagnari, C; Cunha, A; Dahmes, B; Hong, T M; Kovalskyi, D; Richman, J D; Beck, T W; Eisner, A M; Flacco, C J; Heusch, C A; Kroseberg, J; Lockman, W S; Nesom, G; Schalk, T; Schumm, B A; Seiden, A; Spradlin, P; Williams, D C; Wilson, M G; Albert, J; Chen, E; Dvoretskii, A; Fang, F; Hitlin, D G; Narsky, I; Piatenko, T; Porter, F C; Ryd, A; Samuel, A; Mancinelli, G; Meadows, B T; Mishra, K; Sokoloff, M D; Blanc, F; Bloom, P C; Chen, S; Ford, W T; Hirschauer, J F; Kreisel, A; Nagel, M; Nauenberg, U; Olivas, A; Ruddick, W O; Smith, J G; Ulmer, K A; Wagner, S R; Zhang, J; Chen, A; Eckhart, E A; Soffer, A; Toki, W H; Wilson, R J; Winklmeier, F; Zeng, Q; Altenburg, D D; Feltresi, E; Hauke, A; Jasper, H; Merkel, J; Petzold, A; Spaan, B; Brandt, T; Klose, V; Lacker, H M; Mader, W F; Nogowski, R; Schubert, J; Schubert, K R; Schwierz, R; Sundermann, J E; Volk, A; Bernard, D; Bonneaud, G R; Latour, E; Thiebaux, C; Verderi, M; Clark, P J; Gradl, W; Muheim, F; Playfer, S; Robertson, A I; Xie, Y; Andreotti, M; Bettoni, D; Bozzi, C; Calabrese, R; Cibinetto, G; Luppi, E; Negrini, M; Petrella, A; Piemontese, L; Prencipe, E; Anulli, F; Baldini-Ferroli, R; Calcaterra, A; De Sangro, R; Finocchiaro, G; Pacetti, S; Patteri, P; Peruzzi, I M; Piccolo, M; Rama, M; Zallo, A; Buzzo, A; Capra, R; Contri, R; Lo Vetere, M; Macri, M M; Monge, M R; Passaggio, S; Patrignani, C; Robutti, E; Santroni, A; Tosi, S; Brandenburg, G; Chaisanguanthum, K S; Morii, M; Wu, J; Dubitzky, R S; Marks, J; Schenk, S; Uwer, U; Bard, D J; Bhimji, W; Bowerman, D A; Dauncey, P D; Egede, U; Flack, R L; Nash, J A; Nikolich, M B; Panduro-Vazquez, W; Behera, P K; Chai, X; Charles, M J; Mallik, U; Meyer, N T; Ziegler, V; Cochran, J; Crawley, H B; Dong, L; Eyges, V; Meyer, W T; Prell, S; Rosenberg, E I; Rubin, A E; Gritsan, A V; Denig, A G; Fritsch, M; Schott, G; Arnaud, N; Davier, M; Grosdidier, G; Höcker, A; Le Diberder, F R; Lepeltier, V; Lutz, A M; Oyanguren, A; Pruvot, S; Rodier, S; Roudeau, P; Schune, M H; Stocchi, A; Wang, W F; Wormser, G; Cheng, C H; Lange, D J; Wright, D M; Chavez, C A; Forster, I J; Fry, J R; Gabathuler, E; Gamet, R; George, K A; Hutchcroft, D E; Payne, D J; Schofield, K C; Touramanis, C; Bevan, A J; Di Lodovico, F; Menges, W; Sacco, R; Cowan, G; Flächer, H U; Hopkins, D A; Jackson, P S; McMahon, T R; Ricciardi, S; Salvatore, F; Wren, A C; Davis, C L; Allison, J; Barlow, N R; Barlow, R J; Chia, Y M; Edgar, C L; Lafferty, G D; Naisbit, M T; Williams, J C; Yi, J I; Chen, C; Hulsbergen, W D; Jawahery, A; Lae, C K; Roberts, D A; Simi, G; Blaylock, G; Dallapiccola, C; Hertzbach, S S; Li, X; Moore, T B; Saremi, S; Stängle, H; Cowan, R; Sciolla, G; Sekula, S J; Spitznagel, M; Taylor, F; Yamamoto, R K; Kim, H; Mclachlin, S E; Patel, P M; Robertson, S H; Lazzaro, A; Lombardo, V; Palombo, F; Bauer, J M; Cremaldi, L; Eschenburg, V; Godang, R; Kroeger, R; Sanders, D A; Summers, D J; Zhao, H W; Brunet, S; Côté, D; Simard, M; Taras, P; Viaud, F B; Nicholson, H; Cavallo, N; De Nardo, Gallieno; Fabozzi, F; Gatto, C; Lista, L; Monorchio, D; Paolucci, P; Piccolo, D; Sciacca, C; Baak, M A; Raven, G; Snoek, H L; Jessop, C P; LoSecco, J M; Allmendinger, T; Benelli, G; Corwin, L A; Gan, K K; Honscheid, K; Hufnagel, D; Jackson, P D; Kagan, H; Kass, R; Rahimi, A M; Regensburger, J J; Ter-Antonian, R; Wong, Q K; Blount, N L; Brau, J E; Frey, R; Igonkina, O; Kolb, J A; Lu, M; Rahmat, R; Sinev, N B; Strom, D; Strube, J; Torrence, E; Gaz, A; Margoni, M; Morandin, M; Pompili, A; Posocco, M; Rotondo, M; Simonetto, F; Stroili, R; Voci, C; Benayoun, M; Briand, H; Chauveau, J; David, P; Del Buono, L; La Vaissière, C de; Hamon, O; Hartfiel, B L; John, M J J; Leruste, P; Malcles, J; Ocariz, J; Roos, L; Therin, G; Gladney, L; Panetta, J; Biasini, M; Covarelli, R; Angelini, C; Batignani, G; Bettarini, S; Bucci, F; Calderini, G; Carpinelli, M; Cenci, R; Forti, F; Giorgi, M A; Lusiani, A; Marchiori, G; Mazur, M A; Morganti, M; Neri, N; Paoloni, E; Rizzo, G; Walsh, J J; Haire, M; Judd, D; Wagoner, D E; Biesiada, J; Danielson, N; Elmer, P; Lau, Y P; Lü, C; Olsen, J; Smith, A J S; Telnov, A V; Bellini, F; Cavoto, G; D'Orazio, A; Del Re, D; Di Marco, E; Faccini, R; Ferrarotto, F; Ferroni, F; Gaspero, M; Li Gioi, L; Mazzoni, M A; Morganti, S; Piredda, G; Polci, F; Safai-Tehrani, F; Voena, C; Ebert, M; Schröder, H; Waldi, R; Adye, T; De Groot, N; Franek, B; Olaiya, E O; Wilson, F F; Aleksan, R; Emery, S; Gaidot, A; Ganzhur, S F; Hamel de Monchenault, G; Kozanecki, Witold; Legendre, M; Vasseur, G; Yéche, C; Zito, M; Chen, X R; Liu, H; Park, W; Purohit, M V; Wilson, J R; Allen, M T; Aston, D; Bartoldus, R; Bechtle, P; Berger, N; Claus, R; Coleman, J P; Convery, M R; Cristinziani, M; Dingfelder, J C; Dorfan, J; Dubois-Felsmann, G P; Dujmic, D; Dunwoodie, W M; Field, R C; Glanzman, T; Gowdy, S J; Graham, M T; Grenier, P; Halyo, V; Hast, C; Hrynóva, T; Innes, W R; Kelsey, M H; Kim, P; Leith, D W G S; Li, S; Luitz, S; Lüth, V; Lynch, H L; MacFarlane, D B; Marsiske, H; Messner, R; Müller, D R; O'Grady, C P; Ozcan, V E; Perazzo, A; Perl, M; Pulliam, T; Ratcliff, B N; Roodman, A; Salnikov, A A; Schindler, R H; Schwiening, J; Snyder, A; Stelzer, J; Su, D; Sullivan, M K; Suzuki, K; Swain, S K; Thompson, J M; Vavra, J; Van Bakel, N; Weaver, M; Weinstein, A J R; Wisniewski, W J; Wittgen, M; Wright, D H; Yarritu, A K; Yi, K; Young, C C; Burchat, P R; Edwards, A J; Majewski, S A; Petersen, B A; Roat, C; Wilden, L; Ahmed, S; Alam, M S; Bula, R; Ernst, J A; Jain, V; Pan, B; Saeed, M A; Wappler, F R; Zain, S B; Bugg, W; Krishnamurthy, M; Spanier, S M; Eckmann, R; Ritchie, J L; Satpathy, A; Schilling, C J; Schwitters, R F; Izen, J M; Lou, X C; Ye, S; Bianchi, F; Gallo, F; Gamba, D; Bomben, M; Bosisio, L; Cartaro, C; Cossutti, F; Della Ricca, G; Dittongo, S; Lanceri, L; Vitale, L; Azzolini, V; Lopez-March, N; Martínez-Vidal, F; Banerjee, Sw; Bhuyan, B; Brown, C M; Fortin, D; Hamano, K; Kowalewski, R V; Nugent, I M; Roney, J M; Sobie, R J; Back, J J; Harrison, P F; Latham, T E; Mohanty, G B; Pappagallo, M; Band, H R; Chen, X; Cheng, B; Dasu, S; Datta, M; Flood, K T; Hollar, J J; Kutter, P E; Mellado, B; Mihályi, A; Pan, Y; Pierini, M; Prepost, R; Wu, S L; Yu, Z; Neal, H; al, et

    2006-01-01

    We present preliminary measurements of the CP asymmetries and branching fractions for B -> pi pi and B -> K pi decays. A total of 347 million BBbar events collected by the BABAR detector at the PEP-II asymmetric-energy e+e- collider at SLAC are used for these results. We find Spipi = -0.53 +- 0.14 +- 0.02, Cpipi = -0.16 +- 0.11 +- 0.03, AKpi = -0.108 +- 0.024 +- 0.008, BF(B0 -> pi0 pi0) = (1.48 +- 0.26 +- 0.12) x 10^-6, BF(B+ -> pi+pi0) = (5.12 +- 0.47 +- 0.29) x 10^-6, BF(B+ -> K+pi0) = (13.3 +- 0.56 +- 0.64) x 10^-6, Cpi0pi0 = -0.33 +- 0.36 +- 0.08, Apipi0 = -0.019 +- 0.088 +- 0.014, AKpi0 = 0.016 +- 0.041 +- 0.012. The measured values of Spipi and Cpipi imply that CP conservation in B0 -> pi+ pi- decays is excluded at the 3.6 sigma level. From these results we present bounds on the CKM angle alpha.

  20. The branching ratio $\\omega \\to \\pi^+\\pi^-$ revisited

    CERN Document Server

    Hanhart, C; Kubis, B; Kupść, A; Wirzba, A; Xiao, C W

    2016-01-01

    We analyze the most recent data for the pion vector form factor in the timelike region, employing a model-independent approach based on dispersion theory. We confirm earlier observations about the inconsistency of different modern high-precision data sets. Excluding the BaBar data, we find an updated value for the isospin-violating branching ratio $\\mathcal{B}(\\omega \\to \\pi^+\\pi^-) = (1.46\\pm 0.08) \\times 10^{-2}$. As a side result, we also extract an improved value for the pion vector or charge radius, $\\sqrt{\\langle r_V^2\\rangle} = (0.6603\\pm 0.0005)\\text{fm}$. In addition, we demonstrate that modern high-quality data for the decay $\\eta' \\to \\pi^+\\pi^-\\gamma$ will allow for an even improved determination of the transition strength $\\omega\\to\\pi^+\\pi^-$.

  1. Exclusive Measurement of the eta --> pi+ pi- gamma Decay

    CERN Document Server

    Adlarson, P; Augustyniak, W; Bardan, W; Bashkanov, M; Bednarski, T; Bergmann, F S; Ber\\lowski, M; Bhatt, H; Brinkmann, K -T; Büscher, M; Calén, H; Clement, H; Coderre, D; Czerwiński, E; Doroshkevich, E; Engels, R; Erven, W; Eyrich, W; Fedorets, P; Föhl, K; Fransson, K; Goldenbaum, F; Goslawski, P; Grigoryev, K; Gullström, C -O; Hanhart, C; Heijkenskjöld, L; Heimlich, J; Hejny, V; Hinterberger, F; Hodana, M; Höistad, B; Jacewicz, M; Jany, A; Jany, B R; Jarczyk, L; Johansson, T; Kamys, B; Kemmerling, G; Khakimova, O; Khoukaz, A; Kistryn, S; Klaja, J; Kleines, H; K\\los, B; Kren, F; Krzemień, W; Kulessa, P; Kupść, A; Lalwani, K; Leupold, S; Lorentz, B; Magiera, A; Maier, R; Mariański, B; Marciniewski, P; Mei\\ssner, U -G; Mikirtychiants, M; Morsch, H -P; Moskal, P; Nandi, B K; Niedźwiecki, S; Ohm, H; Passfeld, A; Pauly, C; del Rio, E Perez; Petri, T; Petukhov, Y; Piskunov, N; Pluciński, P; Podkopał, P; Povtoreyko, A; Prasuhn, D; Pricking, A; Pysz, K; Pyszniak, A; Rausmann, T; Redmer, C F; Ritman, J; Rudy, Z; Sawant, S; Schadmand, S; Schmidt, A; Sefzick, T; Serdyuk, V; Shah, N; Siemaszko, M; Siudak, R; Skorodko, T; Skurzok, M; Smyrski, J; Sopov, V; Stassen, R; Stepaniak, J; Sterzenbach, G; Stockhorst, H; Stollenwerk, F; Ströher, H; Szczurek, A; Täschner, A; Terschlüsen, C; Tolba, T; Trzciński, A; Varma, R; Vlasov, P; Wagner, G J; W\\keglorz, W; Winnemöller, A; Wirzba, A; Wolke, M; Wrońska, A; Wüstner, P; Wurm, P; Yuan, X; Yurev, L; Zabierowski, J; Zheng, C; Zieliński, M J; Zipper, W; Z\\lomańczuk, J; Żuprański, P

    2011-01-01

    An exclusive measurement of the decay eta --> pi+ pi- gamma has been performed at the WASA facility at COSY. The eta mesons were produced in the fusion reaction pd --> 3He X at a proton beam momentum of 1.7 GeV/c. Efficiency corrected differential distributions have been extracted based on 13340\\pm140 events after background subtraction. The measured pion angular distribution is consistent with a relative p-wave of the two-pion system, whereas the measured photon energy spectrum was found at variance with the simplest gauge invariant matrix element of eta --> pi+ pi- gamma. A parameterization of the data can be achieved by the additional inclusion of the empirical pion vector form factor multiplied by a first-order polynomial in the squared invariant mass of the pi+ pi- system.

  2. First Observation of the Cabibbo-suppressed Decays Xi_c+ -> Sigma+ pi- pi+ and Xi_c+ -> Sigma- pi+ pi+ and Measurement of their Branching Ratios

    CERN Document Server

    Vazquez-Jauregui, E

    2008-01-01

    We report the first observation of two Cabibbo-suppressed decay modes, Xi_c+ -> Sigma+ pi- pi+ and Xi_c+ -> Sigma- pi+ pi+. We observe 56+/-13 over a background of 21, and 23+/-7 over a background of 12 events, respectively, for the signals. The data were accumulated using the SELEX spectrometer during the 1996-1997 fixed target run at Fermilab, chiefly from a 600GeV/c Sigma- beam. The branching ratios of the decays relative to the Cabibbo--favored Xi_c+ -> Xi- pi+ pi+ are measured to be B(Xi_c+ -> Sigma+ pi- pi+)/B(Xi_c+ -> Xi- pi+ pi+) = 0.50+/-0.20, and B(Xi_c+ -> Sigma- pi+ pi+)/B(Xi_c+ -> Xi- pi+ pi+) = 0.23+/-0.11, respectively. We also report branching ratios for the same decay modes of the Lambda_c+ relative to Lambda_c+ -> p K- pi+.

  3. $\\pi\\pi$ Scattering in Three Flavour ChPT

    CERN Document Server

    Bijnens, J; Talavera, P; Bijnens, Johan; Dhonte, Pierre; Talavera, Pere

    2004-01-01

    We present the scattering lengths for the $\\pi\\pi$ processes in the three flavour Chiral Perturbation Theory (ChPT) framework at next-to-next-to-leading order. We then combine this calculation with the determination of the parameters from $K_{e4}$ and the masses and decay constants and compare with the results of a dispersive analysis of $\\pi\\pi$ scattering. The comparison indicates a small but nonzero value for the $1/N_c$ suppressed NLO low energy constants $L_4^r$ and $L_6^r$.

  4. Large electroweak penguins in B --> pi pi and B --> pi K implication for new physics

    CERN Document Server

    Nandi, S; Nandi, Soumitra; Kundu, Anirban

    2004-01-01

    We show that the anomalies in the $B\\to\\pi\\pi$ decay channels, {\\em viz.}, the large branching ratio of $B\\to\\pi^0\\pi^0$ and large direct CP asymmetry of $B\\to\\pi^+\\pi^-$, can both be explained, even in the framework of existing theoretical models which predict the relative strengths of the tree and the strong penguin amplitudes, if there is an abnormally large electroweak penguin contribution. We also critically examine the expectation of a similarly large electroweak penguin in the $B\\to\\pi K$ sector, and show that it can be accomodated, and may even be motivated from an SU(3) flavor symmetry between the $B\\to\\pi\\pi$ and the $B\\to\\pi K$ amplitudes, but is not necessary to explain the data. We emphasize that if the experimental numbers on these charmless nonleptonic channels survive, they may turn out to be an indirect signal of new physics. Current data is insufficient to discriminate betwen flavor-specific and flavor-blind new physics scenarios.

  5. Resonance Production and $\\pi\\pi$ S-wave in $\\pi^- + p \\to \\pi^-\\pi^-\\pi^+ + p_{recoil}$ at 190 GeV/$\\it c$

    CERN Document Server

    Adolph, C; Alexeev, M G; Alexeev, G D; Amoroso, A; Andrieux, V; Anosov, V; Augustyniak, W; Austregesilo, A; Azevedo, C D R; Badełek, B; Balestra, F; Barth, J; Beck, R; Bedfer, Y; Bernhard, J; Bicker, K; Bielert, E R; Birsa, R; Bisplinghoff, J; Bodlak, M; Boer, M; Bordalo, P; Bradamante, F; Braun, C; Bressan, A; Büchele, M; Burtin, E; Chang, W-C; Chiosso, M; Choi, I; Chung, S U; Cicuttin, A; Crespo, M L; Curiel, Q; Dalla Torre, S; Dasgupta, S S; Dasgupta, S; Denisov, O Yu; Dhara, L; Donskov, S V; Doshita, N; Duic, V; Dünnweber, W; Dziewiecki, M; Efremov, A; Eversheim, P D; Eyrich, W; Faessler, M; Ferrero, A; Finger, M; Finger jr , M; Fischer, H; Franco, C; du Fresne von Hohenesche, N; Friedrich, J M; Frolov, V; Fuchey, E; Gautheron, F; Gavrichtchouk, O P; Gerassimov, S; Giordano, F; Gnesi, I; Gorzellik, M; Grabmüller, S; Grasso, A; Grosse Perdekamp, M; Grube, B; Grussenmeyer, T; Guskov, A; Haas, F; Hahne, D; von Harrach, D; Hashimoto, R; Heinsius, F H; Herrmann, F; Hinterberger, F; Horikawa, N; d’Hose, N; Hsieh, C-Y; Huber, S; Ishimoto, S; Ivanov, A; Ivanshin, Yu; Iwata, T; Jahn, R; Jary, V; Joosten, R; Jörg, P; Kabuß, E; Ketzer, B; Khaustov, G V; Khokhlov, Yu A; Kisselev, Yu; Klein, F; Klimaszewski, K; Koivuniemi, J H; Kolosov, V N; Kondo, K; Königsmann, K; Konorov, I; Konstantinov, V F; Kotzinian, A M; Kouznetsov, O; Krämer, M; Kremser, P; Krinner, F; Kroumchtein, Z V; Kuchinski, N; Kunne, F; Kurek, K; Kurjata, R P; Lednev, A A; Lehmann, A; Levillain, M; Levorato, S; Lichtenstadt, J; Longo, R; Maggiora, A; Magnon, A; Makins, N; Makke, N; Mallot, G K; Marchand, C; Marianski, B; Martin, A; Marzec, J; Matoušek, J; Matsuda, H; Matsuda, T; Meshcheryakov, G; Meyer, W; Michigami, T; Mikhailov, Yu V; Miyachi, Y; Montuenga, P; Nagaytsev, A; Nerling, F; Neyret, D; Nikolaenko, V I; Nový, J; Nowak, W-D; Nukazuka, G; Nunes, A S; Olshevsky, A G; Orlov, I; Ostrick, M; Panzieri, D; Parsamyan, B; Paul, S; Peng, J-C; Pereira, F; Pešek, M; Peshekhonov, D V; Platchkov, S; Pochodzalla, J; Polyakov, V A; Pretz, J; Quaresma, M; Quintans, C; Ramos, S; Regali, C; Reicherz, G; Riedl, C; Rossiyskaya, N S; Ryabchikov, D I; Rychter, A; Samoylenko, V D; Sandacz, A; Santos, C; Sarkar, S; Savin, I A; Sbrizzai, G; Schiavon, P; Schlüter, T; Schmidt, K; Schmieden, H; Schönning, K; Schopferer, S; Selyunin, A; Shevchenko, O Yu; Silva, L; Sinha, L; Sirtl, S; Slunecka, M; Sozzi, F; Srnka, A; Stolarski, M; Sulc, M; Suzuki, H; Szabelski, A; Szameitat, T; Sznajder, P; Takekawa, S; Tessaro, S; Tessarotto, F; Thibaud, F; Tosello, F; Tskhay, V; Uhl, S; Veloso, J; Virius, M; Weisrock, T; Wilfert, M; ter Wolbeek, J; Zaremba, K; Zavertyaev, M; Zemlyanichkina, E; Ziembicki, M; Zink, A

    2015-01-01

    The COMPASS collaboration has collected the currently largest data set on diffractively produced $\\pi^-\\pi^-\\pi^+$ final states using a negative pion beam of 190 GeV/$\\it c$ momentum impinging on a stationary proton target. This data set allows for a systematic partial-wave analysis in 100 bins of three-pion mass, 0.5 GeV/$\\it c^2$ < $m_{3\\pi}$ < 2.5 GeV/$\\it c^2$ and in 11 bins of the reduced four-momentum transfer squared, 0.1 (GeV/$\\it c$)$^2$ < t$ ^{\\prime}$ < 1.0 (GeV/$\\it c$)$^2$. This two-dimensional analysis offers sensitivity to genuine one-step resonance production, i.e. the production of a state followed by its decay, as well as to more complex dynamical effects in nonresonant $3\\pi$ production. In this paper, we present detailed studies on selected $3\\pi$ partial waves with $J^{PC} = 0^{-+}$, $1^{++}$, $2^{-+}$, $2^{++}$, and $4^{++}$. In these waves, we observe the well-known ground-state mesons as well as a new narrow axial-vector meson ${\\it a}_1$(1420) decaying into ${\\it f}_0$(980...

  6. Raspberry Pi projects for dummies

    CERN Document Server

    Cook, Mike; Craft, Brock

    2015-01-01

    Join the Raspberry revolution with these fun and easy Pi projects The Raspberry Pi has opened up a whole new world of innovation for everyone from hardware hackers and programmers to students, hobbyists, engineers, and beyond. Featuring a variety of hands-on projects, this easy-to-understand guide walks you through every step of the design process and will have you creating like a Raspberry Pi pro in no time. You'll learn how to prepare your workspace, assemble the necessary tools, work with test equipment, and find your way around the Raspberry Pi before moving on to a series of fun, livel

  7. Exotic Meson Decay to {omega}{pi}{sup 0}{pi}{sup -}

    Energy Technology Data Exchange (ETDEWEB)

    M. Lu; G.S. Adams; T. Adams; Z. Bar-Yam; J.M. Bishop; V.A. Bodyagin; D.S. Brown; N.M. Cason; S.U. Chung; J.P. Cummings; K. Danyo; A.I. Demianov; S.P. Denisov; V. Dorofeev; J.P. Dowd; P. Eugenio; X.L. Fan; A.M. Gribushin; R.W. Hackenburg; M. Hayek; J. Hu; E.I. Ivanov; D. Joffe; I. Kachaev; W. Kern; E. King; O.L. Kodolova; V.L. Korotkikh; M.A. Kostin; J. Kuhn; V.V. Lipaev; J.M. LoSecco; J.J. Manak; J. Napolitano; M. Nozar; C. Olchanski; A.I. Ostrovidov; T.K. Pedlar; A.V. Popov; D.I. Ryabchikov; L.I. Sarycheva; K.K. Seth; N. Shenhav; X. Shen; W.D. Shephard; N.B. Sinev; D.L. Stienike; J.S. Suh; S.A. Taegar; A. Tomaradze; I.N. Vardanyan; D.P. Weygand; D.B. White; H.J. Willutzki; M. Witkowski; A.A. Yershov

    2004-05-01

    A partial-wave analysis of the mesons from the reaction {pi}{sup -} p {yields} {pi}{sup +}{pi}{sup -}{pi}{sup -}{pi}{sup 0}{pi}{sup 0}p has been performed. The data show b{sub 1}{pi} decay of the spin-exotic states {pi}{sub 1}(1600) and {pi}{sub 1}(2000). Three isovector 2{sup -+} states were seen in the {omega}{rho}{sup -} decay channel. In addition to the well known {pi}{sub 2}(1670), signals were also observed for {pi}{sub 2}(1880) and {pi}{sub 2}(1970).

  8. Cross-Symmetric Expansion of $\\pi \\pi$ Amplitude Near Threshold

    CERN Document Server

    Bolokhov, A A; Manida, I S; Polyakov, M V; Sherman, S G

    1996-01-01

    The near-threshold expansion of the $\\pi \\pi$ amplitude is developed using the crossing-covariant independent variables. The independent threshold parameters entering the real part of the amplitude in an explicitly Lorentz-invariant way are free from restrictions of isotopic and crossing symmetries. Parameters of the expansion of the imaginary part are recovered by the perturbative unitarity relations.

  9. Amplitude analysis of B- -> D+pi(-)pi(-) decays

    NARCIS (Netherlands)

    Aaij, R.; Adeva, B.; Adinolfi, M.; Ajaltouni, Z.; Akar, S.; Albrecht, J.; Alessio, F.; Alexander, M.; Ali, S.; Alkhazov, G.; Cartelle, P. Alvarez; Alves, A. A.; Amato, S.; Amerio, S.; Amhis, Y.; An, L.; Anderlini, L.; Andreassi, G.; Andreotti, M.; Andrews, J. E.; Appleby, R. B.; Gutierrez, O. Aquines; Archilli, F.; d'Argent, P.; Romeu, J. Arnau; Artamonov, A.; Artuso, M.; Aslanides, E.; Auriemma, G.; Baalouch, M.; Babuschkin, I.; Bachmann, S.; Back, J. J.; Badalov, A.; Baesso, C.; Baker, S.; Baldini, W.; Barlow, R. J.; Barschel, C.; Barsuk, S.; Barter, W.; Batozskaya, V.; Batsukh, B.; Battista, V.; Beaucourt, L.; Beddow, J.; Bedeschi, F.; Bediaga, I.; Bel, L. J.; Bellee, V.; Belloli, N.; Belous, K.; Belyaev, I.; Ben-Haim, E.; Bencivenni, G.; Benson, S.; Benton, J.; Berezhnoy, A.; Bernet, R.; Bertolin, A.; Betti, F.; Bettler, M. -O.; van Beuzekom, M.; Bezshyiko, I.; Bifani, S.; Billoir, P.; Bird, T.; Birnkraut, A.; Bitadze, A.; Bizzeti, A.; Blake, T.; Blanc, F.; Blouw, J.; Blusk, S.; Bocci, V.; Boettcher, T.; Bondar, A.; Bondar, N.; Bonivento, W.; Borgheresi, A.; Borghi, S.; Borisyak, M.; Borsato, M.; Bossu, F.; Boubdir, M.; Bowcock, T. J. V.; Bowen, E.; Bozzi, C.; Braun, S.; Britsch, M.; Britton, T.; Brodzicka, J.; Buchanan, E.; Burr, C.; Bursche, A.; Buytaert, J.; Cadeddu, S.; Calabrese, R.; Calvi, M.; Gomez, M. Calvo; Camboni, A.; Campana, P.; Perez, D. Campora; Perez, D. H. Campora; Capriotti, L.; Carbone, A.; Carboni, G.; Cardinale, R.; Cardini, A.; Carniti, P.; Carson, L.; Akiba, K. Carvalho; Casse, G.; Cassina, L.; Garcia, L. Castillo; Cattaneo, M.; Cauet, Ch.; Cavallero, G.; Cenci, R.; Charles, M.; Charpentier, Ph.; Chatzikonstantinidis, G.; Chefdeville, M.; Cheung, S. -F.; Chobanova, V.; Chrzaszcz, M.; Vidal, X. Cid; Ciezarek, G.; Clarke, P. E. L.; Clemencic, M.; Cliff, H. V.; Closier, J.; Coco, V.; Cogan, J.; Cogneras, E.; Cogoni, V.; Cojocariu, L.; Collazuol, G.; Collins, P.; Comerma-Montells, A.; Contu, A.; Cook, A.; Coquereau, S.; Corti, G.; Corvo, M.; Sobral, C. M. Costa; Couturier, B.; Cowan, G. A.; Craik, D. C.; Crocombe, A.; Torres, M. Cruz; Cunliffe, S.; Currie, R.; D'Ambrosio, C.; Dall'Occo, E.; Dalseno, J.; David, P. N. Y.; Davis, A.; Francisco, O. De Aguiar; De Bruyn, K.; De Capua, S.; De Cian, M.; De Miranda, J. M.; De Paula, L.; De Serio, M.; De Simone, P.; Dean, C. -T.; Decamp, D.; Deckenhoff, M.; Del Buono, L.; Demmer, M.; Derkach, D.; Deschamps, O.; Dettori, F.; Dey, B.; Di Canto, A.; Dordei, F.; Dorigo, M.; Suarez, A. Dosil; Dovbnya, A.; Dreimanis, K.; Dufour, L.; Dujany, G.; Dungs, K.; Durante, P.; Dzhelyadin, R.; Dziurda, A.; Dzyuba, A.; Deleage, N.; Easo, S.; Ebert, M.; Egede, U.; Egorychev, V.; Eidelman, S.; Eisenhardt, S.; Eitschberger, U.; Ekelhof, R.; Eklund, L.; Elsasser, Ch.; Ely, S.; Esen, S.; Evans, H. M.; Evans, T.; Falabella, A.; Farley, N.; Farry, S.; Fay, R.; Fazzini, D.; Ferguson, D.; Albor, V. Fernandez; Prieto, A. Fernandez; Ferrari, F.; Rodrigues, F. Ferreira; Ferro-Luzzi, M.; Filippov, S.; Fini, R. A.; Fiore, M.; Fiorini, M.; Firlej, M.; Fitzpatrick, C.; Fiutowski, T.; Fleuret, F.; Fohl, K.; Fontana, M.; Fontanelli, F.; Forshaw, D. C.; Forty, R.; Lima, V. Franco; Frei, C.; Furfaro, E.; Faerber, C.; Torreira, A. Gallas; Galli, D.; Gallorini, S.; Gambetta, S.; Gandelman, M.; Gandini, P.; Martin, L. M. Garcia; Pardinas, J. Garcia; Tico, J. Garra; Garrido, L.; Garsed, P. J.; Gascon, D.; Gaspar, C.; Gavardi, L.; Gazzoni, G.; Gerick, D.; Gersabeck, E.; Gersabeck, M.; Gershon, T.; Ghez, Ph.; Giani, S.; Gibson, V.; Girard, O. G.; Giubega, L.; Gizdov, K.; Gligorov, V. V.; Golubkov, D.; Golutvin, A.; Gorelov, I. V.; Gotti, C.; Gandara, M. Grabalosa; Diaz, R. Graciani; Cardoso, L. A. Granado; Grauges, E.; Graverini, E.; Graziani, G.; Grecu, A.; Griffith, P.; Grillo, L.; Cazon, B. R. Gruberg; Gruenberg, O.; Gushchin, E.; Guz, Yu.; Gys, T.; Goebel, C.; Hadavizadeh, T.; Hadjivasiliou, C.; Haefeli, G.; Haen, C.; Haines, S. C.; Hall, S.; Hamilton, B.; Hansmann-Menzemer, S.; Harnew, N.; Harnew, S. T.; Harrison, J.; Hatch, M.; He, J.; Head, T.; Heister, A.; Hennessy, K.; Henrard, P.; Henry, L.; Morata, J. A. Hernando; Van Herwijnen, E.; Hess, M.; Hicheur, A.; Hill, D.; Hombach, C.; Hulsbergen, W.; Humair, T.; Hushchyn, M.; Hutchcroft, D.; Idzik, M.; Ilten, P.; Jacobsson, R.; Jalocha, J.; Jans, E.; Jawahery, A.; Jiang, F.; John, M.; Johnson, D.; Jones, C. R.; Joram, C.; Jost, B.; Jurik, N.; Kandybei, S.; Kanso, W.; Karacson, M.; Kariuki, J. M.; Karodia, S.; Kecke, M.; Kelsey, M.; Kenyon, I. R.; Kenzie, M.; Ketel, T.; Khairullin, E.; Khanji, B.; Khurewathanakul, C.; Kirn, T.; Klaver, S.; Klimaszewski, K.; Koliiev, S.; Kolpin, M.; Komarov, I.; Koppenburg, P.; Kozachuk, A.; Kozeiha, M.; Kravchuk, L.; Kreplin, K.; Kreps, M.; Krokovny, P.; Krzemien, W.; Kucewicz, W.; Kucharczyk, M.; Kudryavtsev, V.; Kuonen, A. K.; Kurek, K.; Kvaratskheliya, T.; Lacarrere, D.; Lafferty, G.; Lai, A.; Lambert, D.; Lanfranchi, G.; Langenbruch, C.; Latham, T.; Lazzeroni, C.; Le Gac, R.; van Leerdam, J.; Lees, J. -P.; Leflat, A.; Lefrancois, J.; Lefevre, R.; Lemaitre, F.; Cid, E. Lemos; Leroy, O.; Lesiak, T.; Leverington, B.; Likhomanenko, T.; Lindner, R.; Linn, C.; Lionetto, F.; Loh, D.; Longstaff, I.; Lopes, J. H.; Lucchesi, D.; Martinez, M. Lucio; Luo, H.; Lupato, A.; Luppi, E.; Lupton, O.; Lusiani, A.; Lyu, X.; Machefert, F.; Maciuc, F.; Maev, O.; Maguire, K.; Malde, S.; Malinin, A.; Maltsev, T.; Manca, G.; Mancinelli, G.; Manning, P.; Maratas, J.; Marchand, J. F.; Marconi, U.; Benito, C. Marin; Marino, P.; Marks, J.; Martellotti, G.; Martinelli, M.; Santos, D. Martinez; Vidal, F. Martinez; Tostes, D. Martins; Massacrier, L. M.; Massafferri, A.; Matev, R.; Mathad, A.; Mathe, Z.; Matteuzzi, C.; Mauri, A.; Maurin, B.; Mazurov, A.; McCann, M.; McCarthy, J.; Mcnab, A.; McNulty, R.; Meadows, B.; Meier, F.; Melnychuk, D.; Merk, M.; Merli, A.; Michielin, E.; Milanes, D. A.; Minard, M. -N.; Mitzel, D. S.; Mogini, A.; Rodriguez, J. Molina; Monroy, I. A.; Monteil, S.; Morandin, M.; Morawski, P.; Morda, A.; Morello, M. J.; Moron, J.; Morris, A. B.; Mountain, R.; Muheim, F.; Mulder, M.; Mussini, M.; Mueller, J.; Mueller, K.; Mueller, V.; Naik, P.; Nakada, T.; Nandakumar, R.; Nandi, A.; Nasteva, I.; Needham, M.; Neri, N.; Neubert, S.; Neufeld, N.; Neuner, M.; Nguyen, A. D.; Nguyen-Mau, C.; Nieswand, S.; Niet, R.; Nikitin, N.; Nikodem, T.; Novoselov, A.; O'Hanlon, D. P.; Oblakowska-Mucha, A.; Obraztsov, V.; Ogilvy, S.; Oldeman, R.; Onderwater, C. J. G.; Goicochea, J. M. Otalora; Otto, A.; Owen, P.; Oyanguren, A.; Pais, P. R.; Palano, A.; Palombo, F.; Palutan, M.; Papanestis, A.; Pappagallo, M.; Pappalardo, L. L.; Parker, W.; Parkes, C.; Passaleva, G.; Pastore, A.; Patel, G. D.; Patrignani, C.; Pearce, A.; Pellegrino, A.; Penso, G.; Altarelli, M. Pepe; Perazzini, S.; Perret, P.; Pescatore, L.; Petridis, K.; Petrolini, A.; Petrov, A.; Petruzzo, M.; Olloqui, E. Picatoste; Pietrzyk, B.; Pikies, M.; Pinci, D.; Pistone, A.; Piucci, A.; Playfer, S.; Casasus, M. Plo; Poikela, T.; Polci, F.; Poluektov, A.; Polyakov, I.; Polycarpo, E.; Pomery, G. J.; Popov, A.; Popov, D.; Popovici, B.; Poslavskii, S.; Potterat, C.; Price, E.; Price, J. D.; Prisciandaro, J.; Pritchard, A.; Prouve, C.; Pugatch, V.; Navarro, A. Puig; Punzi, G.; Qian, W.; Quagliani, R.; Rachwal, B.; Rademacker, J. H.; Rama, M.; Pernas, M. Ramos; Rangel, M. S.; Raniuk, I.; Raven, G.; Redi, F.; Reichert, S.; dos Reis, A. C.; Alepuz, C. Remon; Renaudin, V.; Ricciardi, S.; Richards, S.; Rihl, M.; Rinnert, K.; Molina, V. Rives; Rodrigues, A. B.; Rodrigues, E.; Lopez, J. A. Rodriguez; Perez, P. Rodriguez; Rogozhnikov, A.; Roiser, S.; Romanovskiy, V.; Vidal, A. Romero; Ronayne, J. W.; Rotondo, M.; Ruf, T.; Valls, P. Ruiz; Silva, J. J. Saborido; Sadykhov, E.; Sagidova, N.; Saitta, B.; Guimaraes, V. Salustino; Mayordomo, C. Sanchez; Sedes, B. Sanmartin; Santacesaria, R.; Rios, C. Santamarina; Santimaria, M.; Santovetti, E.; Sarti, A.; Satriano, C.; Satta, A.; Saunders, D. M.; Savrina, D.; Schael, S.; Schellenberg, M.; Schindler, H.; Schlupp, M.; Schmelling, M.; Schmelzer, T.; Schmidt, B.; Schneider, O.; Schopper, A.; Schubiger, M.; Schune, M. -H.; Schwemmer, R.; Sciascia, B.; Sciubba, A.; Semennikov, A.; Sergi, A.; Serra, N.; Serrano, J.; Sestini, L.; Seyfert, P.; Shapkin, M.; Shapoval, I.; Shcheglov, Y.; Shears, T.; Shekhtman, L.; Shevchenko, V.; Shires, A.; Siddi, B. G.; Coutinho, R. Silva; de Oliveira, L. Silva; Simi, G.; Simone, S.; Sirendi, M.; Skidmore, N.; Skwarnicki, T.; Smith, I. T.; Snoek, H.; Sokoloff, M. D.; Soler, F. J. P.; Souza, D.; De Paula, B. Souza; Spaan, B.; Spradlin, P.; Sridharan, S.; Stagni, F.; Stahl, M.; Stahl, S.; Stefko, P.; Stefkova, S.; Steinkamp, O.; Stemmle, S.; Stenyakin, O.; Stevenson, S.; Stone, S.; Storaci, B.; Stracka, S.; Straticiuc, M.; Straumann, U.; Sutcliffe, W.; Swientek, K.; Syropoulos, V.; Szczekowski, M.; Szumlak, T.; T'Jampens, S.; Tayduganov, A.; Tekampe, T.; Tellarini, G.; Teubert, F.; van Tilburg, J.; Tilley, M. J.; Tisserand, V.; Tobin, M.; Tolk, S.; Tomassetti, L.; Tonelli, D.; Topp-Joergensen, S.; Toriello, F.; Tournefier, E.; Tourneur, S.; Trabelsi, K.; Traill, M.; Tresch, M.; Trisovic, A.; Tsaregorodtsev, A.; Tsopelas, P.; Tully, A.; Tuning, N.; Ukleja, A.; Ustyuzhanin, A.; Uwer, U.; Vacca, C.; Vagnoni, V.; Valat, S.; Valenti, G.; Vallier, A.; Gomez, R. Vazquez; Regueiro, P. Vazquez; Vecchi, S.; van Veghel, M.; Velthuis, J. J.; Veltri, M.; Veneziano, G.; Venkateswaran, A.; Vernet, M.; Vesterinen, M.; Viaud, B.; Vieira, D.; Diaz, M. Vieites; Vilasis-Cardona, X.; Volkov, V.; Vollhardt, A.; Voneki, B.; Voong, D.; Vorobyev, A.; Vorobyev, V.; Voss, C.; Sierra, C. Vazquez; Waldi, R.; Wallace, C.; Wallace, R.; Ward, D. R.; Wark, H. M.; Watson, N. K.; Websdale, D.; Weiden, A.; Whitehead, M.; Wicht, J.; Wilkinson, G.; Williams, T.; Wilson, F. F.; Wimberley, J.; Wishahi, J.; Wislicki, W.; Witek, M.; Wormser, G.; Wotton, S. A.; Wraight, K.; Wright, S.; Wyllie, K.; Xie, Y.; Xing, Z.; Yang, Z.; Yu, J.; Yuan, X.; Yushchenko, O.; Zangoli, M.; Zarebski, K. A.; Zavertyaev, M.; Zhelezov, A.; Zheng, Y.; Zhokhov, A.; Zhukov, V.; Zucchelli, S.

    2016-01-01

    The Dalitz plot analysis technique is used to study the resonant substructures of B- -> D+pi(-)pi(-) decays in a data sample corresponding to 3.0 fb(-1) of pp collision data recorded by the LHCb experiment during 2011 and 2012. A model-independent analysis of the angular moments demonstrates the pre

  10. Strong Orbital Interaction in pi-pi Stacking System

    CERN Document Server

    Fu, Xiao-Xiao; Zhang, Rui-Qin

    2016-01-01

    A simple prototypical model of aromatic pi-pi stacking system -- benzene sandwich dimer is investigated by ab initio calculations based on second-order Moller-Plesset perturbation theory (MP2) and Minnesota hybrid functional M06-2X.

  11. Three-body FSIs in D+ ---> K- pi+ pi+

    CERN Document Server

    Magalhães, Patrícia C; Guimarães, K S F F; Frederico, T; de Paula, W; dos Reis, A C; Bediaga, I

    2011-01-01

    We stress the importance of three-body final state interactions in $D^+ \\to K^- \\p^+ \\p^+$. The basic building block is the $K\\pi$ amplitude with parameters determined by a fit to elastic LASS data. Based on a vector weak vertex, we can describe the $K\\pi$ phase production experimental in the elastic region.

  12. Search for $\\B^{0}\\to \\pi^{0}\\pi^{0}$ Decay

    CERN Document Server

    Asner, D M; Hill, T S; Morrison, R J; Briere, R A; Chen, G P; Ferguson, T; Vogel, H; Gritsan, A; Alexander, J P; Baker, R; Bebek, C; Berger, B E; Berkelman, K; Blanc, F; Boisvert, V; Cassel, David G; Drell, P S; Duboscq, J E; Ecklund, K M; Ehrlich, R; Gaidarev, P B; Gibbons, L K; Gittelman, B; Gray, S W; Hartill, D L; Heltsley, B K; Hopman, P I; Hsu, L; Jones, C D; Kandaswamy, J; Kreinick, D L; Lohner, M; Magerkurth, A; Meyer, T O; Mistry, N B; Nordberg, E; Palmer, M; Patterson, J R; Peterson, D; Riley, D; Romano, A; Thayer, J G; Urner, D; Valant-Spaight, B L; Viehhauser, G; Warburton, A; Avery, P; Prescott, C; Rubiera, A I; Stöck, H; Yelton, J; Brandenburg, G; Ershov, A; Kim, D Y J; Wilson, R; Bergfeld, T; Eisenstein, B I; Ernst, J; Gladding, G E; Gollin, G D; Hans, R M; Johnson, E; Karliner, I; Marsh, M A; Plager, C; Sedlack, C; Selen, M; Thaler, J J; Williams, J; Edwards, K W; Janicek, R; Patel, P M; Sadoff, A J; Ammar, R; Bean, A; Besson, D; Zhao, X; Anderson, S; Frolov, V V; Kubota, Y; Lee, S J; O'Neill, J J; Poling, R A; Riehle, T; Smith, A; Stepaniak, C J; Urheim, J; Ahmed, S; Alam, M S; Athar, S B; Jian, L; Ling, L; Saleem, M; Timm, S; Wappler, F; Anastassov, A; Eckhart, E; Gan, K K; Gwon, C; Hart, T; Honscheid, K; Hufnagel, D; Kagan, H; Kass, R; Pedlar, T K; Schwarthoff, H; Thayer, J B; Von Törne, E; Zoeller, M M; Richichi, S J; Severini, H; Skubic, P L; Undrus, A; Savinov, V; Chen, S; Fast, J; Hinson, J W; Lee, J; Miller, D H; Shibata, E I; Shipsey, I P J; Pavlunin, V; Cronin-Hennessy, D; Lyon, A L; Thorndike, E H; Coan, T E; Fadeev, V; Gao, Y S; Maravin, Y; Narsky, I; Stroynowski, R; Ye, J; Wlodek, T; Artuso, M; Boulahouache, C; Bukin, K; Dambasuren, E; Majumder, G; Mountain, R; Schuh, S; Skwarnicki, T; Stone, S; Wang, J C; Wolf, A; Wu, J; Kopp, S E; Kostin, M A; Mahmood, A H; Csorna, S E; Danko, I; McLean, K W; Xu, Z; Godang, R; Bonvicini, G; Cinabro, D; Dubrovin, M; McGee, S; Zhou, G J; Bornheim, A; Lipeles, E; Pappas, S P; Schmidtler, M; Shapiro, A; Sun, W M; Weinstein, A J; Jaffe, D E; Mahapatra, R; Masek, G; Paar, H P

    2002-01-01

    We report on the observation of Bbar -> D(*) pi+ pi- pi- pi^0 decays. The branching ratios for D*+ and D*0 are (1.72+/-0.14+/-0.24)% and (1.80+/-0.24+/-0.27)%, respectively. Each final state has a D* omega pi- component, with branching ratios (0.29+/-0.03+/-0.04)% and (0.45+/-0.10+/-0.07)% for the D*+ and D*0 modes, respectively. We also observe B -> D omega pi- decays. The branching ratios for D+ and D0 are (0.28+/-0.05+/-0.04)% and (0.41+/-0.07+/-0.06)%, respectively. A spin parity analysis of the D omega pi- final state prefers a wide 1^- resonance. A fit to the omega pi- mass spectrum finds a central mass of (1349+/-25^{+10}_{-5}) MeV and width of (547+/-86^{+46}_{-45}) MeV. We identify this object as the rho(1450) or the \\rho'.

  13. Measurement of the branching fraction and decay rate asymmetry of B- --> D_{pi+pi-pi0}K-

    CERN Document Server

    Aubert, B; Boutigny, D; Couderc, F; Karyotakis, Yu; Lees, J P; Poireau, V; Tisserand, V; Zghiche, A; Graugès-Pous, E; Palano, A; Pappagallo, M; Pompili, A; Chen, J C; Qi, N D; Rong, G; Wang, P; Zhu, Y S; Eigen, G; Ofte, I; Stugu, B; Abrams, G S; Battaglia, M; Borgland, A W; Breon, A B; Brown, D N; Button-Shafer, J; Cahn, R N; Charles, E; Day, C T; Gill, M S; Gritsan, A V; Groysman, Y; Jacobsen, R G; Kadel, R W; Kadyk, J; Kerth, L T; Kolomensky, Yu G; Kukartsev, G; Lynch, G; Mir, L M; Oddone, P J; Orimoto, T J; Pripstein, M; Roe, N A; Ronan, M T; Wenzel, W A; Barrett, M; Ford, K E; Harrison, T J; Hart, A J; Hawkes, C M; Morgan, S E; Watson, A T; Fritsch, M; Goetzen, K; Held, T; Koch, H; Lewandowski, B; Pelizaeus, M; Peters, K; Schröder, T; Steinke, M; Boyd, J T; Burke, J P; Chevalier, N; Cottingham, W N; Kelly, M P; Çuhadar-Dönszelmann, T; Hearty, C; Knecht, N S; Mattison, T S; McKenna, J A; Khan, A; Kyberd, P; Teodorescu, L; Blinov, A E; Blinov, V E; Bukin, A D; Druzhinin, V P; Golubev, V B; Kravchenko, E A; Onuchin, A P; Serednyakov, S I; Skovpen, Yu I; Solodov, E P; Yushkov, A N; Best, D; Bondioli, M; Bruinsma, M; Chao, M; Eschrich, I; Kirkby, D; Lankford, A J; Mandelkern, M A; Mommsen, R K; Röthel, W; Stoker, D P; Buchanan, C; Hartfiel, B L; Weinstein, A J R; Foulkes, S D; Gary, J W; Long, O; Shen, B C; Wang, K; Zhang, L; Del Re, D; Hadavand, H K; Hill, E J; MacFarlane, D B; Paar, H P; Rahatlou, S; Sharma, V; Berryhill, J W; Campagnari, C; Cunha, A; Dahmes, B; Hong, T M; Lu, A; Mazur, M A; Richman, J D; Verkerke, W; Beck, T W; Eisner, A M; Flacco, C J; Heusch, C A; Kroseberg, J; Lockman, W S; Nesom, G; Schalk, T; Schumm, B A; Seiden, A; Spradlin, P; Williams, D C; Wilson, M G; Albert, J; Chen, E; Dubois-Felsmann, G P; Dvoretskii, A; Hitlin, D G; Narsky, I; Piatenko, T; Porter, F C; Ryd, A; Samuel, A; Andreassen, R; Jayatilleke, S M; Mancinelli, G; Meadows, B T; Sokoloff, M D; Blanc, F; Bloom, P; Chen, S; Ford, W T; Nauenberg, U; Olivas, A; Rankin, P; Ruddick, W O; Smith, J G; Ulmer, K A; Wagner, S R; Zhang, J; Chen, A; Eckhart, E A; Soffer, A; Toki, W H; Wilson, R J; Zeng, Q; Feltresi, E; Hauke, A; Spaan, B; Altenburg, D; Brandt, T; Brose, J; Dickopp, M; Klose, V; Lacker, H M; Nogowski, R; Otto, S; Petzold, A; Schott, G; Schubert, J; Schubert, K R; Schwierz, R; Sundermann, J E; Bernard, D; Bonneaud, G R; Grenier, P; Schrenk, S; Thiebaux, C; Vasileiadis, G; Verderi, M; Bard, D J; Clark, P J; Gradl, W; Muheim, F; Playfer, S; Xie, Y; Andreotti, M; Azzolini, V; Bettoni, D; Bozzi, C; Calabrese, R; Cibinetto, G; Luppi, E; Negrini, M; Piemontese, L; Anulli, F; Baldini-Ferroli, R; Calcaterra, A; De Sangro, R; Finocchiaro, G; Patteri, P; Peruzzi, I M; Piccolo, M; Zallo, A; Buzzo, A; Capra, R; Contri, R; Lo Vetere, M; Macri, M; Monge, M R; Passaggio, S; Patrignani, C; Robutti, E; Santroni, A; Tosi, S; Bailey, S; Brandenburg, G; Chaisanguanthum, K S; Morii, M; Won, E; Dubitzky, R S; Langenegger, U; Marks, J; Schenk, S; Uwer, U; Bhimji, W; Bowerman, D A; Dauncey, P D; Egede, U; Flack, R L; Gaillard, J R; Morton, G W; Nash, J A; Nikolich, M B; Taylor, G P; Charles, M J; Mader, W F; Mallik, U; Mohapatra, A K; Cochran, J; Crawley, H B; Eyges, V; Meyer, W T; Prell, S; Rosenberg, E I; Rubin, A E; Yi, J; Arnaud, N; Davier, M; Giroux, X; Grosdidier, G; Höcker, A; Le Diberder, F R; Lepeltier, V; Lutz, A M; Oyanguren, A; Petersen, T C; Pierini, M; Plaszczynski, S; Rodier, S; Roudeau, P; Schune, M H; Stocchi, A; Wormser, G; Cheng, C H; Lange, D J; Simani, M C; Wright, D M; Bevan, A J; Chavez, C A; Coleman, J P; Forster, I J; Fry, J R; Gabathuler, E; Gamet, R; George, K A; Hutchcroft, D E; Parry, R J; Payne, D J; Schofield, K C; Touramanis, C; Cormack, C M; Di Lodovico, F; Sacco, R; Brown, C L; Cowan, G; Flächer, H U; Green, M G; Hopkins, D A; Jackson, P S; McMahon, T R; Ricciardi, S; Salvatore, F; Brown, D; Davis, C L; Allison, J; Barlow, N R; Barlow, R J; Hodgkinson, M C; Lafferty, G D; Naisbit, M T; Williams, J C; Chen, C; Farbin, A; Hulsbergen, W D; Jawahery, A; Kovalskyi, D; Lae, C K; Lillard, V; Roberts, D A; Simi, G; Blaylock, G; Dallapiccola, C; Hertzbach, S S; Kofler, R; Koptchev, V B; Li, X; Moore, T B; Saremi, S; Stängle, H; Willocq, S; Cowan, R; Koeneke, K; Sciolla, G; Sekula, S J; Taylor, F; Yamamoto, R K; Kim, H; Patel, P M; Robertson, S H; Lazzaro, A; Lombardo, V; Palombo, F; Bauer, J M; Cremaldi, L; Eschenburg, V; Godang, R; Kroeger, R; Reidy, J; Sanders, D A; Summers, D J; Zhao, H W; Brunet, S; Côté, D; Taras, P; Viaud, B; Nicholson, H; Cavallo, N; De Nardo, Gallieno; Fabozzi, F; Gatto, C; Lista, L; Monorchio, D; Paolucci, P; Piccolo, D; Sciacca, C; Baak, M; Bulten, H; Raven, G; Snoek, H L; Wilden, L; Jessop, C P; LoSecco, J M; Allmendinger, T; Benelli, G; Gan, K K; Honscheid, K; Hufnagel, D; Jackson, P D; Kagan, H; Kass, R; Pulliam, T; Rahimi, A M; Ter-Antonian, R; Wong, Q K; Brau, J E; Frey, R; Igonkina, O; Lu, M; Potter, C T; Sinev, N B; Strom, D; Torrence, E; Colecchia, F; Dorigo, A; Galeazzi, F; Margoni, M; Morandin, M; Posocco, M; Rotondo, M; Simonetto, F; Stroili, R; Voci, C; Benayoun, M; Briand, H; Chauveau, J; David, P; Del Buono, L; La Vaissière, C de; Hamon, O; John, M J J; Leruste, P; Malcles, J; Ocariz, J; Roos, L; Therin, G; Behera, P K; Gladney, L; Guo, Q H; Panetta, J; Biasini, M; Covarelli, R; Pacetti, S; Pioppi, M; Angelini, C; Batignani, G; Bettarini, S; Bucci, F; Calderini, G; Carpinelli, M; Cenci, R; Forti, F; Giorgi, M A; Lusiani, A; Marchiori, G; Morganti, M; Neri, N; Paoloni, E; Rama, M; Rizzo, G; Walsh, J; Haire, M; Judd, D; Paick, K; Wagoner, D E; Biesiada, J; Danielson, N; Elmer, P; Lau, Y P; Lü, C; Olsen, J; Smith, A J S; Telnov, A V; Bellini, F; Cavoto, G; D'Orazio, A; Di, E; Faccini, R; Ferrarotto, F; Ferroni, F; Gaspero, M; Li Gioi, L; Mazzoni, M A; Morganti, S; Piredda, G; Polci, F; Safai-Tehrani, F; Voena, C; Schröder, H; Wagner, G; Waldi, R; Adye, T; De, N; Groot, M; Franek, B; Gopal, G P; Olaiya, E O; Wilson, F F; Aleksan, Roy; Emery, S; Gaidot, A; Ganzhur, S F; Giraud, P F; Graziani, G; Hamel de Monchenault, G; Kozanecki, Witold; Legendre, M; London, G W; Mayer, B; Vasseur, G; Yéche, C; Zito, M; Purohit, M V; Weidemann, A W; Wilson, J R; Yumiceva, F X; Abe, T; Allen, M T; Aston, D; Bartoldus, R; Berger, N; Boyarski, A M; Buchmüller, O L; Claus, R; Convery, M R; Cristinziani, M; Dingfelder, J C; Dong, D; Dorfan, J; Dujmic, D; Dunwoodie, W M; Fan, S; Field, R C; Glanzman, T; Gowdy, S J; Hadig, T; Halyo, V; Hast, C; Hrynóva, T; Innes, W R; Kelsey, M H; Kim, P; Kocian, M L; Leith, D W G S; Libby, J; Luitz, S; Lüth, V; Lynch, H L; Marsiske, H; Messner, R; Müller, D R; O'Grady, C P; Ozcan, V E; Perazzo, A; Perl, M; Ratcliff, B N; Roodman, A; Salnikov, A A; Schindler, R H; Schwiening, J; Snyder, A; Stelzer, J; Strube, J; Su, D; Sullivan, M K; Suzuki, K; Swain, S; Thompson, J M; Vavra, J; Weaver, M; Wisniewski, W J; Wittgen, M; Wright, D H; Yarritu, A K; Yi, K; Young, C C; Burchat, Patricia R; Edwards, A J; Majewski, S A; Petersen, B A; Roat, C; Ahmed, M; Ahmed, S; Alam, M S; Ernst, J A; Saeed, M A; Saleem, M; Wappler, F R; Zain, S B; Bugg, W; Krishnamurthy, M; Spanier, S M; Eckmann, R; Ritchie, J L; Satpathy, A; Schwitters, R F; Izen, J M; Kitayama, I; Lou, X C; Ye, S; Bianchi, F; Bóna, M; Gallo, F; Gamba, D; Bomben, M; Bosisio, L; Cartaro, C; Cossutti, F; Della, G; Ricca; Dittongo, S; Grancagnolo, S; Lanceri, L; Poropat, P; Vitale, L; Martínez-Vidal, F; Panvini, R S; Banerjee, S; Bhuyan, B; Brown, C M; Fortin, D; Hamano, K; Kowalewski, R V; Roney, J M; Sobie, R J; Back, J J; Harrison, P F; Latham, T E; Mohanty, G B; Band, H R; Chen, X; Cheng, B; Dasu, S; Datta, M; Eichenbaum, A M; Flood, K T; Graham, M; Hollar, J J; Johnson, J R; Kutter, P E; Li, H; Liu, R; Mellado, B; Mihályi, A; Pan, Y; Prepost, R; Tan, P; Von Wimmersperg-Töller, J H; Wu, J; Wu, S L; Yu, Z; Greene, M G; Neal, H

    2005-01-01

    We report the observation of the decay $B^- \\to D_{\\pi^+\\pi^-\\pi^0} K^-$, where $D_{\\pi^+\\pi^-\\pi^0}$ indicates a neutral $D$ meson detected in the final state $\\pi^+\\pi^-\\pi^0$, excluding $K_S \\pi^0$. This doubly Cabibbo-suppressed decay chain can be used to measure the CKM phase $\\gamma$. Using about 229 million $e^+e^- \\to B \\bar B$ events recorded by the BaBar experiment at the PEP-II $e^+e^-$ storage ring, we measure the branching fraction ${\\cal B}(B^- \\to D_{\\pi^+\\pi^-\\pi^0} K^-) = (5.5 \\pm 1.0 {\\rm(stat.)} \\pm 0.7 {\\rm(syst.)})\\times 10^{-6}$ and the decay rate asymmetry $A = 0.02 \\pm 0.16 {\\rm(stat.)} \\pm 0.03 {\\rm(syst.)}$ for the full decay chain.

  14. Search for $\\psi(2S) \\to \\eta_c \\pi^+ pi^- pi^0$

    CERN Document Server

    Pedlar, T; Gao, K Y; Gong, D T; Hietala, J; Kubota, Y; Klein, T; Lang, B W; Poling, R; Scott, A W; Smith, A; Zweber, P; Dobbs, S; Metreveli, Z V; Seth, K K; Tomaradze, A G; Ernst, J; Severini, H; Dytman, S A; Love, W; Savinov, V; Aquines, O; Li, Z; López, A; Mehrabyan, S S; Méndez, H; Ramírez, J; Huang, G S; Miller, D H; Pavlunin, V; Sanghi, B; Shipsey, I P J; Xin, B; Adams, G S; Anderson, M; Cummings, J P; Danko, I; Napolitano, J; He, Q; Insler, J; Muramatsu, H; Park, C S; Thorndike, E H; Yang, F; Coan, T E; Gao, Y S; Liu, F; Artuso, M; Blusk, S; Butt, J; Li, J; Menaa, N; Mountain, R; Nisar, S; Randrianarivony, K; Redjimi, R; Sia, R; Skwarnicki, T; Stone, S; Wang, J C; Zhang, K; Csorna, S E; Bonvicini, G; Cinabro, D; Dubrovin, M; Lincoln, A; Asner, D M; Edwards, K W; Briere, R A; Brock, I; Chen, J; Ferguson, T; Tatishvili, G T; Vogel, H; Watkins, M E; Rosner, J L; Adam, N E; Alexander, J P; Berkelman, K; Cassel, D G; Duboscq, J E; Ecklund, K M; Ehrlich, R; Fields, L; Galik, R S; Gibbons, L; Gray, R; Gray, S W; Hartill, D L; Heltsley, B K; Hertz, D; Jones, C D; Kandaswamy, J; Kreinick, D L; Kuznetsov, V E; Mahlke-Krüger, H; Onyisi, P U E; Patterson, J R; Peterson, D; Pivarski, J; Riley, D; Ryd, A; Sadoff, A J; Schwarthoff, H; Shi, X; Stroiney, S; Sun, W M; Wilksen, T; Weinberger, M; Athar, S B; Patel, R; Potlia, V; Yelton, J; Rubin, P; Cawlfield, C; Eisenstein, B I; Karliner, I; Kim, D; Lowrey, N; Naik, P; Sedlack, C; Selen, M; White, E J; Wiss, J; Shepherd, M R; Besson, D; al, et

    2007-01-01

    Using 5.63 pb^-1 of data accumulated at the psi(2S) resonance with the CLEO III and CLEO-c detectors corresponding to 3.08 million psi(2S) decays, a search is performed for the decay psi(2S) -> eta_c pi^+pi^-pi^0 to test a theoretical prediction based upon the assumption that the c \\bar c pair in the psi(2S) does not annihilate directly into three gluons but rather survives before annihilating. No signal is observed, and a combined upper limit from six eta_c decay modes is determined to be B(psi(2S) -> eta_c pi^+pi^-pi^0) < 1.0 x 10^-3 at 90% C.L. This upper limit is about an order of magnitude below the theoretical expectation.

  15. Search For the Highly Suppressed Decays B- -> K+ pi- pi- and B- -> K- K- pi+

    Energy Technology Data Exchange (ETDEWEB)

    Aubert, Bernard; Bona, M.; Karyotakis, Y.; Lees, J.P.; Poireau, V.; Prencipe, E.; Prudent, X.; Tisserand, V.; /Annecy, LAPP; Garra Tico, J.; Grauges, E.; /Barcelona U., ECM; Lopez, L.; Palano, Antimo; Pappagallo, M.; /Bari U. /INFN, Bari; Eigen, G.; Stugu, Bjarne; Sun, L.; /Bergen U.; Abrams, G.S.; Battaglia, M.; Brown, D.N.; Cahn, Robert N.; Jacobsen, R.G.; /LBL, Berkeley /Birmingham U. /Ruhr U., Bochum /Bristol U. /British Columbia U. /Brunel U. /Novosibirsk, IYF /UC, Irvine /UCLA /UC, Riverside /UC, San Diego /UC, Santa Barbara /UC, Santa Cruz /Caltech /Cincinnati U. /Colorado U. /Colorado State U. /Dortmund U. /Dresden, Tech. U. /Ecole Polytechnique /Edinburgh U. /Ferrara U. /INFN, Ferrara /Frascati /Genoa U. /INFN, Genoa /Harvard U. /Heidelberg U. /Humboldt U., Berlin /Imperial Coll., London /Iowa U. /Iowa State U. /Johns Hopkins U. /Orsay, LAL /LLNL, Livermore /Liverpool U. /Queen Mary, U. of London /Royal Holloway, U. of London /Louisville U. /Mainz U., Inst. Kernphys. /Manchester U. /Maryland U. /Massachusetts U., Amherst /MIT /McGill U. /Consorzio Milano Ricerche /INFN, Milan /Mississippi U. /Montreal U. /Mt. Holyoke Coll. /Napoli Seconda U. /INFN, Naples /NIKHEF, Amsterdam /Notre Dame U. /Ohio State U. /Oregon U. /Padua U. /INFN, Padua /Paris U., VI-VII /Pennsylvania U. /Perugia U. /INFN, Perugia /INFN, Pisa /Princeton U. /Banca di Roma /Frascati /Rostock U. /Rutherford /DAPNIA, Saclay /South Carolina U. /SLAC /Stanford U., Phys. Dept. /SUNY, Albany /Tennessee U. /Texas U. /Texas U., Dallas /Turin U. /INFN, Turin /Trieste U. /INFN, Trieste /Valencia U., IFIC /Victoria U. /Warwick U. /Wisconsin U., Madison

    2008-08-11

    The authors report a search for the decays B{sup -} {yields} K{sup +}{pi}{sup -}{pi}{sup -} and B{sup -} {yields} K{sup -}K{sup -}{pi}{sup +}, which are highly suppressed in the Standard Model. Using a sample of (467 {+-} 5) x 10{sup 6} B{bar B} pairs collected with the BABAR detector, they do not see any evidence of these decays and determine 90% confidence level upper limits of {Beta}(B{sup -} {yields} K{sup +}{pi}{sup -}{pi}{sup -}) < 9.5 x 10{sup -7} and {Beta}(B{sup -} {yields} K{sup -}K{sup -}{pi}{sup +}) < 1.6 x 10{sup -7} on the corresponding branching fractions, including systematic uncertainties.

  16. Dalitz plot slope parameters for $K \\to \\pi\\pi\\pi$ decays and two particle interference

    CERN Document Server

    Martínez, M I

    2001-01-01

    We study the possible distortion of phase-space in the decays $K \\to \\pi \\pi \\pi$, which may result from final state interference among the decay products. Such distortion may influence the values of slope parameters extracted from the Dalitz plot distribution of these decays. We comment on the consequences on the magnitude of violation of the $\\mid \\Delta I \\mid = 1/2$ rule in these decays.

  17. Search for the photo-excitation of exotic mesons in the pi+pi+pi- system

    CERN Document Server

    Nozar, M; Weygand, D P; Guo, L; Adams, G; Ji Li; Eugenio, P; Amaryan, M J; Anghinolfi, M; Asryan, G; Avakian, H; Bagdasaryan, H; Baillie, N; Ball, J P; Baltzell, N A; Barrow, S; Battaglieri, M; Bedlinskiy, I; Bektasoglu, M; Bellis, M; Benmouna, N; Berman, B L; Biselli, A S; Blaszczyk, L; Bonner, B E; Bouchigny, S; Boiarinov, S; Bradford, R; Branford, D; Briscoe, W J; Brooks, W K; Bültmann, S; Burkert, V D; Butuceanu, C; Calarco, J R; Careccia, S L; Carman, D S; Carnahan, B; Casey, L; Cazes, A; Chen, S; Cheng, L; Cole, P L; Collins, P; Coltharp, P; Cords, D; Corvisiero, P; Crabb, D; Crannell, H; Credé, V; Cummings, J P; Dale, D; Dashyan, N; De Masi, R; De Vita, R; De Sanctis, E; Degtyarenko, P V; Denizli, H; Dennis, L; Deur, A; Dharmawardane, K V; Dhuga, K S; Dickson, R; Djalali, C; Dodge, G E; Doughty, D; Dugger, M; Dytman, S; Dzyubak, O P; Egiyan, H; Egiyan, K S; El Fassi, L; Elouadrhiri, L; Fatemi, R; Fedotov, G; Feuerbach, R J; Forest, T A; Fradi, A; Funsten, H; Garçon, M; Gavalian, G; Gevorgyan, N; Gilfoyle, G P; Giovanetti, K L; Girod, F X; Goetz, J T; Gothe, R W; Griffioen, K A; Guidal, M; Guillo, M; Guler, N; Gyurjyan, V; Hadjidakis, C; Hafidi, K; Hakobyan, H; Hanretty, C; Hardie, J; Hassall, N; Heddle, D; Hersman, F W; Hicks, K; Hleiqawi, I; Holtrop, M; Hyde-Wright, C E; Ilieva, Y; Ireland, D G; Ishkhanov, B S; Isupov, E L; Ito, M M; Jenkins, D; Jo, H S; Johnstone, J R; Joo, K; Jüngst, H G; Kalantarians, N; Kellie, J D; Khandaker, M; Kim, W; Klein, A; Klein, F J; Kossov, M; Krahn, Z; Kramer, L H; Kubarovski, V; Kühn, J; Kuhn, S E; Kuleshov, S V; Kuznetsov, V; Lachniet, J; Laget, J M; Langheinrich, J; Lawrence, D; Livingston, K; Lu, H Y; MacCormick, M; Markov, N; Mattione, P; McAleer, S; McKinnon, B; McNabb, J W C; Mecking, B A; Mehrabyan, S; Mestayer, M D; Meyer, C A; Mibe, T; Mikhailov, K; Mirazita, M; Miskimen, R; Mokeev, V; Moreno, B; Moriya, K; Morrow, S A; Moteabbed, M; Müller, J; Munevar, E; Mutchler, G S; Nadel-Turonski, P; Nasseripour, R; Niccolai, S; Niculescu, G; Niculescu, I; Niczyporuk, B B; Niroula, M R; Niyazov, R A; O'Rielly, G V; Osipenko, M; Ostrovidov, A I; Park, K; Pasyuk, E; Paterson, C; Anefalos Pereira, S; Philips, S A; Pierce, J; Pivnyuk, N; Pocanic, D; Pogorelko, O; Polli, E; Popa, I; Pozdniakov, S; Preedom, B M; Price, J W; Prok, Y; Protopopescu, D; Qin, L M; Raue, B A; Riccardi, G; Ricco, G; Ripani, M; Ritchie, B G; Ronchetti, F; Rosner, G; Rossi, P; Rubin, P D; Sabati, F; Salamanca, J; Santoro, J P; Sapunenko, V; Schumacher, R A; Serov, V S; Sharabyan, Yu G; Sharov, D; Shvedunov, N V; Skabelin, A V; Smith, E S; Smith, L C; Sober, D I; Sokhan, D; Stavinsky, A; Stepanyan, S S; Stepanyan, S; Stokes, B E; Stoler, P; Strakovsky, I I; Strauch, S; Taiuti, M; Tedeschi, D J; Thoma, U; Tkabladze, A; Tkachenko, S; Todor, L; Ungaro, M; Vineyard, M F; Vlassov, A V; Watts, D P; Weinstein, L B; Williams, M; Wolin, E; Wood, M H; Yegneswaran, A; Zana, L; Zhang, J; Zhao, B; Zhao, Z W

    2008-01-01

    A search for exotic mesons in the $\\pi^{+}\\pi^{+}\\pi^{-}$ system photoproduced by the charge exchange reaction $\\gamma p\\to \\pi^{+}\\pi^{+}\\pi^{-}(n)$ was carried out by the CLAS collaboration at Jefferson Lab. A tagged-photon beam with energies in the 4.8 to 5.4 GeV range, produced through bremsstrahlung from a 5.744 GeV electron beam, was incident on a liquid-hydrogen target. A Partial Wave Analysis (PWA) was performed on a sample of 83,000 events, the highest such statistics to date in this reaction at these energies. The main objective of this study was to look for the photoproduction of an exotic $J^{PC} = 1^{-+}$ resonant state in the 1 to 2 GeV mass range. Our PWA analysis, based on the isobar model, shows production of the $a_{2}(1320)$ and the $\\pi_{2}(1670)$ mesons, but no evidence for the $a_{1}(1260)$, nor the $\\pi_{1}(1600)$ exotic state at the expected levels. An upper limit of 13.5 nb is determined for the exotic $\\pi_1(1600)$ cross section, less than 2% of the $a_2(1320)$ production.

  18. Archimedes and Pi-Revisited.

    Science.gov (United States)

    Bidwell, James K.

    1994-01-01

    Archimedes' method for estimating the value of pi is developed and compared with the Gregory-Machin infinite series method. Programs for the TI-81 calculator for finding the upper and lower bounds using the classical method and estimating pi using infinite series are provided.(Author/MKR)

  19. Searches for CP Violation and \\pi\\pi S-Wave in the Dalitz-Plot of D0 --> \\pi+\\pi-\\pi0

    CERN Document Server

    Cronin-Hennessy, D; Lee, J; Miller, D H; Pavlunin, V; Rangarajan, R; Sanghi, B; Shibata, E I; Shipsey, I P J; Cronin-Hennessy, D; Park, C S; Park, W; Thayer, J B; Thorndike, E H; Coan, T E; Gao, Y S; Liu, F; Stroynowski, R; Artuso, M; Boulahouache, C; Blusk, S; Dambasuren, E; Dorjkhaidav, O; Mountain, R; Muramatsu, H; Nandakumar, R; Skwarnicki, T; Stone, S; Wang, J C; Csorna, S E; Danko, I; Bonvicini, G; Cinabro, D; Dubrovin, M; McGee, S; Bornheim, A; Lipeles, E; Pappas, S P; Shapiro, A; Sun, W M; Weinstein, A J; Briere, R A; Chen, G P; Ferguson, T; Tatishvili, G T; Vogel, H; Watkins, M E; Adam, N E; Alexander, J P; Berkelman, K; Boisvert, V; Cassel, D G; Duboscq, J E; Ecklund, K M; Ehrlich, R; Galik, R S; Gibbons, L; Gittelman, B; Gray, S W; Hartill, D L; Heltsley, B K; Hsu, L; Jones, C D; Kandaswamy, J; Kreinick, D L; Magerkurth, A; Mahlke-Krüger, H; Meyer, T O; Mistry, N B; Patterson, J R; Peterson, D; Pivarski, J; Richichi, S J; Riley, D; Sadoff, A J; Schwarthoff, H; Shepherd, M R; Thayer, J G; Urner, D; Wilksen, T; Warburton, A; Weinberger, M; Athar, S B; Avery, P; Breva-Newell, L; Potlia, V; Stöck, H; Yelton, J; Benslama, K; Cawlfield, C; Eisenstein, B I; Gollin, G D; Karliner, I; Lowrey, N; Plager, C; Sedlack, C; Selen, M; Thaler, J J; Williams, J; Edwards, K W; Besson, D; Anderson, S; Frolov, V V; Gong, D T; Kubota, Y; Li, S Z; Poling, R A; Smith, A; Stepaniak, C J; Urheim, J; Metreveli, Z V; Seth, K K; Tomaradze, A G; Zweber, P; Ahmed, S; Alam, M S; Ernst, J; Jian, L; Saleem, M; Wappler, F; Arms, K; Eckhart, E; Gan, K K; Gwon, C; Honscheid, K; Kagan, H; Kass, R; Pedlar, T K; Von Törne, E; Severini, H; Skubic, P L; Dytman, S A; Müller, J A; Nam, S; Savinov, V

    2005-01-01

    In e+e- collisions using the CLEO II.V detector we have studied the Cabibbo suppressed decay of D0 -> pi+pi-pi0 with the initial flavor of the D0 tagged by the decay D*+ -> D0pi+. We use the Dalitz-plot analysis technique to measure the resonant substructure in this final state and observe \\rho\\pi and non-resonant contributions by fitting for their amplitudes and relative phases. We describe the \\pi\\pi S-wave with a K-matrix formalism and limit this contribution to the rate to be < 2.5% @95% confidence level, in contrast to previous studies with charged D meson decays. Using the amplitudes and phases from this analysis, we calculate an integrated CP asymmetry of 0.01^{+0.09}_{-0.07} +/- 0.05.

  20. Probing ultrafast \\pi\\pi*/n\\pi* internal conversion in organic chromophores via K-edge resonant absorption

    CERN Document Server

    Wolf, T J A; Cryan, J P; Coriani, S; Squibb, R J; Battistoni, A; Berrah, N; Bostedt, C; Bucksbaum, P; Coslovich, G; Feifel, R; Gaffney, K J; Grilj, J; Martinez, T J; Miyabe, S; Moeller, S P; Mucke, M; Natan, A; Obaid, R; Osipov, T; Plekan, O; Wang, S; Koch, H; Gühr, M

    2016-01-01

    Organic chromophores with heteroatoms possess an important excited state relaxation channel from an optically allowed {\\pi}{\\pi}* to a dark n{\\pi}*state. We exploit the element and site specificity of soft x-ray absorption spectroscopy to selectively follow the electronic change during the {\\pi}{\\pi}*/n{\\pi}* internal conversion. As a hole forms in the n orbital during {\\pi}{\\pi}*/n{\\pi}* internal conversion, the near edge x-ray absorption fine structure (NEXAFS) spectrum at the heteroatom K-edge exhibits an additional resonance. We demonstrate the concept with the nucleobase thymine, a prototypical heteroatomic chromophore. With the help of time resolved NEXAFS spectroscopy at the oxygen K-edge, we unambiguously show that {\\pi}{\\pi}*/n{\\pi}* internal conversion takes place within (60 \\pm 30) fs. High-level coupled cluster calculations on the isolated molecules used in the experiment confirm the superb electronic structure sensitivity of this new method for excited state investigations.

  1. Amplitude analysis of $B^- \\to D^+ \\pi^- \\pi^-$ decays

    CERN Document Server

    Aaij, Roel; Adinolfi, Marco; Ajaltouni, Ziad; Akar, Simon; Albrecht, Johannes; Alessio, Federico; Alexander, Michael; Ali, Suvayu; Alkhazov, Georgy; Alvarez Cartelle, Paula; Alves Jr, Antonio Augusto; Amato, Sandra; Amerio, Silvia; Amhis, Yasmine; An, Liupan; Anderlini, Lucio; Andreassi, Guido; Andreotti, Mirco; Andrews, Jason; Appleby, Robert; Aquines Gutierrez, Osvaldo; Archilli, Flavio; d'Argent, Philippe; Arnau Romeu, Joan; Artamonov, Alexander; Artuso, Marina; Aslanides, Elie; Auriemma, Giulio; Baalouch, Marouen; Babuschkin, Igor; Bachmann, Sebastian; Back, John; Badalov, Alexey; Baesso, Clarissa; Baker, Sophie; Baldini, Wander; Barlow, Roger; Barschel, Colin; Barsuk, Sergey; Barter, William; Batozskaya, Varvara; Batsukh, Baasansuren; Battista, Vincenzo; Bay, Aurelio; Beaucourt, Leo; Beddow, John; Bedeschi, Franco; Bediaga, Ignacio; Bel, Lennaert; Bellee, Violaine; Belloli, Nicoletta; Belous, Konstantin; Belyaev, Ivan; Ben-Haim, Eli; Bencivenni, Giovanni; Benson, Sean; Benton, Jack; Berezhnoy, Alexander; Bernet, Roland; Bertolin, Alessandro; Betti, Federico; Bettler, Marc-Olivier; van Beuzekom, Martinus; Bezshyiko, Iaroslava; Bifani, Simone; Billoir, Pierre; Bird, Thomas; Birnkraut, Alex; Bitadze, Alexander; Bizzeti, Andrea; Blake, Thomas; Blanc, Frederic; Blouw, Johan; Blusk, Steven; Bocci, Valerio; Boettcher, Thomas; Bondar, Alexander; Bondar, Nikolay; Bonivento, Walter; Borgheresi, Alessio; Borghi, Silvia; Borisyak, Maxim; Borsato, Martino; Bossu, Francesco; Boubdir, Meriem; Bowcock, Themistocles; Bowen, Espen Eie; Bozzi, Concezio; Braun, Svende; Britsch, Markward; Britton, Thomas; Brodzicka, Jolanta; Buchanan, Emma; Burr, Christopher; Bursche, Albert; Buytaert, Jan; Cadeddu, Sandro; Calabrese, Roberto; Calvi, Marta; Calvo Gomez, Miriam; Camboni, Alessandro; Campana, Pierluigi; Campora Perez, Daniel; Campora Perez, Daniel Hugo; Capriotti, Lorenzo; Carbone, Angelo; Carboni, Giovanni; Cardinale, Roberta; Cardini, Alessandro; Carniti, Paolo; Carson, Laurence; Carvalho Akiba, Kazuyoshi; Casse, Gianluigi; Cassina, Lorenzo; Castillo Garcia, Lucia; Cattaneo, Marco; Cauet, Christophe; Cavallero, Giovanni; Cenci, Riccardo; Charles, Matthew; Charpentier, Philippe; Chatzikonstantinidis, Georgios; Chefdeville, Maximilien; Chen, Shanzhen; Cheung, Shu-Faye; Chobanova, Veronika; Chrzaszcz, Marcin; Cid Vidal, Xabier; Ciezarek, Gregory; Clarke, Peter; Clemencic, Marco; Cliff, Harry; Closier, Joel; Coco, Victor; Cogan, Julien; Cogneras, Eric; Cogoni, Violetta; Cojocariu, Lucian; Collazuol, Gianmaria; Collins, Paula; Comerma-Montells, Albert; Contu, Andrea; Cook, Andrew; Coquereau, Samuel; Corti, Gloria; Corvo, Marco; Costa Sobral, Cayo Mar; Couturier, Benjamin; Cowan, Greig; Craik, Daniel Charles; Crocombe, Andrew; Cruz Torres, Melissa Maria; Cunliffe, Samuel; Currie, Robert; D'Ambrosio, Carmelo; Dall'Occo, Elena; Dalseno, Jeremy; David, Pieter; Davis, Adam; De Aguiar Francisco, Oscar; De Bruyn, Kristof; De Capua, Stefano; De Cian, Michel; De Miranda, Jussara; De Paula, Leandro; De Serio, Marilisa; De Simone, Patrizia; Dean, Cameron Thomas; Decamp, Daniel; Deckenhoff, Mirko; Del Buono, Luigi; Demmer, Moritz; Derkach, Denis; Deschamps, Olivier; Dettori, Francesco; Dey, Biplab; Di Canto, Angelo; Dijkstra, Hans; Dordei, Francesca; Dorigo, Mirco; Dosil Suárez, Alvaro; Dovbnya, Anatoliy; Dreimanis, Karlis; Dufour, Laurent; Dujany, Giulio; Dungs, Kevin; Durante, Paolo; Dzhelyadin, Rustem; Dziurda, Agnieszka; Dzyuba, Alexey; Déléage, Nicolas; Easo, Sajan; Ebert, Marcus; Egede, Ulrik; Egorychev, Victor; Eidelman, Semen; Eisenhardt, Stephan; Eitschberger, Ulrich; Ekelhof, Robert; Eklund, Lars; Elsasser, Christian; Ely, Scott; Esen, Sevda; Evans, Hannah Mary; Evans, Timothy; Falabella, Antonio; Farley, Nathanael; Farry, Stephen; Fay, Robert; Fazzini, Davide; Ferguson, Dianne; Fernandez Albor, Victor; Fernandez Prieto, Antonio; Ferrari, Fabio; Ferreira Rodrigues, Fernando; Ferro-Luzzi, Massimiliano; Filippov, Sergey; Fini, Rosa Anna; Fiore, Marco; Fiorini, Massimiliano; Firlej, Miroslaw; Fitzpatrick, Conor; Fiutowski, Tomasz; Fleuret, Frederic; Fohl, Klaus; Fontana, Marianna; Fontanelli, Flavio; Forshaw, Dean Charles; Forty, Roger; Franco Lima, Vinicius; Frank, Markus; Frei, Christoph; Fu, Jinlin; Furfaro, Emiliano; Färber, Christian; Gallas Torreira, Abraham; Galli, Domenico; Gallorini, Stefano; Gambetta, Silvia; Gandelman, Miriam; Gandini, Paolo; Gao, Yuanning; Garcia Martin, Luis Miguel; García Pardiñas, Julián; Garra Tico, Jordi; Garrido, Lluis; Garsed, Philip John; Gascon, David; Gaspar, Clara; Gavardi, Laura; Gazzoni, Giulio; Gerick, David; Gersabeck, Evelina; Gersabeck, Marco; Gershon, Timothy; Ghez, Philippe; Gianì, Sebastiana; Gibson, Valerie; Girard, Olivier Göran; Giubega, Lavinia-Helena; Gizdov, Konstantin; Gligorov, V.V.; Golubkov, Dmitry; Golutvin, Andrey; Gomes, Alvaro; Gorelov, Igor Vladimirovich; Gotti, Claudio; Grabalosa Gándara, Marc; Graciani Diaz, Ricardo; Granado Cardoso, Luis Alberto; Graugés, Eugeni; Graverini, Elena; Graziani, Giacomo; Grecu, Alexandru; Griffith, Peter; Grillo, Lucia; Gruberg Cazon, Barak Raimond; Grünberg, Oliver; Gushchin, Evgeny; Guz, Yury; Gys, Thierry; Göbel, Carla; Hadavizadeh, Thomas; Hadjivasiliou, Christos; Haefeli, Guido; Haen, Christophe; Haines, Susan; Hall, Samuel; Hamilton, Brian; Han, Xiaoxue; Hansmann-Menzemer, Stephanie; Harnew, Neville; Harnew, Samuel; Harrison, Jonathan; Hatch, Mark; He, Jibo; Head, Timothy; Heister, Arno; Hennessy, Karol; Henrard, Pierre; Henry, Louis; Hernando Morata, Jose Angel; van Herwijnen, Eric; Heß, Miriam; Hicheur, Adlène; Hill, Donal; Hombach, Christoph; Hulsbergen, Wouter; Humair, Thibaud; Hushchyn, Mikhail; Hussain, Nazim; Hutchcroft, David; Idzik, Marek; Ilten, Philip; Jacobsson, Richard; Jaeger, Andreas; Jalocha, Pawel; Jans, Eddy; Jawahery, Abolhassan; Jiang, Feng; John, Malcolm; Johnson, Daniel; Jones, Christopher; Joram, Christian; Jost, Beat; Jurik, Nathan; Kandybei, Sergii; Kanso, Walaa; Karacson, Matthias; Kariuki, James Mwangi; Karodia, Sarah; Kecke, Matthieu; Kelsey, Matthew; Kenyon, Ian; Kenzie, Matthew; Ketel, Tjeerd; Khairullin, Egor; Khanji, Basem; Khurewathanakul, Chitsanu; Kirn, Thomas; Klaver, Suzanne; Klimaszewski, Konrad; Koliiev, Serhii; Kolpin, Michael; Komarov, Ilya; Koopman, Rose; Koppenburg, Patrick; Kozachuk, Anastasiia; Kozeiha, Mohamad; Kravchuk, Leonid; Kreplin, Katharina; Kreps, Michal; Krokovny, Pavel; Kruse, Florian; Krzemien, Wojciech; Kucewicz, Wojciech; Kucharczyk, Marcin; Kudryavtsev, Vasily; Kuonen, Axel Kevin; Kurek, Krzysztof; Kvaratskheliya, Tengiz; Lacarrere, Daniel; Lafferty, George; Lai, Adriano; Lambert, Dean; Lanfranchi, Gaia; Langenbruch, Christoph; Latham, Thomas; Lazzeroni, Cristina; Le Gac, Renaud; van Leerdam, Jeroen; Lees, Jean-Pierre; Leflat, Alexander; Lefrançois, Jacques; Lefèvre, Regis; Lemaitre, Florian; Lemos Cid, Edgar; Leroy, Olivier; Lesiak, Tadeusz; Leverington, Blake; Li, Yiming; Likhomanenko, Tatiana; Lindner, Rolf; Linn, Christian; Lionetto, Federica; Liu, Bo; Liu, Xuesong; Loh, David; Longstaff, Iain; Lopes, Jose; Lucchesi, Donatella; Lucio Martinez, Miriam; Luo, Haofei; Lupato, Anna; Luppi, Eleonora; Lupton, Oliver; Lusiani, Alberto; Lyu, Xiao-Rui; Machefert, Frederic; Maciuc, Florin; Maev, Oleg; Maguire, Kevin; Malde, Sneha; Malinin, Alexander; Maltsev, Timofei; Manca, Giulia; Mancinelli, Giampiero; Manning, Peter Michael; Maratas, Jan; Marchand, Jean François; Marconi, Umberto; Marin Benito, Carla; Marino, Pietro; Marks, Jörg; Martellotti, Giuseppe; Martin, Morgan; Martinelli, Maurizio; Martinez Santos, Diego; Martinez Vidal, Fernando; Martins Tostes, Danielle; Massacrier, Laure Marie; Massafferri, André; Matev, Rosen; Mathad, Abhijit; Mathe, Zoltan; Matteuzzi, Clara; Mauri, Andrea; Maurin, Brice; Mazurov, Alexander; McCann, Michael; McCarthy, James; McNab, Andrew; McNulty, Ronan; Meadows, Brian; Meier, Frank; Meissner, Marco; Melnychuk, Dmytro; Merk, Marcel; Merli, Andrea; Michielin, Emanuele; Milanes, Diego Alejandro; Minard, Marie-Noelle; Mitzel, Dominik Stefan; Mogini, Andrea; Molina Rodriguez, Josue; Monroy, Ignacio Alberto; Monteil, Stephane; Morandin, Mauro; Morawski, Piotr; Mordà, Alessandro; Morello, Michael Joseph; Moron, Jakub; Morris, Adam Benjamin; Mountain, Raymond; Muheim, Franz; Mulder, Mick; Mussini, Manuel; Müller, Dominik; Müller, Janine; Müller, Katharina; Müller, Vanessa; Naik, Paras; Nakada, Tatsuya; Nandakumar, Raja; Nandi, Anita; Nasteva, Irina; Needham, Matthew; Neri, Nicola; Neubert, Sebastian; Neufeld, Niko; Neuner, Max; Nguyen, Anh Duc; Nguyen-Mau, Chung; Nieswand, Simon; Niet, Ramon; Nikitin, Nikolay; Nikodem, Thomas; Novoselov, Alexey; O'Hanlon, Daniel Patrick; Oblakowska-Mucha, Agnieszka; Obraztsov, Vladimir; Ogilvy, Stephen; Oldeman, Rudolf; Onderwater, Gerco; Otalora Goicochea, Juan Martin; Otto, Adam; Owen, Patrick; Oyanguren, Maria Aranzazu; Pais, Preema Rennee; Palano, Antimo; Palombo, Fernando; Palutan, Matteo; Panman, Jacob; Papanestis, Antonios; Pappagallo, Marco; Pappalardo, Luciano; Parker, William; Parkes, Christopher; Passaleva, Giovanni; Pastore, Alessandra; Patel, Girish; Patel, Mitesh; Patrignani, Claudia; Pearce, Alex; Pellegrino, Antonio; Penso, Gianni; Pepe Altarelli, Monica; Perazzini, Stefano; Perret, Pascal; Pescatore, Luca; Petridis, Konstantinos; Petrolini, Alessandro; Petrov, Aleksandr; Petruzzo, Marco; Picatoste Olloqui, Eduardo; Pietrzyk, Boleslaw; Pikies, Malgorzata; Pinci, Davide; Pistone, Alessandro; Piucci, Alessio; Playfer, Stephen; Plo Casasus, Maximo; Poikela, Tuomas; Polci, Francesco; Poluektov, Anton; Polyakov, Ivan; Polycarpo, Erica; Pomery, Gabriela Johanna; Popov, Alexander; Popov, Dmitry; Popovici, Bogdan; Poslavskii, Stanislav; Potterat, Cédric; Price, Eugenia; Price, Joseph David; Prisciandaro, Jessica; Pritchard, Adrian; Prouve, Claire; Pugatch, Valery; Puig Navarro, Albert; Punzi, Giovanni; Qian, Wenbin; Quagliani, Renato; Rachwal, Bartolomiej; Rademacker, Jonas; Rama, Matteo; Ramos Pernas, Miguel; Rangel, Murilo; Raniuk, Iurii; Raven, Gerhard; Redi, Federico; Reichert, Stefanie; dos Reis, Alberto; Remon Alepuz, Clara; Renaudin, Victor; Ricciardi, Stefania; Richards, Sophie; Rihl, Mariana; Rinnert, Kurt; Rives Molina, Vicente; Robbe, Patrick; Rodrigues, Ana Barbara; Rodrigues, Eduardo; Rodriguez Lopez, Jairo Alexis; Rodriguez Perez, Pablo; Rogozhnikov, Alexey; Roiser, Stefan; Romanovskiy, Vladimir; Romero Vidal, Antonio; Ronayne, John William; Rotondo, Marcello; Rudolph, Matthew Scott; Ruf, Thomas; Ruiz Valls, Pablo; Saborido Silva, Juan Jose; Sadykhov, Elnur; Sagidova, Naylya; Saitta, Biagio; Salustino Guimaraes, Valdir; Sanchez Mayordomo, Carlos; Sanmartin Sedes, Brais; Santacesaria, Roberta; Santamarina Rios, Cibran; Santimaria, Marco; Santovetti, Emanuele; Sarti, Alessio; Satriano, Celestina; Satta, Alessia; Saunders, Daniel Martin; Savrina, Darya; Schael, Stefan; Schellenberg, Margarete; Schiller, Manuel; Schindler, Heinrich; Schlupp, Maximilian; Schmelling, Michael; Schmelzer, Timon; Schmidt, Burkhard; Schneider, Olivier; Schopper, Andreas; Schubert, Konstantin; Schubiger, Maxime; Schune, Marie Helene; Schwemmer, Rainer; Sciascia, Barbara; Sciubba, Adalberto; Semennikov, Alexander; Sergi, Antonino; Serra, Nicola; Serrano, Justine; Sestini, Lorenzo; Seyfert, Paul; Shapkin, Mikhail; Shapoval, Illya; Shcheglov, Yury; Shears, Tara; Shekhtman, Lev; Shevchenko, Vladimir; Shires, Alexander; Siddi, Benedetto Gianluca; Silva Coutinho, Rafael; Silva de Oliveira, Luiz Gustavo; Simi, Gabriele; Simone, Saverio; Sirendi, Marek; Skidmore, Nicola; Skwarnicki, Tomasz; Smith, Eluned; Smith, Iwan Thomas; Smith, Jackson; Smith, Mark; Snoek, Hella; Sokoloff, Michael; Soler, Paul; Souza, Daniel; Souza De Paula, Bruno; Spaan, Bernhard; Spradlin, Patrick; Sridharan, Srikanth; Stagni, Federico; Stahl, Marian; Stahl, Sascha; Stefko, Pavol; Stefkova, Slavorima; Steinkamp, Olaf; Stemmle, Simon; Stenyakin, Oleg; Stevenson, Scott; Stoica, Sabin; Stone, Sheldon; Storaci, Barbara; Stracka, Simone; Straticiuc, Mihai; Straumann, Ulrich; Sun, Liang; Sutcliffe, William; Swientek, Krzysztof; Syropoulos, Vasileios; Szczekowski, Marek; Szumlak, Tomasz; T'Jampens, Stephane; Tayduganov, Andrey; Tekampe, Tobias; Tellarini, Giulia; Teubert, Frederic; Thomas, Christopher; Thomas, Eric; van Tilburg, Jeroen; Tilley, Matthew James; Tisserand, Vincent; Tobin, Mark; Tolk, Siim; Tomassetti, Luca; Tonelli, Diego; Topp-Joergensen, Stig; Toriello, Francis; Tournefier, Edwige; Tourneur, Stephane; Trabelsi, Karim; Traill, Murdo; Tran, Minh Tâm; Tresch, Marco; Trisovic, Ana; Tsaregorodtsev, Andrei; Tsopelas, Panagiotis; Tully, Alison; Tuning, Niels; Ukleja, Artur; Ustyuzhanin, Andrey; Uwer, Ulrich; Vacca, Claudia; Vagnoni, Vincenzo; Valat, Sebastien; Valenti, Giovanni; Vallier, Alexis; Vazquez Gomez, Ricardo; Vazquez Regueiro, Pablo; Vecchi, Stefania; van Veghel, Maarten; Velthuis, Jaap; Veltri, Michele; Veneziano, Giovanni; Venkateswaran, Aravindhan; Vernet, Maxime; Vesterinen, Mika; Viaud, Benoit; Vieira, Daniel; Vieites Diaz, Maria; Vilasis-Cardona, Xavier; Volkov, Vladimir; Vollhardt, Achim; Voneki, Balazs; Voong, David; Vorobyev, Alexey; Vorobyev, Vitaly; Voß, Christian; de Vries, Jacco; Vázquez Sierra, Carlos; Waldi, Roland; Wallace, Charlotte; Wallace, Ronan; Walsh, John; Wang, Jianchun; Ward, David; Wark, Heather Mckenzie; Watson, Nigel; Websdale, David; Weiden, Andreas; Whitehead, Mark; Wicht, Jean; Wilkinson, Guy; Wilkinson, Michael; Williams, Mark Richard James; Williams, Matthew; Williams, Mike; Williams, Timothy; Wilson, Fergus; Wimberley, Jack; Wishahi, Julian; Wislicki, Wojciech; Witek, Mariusz; Wormser, Guy; Wotton, Stephen; Wraight, Kenneth; Wright, Simon; Wyllie, Kenneth; Xie, Yuehong; Xing, Zhou; Xu, Zhirui; Yang, Zhenwei; Yin, Hang; Yu, Jiesheng; Yuan, Xuhao; Yushchenko, Oleg; Zangoli, Maria; Zarebski, Kristian Alexander; Zavertyaev, Mikhail; Zhang, Liming; Zhang, Yanxi; Zhang, Yu; Zhelezov, Alexey; Zheng, Yangheng; Zhokhov, Anatoly; Zhu, Xianglei; Zhukov, Valery; Zucchelli, Stefano

    2016-01-01

    The Dalitz plot analysis technique is used to study the resonant substructures of $B^- \\to D^+ \\pi^- \\pi^-$ decays in a data sample corresponding to 3.0 fb$^-1$ of $pp$ collision data recorded by the LHCb experiment during 2011 and 2012. A model-independent analysis of the angular moments demonstrates the presence of resonances with spins 1, 2 and 3 at high $D^+\\pi^-$ mass. The data are fitted with an amplitude model composed of a quasi-model-independent function to describe the $D^+\\pi^-$ S-wave together with virtual contributions from the $D^*(2007)^{0}$ and $B^{*0}$ states, and components corresponding to the $D^*_2(2460)^{0}$, $D^*_1(2680)^{0}$, $D^*_3(2760)^{0}$ and $D^*_2(3000)^{0}$ resonances. The masses and widths of these resonances are determined together with the branching fractions for their production in $B^- \\to D^+ \\pi^- \\pi^-$ decays. The $D^+\\pi^-$ S-wave has phase motion consistent with that expected due to the presence of the $D^*_0(2400)^{0}$ state. These results constitute the first obser...

  2. Pion Polarizabilities from $\\gamma\\gamma\\to\\pi\\pi$ Analysis

    CERN Document Server

    Dai, Ling-Yun

    2016-01-01

    We present results for pion polarizabilities predicted using dispersion relations from our earlier Amplitude Analysis of world data on two photon production of meson pairs. The helicity-zero polarizabilities are rather stable and insensitive to uncertainties in cross-channel exchanges. The need is first to confirm the recent result on $(\\alpha_1-\\beta_1)$ for the charged pion by COMPASS at CERN to an accuracy of 10\\% by measuring the $\\gamma\\gamma\\to\\pi^+\\pi^-$ cross-section to an uncertainty of ~1\\%. Then the same polarizability, but for the $\\pi^0$, is fixed to be $(\\alpha_1-\\beta_1)_{\\pi^0}=(0.9\\pm0.2)\\times 10^{-4}$ fm$^{3}$. By analyzing the correlation between uncertainties in the meson polarizability and those in $\\gamma\\gamma$ cross-sections, we suggest experiments need to measure these cross-sections between $\\sqrt{s}\\simeq 350$ and 600~MeV. The $\\pi^0\\pi^0$ cross-section then makes the $(\\alpha_2-\\beta_2)_{\\pi^0}$ the easiest helicity-two polarizability to determine.

  3. Revisiting \\gamma\\gamma->\\pi^+\\pi^- at low energies

    CERN Document Server

    Gasser, J; Sainio, M E; Gasser, Juerg; Ivanov, Mikhail A.; Sainio, Mikko E.

    2006-01-01

    We complete the recalculation of the available two-loop expressions for the reaction \\gamma\\gamma->\\pi\\pi in the framework of chiral perturbation theory. Here, we present the results for charged pions. The cross section and the values of the dipole polarizabilities agree very well with the earlier calculation, provided the same set of low-energy constants (LECs) is used. With updated values for the LECs at order p^4, we find for the dipole polarizabilities (\\alpha_1-\\beta_1)_{\\pi^\\pm} = (5.7\\pm 1.0) 10^{-4} fm^3, which is in conflict with the experimental result recently reported by the MAMI Collaboration.

  4. Once and twice subtracted dispersion relations in the analysis of pi pi amplitudes

    CERN Document Server

    Kaminski, R; Peláez, J R; Ynduráin, F J

    2009-01-01

    Once and twice subtracted crossing symmetric dispersion relations applied to $\\pi\\pi \\to \\pi\\pi$ scattering data are analyzed and compared. Both sets of dispersion relations can be used to test the $\\pi\\pi$ amplitudes in low partial waves up to about 1 GeV. We show how once subtracted dispersion relations can provide stronger constraints for $\\pi\\pi$ amplitudes than twice subtracted ones in the 400 to 1100 MeV range, given the same experimental input.

  5. Observation of CP violation in B(0) --> K(+)pi(-) and B(0) --> pi(+)pi(-).

    Science.gov (United States)

    Aubert, B; Bona, M; Boutigny, D; Karyotakis, Y; Lees, J P; Poireau, V; Prudent, X; Tisserand, V; Zghiche, A; Garra Tico, J; Grauges, E; Lopez, L; Palano, A; Eigen, G; Ofte, I; Stugu, B; Sun, L; Abrams, G S; Battaglia, M; Brown, D N; Button-Shafer, J; Cahn, R N; Groysman, Y; Jacobsen, R G; Kadyk, J A; Kerth, L T; Kolomensky, Yu G; Kukartsev, G; Lopes Pegna, D; Lynch, G; Mir, L M; Orimoto, T J; Pripstein, M; Roe, N A; Ronan, M T; Tackmann, K; Wenzel, W A; Del Amo Sanchez, P; Hawkes, C M; Watson, A T; Held, T; Koch, H; Lewandowski, B; Pelizaeus, M; Schroeder, T; Steinke, M; Cottingham, W N; Walker, D; Asgeirsson, D J; Cuhadar-Donszelmann, T; Fulsom, B G; Hearty, C; Knecht, N S; Mattison, T S; McKenna, J A; Khan, A; Saleem, M; Teodorescu, L; Blinov, V E; Bukin, A D; Druzhinin, V P; Golubev, V B; Onuchin, A P; Serednyakov, S I; Skovpen, Yu I; Solodov, E P; Todyshev, K Yu; Bondioli, M; Curry, S; Eschrich, I; Kirkby, D; Lankford, A J; Lund, P; Mandelkern, M; Martin, E C; Stoker, D P; Abachi, S; Buchanan, C; Foulkes, S D; Gary, J W; Liu, F; Long, O; Shen, B C; Zhang, L; Paar, H P; Rahatlou, S; Sharma, V; Berryhill, J W; Campagnari, C; Cunha, A; Dahmes, B; Hong, T M; Kovalskyi, D; Richman, J D; Beck, T W; Eisner, A M; Flacco, C J; Heusch, C A; Kroseberg, J; Lockman, W S; Schalk, T; Schumm, B A; Seiden, A; Williams, D C; Wilson, M G; Winstrom, L O; Chen, E; Cheng, C H; Dvoretskii, A; Fang, F; Hitlin, D G; Narsky, I; Piatenko, T; Porter, F C; Mancinelli, G; Meadows, B T; Mishra, K; Sokoloff, M D; Blanc, F; Bloom, P C; Chen, S; Ford, W T; Hirschauer, J F; Kreisel, A; Nagel, M; Nauenberg, U; Olivas, A; Smith, J G; Ulmer, K A; Wagner, S R; Zhang, J; Gabareen, A M; Soffer, A; Toki, W H; Wilson, R J; Winklmeier, F; Zeng, Q; Altenburg, D D; Feltresi, E; Hauke, A; Jasper, H; Merkel, J; Petzold, A; Spaan, B; Wacker, K; Brandt, T; Klose, V; Lacker, H M; Mader, W F; Nogowski, R; Schubert, J; Schubert, K R; Schwierz, R; Sundermann, J E; Volk, A; Bernard, D; Bonneaud, G R; Latour, E; Lombardo, V; Thiebaux, Ch; Verderi, M; Clark, P J; Gradl, W; Muheim, F; Playfer, S; Robertson, A I; Xie, Y; Andreotti, M; Bettoni, D; Bozzi, C; Calabrese, R; Cecchi, A; Cibinetto, G; Franchini, P; Luppi, E; Negrini, M; Petrella, A; Piemontese, L; Prencipe, E; Santoro, V; Anulli, F; Baldini-Ferroli, R; Calcaterra, A; de Sangro, R; Finocchiaro, G; Pacetti, S; Patteri, P; Peruzzi, I M; Piccolo, M; Rama, M; Zallo, A; Buzzo, A; Contri, R; Lo Vetere, M; Macri, M M; Monge, M R; Passaggio, S; Patrignani, C; Robutti, E; Santroni, A; Tosi, S; Chaisanguanthum, K S; Morii, M; Wu, J; Dubitzky, R S; Marks, J; Schenk, S; Uwer, U; Bard, D J; Dauncey, P D; Flack, R L; Nash, J A; Nikolich, M B; Panduro Vazquez, W; Behera, P K; Chai, X; Charles, M J; Mallik, U; Meyer, N T; Ziegler, V; Cochran, J; Crawley, H B; Dong, L; Eyges, V; Meyer, W T; Prell, S; Rosenberg, E I; Rubin, A E; Gritsan, A V; Guo, Z J; Lae, C K; Denig, A G; Fritsch, M; Schott, G; Arnaud, N; Béquilleux, J; Davier, M; Grosdidier, G; Höcker, A; Lepeltier, V; Le Diberder, F; Lutz, A M; Pruvot, S; Rodier, S; Roudeau, P; Schune, M H; Serrano, J; Sordini, V; Stocchi, A; Wang, W F; Wormser, G; Lange, D J; Wright, D M; Chavez, C A; Forster, I J; Fry, J R; Gabathuler, E; Gamet, R; Hutchcroft, D E; Payne, D J; Schofield, K C; Touramanis, C; Bevan, A J; George, K A; Di Lodovico, F; Menges, W; Sacco, R; Cowan, G; Flaecher, H U; Hopkins, D A; Jackson, P S; McMahon, T R; Salvatore, F; Wren, A C; Brown, D N; Davis, C L; Allison, J; Barlow, N R; Barlow, R J; Chia, Y M; Edgar, C L; Lafferty, G D; West, T J; Yi, J I; Anderson, J; Chen, C; Jawahery, A; Roberts, D A; Simi, G; Tuggle, J M; Blaylock, G; Dallapiccola, C; Hertzbach, S S; Li, X; Moore, T B; Salvati, E; Saremi, S; Cowan, R; Fisher, P H; Sciolla, G; Sekula, S J; Spitznagel, M; Taylor, F; Yamamoto, R K; McLachlin, S E; Patel, P M; Robertson, S H; Lazzaro, A; Palombo, F; Bauer, J M; Cremaldi, L; Eschenburg, V; Godang, R; Kroeger, R; Sanders, D A; Summers, D J; Zhao, H W; Brunet, S; Côté, D; Simard, M; Taras, P; Viaud, F B; Nicholson, H; De Nardo, G; Fabozzi, F; Lista, L; Monorchio, D; Sciacca, C; Baak, M A; Raven, G; Snoek, H L; Jessop, C P; Losecco, J M; Benelli, G; Corwin, L A; Gan, K K; Honscheid, K; Hufnagel, D; Kagan, H; Kass, R; Morris, J P; Rahimi, A M; Regensburger, J J; Ter-Antonyan, R; Wong, Q K; Blount, N L; Brau, J; Frey, R; Igonkina, O; Kolb, J A; Lu, M; Rahmat, R; Sinev, N B; Strom, D; Strube, J; Torrence, E; Gagliardi, N; Gaz, A; Margoni, M; Morandin, M; Pompili, A; Posocco, M; Rotondo, M; Simonetto, F; Stroili, R; Voci, C; Ben-Haim, E; Briand, H; Chauveau, J; David, P; Del Buono, L; de la Vaissière, Ch; Hamon, O; Hartfiel, B L; Leruste, Ph; Malclès, J; Ocariz, J; Perez, A; Gladney, L; Biasini, M; Covarelli, R; Manoni, E; Angelini, C; Batignani, G; Bettarini, S; Calderini, G; Carpinelli, M; Cenci, R; Cervelli, A; Forti, F; Giorgi, M A; Lusiani, A; Marchiori, G; Mazur, M A; Morganti, M; Neri, N; Paoloni, E; Rizzo, G; Walsh, J J; Haire, M; Biesiada, J; Elmer, P; Lau, Y P; Lu, C; Olsen, J; Smith, A J S; Telnov, A V; Baracchini, E; Bellini, F; Cavoto, G; D'Orazio, A; Del Re, D; Di Marco, E; Faccini, R; Ferrarotto, F; Ferroni, F; Gaspero, M; Jackson, P D; Li Gioi, L; Mazzoni, M A; Morganti, S; Piredda, G; Polci, F; Renga, F; Voena, C; Ebert, M; Schröder, H; Waldi, R; Adye, T; Castelli, G; Franek, B; Olaiya, E O; Ricciardi, S; Roethel, W; Wilson, F F; Aleksan, R; Emery, S; Escalier, M; Gaidot, A; Ganzhur, S F; Hamel de Monchenault, G; Kozanecki, W; Legendre, M; Vasseur, G; Yèche, Ch; Zito, M; Chen, X R; Liu, H; Park, W; Purohit, M V; Wilson, J R; Allen, M T; Aston, D; Bartoldus, R; Bechtle, P; Berger, N; Claus, R; Coleman, J P; Convery, M R; Dingfelder, J C; Dorfan, J; Dubois-Felsmann, G P; Dujmic, D; Dunwoodie, W; Field, R C; Glanzman, T; Gowdy, S J; Graham, M T; Grenier, P; Hast, C; Hryn'ova, T; Innes, W R; Kelsey, M H; Kim, H; Kim, P; Leith, D W G S; Li, S; Luitz, S; Luth, V; Lynch, H L; Macfarlane, D B; Marsiske, H; Messner, R; Muller, D R; O'grady, C P; Perazzo, A; Perl, M; Pulliam, T; Ratcliff, B N; Roodman, A; Salnikov, A A; Schindler, R H; Schwiening, J; Snyder, A; Stelzer, J; Su, D; Sullivan, M K; Suzuki, K; Swain, S K; Thompson, J M; Va'vra, J; van Bakel, N; Wagner, A P; Weaver, M; Wisniewski, W J; Wittgen, M; Wright, D H; Yarritu, A K; Yi, K; Young, C C; Burchat, P R; Edwards, A J; Majewski, S A; Petersen, B A; Wilden, L; Ahmed, S; Alam, M S; Bula, R; Ernst, J A; Jain, V; Pan, B; Saeed, M A; Wappler, F R; Zain, S B; Bugg, W; Krishnamurthy, M; Spanier, S M; Eckmann, R; Ritchie, J L; Ruland, A M; Schilling, C J; Schwitters, R F; Izen, J M; Lou, X C; Ye, S; Bianchi, F; Gallo, F; Gamba, D; Pelliccioni, M; Bomben, M; Bosisio, L; Cartaro, C; Cossutti, F; Della Ricca, G; Lanceri, L; Vitale, L; Azzolini, V; Lopez-March, N; Martinez-Vidal, F; Milanes, D A; Oyanguren, A; Albert, J; Banerjee, Sw; Bhuyan, B; Hamano, K; Kowalewski, R; Nugent, I M; Roney, J M; Sobie, R J; Back, J J; Harrison, P F; Latham, T E; Mohanty, G B; Pappagallo, M; Band, H R; Chen, X; Dasu, S; Flood, K T; Hollar, J J; Kutter, P E; Pan, Y; Pierini, M; Prepost, R; Wu, S L; Yu, Z; Neal, H

    2007-07-13

    We report observations of CP violation in the decays B(0) --> K(+)pi(-) and B(0) --> pi(+)pi(-) in a sample of 383 x 10(6) Upsilon(4S) --> BB[over] events. We find 4372+/-82 B(0) --> K(+)pi(-) decays and measure the direct CP-violating charge asymmetry A(Kpi) = -0.107+/-0.018(stat)(-0.004)(+0.007)(syst), which excludes the CP-conserving hypothesis with a significance of 5.5 standard deviations. In the same sample, we find 1139+/-49 B(0) --> pi(+)pi(-) decays and measure the CP-violating asymmetries S(pipi) = -0.60+/-0.11(stat)+/-0.03(syst) and C(pipi) = -0.21+/-0.09(stat)+/-0.02(syst). CP conservation in B(0) --> pi(+)pi(-) (S(pipi) = C(pipi) = 0) is excluded at a confidence level 1-C.L. = 8 x 10(-8), corresponding to 5.4 standard deviations.

  6. Amplitude determination for MM -> MM, M= pi, K and cross-sections for gamma gamma -> pi^+pi^-, pi^0 pi^0 in a chiral model

    CERN Document Server

    Klevansky, S P

    2016-01-01

    Recently Dai and Pennington have performed a comprehensive analysis of essentially all pion and kaon pair production data from two-photon collisions below 1.5 GeV, including all high statistics results from Belle, as well as the older data from Mark II at SLAC, CELLO at DESY, and Crystal Ball at SLAC. Imposing the basic constraints required by analyticity, unitarity, and crossing symmetry and making use of Low's low energy theorem for QED, they are able to extract the final-state strong-interaction scattering amplitudes for the intermediate pi pi->pi pi and pi pi-> K\\bar K reactions in a model-independent fashion. In addition, they provide good fits to the respective gamma gamma-> pi pi cross-sections that are known in the low-energy sector in the restricted angular range, | cos theta|pi pi cross-sections integrated over the full angular range. In this work, we use a version of chiral perturbation theory developed by Oller and Oset to evaluate the final-state strong-interaction amplitudes directly theoretical...

  7. Observation of $B^+\\rightarrow J/\\psi 3\\pi^+ 2\\pi^-$ and $B^+\\rightarrow \\psi(2S) \\pi^+\\pi^+\\pi^-$ decays

    CERN Document Server

    Aaij, Roel; Adinolfi, Marco; Ajaltouni, Ziad; Akar, Simon; Albrecht, Johannes; Alessio, Federico; Alexander, Michael; Ali, Suvayu; Alkhazov, Georgy; Alvarez Cartelle, Paula; Alves Jr, Antonio Augusto; Amato, Sandra; Amerio, Silvia; Amhis, Yasmine; An, Liupan; Anderlini, Lucio; Andreassi, Guido; Andreotti, Mirco; Andrews, Jason; Appleby, Robert; Archilli, Flavio; d'Argent, Philippe; Arnau Romeu, Joan; Artamonov, Alexander; Artuso, Marina; Aslanides, Elie; Auriemma, Giulio; Baalouch, Marouen; Babuschkin, Igor; Bachmann, Sebastian; Back, John; Badalov, Alexey; Baesso, Clarissa; Baker, Sophie; Baldini, Wander; Barlow, Roger; Barschel, Colin; Barsuk, Sergey; Barter, William; Baszczyk, Mateusz; Batozskaya, Varvara; Batsukh, Baasansuren; Battista, Vincenzo; Bay, Aurelio; Beaucourt, Leo; Beddow, John; Bedeschi, Franco; Bediaga, Ignacio; Bel, Lennaert; Bellee, Violaine; Belloli, Nicoletta; Belous, Konstantin; Belyaev, Ivan; Ben-Haim, Eli; Bencivenni, Giovanni; Benson, Sean; Benton, Jack; Berezhnoy, Alexander; Bernet, Roland; Bertolin, Alessandro; Betancourt, Christopher; Betti, Federico; Bettler, Marc-Olivier; van Beuzekom, Martinus; Bezshyiko, Iaroslava; Bifani, Simone; Billoir, Pierre; Bird, Thomas; Birnkraut, Alex; Bitadze, Alexander; Bizzeti, Andrea; Blake, Thomas; Blanc, Frederic; Blouw, Johan; Blusk, Steven; Bocci, Valerio; Boettcher, Thomas; Bondar, Alexander; Bondar, Nikolay; Bonivento, Walter; Bordyuzhin, Igor; Borgheresi, Alessio; Borghi, Silvia; Borisyak, Maxim; Borsato, Martino; Bossu, Francesco; Boubdir, Meriem; Bowcock, Themistocles; Bowen, Espen Eie; Bozzi, Concezio; Braun, Svende; Britsch, Markward; Britton, Thomas; Brodzicka, Jolanta; Buchanan, Emma; Burr, Christopher; Bursche, Albert; Buytaert, Jan; Cadeddu, Sandro; Calabrese, Roberto; Calvi, Marta; Calvo Gomez, Miriam; Camboni, Alessandro; Campana, Pierluigi; Campora Perez, Daniel Hugo; Capriotti, Lorenzo; Carbone, Angelo; Carboni, Giovanni; Cardinale, Roberta; Cardini, Alessandro; Carniti, Paolo; Carson, Laurence; Carvalho Akiba, Kazuyoshi; Casse, Gianluigi; Cassina, Lorenzo; Castillo Garcia, Lucia; Cattaneo, Marco; Cauet, Christophe; Cavallero, Giovanni; Cenci, Riccardo; Charles, Matthew; Charpentier, Philippe; Chatzikonstantinidis, Georgios; Chefdeville, Maximilien; Chen, Shanzhen; Cheung, Shu-Faye; Chobanova, Veronika; Chrzaszcz, Marcin; Cid Vidal, Xabier; Ciezarek, Gregory; Clarke, Peter; Clemencic, Marco; Cliff, Harry; Closier, Joel; Coco, Victor; Cogan, Julien; Cogneras, Eric; Cogoni, Violetta; Cojocariu, Lucian; Collazuol, Gianmaria; Collins, Paula; Comerma-Montells, Albert; Contu, Andrea; Cook, Andrew; Coombs, George; Coquereau, Samuel; Corti, Gloria; Corvo, Marco; Costa Sobral, Cayo Mar; Couturier, Benjamin; Cowan, Greig; Craik, Daniel Charles; Crocombe, Andrew; Cruz Torres, Melissa Maria; Cunliffe, Samuel; Currie, Robert; D'Ambrosio, Carmelo; Da Cunha Marinho, Franciole; Dall'Occo, Elena; Dalseno, Jeremy; David, Pieter; Davis, Adam; De Aguiar Francisco, Oscar; De Bruyn, Kristof; De Capua, Stefano; De Cian, Michel; De Miranda, Jussara; De Paula, Leandro; De Serio, Marilisa; De Simone, Patrizia; Dean, Cameron Thomas; Decamp, Daniel; Deckenhoff, Mirko; Del Buono, Luigi; Demmer, Moritz; Dendek, Adam; Derkach, Denis; Deschamps, Olivier; Dettori, Francesco; Dey, Biplab; Di Canto, Angelo; Dijkstra, Hans; Dordei, Francesca; Dorigo, Mirco; Dosil Suárez, Alvaro; Dovbnya, Anatoliy; Dreimanis, Karlis; Dufour, Laurent; Dujany, Giulio; Dungs, Kevin; Durante, Paolo; Dzhelyadin, Rustem; Dziurda, Agnieszka; Dzyuba, Alexey; Déléage, Nicolas; Easo, Sajan; Ebert, Marcus; Egede, Ulrik; Egorychev, Victor; Eidelman, Semen; Eisenhardt, Stephan; Eitschberger, Ulrich; Ekelhof, Robert; Eklund, Lars; Ely, Scott; Esen, Sevda; Evans, Hannah Mary; Evans, Timothy; Falabella, Antonio; Farley, Nathanael; Farry, Stephen; Fay, Robert; Fazzini, Davide; Ferguson, Dianne; Fernandez Prieto, Antonio; Ferrari, Fabio; Ferreira Rodrigues, Fernando; Ferro-Luzzi, Massimiliano; Filippov, Sergey; Fini, Rosa Anna; Fiore, Marco; Fiorini, Massimiliano; Firlej, Miroslaw; Fitzpatrick, Conor; Fiutowski, Tomasz; Fleuret, Frederic; Fohl, Klaus; Fontana, Marianna; Fontanelli, Flavio; Forshaw, Dean Charles; Forty, Roger; Franco Lima, Vinicius; Frank, Markus; Frei, Christoph; Fu, Jinlin; Furfaro, Emiliano; Färber, Christian; Gallas Torreira, Abraham; Galli, Domenico; Gallorini, Stefano; Gambetta, Silvia; Gandelman, Miriam; Gandini, Paolo; Gao, Yuanning; Garcia Martin, Luis Miguel; García Pardiñas, Julián; Garra Tico, Jordi; Garrido, Lluis; Garsed, Philip John; Gascon, David; Gaspar, Clara; Gavardi, Laura; Gazzoni, Giulio; Gerick, David; Gersabeck, Evelina; Gersabeck, Marco; Gershon, Timothy; Ghez, Philippe; Gianì, Sebastiana; Gibson, Valerie; Girard, Olivier Göran; Giubega, Lavinia-Helena; Gizdov, Konstantin; Gligorov, V.V.; Golubkov, Dmitry; Golutvin, Andrey; Gomes, Alvaro; Gorelov, Igor Vladimirovich; Gotti, Claudio; Govorkova, Ekaterina; Grabalosa Gándara, Marc; Graciani Diaz, Ricardo; Granado Cardoso, Luis Alberto; Graugés, Eugeni; Graverini, Elena; Graziani, Giacomo; Grecu, Alexandru; Griffith, Peter; Grillo, Lucia; Gruberg Cazon, Barak Raimond; Grünberg, Oliver; Gushchin, Evgeny; Guz, Yury; Gys, Thierry; Göbel, Carla; Hadavizadeh, Thomas; Hadjivasiliou, Christos; Haefeli, Guido; Haen, Christophe; Haines, Susan; Hall, Samuel; Hamilton, Brian; Han, Xiaoxue; Hansmann-Menzemer, Stephanie; Harnew, Neville; Harnew, Samuel; Harrison, Jonathan; Hatch, Mark; He, Jibo; Head, Timothy; Heister, Arno; Hennessy, Karol; Henrard, Pierre; Henry, Louis; Hernando Morata, Jose Angel; van Herwijnen, Eric; Heß, Miriam; Hicheur, Adlène; Hill, Donal; Hombach, Christoph; Hopchev, P H; Hulsbergen, Wouter; Humair, Thibaud; Hushchyn, Mikhail; Hussain, Nazim; Hutchcroft, David; Idzik, Marek; Ilten, Philip; Jacobsson, Richard; Jaeger, Andreas; Jalocha, Pawel; Jans, Eddy; Jawahery, Abolhassan; Jiang, Feng; John, Malcolm; Johnson, Daniel; Jones, Christopher; Joram, Christian; Jost, Beat; Jurik, Nathan; Kandybei, Sergii; Kanso, Walaa; Karacson, Matthias; Kariuki, James Mwangi; Karodia, Sarah; Kecke, Matthieu; Kelsey, Matthew; Kenyon, Ian; Kenzie, Matthew; Ketel, Tjeerd; Khairullin, Egor; Khanji, Basem; Khurewathanakul, Chitsanu; Kirn, Thomas; Klaver, Suzanne; Klimaszewski, Konrad; Koliiev, Serhii; Kolpin, Michael; Komarov, Ilya; Koopman, Rose; Koppenburg, Patrick; Kosmyntseva, Alena; Kozachuk, Anastasiia; Kozeiha, Mohamad; Kravchuk, Leonid; Kreplin, Katharina; Kreps, Michal; Krokovny, Pavel; Kruse, Florian; Krzemien, Wojciech; Kucewicz, Wojciech; Kucharczyk, Marcin; Kudryavtsev, Vasily; Kuonen, Axel Kevin; Kurek, Krzysztof; Kvaratskheliya, Tengiz; Lacarrere, Daniel; Lafferty, George; Lai, Adriano; Lanfranchi, Gaia; Langenbruch, Christoph; Latham, Thomas; Lazzeroni, Cristina; Le Gac, Renaud; van Leerdam, Jeroen; Lees, Jean-Pierre; Leflat, Alexander; Lefrançois, Jacques; Lefèvre, Regis; Lemaitre, Florian; Lemos Cid, Edgar; Leroy, Olivier; Lesiak, Tadeusz; Leverington, Blake; Li, Yiming; Likhomanenko, Tatiana; Lindner, Rolf; Linn, Christian; Lionetto, Federica; Liu, Bo; Liu, Xuesong; Loh, David; Longstaff, Iain; Lopes, Jose; Lucchesi, Donatella; Lucio Martinez, Miriam; Luo, Haofei; Lupato, Anna; Luppi, Eleonora; Lupton, Oliver; Lusiani, Alberto; Lyu, Xiao-Rui; Machefert, Frederic; Maciuc, Florin; Maev, Oleg; Maguire, Kevin; Malde, Sneha; Malinin, Alexander; Maltsev, Timofei; Manca, Giulia; Mancinelli, Giampiero; Manning, Peter Michael; Maratas, Jan; Marchand, Jean François; Marconi, Umberto; Marin Benito, Carla; Marino, Pietro; Marks, Jörg; Martellotti, Giuseppe; Martin, Morgan; Martinelli, Maurizio; Martinez Santos, Diego; Martinez Vidal, Fernando; Martins Tostes, Danielle; Massacrier, Laure Marie; Massafferri, André; Matev, Rosen; Mathad, Abhijit; Mathe, Zoltan; Matteuzzi, Clara; Mauri, Andrea; Maurin, Brice; Mazurov, Alexander; McCann, Michael; McCarthy, James; McNab, Andrew; McNulty, Ronan; Meadows, Brian; Meier, Frank; Meissner, Marco; Melnychuk, Dmytro; Merk, Marcel; Merli, Andrea; Michielin, Emanuele; Milanes, Diego Alejandro; Minard, Marie-Noelle; Mitzel, Dominik Stefan; Mogini, Andrea; Molina Rodriguez, Josue; Monroy, Ignacio Alberto; Monteil, Stephane; Morandin, Mauro; Morawski, Piotr; Mordà, Alessandro; Morello, Michael Joseph; Moron, Jakub; Morris, Adam Benjamin; Mountain, Raymond; Muheim, Franz; Mulder, Mick; Mussini, Manuel; Müller, Dominik; Müller, Janine; Müller, Katharina; Müller, Vanessa; Naik, Paras; Nakada, Tatsuya; Nandakumar, Raja; Nandi, Anita; Nasteva, Irina; Needham, Matthew; Neri, Nicola; Neubert, Sebastian; Neufeld, Niko; Neuner, Max; Nguyen, Anh Duc; Nguyen, Thi Dung; Nguyen-Mau, Chung; Nieswand, Simon; Niet, Ramon; Nikitin, Nikolay; Nikodem, Thomas; Novoselov, Alexey; O'Hanlon, Daniel Patrick; Oblakowska-Mucha, Agnieszka; Obraztsov, Vladimir; Ogilvy, Stephen; Oldeman, Rudolf; Onderwater, Gerco; Otalora Goicochea, Juan Martin; Otto, Adam; Owen, Patrick; Oyanguren, Maria Aranzazu; Pais, Preema Rennee; Palano, Antimo; Palombo, Fernando; Palutan, Matteo; Panman, Jacob; Papanestis, Antonios; Pappagallo, Marco; Pappalardo, Luciano; Parker, William; Parkes, Christopher; Passaleva, Giovanni; Pastore, Alessandra; Patel, Girish; Patel, Mitesh; Patrignani, Claudia; Pearce, Alex; Pellegrino, Antonio; Penso, Gianni; Pepe Altarelli, Monica; Perazzini, Stefano; Perret, Pascal; Pescatore, Luca; Petridis, Konstantinos; Petrolini, Alessandro; Petrov, Aleksandr; Petruzzo, Marco; Picatoste Olloqui, Eduardo; Pietrzyk, Boleslaw; Pikies, Malgorzata; Pinci, Davide; Pistone, Alessandro; Piucci, Alessio; Playfer, Stephen; Plo Casasus, Maximo; Poikela, Tuomas; Polci, Francesco; Poluektov, Anton; Polyakov, Ivan; Polycarpo, Erica; Pomery, Gabriela Johanna; Popov, Alexander; Popov, Dmitry; Popovici, Bogdan; Poslavskii, Stanislav; Potterat, Cédric; Price, Eugenia; Price, Joseph David; Prisciandaro, Jessica; Pritchard, Adrian; Prouve, Claire; Pugatch, Valery; Puig Navarro, Albert; Punzi, Giovanni; Qian, Wenbin; Quagliani, Renato; Rachwal, Bartolomiej; Rademacker, Jonas; Rama, Matteo; Ramos Pernas, Miguel; Rangel, Murilo; Raniuk, Iurii; Ratnikov, Fedor; Raven, Gerhard; Redi, Federico; Reichert, Stefanie; dos Reis, Alberto; Remon Alepuz, Clara; Renaudin, Victor; Ricciardi, Stefania; Richards, Sophie; Rihl, Mariana; Rinnert, Kurt; Rives Molina, Vicente; Robbe, Patrick; Rodrigues, Ana Barbara; Rodrigues, Eduardo; Rodriguez Lopez, Jairo Alexis; Rodriguez Perez, Pablo; Rogozhnikov, Alexey; Roiser, Stefan; Rollings, Alexandra Paige; Romanovskiy, Vladimir; Romero Vidal, Antonio; Ronayne, John William; Rotondo, Marcello; Rudolph, Matthew Scott; Ruf, Thomas; Ruiz Valls, Pablo; Saborido Silva, Juan Jose; Sadykhov, Elnur; Sagidova, Naylya; Saitta, Biagio; Salustino Guimaraes, Valdir; Sanchez Mayordomo, Carlos; Sanmartin Sedes, Brais; Santacesaria, Roberta; Santamarina Rios, Cibran; Santimaria, Marco; Santovetti, Emanuele; Sarti, Alessio; Satriano, Celestina; Satta, Alessia; Saunders, Daniel Martin; Savrina, Darya; Schael, Stefan; Schellenberg, Margarete; Schiller, Manuel; Schindler, Heinrich; Schlupp, Maximilian; Schmelling, Michael; Schmelzer, Timon; Schmidt, Burkhard; Schneider, Olivier; Schopper, Andreas; Schubert, Konstantin; Schubiger, Maxime; Schune, Marie Helene; Schwemmer, Rainer; Sciascia, Barbara; Sciubba, Adalberto; Semennikov, Alexander; Sergi, Antonino; Serra, Nicola; Serrano, Justine; Sestini, Lorenzo; Seyfert, Paul; Shapkin, Mikhail; Shapoval, Illya; Shcheglov, Yury; Shears, Tara; Shekhtman, Lev; Shevchenko, Vladimir; Siddi, Benedetto Gianluca; Silva Coutinho, Rafael; Silva de Oliveira, Luiz Gustavo; Simi, Gabriele; Simone, Saverio; Sirendi, Marek; Skidmore, Nicola; Skwarnicki, Tomasz; Smith, Eluned; Smith, Iwan Thomas; Smith, Jackson; Smith, Mark; Snoek, Hella; Sokoloff, Michael; Soler, Paul; Souza De Paula, Bruno; Spaan, Bernhard; Spradlin, Patrick; Sridharan, Srikanth; Stagni, Federico; Stahl, Marian; Stahl, Sascha; Stefko, Pavol; Stefkova, Slavorima; Steinkamp, Olaf; Stemmle, Simon; Stenyakin, Oleg; Stevenson, Scott; Stoica, Sabin; Stone, Sheldon; Storaci, Barbara; Stracka, Simone; Straticiuc, Mihai; Straumann, Ulrich; Sun, Liang; Sutcliffe, William; Swientek, Krzysztof; Syropoulos, Vasileios; Szczekowski, Marek; Szumlak, Tomasz; T'Jampens, Stephane; Tayduganov, Andrey; Tekampe, Tobias; Tellarini, Giulia; Teubert, Frederic; Thomas, Eric; van Tilburg, Jeroen; Tilley, Matthew James; Tisserand, Vincent; Tobin, Mark; Tolk, Siim; Tomassetti, Luca; Tonelli, Diego; Topp-Joergensen, Stig; Toriello, Francis; Tournefier, Edwige; Tourneur, Stephane; Trabelsi, Karim; Traill, Murdo; Tran, Minh Tâm; Tresch, Marco; Trisovic, Ana; Tsaregorodtsev, Andrei; Tsopelas, Panagiotis; Tully, Alison; Tuning, Niels; Ukleja, Artur; Ustyuzhanin, Andrey; Uwer, Ulrich; Vacca, Claudia; Vagnoni, Vincenzo; Valassi, Andrea; Valat, Sebastien; Valenti, Giovanni; Vallier, Alexis; Vazquez Gomez, Ricardo; Vazquez Regueiro, Pablo; Vecchi, Stefania; van Veghel, Maarten; Velthuis, Jaap; Veltri, Michele; Veneziano, Giovanni; Venkateswaran, Aravindhan; Vernet, Maxime; Vesterinen, Mika; Viaud, Benoit; Vieira, Daniel; Vieites Diaz, Maria; Viemann, Harald; Vilasis-Cardona, Xavier; Vitti, Marcela; Volkov, Vladimir; Vollhardt, Achim; Voneki, Balazs; Vorobyev, Alexey; Vorobyev, Vitaly; Voß, Christian; de Vries, Jacco; Vázquez Sierra, Carlos; Waldi, Roland; Wallace, Charlotte; Wallace, Ronan; Walsh, John; Wang, Jianchun; Ward, David; Wark, Heather Mckenzie; Watson, Nigel; Websdale, David; Weiden, Andreas; Whitehead, Mark; Wicht, Jean; Wilkinson, Guy; Wilkinson, Michael; Williams, Mark Richard James; Williams, Matthew; Williams, Mike; Williams, Timothy; Wilson, Fergus; Wimberley, Jack; Wishahi, Julian; Wislicki, Wojciech; Witek, Mariusz; Wormser, Guy; Wotton, Stephen; Wraight, Kenneth; Wyllie, Kenneth; Xie, Yuehong; Xing, Zhou; Xu, Zhirui; Yang, Zhenwei; Yin, Hang; Yu, Jiesheng; Yuan, Xuhao; Yushchenko, Oleg; Zarebski, Kristian Alexander; Zavertyaev, Mikhail; Zhang, Liming; Zhang, Yanxi; Zhang, Yu; Zhelezov, Alexey; Zheng, Yangheng; Zhokhov, Anatoly; Zhu, Xianglei; Zhukov, Valery; Zucchelli, Stefano

    2017-01-01

    The decays $B^+\\rightarrow J/\\psi 3\\pi^+ 2\\pi^-$ and $B^+\\rightarrow \\psi(2S) \\pi^+\\pi^+\\pi^-$ are observed for the first time using a data sample corresponding to an integrated luminosity of $3.0fb^{-1}$, collected by the LHCb experiment in proton-proton collisions at the centre-of-mass energies of 7 and 8 TeV. The branching fractions relative to that of $B^+ \\rightarrow \\psi(2S)K^+$ are measured to be \\begin{eqnarray*} \\frac {\\mathcal{B}\\left( B^+\\rightarrow J/\\psi 3\\pi^+ 2\\pi^- \\right)} {\\mathcal{B}\\left( B^+ \\rightarrow \\psi(2S)K^+ \\right)} & = & \\left( 1.88\\pm0.17\\pm0.09\\right)\\times10^{-2}, \\\\ \\frac {\\mathcal{B}\\left( B^+\\rightarrow \\psi(2S) \\pi^+\\pi^+\\pi^- \\right)} {\\mathcal{B}\\left( B^+ \\rightarrow \\psi(2S)K^+ \\right) } & = & \\left( 3.04\\pm0.50\\pm0.26\\right)\\times10^{-2}, \\end{eqnarray*} where the first uncertainties are statistical and the second are systematic.

  8. The pi pi interaction in nuclear matter from a study of the pi sup + A-> pi sup +pi sup+-A' reactions 25.80.Hp

    CERN Document Server

    Bonutti, F; Fragiacomo, E; Grion, N; Rui, R; Brack, J T; Felawka, L; Gibson, E F; Hofman, G J; Kermani, M; Mathie, E L; Meier, R; Ottewell, D; Raywood, K; Sevior, M E; Smith, G R; Tacik, R

    2000-01-01

    The pion-production reactions pi sup + A-> pi sup +pi sup+-A' were studied on sup 2 H, sup 1 sup 2 C, sup 4 sup 0 Ca, and sup 2 sup 0 sup 8 Pb nuclei at an incident pion energy of T subpi sub sup + =283 MeV. Pions were detected in coincidence using the CHAOS spectrometer. The experimental results are reduced to differential cross sections and compared to both theoretical predictions and the reaction phase space. The composite ratio C subpi subpi sup A between the pi sup +pi sup+- invariant masses on nuclei and on the nucleon is also presented. Near the 2m subpi threshold pion pairs couple to (pi pi) sub I sub = sub J sub = sub 0 when produced in the pi sup +-> pi sup +pi sup - reaction channel. There is a marked near-threshold enhancement of C subpi sub sup + subpi sub sup - sup A which is consistent with theoretical predictions addressing the partial restoration of chiral symmetry in nuclear matter. Furthermore, the behaviour of C subpi sub sup + subpi sub sup - sup A is well described when the restoration o...

  9. Search for the Decay tau- --> 3pi- 2pi+ 2pi0 nu_tau

    CERN Document Server

    Aubert, B; Bóna, M; Boutigny, D; Couderc, F; Karyotakis, Yu; Lees, J P; Poireau, V; Tisserand, V; Zghiche, A; Graugès-Pous, E; Palano, A; Pappagallo, M; Chen, J C; Qi, N D; Rong, G; Wang, P; Zhu, Y S; Eigen, G; Ofte, I; Stugu, B; Abrams, G S; Battaglia, M; Brown, D N; Button-Shafer, J; Cahn, R N; Charles, E; Day, C T; Gill, M S; Groysman, Y; Jacobsen, R G; Kadyk, J A; Kerth, L T; Kolomensky, Yu G; Kukartsev, G; Lynch, G; Mir, L M; Oddone, P J; Orimoto, T J; Pripstein, M; Roe, N A; Ronan, M T; Wenzel, W A; Barrett, M; Ford, K E; Harrison, T J; Hart, A J; Hawkes, C M; Morgan, S E; Watson, A T; Goetzen, K; Held, T; Koch, H; Lewandowski, B; Pelizaeus, M; Peters, K; Schröder, T; Steinke, M; Boyd, J T; Burke, J P; Cottingham, W N; Walker, D; Çuhadar-Dönszelmann, T; Fulsom, B G; Hearty, C; Knecht, N S; Mattison, T S; McKenna, J A; Khan, A; Kyberd, P; Saleem, M; Teodorescu, L; Blinov, V E; Bukin, A D; Druzhinin, V P; Golubev, V B; Onuchin, A P; Serednyakov, S I; Skovpen, Yu I; Solodov, E P; Todyshev, K Yu; Best, D S; Bondioli, M; Bruinsma, M; Chao, M; Curry, S; Eschrich, I; Kirkby, D; Lankford, A J; Lund, P; Mandelkern, M A; Mommsen, R K; Röthel, W; Stoker, D P; Abachi, S; Buchanan, C; Foulkes, S D; Gary, J W; Long, O; Shen, B C; Wang, K; Zhang, L; Hadavand, H K; Hill, E J; Paar, H P; Rahatlou, S; Sharma, V; Berryhill, J W; Campagnari, C; Cunha, A; Dahmes, B; Hong, T M; Kovalskyi, D; Richman, J D; Beck, T W; Eisner, A M; Flacco, C J; Heusch, C A; Kroseberg, J; Lockman, W S; Nesom, G; Schalk, T; Schumm, B A; Seiden, A; Spradlin, P; Williams, D C; Wilson, M G; Albert, J; Chen, E; Dvoretskii, A; Hitlin, D G; Narsky, I; Piatenko, T; Porter, F C; Ryd, A; Samuel, A; Andreassen, R; Mancinelli, G; Meadows, B T; Sokoloff, M D; Blanc, F; Bloom, P C; Chen, S; Ford, W T; Hirschauer, J F; Kreisel, A; Nauenberg, U; Olivas, A; Ruddick, W O; Smith, J G; Ulmer, K A; Wagner, S R; Zhang, J; Chen, A; Eckhart, E A; Soffer, A; Toki, W H; Wilson, R J; Winklmeier, F; Zeng, Q; Altenburg, D D; Feltresi, E; Hauke, A; Jasper, H; Spaan, B; Brandt, T; Klose, V; Lacker, H M; Mader, W F; Nogowski, R; Petzold, A; Schubert, J; Schubert, K R; Schwierz, R; Sundermann, J E; Volk, A; Bernard, D; Bonneaud, G R; Grenier, P; Latour, E; Thiebaux, C; Verderi, M; Bard, D J; Clark, P J; Gradl, W; Muheim, F; Playfer, S; Robertson, A I; Xie, Y; Andreotti, M; Bettoni, D; Bozzi, C; Calabrese, R; Cibinetto, G; Luppi, E; Negrini, M; Petrella, A; Piemontese, L; Prencipe, E; Anulli, F; Baldini-Ferroli, R; Calcaterra, A; De Sangro, R; Finocchiaro, G; Pacetti, S; Patteri, P; Peruzzi, I M; Piccolo, M; Rama, M; Zallo, A; Buzzo, A; Capra, R; Contri, R; Lo Vetere, M; Macri, M M; Monge, M R; Passaggio, S; Patrignani, C; Robutti, E; Santroni, A; Tosi, S; Brandenburg, G; Chaisanguanthum, K S; Morii, M; Wu, J; Dubitzky, R S; Marks, J; Schenk, S; Uwer, U; Bhimji, W; Bowerman, D A; Dauncey, P D; Egede, U; Flack, R L; Gaillard, J R; Nash, J A; Nikolich, M B; Panduro-Vazquez, W; Chai, X; Charles, M J; Mallik, U; Meyer, N T; Ziegler, V; Cochran, J; Crawley, H B; Dong, L; Eyges, V; Meyer, W T; Prell, S; Rosenberg, E I; Rubin, A E; Gritsan, A V; Fritsch, M; Schott, G; Arnaud, N; Davier, M; Grosdidier, G; Höcker, A; Le Diberder, F R; Lepeltier, V; Lutz, A M; Oyanguren, A; Pruvot, S; Rodier, S; Roudeau, P; Schune, M H; Stocchi, A; Wang, W F; Wormser, G; Cheng, C H; Lange, D J; Wright, D M; Chavez, C A; Forster, I J; Fry, J R; Gabathuler, E; Gamet, R; George, K A; Hutchcroft, D E; Payne, D J; Schofield, K C; Touramanis, C; Bevan, A J; Di Lodovico, F; Menges, W; Sacco, R; Brown, C L; Cowan, G; Flächer, H U; Hopkins, D A; Jackson, P S; McMahon, T R; Ricciardi, S; Salvatore, F; Davis, C L; Allison, J; Barlow, N R; Barlow, R J; Chia, Y M; Edgar, C L; Kelly, M P; Lafferty, G D; Naisbit, M T; Williams, J C; Yi, J I; Chen, C; Hulsbergen, W D; Jawahery, A; Lae, C K; Roberts, D A; Simi, G; Blaylock, G; Dallapiccola, C; Hertzbach, S S; Li, X; Moore, T B; Saremi, S; Stängle, H; Willocq, S Y; Cowan, R; Koeneke, K; Sciolla, G; Sekula, S J; Spitznagel, M; Taylor, F; Yamamoto, R K; Kim, H; Patel, P M; Potter, C T; Robertson, S H; Lazzaro, A; Lombardo, V; Palombo, F; Bauer, J M; Cremaldi, L; Eschenburg, V; Godang, R; Kroeger, R; Reidy, J; Sanders, D A; Summers, D J; Zhao, H W; Brunet, S; Côté, D; Simard, M; Taras, P; Viaud, F B; Nicholson, H; Cavallo, N; De Nardo, Gallieno; Del Re, D; Fabozzi, F; Gatto, C; Lista, L; Monorchio, D; Paolucci, P; Piccolo, D; Sciacca, C; Baak, M; Bulten, H; Raven, G; Snoek, H L; Jessop, C P; LoSecco, J M; Allmendinger, T; Benelli, G; Gan, K K; Honscheid, K; Hufnagel, D; Jackson, P D; Kagan, H; Kass, R; Pulliam, T; Rahimi, A M; Ter-Antonian, R; Wong, Q K; Blount, N L; Brau, J E; Frey, R; Igonkina, O; Lu, M; Rahmat, R; Sinev, N B; Strom, D; Strube, J; Torrence, E; Galeazzi, F; Gaz, A; Margoni, M; Morandin, M; Pompili, A; Posocco, M; Rotondo, M; Simonetto, F; Stroili, R; Voci, C; Benayoun, M; Chauveau, J; David, P; Del Buono, L; La Vaissière, C de; Hamon, O; Hartfiel, B L; John, M J J; Leruste, P; Malcles, J; Ocariz, J; Roos, L; Therin, G; Behera, P K; Gladney, L; Panetta, J; Biasini, M; Covarelli, R; Pioppi, M; Angelini, C; Batignani, G; Bettarini, S; Bucci, F; Calderini, G; Carpinelli, M; Cenci, R; Forti, F; Giorgi, M A; Lusiani, A; Marchiori, G; Mazur, M A; Morganti, M; Neri, N; Paoloni, E; Rizzo, G; Walsh, J; Haire, M; Judd, D; Wagoner, D E; Biesiada, J; Danielson, N; Elmer, P; Lau, Y P; Lü, C; Olsen, J; Smith, A J S; Telnov, A V; Bellini, F; Cavoto, G; D'Orazio, A; Di Marco, E; Faccini, R; Ferrarotto, F; Ferroni, F; Gaspero, M; Li Gioi, L; Mazzoni, M A; Morganti, S; Piredda, G; Polci, F; Safai-Tehrani, F; Voena, C; Ebert, M; Schröder, H; Waldi, R; Adye, T; De Groot, N; Franek, B; Olaiya, E O; Wilson, F F; Emery, S; Gaidot, A; Ganzhur, S F; Hamel de Monchenault, G; Kozanecki, Witold; Legendre, M; Mayer, B; Vasseur, G; Yéche, C; Zito, M; Park, W; Purohit, M V; Weidemann, A W; Wilson, J R; Allen, M T; Aston, D; Bartoldus, R; Bechtle, P; Berger, N; Boyarski, A M; Claus, R; Coleman, J P; Convery, M R; Cristinziani, M; Dingfelder, J C; Dong, D; Dorfan, J; Dubois-Felsmann, G P; Dujmic, D; Dunwoodie, W M; Field, R C; Glanzman, T; Gowdy, S J; Graham, M T; Halyo, V; Hast, C; Hrynóva, T; Innes, W R; Kelsey, M H; Kim, P; Kocian, M L; Leith, D W G S; Li, S; Libby, J; Luitz, S; Lüth, V; Lynch, H L; MacFarlane, D B; Marsiske, H; Messner, R; Müller, D R; O'Grady, C P; Ozcan, V E; Perazzo, A; Perl, M; Ratcliff, B N; Roodman, A; Salnikov, A A; Schindler, R H; Schwiening, J; Snyder, A; Stelzer, J; Su, D; Sullivan, M K; Suzuki, K; Swain, S K; Thompson, J M; Vavra, J; Van Bakel, N; Weaver, M; Weinstein, A J R; Wisniewski, W J; Wittgen, M; Wright, D H; Yarritu, A K; Yi, K; Young, C C; Burchat, P R; Edwards, A J; Majewski, S A; Petersen, B A; Roat, C; Wilden, L; Ahmed, S; Alam, M S; Bula, R; Ernst, J A; Jain, V; Pan, B; Saeed, M A; Wappler, F R; Zain, S B; Bugg, W; Krishnamurthy, M; Spanier, S M; Eckmann, R; Ritchie, J L; Satpathy, A; Schilling, C J; Schwitters, R F; Izen, J M; Kitayama, I; Lou, X C; Ye, S; Bianchi, F; Gallo, F; Gamba, D; Bomben, M; Bosisio, L; Cartaro, C; Cossutti, F; Della Ricca, G; Dittongo, S; Grancagnolo, S; Lanceri, L; Vitale, L; Azzolini, V; Martínez-Vidal, F; Banerjee, Sw; Bhuyan, B; Brown, C M; Fortin, D; Hamano, K; Kowalewski, R V; Nugent, I M; Roney, J M; Sobie, R J; Back, J J; Harrison, P F; Latham, T E; Mohanty, G B; Band, H R; Chen, X; Cheng, B; Dasu, S; Datta, M; Eichenbaum, A M; Flood, K T; Hollar, J J; Johnson, J R; Kutter, P E; Li, H; Liu, R; Mellado, B; Mihályi, A; Mohapatra, A K; Pan, Y; Pierini, M; Prepost, R; Tan, P; Wu, S L; Yu, Z; Neal, H

    2006-01-01

    A search for the decay of the tau lepton to five charged and two neutral pions is performed using data collected by the BABAR detector at the PEP-II asymmetric-energy e+e- collider. The analysis uses 232 fb-1 of data at center-of-mass energies on or near the Y(4S) resonance. We observe 10 events with an expected background of 6.5^{+2.0}_{-1.4} events. In the absence of a signal, we set the limit on the branching ratio B(tau- --> 3pi- 2pi+ 2pi0 nu_tau) 2omega pi- nu_tau. We observe 1 event with an expected background of 0.4^{+1.0}_{-0.4} events and calculate the upper limit B(tau- --> 2omega pi- nu_tau) < 5.4x10^{-7} at the 90% confidence level. This is the first upper limit for this mode.

  10. Time-dependent analysis of $B^0 \\to {{K^0_{S}}} \\pi^- \\pi^+ \\gamma$ decays and studies of the $K^+\\pi^-\\pi^+$ system in $B^+ \\to K^+ \\pi^- \\pi^+ \\gamma$ decays

    CERN Document Server

    Sanchez, P del Amo

    2015-01-01

    We measure the time-dependent $CP$ asymmetry in the radiative-penguin decay $B^0 \\to {{K^0_{S}}} \\pi^- \\pi^+ \\gamma$, using a sample of $471$ million $\\Upsilon(4S) \\to B{\\kern 0.18em\\overline{\\kern -0.18em B}}$ events recorded with the BaBar detector at the PEP-II $e^+e^-$ storage ring at SLAC. Using events with $m_{K\\pi\\pi}<1.8{\\mathrm{\\,Ge\\kern -0.1em V/}c^2}$, we measure the branching fractions of $B^+ \\to K^+ \\pi^- \\pi^+ \\gamma$ and $B^0 \\to K^0 \\pi^+ \\pi^- \\gamma$, the branching fractions of the kaonic resonances decaying to $K^+ \\pi^- \\pi^+$, as well as the overall branching fractions of the $B^+ \\to \\rho^0 K^+ \\gamma$, $B^+ \\to K^{*0} \\pi^+ \\gamma$ and S-wave $B^+ \\to (K \\pi)^{*0}_0 \\pi^+ \\gamma$ components. For events from the $\\rho$ mass band, we measure the $CP$-violating parameters ${\\mathcal{S}_{{{K^0_{S}}}\\pi^+\\pi^-\\gamma}} = 0.14 \\pm 0.25 \\pm 0.03$ and ${\\mathcal{C}_{{{K^0_{S}}}\\pi^+\\pi^-\\gamma}} = -0.39 \\pm 0.20^{+0.03}_{-0.02}$, where the first uncertainties are statistical and the second a...

  11. The ABC effect in the reaction NN to d pi pi

    CERN Document Server

    Bar-Nir, I; Shuster, M D

    1975-01-01

    A simple peripheral model for the reaction NN to NN pi pi is extended to the reaction NN to d pi pi . Predictions for the differential and total cross sections are compared with recent experiments. The enhancement of the deuteron recoil-momentum spectrum near the pi pi threshold (ABC effect) is well reproduced. (12 refs).

  12. SERPINA1 PiZ and PiS heterozygotes and lung function decline in the SAPALDIA cohort.

    Directory of Open Access Journals (Sweden)

    Gian-Andri Thun

    Full Text Available BACKGROUND: Severe alpha1-antitrypsin (AAT deficiency is a strong risk factor for COPD. But the impact of gene variants resulting in mild or intermediate AAT deficiency on the longitudinal course of respiratory health remains controversial. There is indication from experimental studies that pro-inflammatory agents like cigarette smoke can interact with these variants and thus increase the risk of adverse respiratory health effects. Therefore, we tested the effect of the presence of a protease inhibitor (Pi S or Z allele (PiMS and PiMZ on the change in lung function in different inflammation-exposed subgroups of a large, population-based cohort study. METHODOLOGY AND PRINCIPAL FINDINGS: The SAPALDIA population includes over 4600 subjects from whom SERPINA1 genotypes for S and Z alleles, spirometry and respiratory symptoms at baseline and after 11 years follow-up, as well as proxies for inflammatory conditions, such as detailed smoking history, obesity and high sensitivity C-reactive protein (hs-CRP, were available. All analyses were performed by applying multivariate regression models. There was no overall unfavourable effect of PiMS or PiMZ genotype on lung function change. We found indication that PiZ heterozygosity interacted with inflammatory stimuli leading to an accelerated decline in measures in use as indices for assessing mild airway obstruction. Obese individuals with genotype PiMM had an average annual decline in the forced mid expiratory flow (ΔFEF25-75% of 58.4 ml whereas in obese individuals with PiMZ it amounted to 92.2 ml (p = 0.03. Corresponding numbers for persistent smokers differed even more strongly (66.8 ml (PiMM vs. 108.2 ml (PiMZ, p = 0.005. Equivalent, but less strong associations were observed for the change in the FEV1/FVC ratio. CONCLUSIONS: We suggest that, in addition to the well established impact of the rare PiZZ genotype, one Z allele may be sufficient to accelerate lung function decline in population subgroups

  13. In-medium modifications of the $\\pi\\pi$ interaction in photon-induced reactions

    CERN Document Server

    Messchendorp, J G; Kotulla, M; Ahrens, J; Annand, J R M; Beck, R; Bloch, Felix; Caselotti, G; Fog, L; Hornidge, D; Krusche, B; Langgärtner, W; McGeorge, J C; MacGregor, I J D; Mengel, K; Metag, V; Novotny, R; Owens, R O; Pfeiffer, M; Sack, S; Sanderson, R; Schadmand, S

    2002-01-01

    Differential cross sections of the reactions $(\\gamma,\\pi^\\circ\\pi^\\circ)$ and $(\\gamma,\\pi^\\circ\\pi^++\\pi^\\circ\\pi^-)$ have been measured for several nuclei ($^1$H,$^{12}$C, and $^{\\rm nat}$Pb) at an incident-photon energy of $E_{\\gamma}$=400-460 MeV at the tagged-photon facility at MAMI-B using the TAPS spectrometer. A significant nuclear-mass dependence of the $\\pi\\pi$ invariant-mass distribution is found in the $\\pi^\\circ\\pi^\\circ$ channel. This dependence is not observed in the $\\pi^\\circ\\pi^{+/-}$ channel and is consistent with an in-medium modification of the $\\pi\\pi$ interaction in the $I$=$J$=0 channel. The data are compared to $\\pi$-induced measurements and to calculations within a chiral-unitary approach.

  14. Learning Python with Raspberry Pi

    CERN Document Server

    Bradbury, Alex

    2014-01-01

    The must-have companion guide to the Raspberry Pi User Guide! Raspberry Pi chose Python as its teaching language of choice to encourage a new generation of programmers to learn how to program. This approachable book serves as an ideal resource for anyone wanting to use Raspberry Pi to learn to program and helps you get started with the Python programming language. Aimed at first-time developers with no prior programming language assumed, this beginner book gets you up and running.Covers variables, loops, and functionsAddresses 3D graphics programmingWalks you through programming MinecraftZero

  15. Search for a dark vector gauge boson decaying to $\\pi^+ \\pi^-$ using $\\eta \\rightarrow \\pi^+\\pi^- \\gamma$ decays

    CERN Document Server

    Won, E; Aihara, H; Said, S Al; Asner, D M; Aushev, T; Ayad, R; Badhrees, I; Bakich, A M; Bansal, V; Barberio, E; Behera, P; Bhuyan, B; Biswal, J; Bobrov, A; Bozek, A; Bračko, M; Červenkov, D; Chekelian, V; Chen, A; Cheon, B G; Chilikin, K; Chistov, R; Cho, K; Chobanova, V; Choi, Y; Cinabro, D; Dash, N; Di Carlo, S; Doležal, Z; Drásal, Z; Dutta, D; Eidelman, S; Epifanov, D; Farhat, H; Fast, J E; Ferber, T; Fulsom, B G; Gaur, V; Gabyshev, N; Garmash, A; Gillard, R; Goldenzweig, P; Greenwald, D; Haba, J; Hayasaka, K; Hayashii, H; Hou, W -S; Iijima, T; Inami, K; Inguglia, G; Ishikawa, A; Itoh, R; Iwasaki, Y; Jaegle, I; Jeon, H B; Joffe, D; Joo, K K; Julius, T; Kang, K H; Kawasaki, T; Kim, D Y; Kim, J B; Kim, K T; Kim, M J; Kim, S H; Kim, Y J; Kinoshita, K; Kodyš, P; Križan, P; Krokovny, P; Kuhr, T; Kulasiri, R; Kwon, Y -J; Lange, J S; Lee, I S; Li, C H; Li, L; Li, Y; Gioi, L Li; Libby, J; Liventsev, D; Luo, T; Masuda, M; Matsuda, T; Matvienko, D; Miyabayashi, K; Miyata, H; Mizuk, R; Mohanty, G B; Nakano, E; Nakao, M; Nakazawa, H; Nanut, T; Nath, K J; Natkaniec, Z; Nayak, M; Nishida, S; Ogawa, S; Okuno, S; Pakhlov, P; Pal, B; Park, C -S; Paul, S; Pedlar, T K; Piilonen, L E; Pulvermacher, C; Rauch, J; Ritter, M; Sahoo, H; Sakai, Y; Sandilya, S; Santelj, L; Sanuki, T; Sato, Y; Savinov, V; Schlüter, T; Schneider, O; Schnell, G; Schwanda, C; Seino, Y; Semmler, D; Senyo, K; Seon, O; Seong, I S; Shebalin, V; Shen, C P; Shibata, T -A; Shiu, J -G; Simon, F; Starič, M; Sumiyoshi, T; Takizawa, M; Tamponi, U; Tenchini, F; Trabelsi, K; Uchida, M; Uehara, S; Uglov, T; Unno, Y; Uno, S; Urquijo, P; Usov, Y; Van Hulse, C; Varner, G; Varvell, K E; Vorobyev, V; Wang, C H; Wang, M -Z; Watanabe, M; Watanabe, Y; Widmann, E; Yamaoka, J; Ye, H; Yook, Y; Yuan, C Z; Yusa, Y; Zhang, Z P; Zhilich, V; Zhukova, V; Zhulanov, V; Zupanc, A

    2016-01-01

    We report a search for a dark vector gauge boson $U^\\prime$ that couples to quarks in the decay chain $D^{*+} \\to D^0 \\pi^+, D^0 \\to K^0_S \\eta, \\eta \\to U^\\prime \\gamma$, $U^\\prime \\to \\pi^+ \\pi^-$. No signal is found and we set a mass-dependent limit on the baryonic fine structure constant of $10^{-3} - 10^{-2}$ in the $U^\\prime$ mass range of 290 to 520 MeV/$c^2$. This analysis is based on a data sample of 976 fb$^{-1}$ collected by the Belle experiment at the KEKB asymmetric-energy $e^+e^-$ collider.

  16. Observation of e+e- -> Upsilon(1S)pi+pi- and Upsilon(2S)pi+pi- at sqrt{s}~10.87 GeV

    CERN Document Server

    Abe, K; Arinstein, K; Aso, T; Aulchenko, V; Aushev, T; Aziz, T; Bahinipati, S; Bakich, A M; Balagura, V; Ban, Y; Banerjee, S; Barberio, E; Bay, A; Bedny, I; Belous, K S; Bhardwaj, V; Bitenc, U; Blyth, S; Bondar, A; Bozek, A; Bracko, M; Brodzicka, J; Browder, T E; Chang, M C; Chang, P; Chao, Y; Chen, A; Chen, K F; Chen, W T; Cheon, B G; Chiang, C C; Chistov, R; Cho, I S; Choi, S K; Choi, Y; Choi, Y K; Cole, S; Dalseno, J; Danilov, M; Das, A; Dash, M; Dragic, J; Drutskoy, A; Eidelman, S; Epifanov, D; Fratina, S; Fujii, H; Fujikawa, M; Gabyshev, N; Garmash, A; Go, A; Gokhroo, G; Goldenzweig, P; Golob, B; Grosse-Perdekamp, M; Guler, H; Ha, H; Haba, J; Hara, K; Hara, T; Hasegawa, Y; Hastings, N C; Hayasaka, K; Hayashii, H; Hazumi, M; Heffernan, D; Higuchi, T; Hinz, L; Hoedlmoser, H; Hokuue, T; Horii, Y; Hoshi, Y; Hoshina, K; Hou, S; Hou, W S; Hsiung, Y B; Hyun, H J; Igarashi, Y; Iijima, T; Ikado, K; Inami, K; Ishikawa, A; Ishino, H; Itoh, R; Iwabuchi, M; Iwasaki, M; Iwasaki, Y; Jacoby, C; Joshi, N J; Kaga, M; Kah, D H; Kaji, H; Kajiwara, S; Kakuno, H; Kang, J H; Kapusta, P; Kataoka, S U; Katayama, N; Kawai, H; Kawasaki, T; Kibayashi, A; Kichimi, H; Kim, H J; Kim, H O; Kim, J H; Kim, S K; Kim, Y J; Kinoshita, K; Korpar, S; Kozakai, Y; Krizan, P; Krokovny, P; Kumar, R; Kurihara, E; Kusaka, A; Kuzmin, A; Kwon, Y J; Lange, J S; Leder, G; Lee, J; Lee, J S; Lee, M J; Lee, S E; Lesiak, T; Li, J; Limosani, A; Lin, S W; Liu, Y; Liventsev, D; MacNaughton, J; Majumder, G; Mandl, F; Marlow, D; Matsumura, T; Matyja, A; McOnie, S; Medvedeva, T; Mikami, Y; Mitaroff, W A; Miyabayashi, K; Miyake, H; Miyata, H; Miyazaki, Y; Mizuk, R; Moloney, G R; Mori, T; Müller, J; Murakami, A; Nagamine, T; Nagasaka, Y; Nakahama, Y; Nakamura, I; Nakano, E; Nakao, M; Nakayama, H; Nakazawa, H; Natkaniec, Z; Neichi, K; Nishida, S; Nishimura, K; Nishio, Y; Nishizawa, I; Nitoh, O; Noguchi, S; Nozaki, T; Ogawa, A; Ogawa, S; Ohshima, T; Okuno, S; Olsen, S L; Ono, S; Ostrowicz, W; Ozaki, H; Pakhlov, P; Pakhlova, G; Palka, H; Park, C W; Park, H; Park, K S; Parslow, N; Peak, L S; Pernicka, M; Pestotnik, R; Peters, M; Piilonen, L E; Poluektov, A; Rorie, J; Rózanska, M; Sahoo, H; Sakai, Y; Sakaue, H; Sasao, N; Sarangi, T R; Satoyama, N; Sayeed, K; Schietinger, T; Schneider, O; Schonmeier, P; Schümann, J; Schwanda, C; Schwartz, A J; Seidl, R; Sekiya, A; Senyo, K; Sevior, M E; Shang, L; Shapkin, M; Shen, C P; Shibuya, H; Shinomiya, S; Shiu, J G; Shwartz, B; Singh, J B; Sokolov, A; Solovieva, E; Somov, A; Stanic, S; Staric, M; Stypula, J; Sugiyama, A; Sumisawa, K; Sumiyoshi, T; Suzuki, S; Suzuki, S Y; Tajima, O; Takasaki, F; Tamai, K; Tamura, N; Tanaka, M; Taniguchi, N; Taylor, G N; Teramoto, Y; Tikhomirov, I; Trabelsi, K; Tse, Y F; Tsuboyama, T; Uchida, K; Uchida, Y; Uehara, S; Ueno, K; Uglov, T; Unno, Y; Uno, S; Urquijo, P; Ushiroda, Y; Usov, Yu; Varner, G; Varvell, K E; Vervink, K; Villa, S; Vinokurova, A; Wang, C C; Wang, C H; Wang, J; Wang, M Z; Wang, P; Wang, X L; Watanabe, M; Watanabe, Y; Wedd, R; Wicht, J; Widhalm, L; Wiechczynski, J; Won, E; Yabsley, B D; Yamaguchi, A; Yamamoto, H; Yamaoka, M; Yamashita, Y; Yamauchi, M; Yuan, C Z; Yusa, Y; Zhang, C C; Zhang, L M; Zhang, Z P; Zhilich, V; Zhulanov, V; Zupanc, A; Zwahlen, N

    2007-01-01

    We report the first observation of e+e- -> Upsilon(1S)pi+pi-, Upsilon(2S)pi+pi-, and first evidence for e+e- -> Upsilon(3S)pi+pi-, Upsilon(1S)K+K-, near the peak of the Upsilon(5S) resonance at sqrt{s}~10.87 GeV. The results are based on a data sample of 21.7 fb^-1 collected with the Belle detector at the KEKB e+e- collider. The observed cross-sections are sigma(Upsilon(1S)pi+pi-) = 1.61+-0.10(stat)+-0.12(sys) pb and sigma(Upsilon(2S)pi+pi-) = 2.35+-0.19(stat)+-0.32(sys) pb. Attributing these signals to the Upsilon(5S) resonance, the partial widths Gamma(Upsilon(5S)->Upsilon(1S)pi+pi-) = 0.59+-0.04(stat)+-0.09(sys) MeV and Gamma(Upsilon(5S)->Upsilon(2S)pi+pi-) = 0.85+-0.07(stat)+-0.16(sys) MeV are inferred. These are much larger than any partial widths for previously observed Upsilon(nS) -> Upsilon(1S)pi+pi-, Upsilon(2S)pi+pi- decays.

  17. Photoproduction of $\\pi^+ \\pi^-$ meson pairs on the proton

    Energy Technology Data Exchange (ETDEWEB)

    Battaglieri, Marco A. [Istituto Nazionale di Fisica Nucleare (INFN) - Sezione di Genova; DeVita, Raffaella [Istituto Nazionale di Fisica Nucleare (INFN) - Sezione di Genova; Szczepaniak, Adam P. [Indiana Univ., Bloomington, IN (United States)

    2009-10-01

    The exclusive reaction $\\gamma p \\to p \\pi^+ \\pi^-$ was studied in the photon energy range 3.0 - 3.8 GeV and momentum transfer range $0.4<-t<1.0$ GeV$^2$. Data were collected with the CLAS detector at the Thomas Jefferson National Accelerator Facility. In this kinematic range the integrated luminosity was about 20 pb$^{-1}$. The reaction was isolated by detecting the $\\pi^+$ and proton in CLAS, and reconstructing the $\\pi^-$ via the missing-mass technique. Moments of the di-pion decay angular distributions were derived from the experimental data. Differential cross sections for the $S$, $P$, and $D$-waves in the $M_{\\pi^+\\pi^-}$ mass range $0.4-1.4$ GeV were derived performing a partial wave expansion of the extracted moments. Besides the dominant contribution of the $\\rho(770)$ meson in the $P$-wave, evidence for the $f_0(980)$ and the $f_2(1270)$ mesons was found in the $S$ and $D$-waves, respectively. The differential production cross sections $d\\sigma/dt$ for individual waves in the mass range of the above-mentioned mesons were extracted. This is the first time the $f_0(980)$ has been measured in a photoproduction experiment.

  18. Exclusive pi+ pi- production at 7TeV

    CERN Document Server

    Khakzad, Mohsen

    2016-01-01

    We report a measurement of the exclusive production of pairs of charged pions in proton-proton collisions, dominated by the process $pp \\rightarrow p^{(*)} \\pi^{+}\\pi^{-} p^{(*)}$, where $\\rm p^{(*)}$ stands for a diffractively dissociated proton, the $\\pi^{+} \\pi^{-}$ pair is emitted at central rapidities $y$, and the incident protons stay intact or dissociate without detection ${\\rm p^{(*)}}$. The measurement is performed with the CMS detector at the LHC, using a data sample corresponding to an integrated luminosity of 450~$\\mu$b$^{-1}$ collected at a center-of-mass energy of $\\sqrt{s}$ = 7 TeV in 2010. The cross section measured in the phase space defined by pion transverse momentum $p_{\\rm T}>0.2$~GeV/c and rapidity $|y|< 2 $ is found to be $20.5~\\pm~0.3~(\\rm {stat})~(\\pm~3.1~\\rm {syst})~\\pm$~0.8~(lumi)~$\\mu$b. The differential cross sections for $\\pi^{+}\\pi^{-}$ pairs as a function of the pion pair invariant mass, $p_{\\rm T}$, and $y$, as well as a single-pion differential cross section as a function ...

  19. Amplitude analysis of D0->K+K-pi+pi-

    CERN Document Server

    Artuso, M; Mountain, R; Skwarnicki, T; Stone, S; Zhang, L M; Gershon, T; Bonvicini, G; Cinabro, D; Lincoln, A; Smith, M J; Zhou, P; Zhu, J; Naik, P; Rademacker, J; Asner, D M; Edwards, K W; Randrianarivony, K; Tatishvili, G; Briere, R A; Vogel, H; Onyisi, P U E; Rosner, J L; Alexander, J P; Cassel, D G; Das, S; Ehrlich, R; Gibbons, L; Gray, S W; Hartill, D L; Heltsley, B K; Kreinick, D L; Kuznetsov, V E; Patterson, J R; Peterson, D; Riley, D; Ryd, A; Sadoff, A J; Shi, X; Sun, W M; Yelton, J; Rubin, P; Lowrey, N; Mehrabyan, S; Selen, M; Wiss, J; Libby, J; Kornicer, M; Mitchell, R E; Besson, D; Pedlar, T K; Cronin-Hennessy, D; Hietala, J; Dobbs, S; Metreveli, Z; Seth, K K; Tomaradze, A; Xiao, T; Martin, L; Powell, A; Spradlin, P; Wilkinson, G; Ge, J Y; Miller, D H; Shipsey, I P J; Xin, B; Adams, G S; Napolitano, J; Ecklund, K M; Insler, J; Muramatsu, H; Park, C S; Pearson, L J; Thorndike, E H; Ricciardi, S; Thomas, C

    2012-01-01

    The first flavor-tagged amplitude analysis of the decay D0 to the self-conjugate final state K+K-pi+pi- is presented. Data from the CLEO II.V, CLEO III, and CLEO-c detectors are used, from which around 3000 signal decays are selected. The three most significant amplitudes, which contribute to the model that best fits the data, are phirho0, K1(1270)+-K-+, and non-resonant K+K-pi+pi-. Separate amplitude analyses of D0 and D0-bar candidates indicate no CP violation among the amplitudes at the level of 5% to 30% depending on the mode. In addition, the sensitivity to the CP-violating parameter gamma/phi3 of a sample of 2000 B+ -> D0-tilde(K+K-pi+pi-)K+ decays, where D0-tilde is a D0 or D0-bar, collected at LHCb or a future flavor facility, is estimated to be (11.3 +/- 0.3) degrees using the favored model.

  20. Observation of CP Violation in B0 to K+pi- and B0 to pi+pi-

    Energy Technology Data Exchange (ETDEWEB)

    Aubert, B.

    2007-03-14

    The authors report observations of CP violation in the decays B{sup 0} {yields} K{sup +}{pi}{sup -} and B{sup 0} {yields} {pi}{sup +}{pi}{sup -} in a sample of 383 million {Upsilon}(4S) {yields} B{bar B} events. They find 4372 {+-} 82 B{sup 0} {yields} K{sup +}{pi}{sup -} decays and measure the direct Cp-violating charge asymmetry {Alpha}{sub K{pi}} = -0.107 {+-} 0.018(stat){sub -0.004}{sup +0.007}(syst), which excludes the CP-conserving hypothesis with a significance of 5.5 standard deviations. In the same sample they find 1139 {+-} 49 B{sup 0} {yields} {pi}{sup +}{pi}{sup -} decays and measure the CP-violating asymmetries S{sub {pi}{pi}} = -0.60 {+-} 0.11(stat) {+-} 0.03(syst) and C{sub {pi}{pi}} = -0.21 {+-} 0.09(stat) {+-} 0.02(syst). CP conservation in B{sup 0} {yields} {pi}{sup +}{pi}{sup -} (S{sub {pi}{pi}} = C{sub {pi}{pi}} = 0) is excluded at a confidence level 1-C.L. = 8 x 10{sup -8}, corresponding to 5.4 standard deviations.

  1. Constrain the UT angle gamma by CP violation parameters in B0 -> pi+ pi-

    CERN Document Server

    Qin, Qin; Lü, Cai-Dian; Li, Ying

    2015-01-01

    We calculate the tree and penguin amplitudes in the $B^0\\to\\pi^+\\pi^-$ decay channel employing the perturbative QCD factorization approach. Using the amplitudes as input with the theoretical uncertainties sufficiently considered, we constrain the UT angle $\\gamma$ to $51^\\circ\\leq\\gamma\\leq64^\\circ$, from the measurements of the CP violation parameters $C_{\\pi^+\\pi^-}$ and $S_{\\pi^+\\pi^-}$ in $B^0\\to\\pi^+\\pi^-$. The U-spin breaking effect between $B^0\\to\\pi^+\\pi^-$ and $B_s^0\\to K^+K^-$ is estimated to be around 30\\%.

  2. Cacti with Extremal PI Index

    Directory of Open Access Journals (Sweden)

    Chunxiang Wang

    2016-12-01

    Full Text Available The vertex PI index PI(G=∑ xy∈E(G [n xy (x‎+‎n xy (y] PI(G=∑xy∈E(G[nxy(x‎+‎nxy(y] is a distance-based molecular structure descriptor‎, ‎where n xy (x nxy(x denotes the number of vertices which are closer to the vertex x x than to the vertex y y and which has been the considerable research in computational chemistry dating back to Harold Wiener in 1947‎. ‎A connected graph is a cactus if any two of its cycles have at most one common vertex‎. ‎In this paper‎, ‎we completely determine the extremal graphs with the greatest and smallest vertex PI indices mong all cacti with a fixed number of vertices‎. ‎As a consequence‎, ‎we obtain the sharp bounds with corresponding extremal cacti and extend a known result‎.

  3. Raspberry Pi mechatronics projects hotshot

    CERN Document Server

    Yamanoor, Sai

    2015-01-01

    This book is targeted towards beginners and intermediate designers of mechatronic systems and embedded system design. Some familiarity with the Raspberry Pi and Python programming is preferred but not required.

  4. The reaction pi N-> pi pi N in chiral effective field theory with explicit Delta(1232)

    CERN Document Server

    Siemens, D; Epelbaum, E; Krebs, H; Meißner, Ulf-G

    2014-01-01

    The reaction pi N -> pi pi N is studied at tree level up to next-to-leading order in the framework of manifestly covariant baryon chiral perturbation theory with explicit Delta(1232) degrees of freedom. Using total cross section data to determine the relevant low-energy constants, predictions are made for various differential as well as total cross sections at higher energies. A detailed comparison of results based on the heavy-baryon and relativistic formulations of chiral perturbation theory with and without explicit Delta degrees of freedom is given.

  5. S-wave K- pi+ system in D+ ---> K- pi+ pi+ decays from Fermilab E791

    Energy Technology Data Exchange (ETDEWEB)

    Meadows, B.T.; /Cincinnati U.

    2005-06-01

    A new approach to the analysis of three body decays is presented. Model-independent results are obtained for the S-wave K{pi} amplitude as a function of K{pi} invariant mass. These are compared with results from K{sup -}{pi}{sup +} elastic scattering, and the prediction of the Watson theorem, that the phase behavior be the same below K{eta}' threshold, is tested. Contributions from I = 1/2 and I = 3/2 are not resolved in this study. If I = 1/2 dominates, however, the Watson theorem does not describe these data well.

  6. Search for CP violation in the decay $D^+ \\to \\pi^-\\pi^+\\pi^+$

    CERN Document Server

    Aaij, R; Adinolfi, M; Adrover, C; Affolder, A; Ajaltouni, Z; Albrecht, J; Alessio, F; Alexander, M; Ali, S; Alkhazov, G; Alvarez Cartelle, P; Alves Jr, A A; Amato, S; Amerio, S; Amhis, Y; Anderlini, L; Anderson, J; Andreassen, R; Andreotti, M; Andrews, J E; Appleby, R B; Aquines Gutierrez, O; Archilli, F; Artamonov, A; Artuso, M; Aslanides, E; Auriemma, G; Baalouch, M; Bachmann, S; Back, J J; Badalov, A; Baesso, C; Balagura, V; Baldini, W; Barlow, R J; Barschel, C; Barsuk, S; Barter, W; Batozskaya, V; Bauer, Th; Bay, A; Beddow, J; Bedeschi, F; Bediaga, I; Belogurov, S; Belous, K; Belyaev, I; Ben-Haim, E; Bencivenni, G; Benson, S; Benton, J; Berezhnoy, A; Bernet, R; Bettler, M -O; van Beuzekom, M; Bien, A; Bifani, S; Bird, T; Bizzeti, A; Bjørnstad, P M; Blake, T; Blanc, F; Blouw, J; Blusk, S; Bocci, V; Bondar, A; Bondar, N; Bonivento, W; Borghi, S; Borgia, A; Bowcock, T J V; Bowen, E; Bozzi, C; Brambach, T; van den Brand, J; Bressieux, J; Brett, D; Britsch, M; Britton, T; Brook, N H; Brown, H; Bursche, A; Busetto, G; Buytaert, J; Cadeddu, S; Calabrese, R; Callot, O; Calvi, M; Calvo Gomez, M; Camboni, A; Campana, P; Campora Perez, D; Carbone, A; Carboni, G; Cardinale, R; Cardini, A; Carranza-Mejia, H; Carson, L; Carvalho Akiba, K; Casse, G; Castillo Garcia, L; Cattaneo, M; Cauet, Ch; Cenci, R; Charles, M; Charpentier, Ph; Cheung, S -F; Chiapolini, N; Chrzaszcz, M; Ciba, K; Cid Vidal, X; Ciezarek, G; Clarke, P E L; Clemencic, M; Cliff, H V; Closier, J; Coca, C; Coco, V; Cogan, J; Cogneras, E; Collins, P; Comerma-Montells, A; Contu, A; Cook, A; Coombes, M; Coquereau, S; Corti, G; Couturier, B; Cowan, G A; Craik, D C; Cruz Torres, M; Cunliffe, S; Currie, R; D'Ambrosio, C; Dalseno, J; David, P; David, P N Y; Davis, A; De Bonis, I; De Bruyn, K; De Capua, S; De Cian, M; De Miranda, J M; De Paula, L; De Silva, W; De Simone, P; Decamp, D; Deckenhoff, M; Del Buono, L; Déléage, N; Derkach, D; Deschamps, O; Dettori, F; Di Canto, A; Dijkstra, H; Dogaru, M; Donleavy, S; Dordei, F; Dosil Suárez, A; Dossett, D; Dovbnya, A; Dupertuis, F; Durante, P; Dzhelyadin, R; Dziurda, A; Dzyuba, A; Easo, S; Egede, U; Egorychev, V; Eidelman, S; van Eijk, D; Eisenhardt, S; Eitschberger, U; Ekelhof, R; Eklund, L; El Rifai, I; Elsasser, Ch; Falabella, A; Färber, C; Farinelli, C; Farry, S; Ferguson, D; Fernandez Albor, V; Ferreira Rodrigues, F; Ferro-Luzzi, M; Filippov, S; Fiore, M; Fiorini, M; Fitzpatrick, C; Fontana, M; Fontanelli, F; Forty, R; Francisco, O; Frank, M; Frei, C; Frosini, M; Furfaro, E; Gallas Torreira, A; Galli, D; Gandelman, M; Gandini, P; Gao, Y; Garofoli, J; Garosi, P; Garra Tico, J; Garrido, L; Gaspar, C; Gauld, R; Gersabeck, E; Gersabeck, M; Gershon, T; Ghez, Ph; Gibson, V; Giubega, L; Gligorov, V V; Göbel, C; Golubkov, D; Golutvin, A; Gomes, A; Gorbounov, P; Gordon, H; Grabalosa Gándara, M; Graciani Diaz, R; Granado Cardoso, L A; Graugés, E; Graziani, G; Grecu, A; Greening, E; Gregson, S; Griffith, P; Grillo, L; Grünberg, O; Gui, B; Gushchin, E; Guz, Yu; Gys, T; Hadjivasiliou, C; Haefeli, G; Haen, C; Hafkenscheid, T W; Haines, S C; Hall, S; Hamilton, B; Hampson, T; Hansmann-Menzemer, S; Harnew, N; Harnew, S T; Harrison, J; Hartmann, T; He, J; Head, T; Heijne, V; Hennessy, K; Henrard, P; Hernando Morata, J A; van Herwijnen, E; Heß, M; Hicheur, A; Hicks, E; Hill, D; Hoballah, M; Hombach, C; Hulsbergen, W; Hunt, P; Huse, T; Hussain, N; Hutchcroft, D; Hynds, D; Iakovenko, V; Idzik, M; Ilten, P; Jacobsson, R; Jaeger, A; Jans, E; Jaton, P; Jawahery, A; Jing, F; John, M; Johnson, D; Jones, C R; Joram, C; Jost, B; Kaballo, M; Kandybei, S; Kanso, W; Karacson, M; Karbach, T M; Kenyon, I R; Ketel, T; Khanji, B; Kochebina, O; Komarov, I; Koopman, R F; Koppenburg, P; Korolev, M; Kozlinskiy, A; Kravchuk, L; Kreplin, K; Kreps, M; Krocker, G; Krokovny, P; Kruse, F; Kucharczyk, M; Kudryavtsev, V; Kurek, K; Kvaratskheliya, T; La Thi, V N; Lacarrere, D; Lafferty, G; Lai, A; Lambert, D; Lambert, R W; Lanciotti, E; Lanfranchi, G; Langenbruch, C; Latham, T; Lazzeroni, C; Le Gac, R; van Leerdam, J; Lees, J -P; Lefèvre, R; Leflat, A; Lefrançois, J; Leo, S; Leroy, O; Lesiak, T; Leverington, B; Li, Y; Li Gioi, L; Liles, M; Lindner, R; Linn, C; Liu, B; Liu, G; Lohn, S; Longstaff, I; Lopes, J H; Lopez-March, N; Lu, H; Lucchesi, D; Luisier, J; Luo, H; Luppi, E; Lupton, O; Machefert, F; Machikhiliyan, I V; Maciuc, F; Maev, O; Malde, S; Manca, G; Mancinelli, G; Maratas, J; Marconi, U; Marino, P; Märki, R; Marks, J; Martellotti, G; Martens, A; Martín Sánchez, A; Martinelli, M; Martinez Santos, D; Martins Tostes, D; Martynov, A; Massafferri, A; Matev, R; Mathe, Z; Matteuzzi, C; Maurice, E; Mazurov, A; McCann, M; McCarthy, J; McNab, A; McNulty, R; McSkelly, B; Meadows, B; Meier, F; Meissner, M; Merk, M; Milanes, D A; Minard, M -N; Molina Rodriguez, J; Monteil, S; Moran, D; Morawski, P; Mordà, A; Morello, M J; Mountain, R; Mous, I; Muheim, F; Müller, K; Muresan, R; Muryn, B; Muster, B; Naik, P; Nakada, T; Nandakumar, R; Nasteva, I; Needham, M; Neubert, S; Neufeld, N; Nguyen, A D; Nguyen, T D; Nguyen-Mau, C; Nicol, M; Niess, V; Niet, R; Nikitin, N; Nikodem, T; Nomerotski, A; Novoselov, A; Oblakowska-Mucha, A; Obraztsov, V; Oggero, S; Ogilvy, S; Okhrimenko, O; Oldeman, R; Onderwater, G; Orlandea, M; Otalora Goicochea, J M; Owen, P; Oyanguren, A; Pal, B K; Palano, A; Palutan, M; Panman, J; Papanestis, A; Pappagallo, M; Parkes, C; Parkinson, C J; Passaleva, G; Patel, G D; Patel, M; Patrignani, C; Pavel-Nicorescu, C; Pazos Alvarez, A; Pearce, A; Pellegrino, A; Penso, G; Pepe Altarelli, M; Perazzini, S; Perez Trigo, E; Pérez-Calero Yzquierdo, A; Perret, P; Perrin-Terrin, M; Pescatore, L; Pesen, E; Pessina, G; Petridis, K; Petrolini, A; Picatoste Olloqui, E; Pietrzyk, B; Pilař, T; Pinci, D; Playfer, S; Plo Casasus, M; Polci, F; Polok, G; Poluektov, A; Polycarpo, E; Popov, A; Popov, D; Popovici, B; Potterat, C; Powell, A; Prisciandaro, J; Pritchard, A; Prouve, C; Pugatch, V; Puig Navarro, A; Punzi, G; Qian, W; Rachwal, B; Rademacker, J H; Rakotomiaramanana, B; Rangel, M S; Raniuk, I; Rauschmayr, N; Raven, G; Redford, S; Reichert, S; Reid, M M; dos Reis, A C; Ricciardi, S; Richards, A; Rinnert, K; Rives Molina, V; Roa Romero, D A; Robbe, P; Roberts, D A; Rodrigues, A B; Rodrigues, E; Rodriguez Perez, P; Roiser, S; Romanovsky, V; Romero Vidal, A; Rotondo, M; Rouvinet, J; Ruf, T; Ruffini, F; Ruiz, H; Ruiz Valls, P; Sabatino, G; Saborido Silva, J J; Sagidova, N; Sail, P; Saitta, B; Salustino Guimaraes, V; Sanmartin Sedes, B; Santacesaria, R; Santamarina Rios, C; Santovetti, E; Sapunov, M; Sarti, A; Satriano, C; Satta, A; Savrie, M; Savrina, D; Schiller, M; Schindler, H; Schlupp, M; Schmelling, M; Schmidt, B; Schneider, O; Schopper, A; Schune, M -H; Schwemmer, R; Sciascia, B; Sciubba, A; Seco, M; Semennikov, A; Senderowska, K; Sepp, I; Serra, N; Serrano, J; Seyfert, P; Shapkin, M; Shapoval, I; Shcheglov, Y; Shears, T; Shekhtman, L; Shevchenko, O; Shevchenko, V; Shires, A; Silva Coutinho, R; Sirendi, M; Skidmore, N; Skwarnicki, T; Smith, N A; Smith, E; Smith, E; Smith, J; Smith, M; Sokoloff, M D; Soler, F J P; Soomro, F; Souza, D; Souza De Paula, B; Spaan, B; Sparkes, A; Spradlin, P; Stagni, F; Stahl, S; Steinkamp, O; Stevenson, S; Stoica, S; Stone, S; Storaci, B; Stracka, S; Straticiuc, M; Straumann, U; Subbiah, V K; Sun, L; Sutcliffe, W; Swientek, S; Syropoulos, V; Szczekowski, M; Szczypka, P; Szilard, D; Szumlak, T; T'Jampens, S; Teklishyn, M; Tellarini, G; Teodorescu, E; Teubert, F; Thomas, C; Thomas, E; van Tilburg, J; Tisserand, V; Tobin, M; Tolk, S; Tomassetti, L; Tonelli, D; Topp-Joergensen, S; Torr, N; Tournefier, E; Tourneur, S; Tran, M T; Tresch, M; Tsaregorodtsev, A; Tsopelas, P; Tuning, N; Ubeda Garcia, M; Ukleja, A; Ustyuzhanin, A; Uwer, U; Vagnoni, V; Valenti, G; Vallier, A; Vazquez Gomez, R; Vazquez Regueiro, P; Vázquez Sierra, C; Vecchi, S; Velthuis, J J; Veltri, M; Veneziano, G; Vesterinen, M; Viaud, B; Vieira, D; Vilasis-Cardona, X; Vollhardt, A; Volyanskyy, D; Voong, D; Vorobyev, A; Vorobyev, V; Voß, C; Voss, H; Waldi, R; Wallace, C; Wallace, R; Wandernoth, S; Wang, J; Ward, D R; Watson, N K; Webber, A D; Websdale, D; Whitehead, M; Wicht, J; Wiechczynski, J; Wiedner, D; Wiggers, L; Wilkinson, G; Williams, M P; Williams, M; Wilson, F F; Wimberley, J; Wishahi, J; Wislicki, W; Witek, M; Wormser, G; Wotton, S A; Wright, S; Wu, S; Wyllie, K; Xie, Y; Xing, Z; Yang, Z; Yuan, X; Yushchenko, O; Zangoli, M; Zavertyaev, M; Zhang, F; Zhang, L; Zhang, W C; Zhang, Y; Zhelezov, A; Zhokhov, A; Zhong, L; Zvyagin, A

    2014-01-01

    A search for CP violation in the phase space of the decay $D^+\\to\\pi^-\\pi^+\\pi^+$ is reported using $pp$ collision data, corresponding to an integrated luminosity of 1.0 fb$^{-1}$, collected by the LHCb experiment at a centre-of-mass energy of 7 TeV. The Dalitz plot distributions for $3.1\\times 10^6$ $D^+$ and $D^-$ candidates are compared with binned and unbinned model-independent techniques. No evidence for CP violation is found.

  7. Intelligente Himbeere - Der Raspberry Pi

    OpenAIRE

    Heik, Andreas; Sontag, Ralph

    2013-01-01

    Aus der Vision, Computertechnik für den schmalen Geldbeutel technisch interessierten Jugendlichen verfügbar zu machen entstand ein kreditkartengroßer Einplatinencomputer, der Raspberry Pi. Wir möchten den Raspi im Vortrag etwas näher vorstellen und in einer kleinen Demonstration Anregungen für eigene Projekte geben. Gespannt sind wir auch auf Projekte, welche die Zuhörer bereits mit dem Raspberry Pi umgesetzt haben.

  8. Search for the $C\\!P$-violating strong decays $\\eta \\to \\pi^+\\pi^-$ and $\\eta^\\prime(958) \\to \\pi^+\\pi^-$

    CERN Document Server

    LHCb Collaboration

    2016-01-01

    A search for the $C\\!P$-violating strong decays $\\eta \\to \\pi^+\\pi^-$ and $\\eta^\\prime(958) \\to \\pi^+\\pi^-$ has been performed using approximately $2.5 \\times 10^{7}$ events of each of the decays $D^+ \\to \\pi^+\\pi^+\\pi^-$ and $D_s^+ \\to \\pi^+\\pi^+\\pi^-$, recorded by the LHCb experiment. The data set corresponds to an integrated luminosity of 3.0 fb$^{-1}$ of $pp$ collision data recorded during LHC Run 1 and 0.3 fb$^{-1}$ recorded in Run 2. No evidence is seen for $D^+_{(s)} \\to \\pi^+ \\eta^{(\\prime)}$ with $\\eta^{(\\prime)} \\to \\pi^+\\pi^-$, and upper limits at 90% confidence level are set on the branching fractions, $\\mathcal{B}(\\eta \\to \\pi^+\\pi^-) < 1.6 \\times 10^{-5}$ and $\\mathcal{B}(\\eta^\\prime \\to \\pi^+\\pi^-) < 1.8 \\times 10^{-5}$. The limit for the $\\eta$ decay is comparable with the existing one, while that for the $\\eta^\\prime$ is a factor of three smaller than the previous limit.

  9. Search for the $C\\!P$-violating strong decays $\\eta \\to \\pi^+\\pi^-$ and $\\eta^\\prime(958) \\to \\pi^+\\pi^-$

    CERN Document Server

    Aaij, Roel; Adinolfi, Marco; Ajaltouni, Ziad; Akar, Simon; Albrecht, Johannes; Alessio, Federico; Alexander, Michael; Ali, Suvayu; Alkhazov, Georgy; Alvarez Cartelle, Paula; Alves Jr, Antonio Augusto; Amato, Sandra; Amerio, Silvia; Amhis, Yasmine; An, Liupan; Anderlini, Lucio; Andreassi, Guido; Andreotti, Mirco; Andrews, Jason; Appleby, Robert; Archilli, Flavio; d'Argent, Philippe; Arnau Romeu, Joan; Artamonov, Alexander; Artuso, Marina; Aslanides, Elie; Auriemma, Giulio; Baalouch, Marouen; Babuschkin, Igor; Bachmann, Sebastian; Back, John; Badalov, Alexey; Baesso, Clarissa; Baker, Sophie; Baldini, Wander; Barlow, Roger; Barschel, Colin; Barsuk, Sergey; Barter, William; Baszczyk, Mateusz; Batozskaya, Varvara; Batsukh, Baasansuren; Battista, Vincenzo; Bay, Aurelio; Beaucourt, Leo; Beddow, John; Bedeschi, Franco; Bediaga, Ignacio; Bel, Lennaert; Bellee, Violaine; Belloli, Nicoletta; Belous, Konstantin; Belyaev, Ivan; Ben-Haim, Eli; Bencivenni, Giovanni; Benson, Sean; Benton, Jack; Berezhnoy, Alexander; Bernet, Roland; Bertolin, Alessandro; Betancourt, Christopher; Betti, Federico; Bettler, Marc-Olivier; van Beuzekom, Martinus; Bezshyiko, Iaroslava; Bifani, Simone; Billoir, Pierre; Bird, Thomas; Birnkraut, Alex; Bitadze, Alexander; Bizzeti, Andrea; Blake, Thomas; Blanc, Frederic; Blouw, Johan; Blusk, Steven; Bocci, Valerio; Boettcher, Thomas; Bondar, Alexander; Bondar, Nikolay; Bonivento, Walter; Bordyuzhin, Igor; Borgheresi, Alessio; Borghi, Silvia; Borisyak, Maxim; Borsato, Martino; Bossu, Francesco; Boubdir, Meriem; Bowcock, Themistocles; Bowen, Espen Eie; Bozzi, Concezio; Braun, Svende; Britsch, Markward; Britton, Thomas; Brodzicka, Jolanta; Buchanan, Emma; Burr, Christopher; Bursche, Albert; Buytaert, Jan; Cadeddu, Sandro; Calabrese, Roberto; Calvi, Marta; Calvo Gomez, Miriam; Camboni, Alessandro; Campana, Pierluigi; Campora Perez, Daniel Hugo; Capriotti, Lorenzo; Carbone, Angelo; Carboni, Giovanni; Cardinale, Roberta; Cardini, Alessandro; Carniti, Paolo; Carson, Laurence; Carvalho Akiba, Kazuyoshi; Casse, Gianluigi; Cassina, Lorenzo; Castillo Garcia, Lucia; Cattaneo, Marco; Cauet, Christophe; Cavallero, Giovanni; Cenci, Riccardo; Chamont, David; Charles, Matthew; Charpentier, Philippe; Chatzikonstantinidis, Georgios; Chefdeville, Maximilien; Chen, Shanzhen; Cheung, Shu-Faye; Chobanova, Veronika; Chrzaszcz, Marcin; Cid Vidal, Xabier; Ciezarek, Gregory; Clarke, Peter; Clemencic, Marco; Cliff, Harry; Closier, Joel; Coco, Victor; Cogan, Julien; Cogneras, Eric; Cogoni, Violetta; Cojocariu, Lucian; Collazuol, Gianmaria; Collins, Paula; Comerma-Montells, Albert; Contu, Andrea; Cook, Andrew; Coombs, George; Coquereau, Samuel; Corti, Gloria; Corvo, Marco; Costa Sobral, Cayo Mar; Couturier, Benjamin; Cowan, Greig; Craik, Daniel Charles; Crocombe, Andrew; Cruz Torres, Melissa Maria; Cunliffe, Samuel; Currie, Robert; D'Ambrosio, Carmelo; Da Cunha Marinho, Franciole; Dall'Occo, Elena; Dalseno, Jeremy; David, Pieter; Davis, Adam; De Aguiar Francisco, Oscar; De Bruyn, Kristof; De Capua, Stefano; De Cian, Michel; De Miranda, Jussara; De Paula, Leandro; De Serio, Marilisa; De Simone, Patrizia; Dean, Cameron Thomas; Decamp, Daniel; Deckenhoff, Mirko; Del Buono, Luigi; Demmer, Moritz; Dendek, Adam; Derkach, Denis; Deschamps, Olivier; Dettori, Francesco; Dey, Biplab; Di Canto, Angelo; Dijkstra, Hans; Dordei, Francesca; Dorigo, Mirco; Dosil Suárez, Alvaro; Dovbnya, Anatoliy; Dreimanis, Karlis; Dufour, Laurent; Dujany, Giulio; Dungs, Kevin; Durante, Paolo; Dzhelyadin, Rustem; Dziurda, Agnieszka; Dzyuba, Alexey; Déléage, Nicolas; Easo, Sajan; Ebert, Marcus; Egede, Ulrik; Egorychev, Victor; Eidelman, Semen; Eisenhardt, Stephan; Eitschberger, Ulrich; Ekelhof, Robert; Eklund, Lars; Ely, Scott; Esen, Sevda; Evans, Hannah Mary; Evans, Timothy; Falabella, Antonio; Farley, Nathanael; Farry, Stephen; Fay, Robert; Fazzini, Davide; Ferguson, Dianne; Fernandez Prieto, Antonio; Ferrari, Fabio; Ferreira Rodrigues, Fernando; Ferro-Luzzi, Massimiliano; Filippov, Sergey; Fini, Rosa Anna; Fiore, Marco; Fiorini, Massimiliano; Firlej, Miroslaw; Fitzpatrick, Conor; Fiutowski, Tomasz; Fleuret, Frederic; Fohl, Klaus; Fontana, Marianna; Fontanelli, Flavio; Forshaw, Dean Charles; Forty, Roger; Franco Lima, Vinicius; Frank, Markus; Frei, Christoph; Fu, Jinlin; Furfaro, Emiliano; Färber, Christian; Gallas Torreira, Abraham; Galli, Domenico; Gallorini, Stefano; Gambetta, Silvia; Gandelman, Miriam; Gandini, Paolo; Gao, Yuanning; Garcia Martin, Luis Miguel; García Pardiñas, Julián; Garra Tico, Jordi; Garrido, Lluis; Garsed, Philip John; Gascon, David; Gaspar, Clara; Gavardi, Laura; Gazzoni, Giulio; Gerick, David; Gersabeck, Evelina; Gersabeck, Marco; Gershon, Timothy; Ghez, Philippe; Gianì, Sebastiana; Gibson, Valerie; Girard, Olivier Göran; Giubega, Lavinia-Helena; Gizdov, Konstantin; Gligorov, V.V.; Golubkov, Dmitry; Golutvin, Andrey; Gomes, Alvaro; Gorelov, Igor Vladimirovich; Gotti, Claudio; Grabalosa Gándara, Marc; Graciani Diaz, Ricardo; Granado Cardoso, Luis Alberto; Graugés, Eugeni; Graverini, Elena; Graziani, Giacomo; Grecu, Alexandru; Griffith, Peter; Grillo, Lucia; Gruberg Cazon, Barak Raimond; Grünberg, Oliver; Gushchin, Evgeny; Guz, Yury; Gys, Thierry; Göbel, Carla; Hadavizadeh, Thomas; Hadjivasiliou, Christos; Haefeli, Guido; Haen, Christophe; Haines, Susan; Hall, Samuel; Hamilton, Brian; Han, Xiaoxue; Hansmann-Menzemer, Stephanie; Harnew, Neville; Harnew, Samuel; Harrison, Jonathan; Hatch, Mark; He, Jibo; Head, Timothy; Heister, Arno; Hennessy, Karol; Henrard, Pierre; Henry, Louis; Hernando Morata, Jose Angel; van Herwijnen, Eric; Heß, Miriam; Hicheur, Adlène; Hill, Donal; Hombach, Christoph; Hopchev, P H; Hulsbergen, Wouter; Humair, Thibaud; Hushchyn, Mikhail; Hussain, Nazim; Hutchcroft, David; Idzik, Marek; Ilten, Philip; Jacobsson, Richard; Jaeger, Andreas; Jalocha, Pawel; Jans, Eddy; Jawahery, Abolhassan; Jiang, Feng; John, Malcolm; Johnson, Daniel; Jones, Christopher; Joram, Christian; Jost, Beat; Jurik, Nathan; Kandybei, Sergii; Kanso, Walaa; Karacson, Matthias; Kariuki, James Mwangi; Karodia, Sarah; Kecke, Matthieu; Kelsey, Matthew; Kenyon, Ian; Kenzie, Matthew; Ketel, Tjeerd; Khairullin, Egor; Khanji, Basem; Khurewathanakul, Chitsanu; Kirn, Thomas; Klaver, Suzanne; Klimaszewski, Konrad; Koliiev, Serhii; Kolpin, Michael; Komarov, Ilya; Koopman, Rose; Koppenburg, Patrick; Kosmyntseva, Alena; Kozachuk, Anastasiia; Kozeiha, Mohamad; Kravchuk, Leonid; Kreplin, Katharina; Kreps, Michal; Krokovny, Pavel; Kruse, Florian; Krzemien, Wojciech; Kucewicz, Wojciech; Kucharczyk, Marcin; Kudryavtsev, Vasily; Kuonen, Axel Kevin; Kurek, Krzysztof; Kvaratskheliya, Tengiz; Lacarrere, Daniel; Lafferty, George; Lai, Adriano; Lanfranchi, Gaia; Langenbruch, Christoph; Latham, Thomas; Lazzeroni, Cristina; Le Gac, Renaud; van Leerdam, Jeroen; Lees, Jean-Pierre; Leflat, Alexander; Lefrançois, Jacques; Lefèvre, Regis; Lemaitre, Florian; Lemos Cid, Edgar; Leroy, Olivier; Lesiak, Tadeusz; Leverington, Blake; Li, Tenglin; Li, Yiming; Likhomanenko, Tatiana; Lindner, Rolf; Linn, Christian; Lionetto, Federica; Liu, Bo; Liu, Xuesong; Loh, David; Longstaff, Iain; Lopes, Jose; Lucchesi, Donatella; Lucio Martinez, Miriam; Luo, Haofei; Lupato, Anna; Luppi, Eleonora; Lupton, Oliver; Lusiani, Alberto; Lyu, Xiao-Rui; Machefert, Frederic; Maciuc, Florin; Maev, Oleg; Maguire, Kevin; Malde, Sneha; Malinin, Alexander; Maltsev, Timofei; Manca, Giulia; Mancinelli, Giampiero; Manning, Peter Michael; Maratas, Jan; Marchand, Jean François; Marconi, Umberto; Marin Benito, Carla; Marino, Pietro; Marks, Jörg; Martellotti, Giuseppe; Martin, Morgan; Martinelli, Maurizio; Martinez Santos, Diego; Martinez Vidal, Fernando; Martins Tostes, Danielle; Massacrier, Laure Marie; Massafferri, André; Matev, Rosen; Mathad, Abhijit; Mathe, Zoltan; Matteuzzi, Clara; Mauri, Andrea; Maurin, Brice; Mazurov, Alexander; McCann, Michael; McCarthy, James; McNab, Andrew; McNulty, Ronan; Meadows, Brian; Meier, Frank; Meissner, Marco; Melnychuk, Dmytro; Merk, Marcel; Merli, Andrea; Michielin, Emanuele; Milanes, Diego Alejandro; Minard, Marie-Noelle; Mitzel, Dominik Stefan; Mogini, Andrea; Molina Rodriguez, Josue; Monroy, Ignacio Alberto; Monteil, Stephane; Morandin, Mauro; Morawski, Piotr; Mordà, Alessandro; Morello, Michael Joseph; Moron, Jakub; Morris, Adam Benjamin; Mountain, Raymond; Muheim, Franz; Mulder, Mick; Mussini, Manuel; Müller, Dominik; Müller, Janine; Müller, Katharina; Müller, Vanessa; Naik, Paras; Nakada, Tatsuya; Nandakumar, Raja; Nandi, Anita; Nasteva, Irina; Needham, Matthew; Neri, Nicola; Neubert, Sebastian; Neufeld, Niko; Neuner, Max; Nguyen, Anh Duc; Nguyen, Thi Dung; Nguyen-Mau, Chung; Nieswand, Simon; Niet, Ramon; Nikitin, Nikolay; Nikodem, Thomas; Novoselov, Alexey; O'Hanlon, Daniel Patrick; Oblakowska-Mucha, Agnieszka; Obraztsov, Vladimir; Ogilvy, Stephen; Oldeman, Rudolf; Onderwater, Gerco; Otalora Goicochea, Juan Martin; Otto, Adam; Owen, Patrick; Oyanguren, Maria Aranzazu; Pais, Preema Rennee; Palano, Antimo; Palombo, Fernando; Palutan, Matteo; Panman, Jacob; Papanestis, Antonios; Pappagallo, Marco; Pappalardo, Luciano; Parker, William; Parkes, Christopher; Passaleva, Giovanni; Pastore, Alessandra; Patel, Girish; Patel, Mitesh; Patrignani, Claudia; Pearce, Alex; Pellegrino, Antonio; Penso, Gianni; Pepe Altarelli, Monica; Perazzini, Stefano; Perret, Pascal; Pescatore, Luca; Petridis, Konstantinos; Petrolini, Alessandro; Petrov, Aleksandr; Petruzzo, Marco; Picatoste Olloqui, Eduardo; Pietrzyk, Boleslaw; Pikies, Malgorzata; Pinci, Davide; Pistone, Alessandro; Piucci, Alessio; Playfer, Stephen; Plo Casasus, Maximo; Poikela, Tuomas; Polci, Francesco; Poluektov, Anton; Polyakov, Ivan; Polycarpo, Erica; Pomery, Gabriela Johanna; Popov, Alexander; Popov, Dmitry; Popovici, Bogdan; Poslavskii, Stanislav; Potterat, Cédric; Price, Eugenia; Price, Joseph David; Prisciandaro, Jessica; Pritchard, Adrian; Prouve, Claire; Pugatch, Valery; Puig Navarro, Albert; Punzi, Giovanni; Qian, Wenbin; Quagliani, Renato; Rachwal, Bartolomiej; Rademacker, Jonas; Rama, Matteo; Ramos Pernas, Miguel; Rangel, Murilo; Raniuk, Iurii; Ratnikov, Fedor; Raven, Gerhard; Redi, Federico; Reichert, Stefanie; dos Reis, Alberto; Remon Alepuz, Clara; Renaudin, Victor; Ricciardi, Stefania; Richards, Sophie; Rihl, Mariana; Rinnert, Kurt; Rives Molina, Vicente; Robbe, Patrick; Rodrigues, Ana Barbara; Rodrigues, Eduardo; Rodriguez Lopez, Jairo Alexis; Rodriguez Perez, Pablo; Rogozhnikov, Alexey; Roiser, Stefan; Rollings, Alexandra Paige; Romanovskiy, Vladimir; Romero Vidal, Antonio; Ronayne, John William; Rotondo, Marcello; Rudolph, Matthew Scott; Ruf, Thomas; Ruiz Valls, Pablo; Saborido Silva, Juan Jose; Sadykhov, Elnur; Sagidova, Naylya; Saitta, Biagio; Salustino Guimaraes, Valdir; Sanchez Mayordomo, Carlos; Sanmartin Sedes, Brais; Santacesaria, Roberta; Santamarina Rios, Cibran; Santimaria, Marco; Santovetti, Emanuele; Sarti, Alessio; Satriano, Celestina; Satta, Alessia; Saunders, Daniel Martin; Savrina, Darya; Schael, Stefan; Schellenberg, Margarete; Schiller, Manuel; Schindler, Heinrich; Schlupp, Maximilian; Schmelling, Michael; Schmelzer, Timon; Schmidt, Burkhard; Schneider, Olivier; Schopper, Andreas; Schubert, Konstantin; Schubiger, Maxime; Schune, Marie Helene; Schwemmer, Rainer; Sciascia, Barbara; Sciubba, Adalberto; Semennikov, Alexander; Sergi, Antonino; Serra, Nicola; Serrano, Justine; Sestini, Lorenzo; Seyfert, Paul; Shapkin, Mikhail; Shapoval, Illya; Shcheglov, Yury; Shears, Tara; Shekhtman, Lev; Shevchenko, Vladimir; Siddi, Benedetto Gianluca; Silva Coutinho, Rafael; Silva de Oliveira, Luiz Gustavo; Simi, Gabriele; Simone, Saverio; Sirendi, Marek; Skidmore, Nicola; Skwarnicki, Tomasz; Smith, Eluned; Smith, Iwan Thomas; Smith, Jackson; Smith, Mark; Snoek, Hella; Sokoloff, Michael; Soler, Paul; Souza De Paula, Bruno; Spaan, Bernhard; Spradlin, Patrick; Sridharan, Srikanth; Stagni, Federico; Stahl, Marian; Stahl, Sascha; Stefko, Pavol; Stefkova, Slavorima; Steinkamp, Olaf; Stemmle, Simon; Stenyakin, Oleg; Stevenson, Scott; Stoica, Sabin; Stone, Sheldon; Storaci, Barbara; Stracka, Simone; Straticiuc, Mihai; Straumann, Ulrich; Sun, Liang; Sutcliffe, William; Swientek, Krzysztof; Syropoulos, Vasileios; Szczekowski, Marek; Szumlak, Tomasz; T'Jampens, Stephane; Tayduganov, Andrey; Tekampe, Tobias; Tellarini, Giulia; Teubert, Frederic; Thomas, Eric; van Tilburg, Jeroen; Tilley, Matthew James; Tisserand, Vincent; Tobin, Mark; Tolk, Siim; Tomassetti, Luca; Tonelli, Diego; Topp-Joergensen, Stig; Toriello, Francis; Tournefier, Edwige; Tourneur, Stephane; Trabelsi, Karim; Traill, Murdo; Tran, Minh Tâm; Tresch, Marco; Trisovic, Ana; Tsaregorodtsev, Andrei; Tsopelas, Panagiotis; Tully, Alison; Tuning, Niels; Ukleja, Artur; Ustyuzhanin, Andrey; Uwer, Ulrich; Vacca, Claudia; Vagnoni, Vincenzo; Valassi, Andrea; Valat, Sebastien; Valenti, Giovanni; Vallier, Alexis; Vazquez Gomez, Ricardo; Vazquez Regueiro, Pablo; Vecchi, Stefania; van Veghel, Maarten; Velthuis, Jaap; Veltri, Michele; Veneziano, Giovanni; Venkateswaran, Aravindhan; Vernet, Maxime; Vesterinen, Mika; Viaud, Benoit; Vieira, Daniel; Vieites Diaz, Maria; Viemann, Harald; Vilasis-Cardona, Xavier; Vitti, Marcela; Volkov, Vladimir; Vollhardt, Achim; Voneki, Balazs; Vorobyev, Alexey; Vorobyev, Vitaly; Voß, Christian; de Vries, Jacco; Vázquez Sierra, Carlos; Waldi, Roland; Wallace, Charlotte; Wallace, Ronan; Walsh, John; Wang, Jianchun; Ward, David; Wark, Heather Mckenzie; Watson, Nigel; Websdale, David; Weiden, Andreas; Whitehead, Mark; Wicht, Jean; Wilkinson, Guy; Wilkinson, Michael; Williams, Mark Richard James; Williams, Matthew; Williams, Mike; Williams, Timothy; Wilson, Fergus; Wimberley, Jack; Wishahi, Julian; Wislicki, Wojciech; Witek, Mariusz; Wormser, Guy; Wotton, Stephen; Wraight, Kenneth; Wyllie, Kenneth; Xie, Yuehong; Xing, Zhou; Xu, Zhirui; Yang, Zhenwei; Yao, Yuezhe; Yin, Hang; Yu, Jiesheng; Yuan, Xuhao; Yushchenko, Oleg; Zarebski, Kristian Alexander; Zavertyaev, Mikhail; Zhang, Liming; Zhang, Yanxi; Zhang, Yu; Zhelezov, Alexey; Zheng, Yangheng; Zhokhov, Anatoly; Zhu, Xianglei; Zhukov, Valery; Zucchelli, Stefano

    2017-01-01

    A search for the $C\\!P$-violating strong decays $\\eta \\to \\pi^+\\pi^-$ and $\\eta^\\prime(958) \\to \\pi^+\\pi^-$ has been performed using approximately $2.5 \\times 10^{7}$ events of each of the decays $D^+ \\to \\pi^+\\pi^+\\pi^-$ and $D_s^+ \\to \\pi^+\\pi^+\\pi^-$, recorded by the LHCb experiment. The data set corresponds to an integrated luminosity of 3.0 fb$^{-1}$ of $pp$ collision data recorded during LHC Run 1 and 0.3 fb$^{-1}$ recorded in Run 2. No evidence is seen for $D^+_{(s)} \\to \\pi^+ \\eta^{(\\prime)}$ with $\\eta^{(\\prime)} \\to \\pi^+\\pi^-$, and upper limits at 90% confidence level are set on the branching fractions, $\\mathcal{B}(\\eta \\to \\pi^+\\pi^-) < 1.6 \\times 10^{-5}$ and $\\mathcal{B}(\\eta^\\prime \\to \\pi^+\\pi^-) < 1.8 \\times 10^{-5}$. The limit for the $\\eta$ decay is comparable with the existing one, while that for the $\\eta^\\prime$ is a factor of three smaller than the previous limit.

  10. Partial wave analyses of J/psi to gamma pi^+ pi^- and gamma pi^0 pi^0

    CERN Document Server

    Ablikim, M

    2006-01-01

    Results are presented on J/psi radiative decays to pi^+pi^- and pi^0pi^0 based on a sample of 58M J/psi events taken with the BESII detector. Partial wave analyses are carried out using the relativistic covariant tensor amplitude method in the 1.0 to 2.3 GeV/c^2 pipi mass range. There are conspicuous peaks due to the f_2(1270) and two 0^++ states in the 1.45 and 1.75 GeV/c^2 mass regions. The first 0^++ state has a mass of 1466\\pm 6\\pm 20 MeV/c^2, a width of 108^{+14}_{-11}\\pm 21 MeV/c^2, and a branching fraction B(J/psi \\to \\gamma f_0(1500) \\to\\gamma \\pi^+\\pi^-) = (0.67\\pm0.02\\pm0.28) \\times 10^{-4}. Spin 0 is strongly preferred over spin 2. The second 0^++ state peaks at 1765^{+4}_{-3}\\pm 12 MeV/c^2 with a width of 145\\pm8\\pm69 MeV/c^2. If this 0^++ is interpreted as coming from f_0(1710), the ratio of its branching fractions to pipi and K\\bar K is 0.41^{+0.11}_{-0.17}.

  11. $B \\to \\pi \\pi$, New Physics in $B \\to \\pi K$ and Rare K and B Decays

    CERN Document Server

    Buras, Andrzej J; Recksiegel, S; Schwab, F; Buras, Andrzej J.; Fleischer, Robert; Recksiegel, Stefan; Schwab, Felix

    2005-01-01

    We summarize a recent strategy for a global analysis of the B -> pi pi, pi K systems and rare decays. We find that the present B -> pi pi and B -> pi K data cannot be simultaneously described in the Standard Model. In a simple extension in which new physics enters dominantly through Z^0 penguins with a CP-violating phase, only certain B -> pi K modes are affected by new physics. The B -> pi pi data can then be described entirely within the Standard Model but with values of hadronic parameters that reflect large non-factorizable contributions. Using the SU(3) flavour symmetry and plausible dynamical assumptions, we can then use the B -> pi pi decays to fix the hadronic part of the B -> pi K system and make predictions for various observables in the B_d -> pi^-+ K^+- and B^+- -> pi^+- K decays that are practically unaffected by electroweak penguins. The data on the B^+- -> pi^0 K^+- and B_d -> pi^0 K modes allow us then to determine the electroweak penguin component which differs from the Standard Model one, in...

  12. The $\\epem\\to\\pi^+\\pi^-\\pi^+\\pi^-$, $K^+K^-\\pi^+\\pi^-$, and $K^+K^- K^+K^- $ Cross Sections at Center-of-Mass Energies 0.5--4.5 \\gev Measured with Initial-State Radiation

    CERN Document Server

    Aubert, B; Abrams, G S; Adye, T; Ahmed, M; Ahmed, S; Alam, M S; Albert, J; Aleksan, Roy; Allison, J; Allmendinger, T; Altenburg, D; Andreotti, M; Angelini, C; Anulli, F; Arnaud, N; Aston, D; Azzolini, V; Baak, M; Back, J J; Bailey, S; Baldini-Ferroli, R; Band, H R; Banerjee, Sw; Barate, R; Bard, D J; Barlow, N R; Barlow, R J; Barrett, M; Bartoldus, R; Batignani, G; Bauer, J M; Beck, T W; Behera, P K; Bellini, F; Benayoun, M; Benelli, G; Berger, N; Bernard, D; Berryhill, J W; Best, D; Bettarini, S; Bettoni, D; Bevan, A J; Bhimji, W; Bhuyan, B; Bianchi, F; Biasini, M; Blanc, F; Blaylock, G; Blinov, A E; Blinov, V E; Bloom, P; Bóna, M; Bondioli, M; Bonneaud, G R; Borgland, A W; Bosisio, L; Boutigny, D; Bowerman, D A; Boyarski, A M; Boyd, J T; Bozzi, C; Brandenburg, G; Brandt, T; Brau, J E; Breon, A B; Briand, H; Brose, J; Brown, C L; Brown, C M; Brown, D N; Bruinsma, M; Brunet, S; Bucci, F; Buchanan, C; Buchmüller, O L; Bugg, W; Bulten, H; Burchat, Patricia R; Burke, J P; Button-Shafer, J; Buzzo, A; Côté, D; Cahn, R N; Calabrese, R; Calcaterra, A; Calderini, G; Campagnari, C; Capra, R; Carpinelli, M; Cartaro, C; Cavallo, N; Cavoto, G; Chaisanguanthum, K S; Chao, M; Charles, E; Charles, M J; Chauveau, J; Chavez, C A; Chen, A; Chen, C; Chen, E; Chen, J C; Chen, S; Chen, X; Cheng, B; Cheng, C H; Chevalier, N; Christ, S; Cibinetto, G; Clark, P J; Claus, R; Cochran, J; Colecchia, F; Coleman, J P; Contri, R; Convery, M R; Cossutti, F; Cottingham, W N; Couderc, F; Covarelli, R; Cowan, G; Cowan, R; Crawley, H B; Cremaldi, L M; Cristinziani, M; Crosetti, G; Çuhadar-Dönszelmann, T; Cunha, A; D'Orazio, A; Dahmes, B; Dallapiccola, C; Danielson, N; Dasu, S; Datta, M; Dauncey, P D; David, P; Davier, M; Davis, D; Day, C T; De Groot, N; De Nardo, Gallieno; Del Buono, L; Della Ricca, G; Di Lodovico, C M; Cormack, F; Di Marco, E; Dickopp, M; Dingfelder, J C; Dittongo, S; Dong, D; Dorfan, J; Dorigo, A; Druzhinin, V P; Dubitzky, R S; Dubois-Felsmann, G P; Dujmic, D; Dunwoodie, W M; Dvoretskii, A; Eckhart, E A; Eckmann, R; Edwards, A J; Egede, U; Eichenbaum, A M; Eigen, G; Eisner, A M; Elmer, P; Emery, S; Ernst, J A; Eschenburg, V; Eschrich, I; Fabozzi, F; Faccini, R; Fan, S; Farbin, A; Feltresi, E; Ferrarotto, F; Ferroni, F; Field, R C; Finocchiaro, G; Flacco, C J; Flack, R L; Flächer, H U; Flood, K T; Ford, K E; Ford, W T; Forster, I J; Forti, F; Fortin, D; Foulkes, S D; Franek, B J; Frey, R; Fritsch, M; Fry, J R; Gabathuler, Erwin; Gaidot, A; Gaillard, J R; Galeazzi, F; Gallo, F; Gamba, D; Gamet, R; Gan, K K; Ganzhur, S F; Gary, J W; Gaspero, M; Gatto, C; Gill, M S; Giorgi, M A; Giraud, P F; Giroux, X; Gladney, L; Glanzman, T; Godang, R; Goetzen, K; Golubev, V B; Gopal, G P; Gowdy, S J; Graham, M; Grancagnolo, S; Graugès-Pous, E; Graziani, G; Green, M G; Grenier, G J; Grenier, P; Gritsan, A V; Grosdidier, G; Groysman, Y; Guo, Q H; Hadavand, H K; Hadig, T; Haire, M; Halyo, V; Hamano, K; Hamel de Monchenault, G; Hamon, O; Harrison, P F; Harrison, T J; Hart, A J; Hartfiel, B L; Harton, J L; Hast, C; Hauke, A; Hawkes, C M; Hearty, C; Held, T; Hertzbach, S S; Heusch, C A; Hill, E J; Hitlin, D G; Höcker, A; Hodgkinson, M C; Hollar, J J; Hong, T M; Honscheid, K; Hrynóva, T; Hufnagel, D; Hulsbergen, W D; Hutchcroft, D E; Igonkina, O; Innes, W R; Ivanchenko, V N; Izen, J M; Jackson, P D; Jackson, P S; Jacobsen, R G; Jawahery, A; Jayatilleke, S M; John, M J J; Johnson, J R; Judd, D; Kadel, R W; Kadyk, J; Kagan, H; Karyotakis, Yu; Kass, R; Kelly, M P; Kelsey, M H; Kerth, L T; Khan, A; Kim, H; Kim, P; Kirkby, D; Kitayama, I; Knecht, N S; Koch, H; Kocian, M L; Koeneke, K; Kofler, R; Kolomensky, Yu G; Koptchev, V B; Kovalskyi, D; Kowalewski, R V; Kozanecki, Witold; Kravchenko, E A; Krishnamurthy, M; Kroeger, R; Kroseberg, J; Kukartsev, G; Kutter, P E; Kyberd, P; Lacker, H M; Lae, C K; Lafferty, G D; Lamsa, J; Lanceri, L; Lange, D J; Langenegger, U; Lankford, A J; Latham, T E; Lau, Y P; Lazzaro, A; Le Diberder, F R; Lees, J P; Legendre, M; Leith, D W G S; Lepeltier, V; Leruste, P; Levesque, J A; Lewandowski, B; Li, H; Li, L; Libby, J; Lillard, V; Lista, L; Liu, R; Lo Secco, C P; Jessop, J M; Lo Vetere, M; Lockman, W S; Lombardo, V; London, G W; Long, O; Lou, X C; Lu, A; Lü, C; Lu, M; Luitz, S; Luppi, E; Lusiani, A; Lüth, V; Lutz, A M; Lynch, G; Lynch, H L; MacFarlane, D B; Macri, M; Majewski, S A; Malcles, J; Mallik, U; Maly, E; Mancinelli, G; Mandelkern, M A; Marchiori, G; Margoni, M; Marks, J; Marsiske, H; Martínez-Vidal, F; Mattison, T S; Mayer, B; Mazur, M A; Mazzoni, M A; McKenna, J A; McMahon, T R; Meadows, B T; Messner, R; Meyer, W T; Miftakov, V; Mihályi, A; Mir, L M; Mohanty, G B; Mohapatra, A K; Mommsen, R K; Monge, M R; Monorchio, D; Moore, T B; Morandin, M; Morgan, S E; Morganti, M; Morganti, S; Morii, M; Morton, G W; Muheim, F; Müller, D R; Naisbit, M T; Narsky, I; Nash, J A; Nauenberg, U; Neal, H; Greene, H; Negrini, M; Neri, N; Nesom, G; Nicholson, H; Nikolich, M B; Nogowski, R; O'Grady, C P; Ocariz, J; Oddone, P J; Ofte, I; Olaiya, E O; Olivas, A; Olsen, J; Onuchin, A P; Orimoto, T J; Otto, S; Ozcan, V E; Paar, H P; Paick, K; Palombo, F; Pan, Y; Panetta, J; Panvini, R S; Paoloni, E; Paolucci, P; Parry, R J; Passaggio, S; Patrignani, C; Patteri, P; Payne, D J; Pelizaeus, M; Perazzo, A; Perl, M; Peruzzi, I M; Peters, K; Petersen, B A; Petersen, T C; Petzold, A; Piatenko, T; Piccolo, D; Piccolo, M; Piemontese, L; Pierini, M; Pioppi, M; Piredda, G; Plaszczynski, S; Playfer, S; Poireau, V; Polci, F; Pompili, A; Palano, A; Poropat, P; Porter, F C; Posocco, M; Potter, C T; Prell, S; Prepost, R; Pripstein, M; Pulliam, T; Purohit, M V; Qi, N D; Rahatlou, S; Rahimi, A M; Rama, M; Rankin, P; Ratcliff, B N; Raven, G; Reidy, J; Ricciardi, S; Richman, J D; Ritchie, J L; Rizzo, G; Roat, C; Roberts, D A; Robertson, P M; Patel, S H; Robutti, E; Roe, N A; Röthel, W; Ronan, Michael T; Roney, J M; Rong, G; Roodman, A; Roos, L; Rosenberg, E I; Rotondo, M; Rubin, A E; Ruddick, W O; Ryd, A; Saeed, M A; Safai-Tehrani, F; Saleem, M; Salnikov, A A; Salvatore, F; Samuel, A; Sanders, D A; Santroni, A; Saremi, S; Sarti, A; Satpathy, A; Schalk, T; Schindler, R H; Schott, G; Schrenk, S; Schröder, H; Schröder, T; Schubert, J; Schubert, Klaus R; Schumm, B A; Schune, M H; Schwiening, J; Schwierz, R; Schwitters, R F; Sciacca, C; Sciolla, G; Seiden, A; Sekula, S J; Serednyakov, S I; Sharma, V; Shen, B C; Simani, M C; Simi, G; Simonetto, F; Sinev, N B; Skovpen, Yu I; Smith, A J S; Smith, J G; Snoek, H L; Snyder, A; Sobie, R J; Soffer, A; Soha, A; Sokoloff, M D; Solodov, E P; Spaan, B; Spanier, S M; Spradlin, P; Stängle, H; Steinke, M; Stelzer, J; Stoker, D P; Stroili, R; Strom, D; Strube, J; Stugu, B; Su, D; Sullivan, M K; Summers, D J; Sundermann, J E; Tan, P; Taras, P; Taylor, F; Taylor, G P; Telnov, A V; Teodorescu, L; Ter-Antonian, R; Therin, G; Thiebaux, C; Thiessen, D; Tisserand, V; Toki, W H; Torrence, E; Tosi, S; Touramanis, C; Ulmer, K A; Uwer, U; Vasileiadis, G; Vasseur, G; Vavra, J; Verderi, M; Verkerke, W; Vitale, L; Voci, C; Voena, C; Vuagnin, G; Wagner, G; Wagner, S R; Wagoner, D E; Waldi, R; Walsh, J; Wang, K; Wang, P; Wappler, F R; Watson, A T; Weaver, M; Weidemann, A W; Weinstein, A J R; Wenzel, W A; Wilden, L; Williams, D C; Williams, J C; Willocq, S; Wilson, F F; Wilson, J R; Wilson, M G; Wilson, R J; Winter, M A; Wisniewski, W J; Wittgen, M; Won, E; Wong, Q K; Wormser, G; Wright, D H; Wright, D M; Wu, J; Wu, S L; Xie, Y; Yamamoto, R K; Yang, S; Yarritu, A K; Ye, S; Yéche, C; Yi, J; Young, C C; Yu, Z; Yumiceva, F X; Yushkov, A N; Zallo, A; Zeng, Q; Zghiche, A; Zhang, J; Zhang, L; Zhao, H W; Zhu, Y S; Zito, M; De Sangro, R; Del Re, D; La Vaissière, C de; Von Wimmersperg-Töller, J H

    2005-01-01

    We study the process $e^+e^-\\to\\pi^+\\pi^-\\pi^+\\pi^-\\gamma$, with a hard photon radiated from the initial state. About 60,000 fully reconstructed events have been selected from 89 $fb^{-1}$ of BaBar data. The invariant mass of the hadronic final state defines the effective \\epem center-of-mass energy, so that these data can be compared with the corresponding direct $e^+e^-$ measurements. From the $4\\pi$-mass spectrum, the cross section for the process $e^+e^-\\to\\pi^+\\pi^-\\pi^+\\pi^-$ is measured for center-of-mass energies from 0.6 to 4.5 $GeV/c^2$. The uncertainty in the cross section measurement is typically 5%. We also measure the cross sections for the final states $K^+ K^- \\pi^+\\pi^-$ and $K^+ K^- K^+ K^-$. We observe the $J/\\psi$ in all three final states and measure the corresponding branching fractions. We search for X(3872) in $J/\\psi (\\to\\mu^+\\mu^-) \\pi^+\\pi^-$ and obtain an upper limit on the product of the $e^+e^-$ width of the X(3872) and the branching fraction for $X(3872) \\to J/\\psi\\pi^+\\pi^-$.

  13. Determination of $\\eta\\to\\pi^+\\pi^-\\pi^0$ Dalitz plot slopes and asymmetries with the KLOE detector

    CERN Document Server

    Ambrosino, F; Antonelli, M; Archilli, F; Bacci, C; Beltrame, P; Bencivenni, G; Bertolucci, S; Bini, C; Bloise, C; Bocchetta, S; Bossi, F; Branchini, P; Caloi, R; Campana, P; Capon, G; Capussela, T; Ceradini, F; Cesario, F; Chi, S; Chiefari, G; Ciambrone, P; Crucianelli, F; De Lucia, E; De Santis, A; De Simone, P; De Zorzi, G; Denig, A; Di Domenico, A; Di Donato, C; Di Micco, B; Doria, A; Dreucci, M; Felici, G; Ferrari, A; Ferrer, M L; Fiore, S; Forti, C; Franzini, P; Gatti, C; Gauzzi, P; Giovannella, S; Gorini, E; Graziani, E; Kluge, W; Kulikov, V; Lacava, F; Lanfranchi, G; Lee-Franzini, J; Leone, D; Martini, M; Massarotti, P; Mei, W; Meola, S; Miscetti, S; Moulson, M; Müller, S; Murtas, F; Napolitano, M; Nguyen, F; Palutan, M; Pasqualucci, E; Passeri, A; Patera, V; Perfetto, F; Primavera, M; Santangelo, P; Saracino, G; Sciascia, B; Sciubba, A; Sibidanov, A; Spadaro, T; Testa, M; Tortora, L; Valente, P; Venanzoni, G; Versaci, R; Xu, G

    2008-01-01

    We have studied, with the KLOE detector at the DA$\\Phi$NE $\\Phi$-Factory, the dynamics of the decay $\\eta\\to\\pi^+\\pi^-\\pi^0$ using $\\eta$ mesons from the decay $\\phi\\to\\eta\\gamma$ for an integrated luminosity ${\\mathcal L}$ = 450 pb$^{-1}$. From a fit to the Dalitz plot density distribution we obtain a precise measurement of the slope parameters. An alternative parametrization relates the $\\pi^+\\pi^-\\pi^0$ slopes to that for $\\eta\\to 3\\pi^0$ showing the consistency of KLOE results for both channels. We also obtain the best confirmation of the $C$-invariance in the $\\eta\\to\\pi^+\\pi^-\\pi^0$ decay.

  14. Observation of the B-0 -> rho(0)rho(0) decay from an amplitude analysis of B-0 -> (pi(+)pi(-))(pi(+)pi(-)) decays

    NARCIS (Netherlands)

    Aaij, R.; Adeva, B.; Adinolfi, M.; Affolder, A.; Ajaltouni, Z.; Akar, S.; Albrecht, J.; Alessio, F.; Alexander, M.; Ali, S.; Alkhazov, G.; Cartelle, P. Alvarez; Alves, A. A.; Amato, S.; Amerio, S.; Amhis, Y.; An, L.; Anderlini, L.; Andreotti, M.; Andrews, J. E.; Appleby, R. B.; Gutierrez, O. Aquines; Archilli, F.; Artamonov, A.; Artuso, M.; Aslanides, E.; Auriemma, G.; Baalouch, M.; Bachmann, S.; Back, J. J.; Badalov, A.; Baesso, C.; Baldini, W.; Barlow, R. J.; Barschel, C.; Barsuk, S.; Barter, W.; Batozskaya, V.; Battista, V.; Beaucourt, L.; Beddow, J.; Bedeschi, F.; Bediaga, I.; Bel, L. J.; Belyaev, I.; Ben-Haim, E.; Bencivenni, G.; Benson, S.; Benton, J.; Berezhnoy, A.; Bernet, R.; Bertolin, A.; Bettler, M. -O; van Beuzekom, M.; Bien, A.; Bifani, S.; Bird, T.; Bizzeti, A.; Blake, T.; Blanc, F.; Blouw, J.; Blusk, S.; Bocci, V.; Bondar, A.; Bondar, N.; Bonivento, W.; Borghi, S.; Borsato, M.; Bowcock, T. J. V.; Bowen, E.; Bozzi, C.; Braun, S.; Brett, D.; Britsch, M.; Britton, T.; Brodzicka, J.; Brook, N. H.; Bursche, A.; Buytaert, J.; Cadeddu, S.; Calabrese, R.; Calvi, M.; Calvo Gomez, M.; Campana, P.; Perez, D. Campora; Capriotti, L.; Carbone, A.; Carboni, G.; Cardinale, R.; Cardini, A.; Carniti, R.; Carson, L.; Carvalho Akiba, K.; Casanova Mohr, R.; Can, G.; Cassina, L.; Garcia, L. Castillo; Cattaneo, M.; Cauet, Ch.; Cavallero, G.; Cenci, R.; Charles, M.; Charpentier, Ph.; Chefdeville, M.; Cheung, S. -F.; Chiapolini, N.; Chrzaszcz, M.; Vidal, X. Cid; Ciezarek, G.; Clarke, P. E. L.; Clemencic, M.; Cliff, H. V.; Closier, J.; Coco, V.; Cogan, J.; Cogneras, E.; Cogoni, V.; Cojocariu, L.; Collazuol, G.; Collins, P.; Comerma-Montells, A.; Contu, A.; Cook, A.; Coombes, M.; Coquereau, S.; Corti, G.; Corvo, M.; Counts, I.; Couturier, B.; Cowan, G. A.; Craik, D. C.; Crocombe, A. C.; Cruz Torres, M.; Cunliffe, S.; Currie, R.; D'Ambrosio, C.; Dalseno, J.; David, P. N. Y.; Davis, A.; De Bruyn, K.; De Capua, S.; De Cian, M.; De Miranda, J. M.; De Paula, L.; De Silva, W.; De Simone, P.; Dean, C. -T.; Decamp, D.; Deckenhoff, M.; Del Buono, L.; Deleage, N.; Derkach, D.; Deschamps, O.; Dettori, F.; Dey, B.; Di Canto, A.; Di Ruscio, F.; Donleavy, S.; Dordei, F.; Dorigo, M.; Dosil Suarez, A.; Dossett, D.; Dovbnya, A.; Dreimanis, K.; Dujany, G.; Dupertuis, F.; Durante, P.; Dzhelyadin, R.; Dziurda, A.; Dzyuba, A.; Easo, S.; Egede, U.; Egorychev, V.; Eidelman, S.; Eisenhardt, S.; Eitschberger, U.; Ekelhof, R.; Eklund, L.; El Rifai, I.; Elsasser, Ch.; Ely, S.; Esen, S.; Evans, H. M.; Evans, T.; Falabella, A.; Faerber, C.; Farinelli, C.; Farley, N.; Farry, S.; Fay, R.; Ferguson, D.; Albor, V. Fernandez; Ferrari, F.; Ferreira Rodrigues, F.; Ferro-Luzzi, M.; Filippov, S.; Fiore, M.; Fiorini, M.; Firlej, M.; Fitzpatrick, C.; Fiutowski, T.; Fol, P.; Fontana, M.; Fontanelli, F.; Forty, R.; Francisco, O.; Frei, C.; Frosini, M.; Furfaro, E.; Gallas Torreira, A.; Galli, D.; Gallorini, S.; Gambetta, S.; Gandelman, M.; Gandini, P.; Garcia Pardinas, J.; Garofoli, J.; Tico, J. Garra; Garrido, L.; Gascon, D.; Gaspar, C.; Gastaldi, U.; Gauld, R.; Gavardi, L.; Gazzoni, G.; Geraci, A.; Gerick, D.; Gersabeck, E.; Gersabeck, M.; Gershon, T.; Ghez, Ph.; Gianelle, A.; Giani, S.; Gibson, V.; Giubega, L.; Gligorov, V. V.; Goebel, C.; Golubkov, D.; Golutvin, A.; Gotti, C.; Gandara, M. Grabalosa; Graciani Diaz, R.; Cardoso, L. A. Granado; Grauges, E.; Graverini, E.; Graziani, G.; Grecu, A.; Greening, E.; Gregson, S.; Griffith, P.; Grillo, L.; Gruenberg, O.; Gui, B.; Gushchin, E.; Guz, Yu.; Gys, T.; Hadjivasiliou, C.; Haefeli, G.; Haen, C.; Haines, S. C.; Hall, S.; Hamilton, B.; Hampson, T.; Han, X.; Hansmann-Menzemer, S.; Harnew, N.; Harnew, S. T.; Harrison, J.; He, J.; Head, T.; Heijne, V.; Hennessy, K.; Henrard, P.; Henry, L.; Hernando Morata, J. A.; van Herwijnen, E.; Hess, M.; Hicheur, A.; Hill, D.; Hoballah, M.; Hombach, C.; Hulsbergen, W.; Humair, T.; Hussain, N.; Hutchcroft, D.; Hynds, D.; Idzik, M.; Ilten, P.; Jacobsson, R.; Jalocha, J.; Jans, E.; Jawahery, A.; Jing, F.; John, M.; Johnson, D.; Jones, C. R.; Joram, C.; Jost, B.; Jurik, N.; Kandybei, S.; Kanso, W.; Karacson, M.; Karbach, T. M.; Karodia, S.; Kelsey, M.; Kenyon, I. R.; Kenzie, M.; Ketel, T.; Khanji, B.; Khurewathanakul, C.; Klaver, S.; Klimaszewski, K.; Kochebina, O.; Kolpin, M.; Komarov, I.; Koppenburg, P.; Korolev, M.; Kravchuk, L.; Kreplin, K.; Kreps, M.; Krocker, G.; Krokovny, P.; Kruse, E.; Kucewicz, W.; Kucharczyk, M.; Kudryavtsev, V.; Kurek, K.; Kvaratskheliya, T.; La Thi, V. N.; Lacarrere, D.; Lafferty, G.; Lai, A.; Lambert, D.; Lambert, R. W.; Lanfranchi, G.; Langenbruch, C.; Langhans, B.; Latham, T.; Lazzeroni, C.; Le Gac, R.; van Leerdam, J.; Lees, J. -P.; Lefevre, R.; Leflat, A.; Lefrancois, J.; Leroy, O.; Lesiak, T.; Leverington, B.; Likhomanenko, T.; Liles, M.

    2015-01-01

    Proton-proton collision data recorded in 2011 and 2012 by the LHCb experiment, corresponding to an integrated luminosity of 3.0 fb(-1), are analysed to search for the charmless B-0 -> rho(0)rho(0) decay. More than 600 B-0 -> (pi(+)pi(-))(pi(+)pi(-)) signal decays are selected and used to perform an

  15. Observation of the decay B-s(0) -> phi pi(+)pi(-) and evidence for B-0 -> phi pi(+)pi(-)

    NARCIS (Netherlands)

    Aaij, R.; Adeva, B.; Adinolfi, M.; Ajaltouni, Z.; Akar, S.; Albrecht, J.; Alessio, F.; Alexander, M.; Ali, S.; Alkhazov, G.; Cartelle, P. Alvarez; Alves, A. A.; Amato, S.; Amerio, S.; Amhis, Y.; An, L.; Anderlini, L.; Andreassi, G.; Andreotti, M.; Andrews, J. E.; Appleby, R. B.; Archilli, F.; d'Argent, P.; Romeu, J. Arnau; Artamonov, A.; Artuso, M.; Aslanides, E.; Auriemma, G.; Baalouch, M.; Babuschkin, I.; Bachmann, S.; Back, J. J.; Badalov, A.; Baesso, C.; Baker, S.; Baldini, W.; Barlow, R. J.; Barschel, C.; Barsuk, S.; Barter, W.; Baszczyk, M.; Batozskaya, V.; Batsukh, B.; Battista, V.; Beaucourt, L.; Beddow, J.; Bedeschi, F.; Bediaga, I.; Bel, L. J.; Bellee, V.; Belloli, N.; Belous, K.; Belyaev, I.; Ben-Haim, E.; Bencivenni, G.; Benson, S.; Benton, J.; Berezhnoy, A.; Bernet, R.; Bertolin, A.; Betti, F.; Bettler, M. -O.; van Beuzekom, M.; Bezshyiko, Ia.; Bifani, S.; Billoir, P.; Bird, T.; Birnkraut, A.; Bitadze, A.; Bizzeti, A.; Blake, T.; Blanc, F.; Blouw, J.; Blusk, S.; Bocci, V.; Boettcher, T.; Bondar, A.; Bondar, N.; Bonivento, W.; Borgheresi, A.; Borghi, S.; Borisyak, M.; Borsato, M.; Bossu, F.; Boubdir, M.; Bowcock, T. J. V.; Bowen, E.; Bozzi, C.; Braun, S.; Britsch, M.; Britton, T.; Brodzicka, J.; Buchanan, E.; Burr, C.; Bursche, A.; Buytaert, J.; Cadeddu, S.; Calabrese, R.; Calvi, M.; Calvo Gomez, M.; Camboni, A.; Campana, P.; Perez, D. Campora; Perez, D. H. Campora; Capriotti, L.; Carbone, A.; Carboni, G.; Cardinale, R.; Cardini, A.; Carniti, P.; Carson, L.; Carvalho Akiba, K.; Casse, G.; Cassina, L.; Garcia, L. Castillo; Cattaneo, M.; Cauet, Ch.; Cavallero, G.; Cenci, R.; Charles, M.; Charpentier, Ph.; Chatzikonstantinidis, G.; Chefdeville, M.; Cheung, S. -F.; Chobanova, V.; Chrzaszcz, M.; Cid Vidal, X.; Ciezarek, G.; Clarke, P. E. L.; Clemencic, M.; Cliff, H. V.; Closier, J.; Coco, V.; Cogan, J.; Cogneras, E.; Cogoni, V.; Cojocariu, L.; Collazuol, G.; Collins, P.; Comerma-Montells, A.; Contu, A.; Cook, A.; Coquereau, S.; Corti, G.; Corvo, M.; Sobral, C. M. Costa; Couturier, B.; Cowan, G. A.; Craik, D. C.; Crocombe, A.; Cruz Torres, M.; Cunliffe, S.; Currie, R.; D'Ambrosio, C.; Dall'Occo, E.; Dalseno, J.; David, P. N. Y.; Davis, A.; De Aguiar Francisco, O.; De Bruyn, K.; De Capua, S.; De Cian, M.; De Miranda, J. M.; De Paula, L.; De Serio, M.; De Simone, P.; Dean, C. -T.; Decamp, D.; Deckenhoff, M.; Del Buono, L.; Demmer, M.; Derkach, D.; Deschamps, O.; Dettori, F.; Dey, B.; Di Canto, A.; Dordei, F.; Dorigo, M.; Dosil Suarez, A.; Dovbnya, A.; Dreimanis, K.; Dufour, L.; Dujany, G.; Dungs, K.; Durante, P.; Dzhelyadin, R.; Dziurda, A.; Dzyuba, A.; Deleage, N.; Easo, S.; Ebert, M.; Egede, U.; Egorychev, V.; Eidelman, S.; Eisenhardt, S.; Eitschberger, U.; Ekelhof, R.; Eklund, L.; Elsasser, Ch.; Ely, S.; Esen, S.; Evans, H. M.; Evans, T.; Falabella, A.; Farley, N.; Farry, S.; Fay, R.; Fazzini, D.; Ferguson, D.; Fernandez Albor, V.; Fernandez Prieto, A.; Ferrari, F.; Ferreira Rodrigues, F.; Ferro-Luzzi, M.; Filippov, S.; Fini, R. A.; Fiore, M.; Fiorini, M.; Firlej, M.; Fitzpatrick, C.; Fiutowski, T.; Fleuret, F.; Fohl, K.; Fontana, M.; Fontanelli, F.; Forshaw, D. C.; Forty, R.; Lima, V. Franco; Frei, C.; Furfaro, E.; Faerber, C.; Gallas Torreira, A.; Galli, D.; Gallorini, S.; Gambetta, S.; Gandelman, M.; Gandini, P.; Garcia Martin, L. M.; Garcia Pardinas, J.; Tico, J. Garra; Garrido, L.; Garsed, P. J.; Gascon, D.; Gaspar, C.; Gavardi, L.; Gazzoni, G.; Gerick, D.; Gersabeck, E.; Gersabeck, M.; Gershon, T.; Ghez, Ph.; Giani, S.; Gibson, V.; Girard, O. G.; Giubega, L.; Gizdov, K.; Gligorov, V. V.; Golubkov, D.; Golutvin, A.; Gorelov, I. V.; Gotti, C.; Gandara, M. Grabalosa; Graciani Diaz, R.; Cardoso, L. A. Granado; Grauges, E.; Graverini, E.; Graziani, G.; Grecu, A.; Griffith, P.; Grillo, L.; Cazon, B. R. Gruberg; Gruenberg, O.; Gushchin, E.; Guz, Yu.; Gys, T.; Goebel, C.; Hadavizadeh, T.; Hadjivasiliou, C.; Haefeli, G.; Haen, C.; Haines, S. C.; Hall, S.; Hamilton, B.; Hansmann-Menzemer, S.; Harnew, N.; Harnew, S. T.; Harrison, J.; Hatch, M.; He, J.; Head, T.; Heister, A.; Hennessy, K.; Henrard, P.; Henry, L.; Hernando Morata, J. A.; van Herwijnen, E.; Hess, M.; Hicheur, A.; Hill, D.; Hombach, C.; Hopchev, H.; Hulsbergen, W.; Humair, T.; Hushchyn, M.; Hutchcroft, D.; Idzik, M.; Ilten, P.; Jacobsson, R.; Jalocha, J.; Jans, E.; Jawahery, A.; Jiang, F.; John, M.; Johnson, D.; Jones, C. R.; Joram, C.; Jost, B.; Jurik, N.; Kandybei, S.; Kanso, W.; Karacson, M.; Kariuki, J. M.; Karodia, S.; Kecke, M.; Kelsey, M.; Kenyon, I. R.; Kenzie, M.; Ketel, T.; Khairullin, E.; Khanji, B.; Khurewathanakul, C.; Kirn, T.; Klaver, S.; Klimaszewski, K.; Koliiev, S.; Kolpin, M.; Komarov, I.; Koppenburg, P.; Kozachuk, A.; Kozeiha, M.; Kravchuk, L.; Kreplin, K.; Kreps, M.; Krokovny, P.; Krzemien, W.; Kucewicz, W.; Kucharczyk, M.; Kudryavtsev, V.; Kuonen, A. K.; Kurek, K.; Kvaratskheliya, T.; Lacarrere, D.; Lafferty, G.; Lai, A.; Lambert, D.; Lanfranchi, G.; Langenbruch, C.; Latham, T.; Lazzeroni, C.; Le Gac, R.; van Leerdam, J.; Lees, J. -P.; Leflat, A.; Lefrancois, J.; Lefevre, R.; Lemaitre, F.; Lemos Cid, E.; Leroy, O.; Lesiak, T.; Leverington, B.; Likhomanenko, T.; Lindner, R.; Linn, C.; Lionetto, F.; Loh, D.; Longstaff, I.; Lopes, J. H.; Lucchesi, D.; Lucio Martinez, M.; Luo, H.; Lupato, A.; Luppi, E.; Lupton, O.; Lusiani, A.; Lyu, X.; Machefert, F.; Maciuc, F.; Maev, O.; Maguire, K.; Malde, S.; Malinin, A.; Maltsev, T.; Manca, G.; Mancinelli, G.; Manning, P.; Maratas, J.; Marchand, J. F.; Marconi, U.; Marin Benito, C.; Marino, P.; Marks, J.; Martellotti, G.; Martinelli, M.; Martinez Santos, D.; Martinez Vidal, F.; Martins Tostes, D.; Massacrier, L. M.; Massafferri, A.; Matev, R.; Mathad, A.; Mathe, Z.; Matteuzzi, C.; Mauri, A.; Maurin, B.; Mazurov, A.; McCann, M.; McCarthy, J.; McNab, A.; McNulty, R.; Meadows, B.; Meier, F.; Melnychuk, D.; Merk, M.; Merli, A.; Michielin, E.; Milanes, D. A.; Minard, M. -N.; Mitzel, D. S.; Mogini, A.; Molina Rodriguez, J.; Monroy, I. A.; Monteil, S.; Morandin, M.; Morawski, P.; Morda, A.; Morello, M. J.; Moron, J.; Morris, A. B.; Mountain, R.; Muheim, F.; Mulder, M.; Mussini, M.; Mueller, J.; Mueller, K.; Mueller, V.; Naik, P.; Nakada, T.; Nandakumar, R.; Nandi, A.; Nasteva, I.; Needham, M.; Neri, N.; Neubert, S.; Neufeld, N.; Neuner, M.; Nguyen, A. D.; Nguyen-Mau, C.; Nieswand, S.; Niet, R.; Nikitin, N.; Nikodem, T.; Novoselov, A.; O'Hanlon, D. P.; Oblakowska-Mucha, A.; Obraztsov, V.; Ogilvy, S.; Oldeman, R.; Onderwater, C. J. G.; Otalora Goicochea, J. M.; Otto, A.; Owen, P.; Oyanguren, A.; Pais, P. R.; Palano, A.; Palombo, F.; Palutan, M.; Papanestis, A.; Pappagallo, M.; Pappalardo, L. L.; Parker, W.; Parkes, C.; Passaleva, G.; Pastore, A.; Patel, G. D.; Patrignani, C.; Pearce, A.; Pellegrino, A.; Penso, G.; Altarelli, M. Pepe; Perazzini, S.; Perret, P.; Pescatore, L.; Petridis, K.; Petrolini, A.; Petrov, A.; Petruzzo, M.; Picatoste Olloqui, E.; Pietrzyk, B.; Pikies, M.; Pinci, D.; Pistone, A.; Piucci, A.; Playfer, S.; Plo Casasus, M.; Poikela, T.; Polci, F.; Poluektov, A.; Polyakov, I.; Polycarpo, E.; Pomery, G. J.; Popov, A.; Popov, D.; Popovici, B.; Poslavskii, S.; Potterat, C.; Price, E.; Price, J. D.; Prisciandaro, J.; Pritchard, A.; Prouve, C.; Pugatch, V.; Navarro, A. Puig; Punzi, G.; Qian, W.; Quagliani, R.; Rachwal, B.; Rademacker, J. H.; Rama, M.; Ramos Pernas, M.; Rangel, M. S.; Raniuk, I.; Raven, G.; Redi, F.; Reichert, S.; dos Reis, A. C.; Remon Alepuz, C.; Renaudin, V.; Ricciardi, S.; Richards, S.; Rihl, M.; Rinnert, K.; Rives Molina, V.; Rodrigues, A. B.; Rodrigues, E.; Lopez, J. A. Rodriguez; Perez, P. Rodriguez; Rogozhnikov, A.; Roiser, S.; Romanovskiy, V.; Romero Vidal, A.; Ronayne, J. W.; Rotondo, M.; Ruf, T.; Ruiz Valls, P.; Saborido Silva, J. J.; Sadykhov, E.; Sagidova, N.; Saitta, B.; Salustino Guimaraes, V.; Sanchez Mayordomo, C.; Sanmartin Sedes, B.; Santacesaria, R.; Santamarina Rios, C.; Santimaria, M.; Santovetti, E.; Sarti, A.; Satriano, C.; Satta, A.; Saunders, D. M.; Savrina, D.; Schael, S.; Schellenberg, M.; Schindler, H.; Schlupp, M.; Schmelling, M.; Schmelzer, T.; Schmidt, B.; Schneider, O.; Schopper, A.; Schubiger, M.; Schune, M. -H.; Schwemmer, R.; Sciascia, B.; Sciubba, A.; Semennikov, A.; Sergi, A.; Serra, N.; Serrano, J.; Sestini, L.; Seyfert, P.; Shapkin, M.; Shapoval, I.; Shcheglov, Y.; Shears, T.; Shekhtman, L.; Shevchenko, V.; Shires, A.; Siddi, B. G.; Coutinho, R. Silva; Silva de Oliveira, L.; Simi, G.; Simone, S.; Sirendi, M.; Skidmore, N.; Skwarnicki, T.; Smith, I. T.; Snoek, H.; Sokoloff, M. D.; Soler, F. J. P.; Souza, D.; Souza De Paula, B.; Spaan, B.; Spradlin, P.; Sridharan, S.; Stagni, F.; Stahl, M.; Stahl, S.; Stefko, P.; Stefkova, S.; Steinkamp, O.; Stemmle, S.; Stenyakin, O.; Stevenson, S.; Stone, S.; Storaci, B.; Stracka, S.; Straticiuc, M.; Straumann, U.; Sutcliffe, W.; Swientek, K.; Syropoulos, V.; Szczekowski, M.; Szumlak, T.; T'Jampens, S.; Tayduganov, A.; Tekampe, T.; Teklishyn, M.; Tellarini, G.; Teubert, F.; van Tilburg, J.; Tilley, M. J.; Tisserand, V.; Tobin, M.; Tolk, S.; Tomassetti, L.; Tonelli, D.; Topp-Joergensen, S.; Toriello, F.; Tournefier, E.; Tourneur, S.; Trabelsi, K.; Traill, M.; Tresch, M.; Trisovic, A.; Tsaregorodtsev, A.; Tsopelas, P.; Tully, A.; Tuning, N.; Ukleja, A.; Ustyuzhanin, A.; Uwer, U.; Vacca, C.; Vagnoni, V.; Valassi, A.; Valat, S.; Valenti, G.; Vallier, A.; Gomez, R. Vazquez; Vazquez Regueiro, P.; Vecchi, S.; van Veghel, M.; Velthuis, J. J.; Veltri, M.; Veneziano, G.; Venkateswaran, A.; Vernet, M.; Vesterinen, M.; Viaud, B.; Vieira, D.; Vieites Diaz, M.; Vilasis-Cardona, X.; Volkov, V.; Vollhardt, A.; Voneki, B.; Vorobyev, A.; Vorobyev, V.; Voss, C.; Vazquez Sierra, C.; Waldi, R.; Wallace, C.; Wallace, R.; Ward, D. R.; Wark, H. M.; Watson, N. K.; Websdale, D.; Weiden, A.; Whitehead, M.; Wicht, J.; Wilkinson, G.; Williams, T.; Wilson, F. F.; Wimberley, J.; Wishahi, J.; Wislicki, W.; Witek, M.; Wormser, G.; Wotton, S. A.; Wraight, K.; Wright, S.; Wyllie, K.; Xie, Y.; Xing, Z.; Yang, Z.; Yu, J.; Yuan, X.; Yushchenko, O.; Zangoli, M.; Zarebski, K. A.; Zavertyaev, M.; Zhelezov, A.; Zheng, Y.; Zhokhov, A.; Zhukov, V.; Zucchelli, S.

    2017-01-01

    The first observation of the rare decay B-s(0) -> phi pi(+) pi(-) and evidence for B-0 -> phi pi(+) pi(-) are reported, using pp collision data recorded by the LHCb detector at center-of-mass energies root s = 7 and 8 TeV, corresponding to an integrated luminosity of 3 fb(-1). The branching fraction

  16. First observation of the decays $\\overline{B}^0 \\to D^+ K^- \\pi^+ \\pi^-$ and $B^- \\to D^0 K^- \\pi^+ \\pi^-$

    CERN Document Server

    Aaij, R; Adeva, B; Adinolfi, M; Adrover, C; Affolder, A; Ajaltouni, Z; Albrecht, J; Alessio, F; Alexander, M; Alkhazov, G; Alvarez Cartelle, P; Alves Jr, A A; Amato, S; Amhis, Y; Anderson, J; Appleby, R B; Aquines Gutierrez, O; Archilli, F; Arrabito, L; Artamonov, A; Artuso, M; Aslanides, E; Auriemma, G; Bachmann, S; Back, J J; Bailey, D S; Balagura, V; Baldini, W; Barlow, R J; Barschel, C; Barsuk, S; Barter, W; Bates, A; Bauer, C; Bauer, Th; Bay, A; Bediaga, I; Belogurov, S; Belous, K; Belyaev, I; Ben-Haim, E; Benayoun, M; Bencivenni, G; Benson, S; Benton, J; Bernet, R; Bettler, M -O; van Beuzekom, M; Bien, A; Bifani, S; Bird, T; Bizzeti, A; Bjørnstad, P M; Blake, T; Blanc, F; Blanks, C; Blouw, J; Blusk, S; Bobrov, A; Bocci, V; Bondar, A; Bondar, N; Bonivento, W; Borghi, S; Borgia, A; Bowcock, T J V; Bozzi, C; Brambach, T; van den Brand, J; Bressieux, J; Brett, D; Britsch, M; Britton, T; Brook, N H; Brown, H; Büchler-Germann, A; Burducea, I; Bursche, A; Buytaert, J; Cadeddu, S; Callot, O; Calvi, M; Calvo Gomez, M; Camboni, A; Campana, P; Carbone, A; Carboni, G; Cardinale, R; Cardini, A; Carson, L; Carvalho Akiba, K; Casse, G; Cattaneo, M; Cauet, Ch; Charles, M; Charpentier, Ph; Chiapolini, N; Ciba, K; Cid Vidal, X; Ciezarek, G; Clarke, P E L; Clemencic, M; Cliff, H V; Closier, J; Coca, C; Coco, V; Cogan, J; Collins, P; Comerma-Montells, A; Constantin, F; Contu, A; Cook, A; Coombes, M; Corti, G; Couturier, B; Cowan, G A; Currie, R; D'Ambrosio, C; David, P; David, P N Y; De Bonis, I; De Capua, S; De Cian, M; De Lorenzi, F; De Miranda, J M; De Paula, L; De Simone, P; Decamp, D; Deckenhoff, M; Degaudenzi, H; Del Buono, L; Deplano, C; Derkach, D; Deschamps, O; Dettori, F; Dickens, J; Dijkstra, H; Diniz Batista, P; Domingo Bonal, F; Donleavy, S; Dordei, F; Dosil Suárez, A; Dossett, D; Dovbnya, A; Dupertuis, F; Dzhelyadin, R; Dziurda, A; Easo, S; Egede, U; Egorychev, V; Eidelman, S; van Eijk, D; Eisele, F; Eisenhardt, S; Ekelhof, R; Eklund, L; Elsasser, Ch; Elsby, D; Esperante Pereira, D; Estève, L; Falabella, A; Fanchini, E; Färber, C; Fardell, G; Farinelli, C; Farry, S; Fave, V; Fernandez Albor, V; Ferro-Luzzi, M; Filippov, S; Fitzpatrick, C; Fontana, M; Fontanelli, F; Forty, R; Francisco, O; Frank, M; Frei, C; Frosini, M; Furcas, S; Gallas Torreira, A; Galli, D; Gandelman, M; Gandini, P; Gao, Y; Garnier, J-C; Garofoli, J; Garra Tico, J; Garrido, L; Gascon, D; Gaspar, C; Gauvin, N; Gersabeck, M; Gershon, T; Ghez, Ph; Gibson, V; Gligorov, V V; Göbel, C; Golubkov, D; Golutvin, A; Gomes, A; Gordon, H; Grabalosa Gándara, M; Graciani Diaz, R; Granado Cardoso, L A; Graugés, E; Graziani, G; Grecu, A; Greening, E; Gregson, S; Gui, B; Gushchin, E; Guz, Yu; Gys, T; Haefeli, G; Haen, C; Haines, S C; Hampson, T; Hansmann-Menzemer, S; Harji, R; Harnew, N; Harrison, J; Harrison, P F; Hartmann, T; He, J; Heijne, V; Hennessy, K; Henrard, P; Hernando Morata, J A; van Herwijnen, E; Hicks, E; Holubyev, K; Hopchev, P; Hulsbergen, W; Hunt, P; Huse, T; Huston, R S; Hutchcroft, D; Hynds, D; Iakovenko, V; Ilten, P; Imong, J; Jacobsson, R; Jaeger, A; Jahjah Hussein, M; Jans, E; Jansen, F; Jaton, P; Jean-Marie, B; Jing, F; John, M; Johnson, D; Jones, C R; Jost, B; Kaballo, M; Kandybei, S; Karacson, M; Karbach, T M; Keaveney, J; Kenyon, I R; Kerzel, U; Ketel, T; Keune, A; Khanji, B; Kim, Y M; Knecht, M; Koopman, R F; Koppenburg, P; Korolev, M; Kozlinskiy, A; Kravchuk, L; Kreplin, K; Kreps, M; Krocker, G; Krokovny, P; Kruse, F; Kruzelecki, K; Kucharczyk, M; Kvaratskheliya, T; La Thi, V N; Lacarrere, D; Lafferty, G; Lai, A; Lambert, D; Lambert, R W; Lanciotti, E; Lanfranchi, G; Langenbruch, C; Latham, T; Lazzeroni, C; Le Gac, R; van Leerdam, J; Lees, J -P; Lefèvre, R; Leflat, A; Lefrançois, J; Leroy, O; Lesiak, T; Li, L; Li Gioi, L; Lieng, M; Liles, M; Lindner, R; Linn, C; Liu, B; Liu, G; von Loeben, J; Lopes, J H; Lopez Asamar, E; Lopez-March, N; Lu, H; Luisier, J; Mac Raighne, A; Machefert, F; Machikhiliyan, I V; Maciuc, F; Maev, O; Magnin, J; Malde, S; Mamunur, R M D; Manca, G; Mancinelli, G; Mangiafave, N; Marconi, U; Märki, R; Marks, J; Martellotti, G; Martens, A; Martin, L; Martín Sánchez, A; Martinez Santos, D; Massafferri, A; Mathe, Z; Matteuzzi, C; Matveev, M; Maurice, E; Maynard, B; Mazurov, A; McGregor, G; McNulty, R; Meissner, M; Merk, M; Merkel, J; Messi, R; Miglioranzi, S; Milanes, D A; Minard, M -N; Molina Rodriguez, J; Monteil, S; Moran, D; Morawski, P; Mountain, R; Mous, I; Muheim, F; Müller, K; Muresan, R; Muryn, B; Muster, B; Musy, M; Mylroie-Smith, J; Naik, P; Nakada, T; Nandakumar, R; Nasteva, I; Nedos, M; Needham, M; Neufeld, N; Nguyen-Mau, C; Nicol, M; Niess, V; Nikitin, N; Nikodem, T; Nomerotski, A; Novoselov, A; Oblakowska-Mucha, A; Obraztsov, V; Oggero, S; Ogilvy, S; Okhrimenko, O; Oldeman, R; Orlandea, M; Otalora Goicochea, J M; Owen, P; Pal, B K; Palacios, J; Palano, A; Palutan, M; Panman, J; Papanestis, A; Pappagallo, M; Parkes, C; Parkinson, C J; Passaleva, G; Patel, G D; Patel, M; Paterson, S K; Patrick, G N; Patrignani, C; Pavel-Nicorescu, C; Pazos Alvarez, A; Pellegrino, A; Penso, G; Pepe Altarelli, M; Perazzini, S; Perego, D L; Perez Trigo, E; Pérez-Calero Yzquierdo, A; Perret, P; Perrin-Terrin, M; Pessina, G; Petrella, A; Petrolini, A; Phan, A; Picatoste Olloqui, E; Pie Valls, B; Pietrzyk, B; Pilař, T; Pinci, D; Plackett, R; Playfer, S; Plo Casasus, M; Polok, G; Poluektov, A; Polycarpo, E; Popov, D; Popovici, B; Potterat, C; Powell, A; Prisciandaro, J; Pugatch, V; Puig Navarro, A; Qian, W; Rademacker, J H; Rakotomiaramanana, B; Rangel, M S; Raniuk, I; Raven, G; Redford, S; Reid, M M; dos Reis, A C; Ricciardi, S; Rinnert, K; Roa Romero, D A; Robbe, P; Rodrigues, E; Rodrigues, F; Rodriguez Perez, P; Rogers, G J; Roiser, S; Romanovsky, V; Rosello, M; Rouvinet, J; Ruf, T; Ruiz, H; Sabatino, G; Saborido Silva, J J; Sagidova, N; Sail, P; Saitta, B; Salzmann, C; Sannino, M; Santacesaria, R; Santamarina Rios, C; Santinelli, R; Santovetti, E; Sapunov, M; Sarti, A; Satriano, C; Satta, A; Savrie, M; Savrina, D; Schaack, P; Schiller, M; Schleich, S; Schlupp, M; Schmelling, M; Schmidt, B; Schneider, O; Schopper, A; Schune, M -H; Schwemmer, R; Sciascia, B; Sciubba, A; Seco, M; Semennikov, A; Senderowska, K; Sepp, I; Serra, N; Serrano, J; Seyfert, P; Shapkin, M; Shapoval, I; Shatalov, P; Shcheglov, Y; Shears, T; Shekhtman, L; Shevchenko, O; Shevchenko, V; Shires, A; Silva Coutinho, R; Skwarnicki, T; Smith, A C; Smith, N A; Smith, E; Sobczak, K; Soler, F J P; Solomin, A; Soomro, F; Souza De Paula, B; Spaan, B; Sparkes, A; Spradlin, P; Stagni, F; Stahl, S; Steinkamp, O; Stoica, S; Stone, S; Storaci, B; Straticiuc, M; Straumann, U; Subbiah, V K; Swientek, S; Szczekowski, M; Szczypka, P; Szumlak, T; T'Jampens, S; Teodorescu, E; Teubert, F; Thomas, C; Thomas, E; van Tilburg, J; Tisserand, V; Tobin, M; Tolk, S; Topp-Joergensen, S; Torr, N; Tournefier, E; Tran, M T; Tsaregorodtsev, A; Tuning, N; Ubeda Garcia, M; Ukleja, A; Urquijo, P; Uwer, U; Vagnoni, V; Valenti, G; Vazquez Gomez, R; Vazquez Regueiro, P; Vecchi, S; Velthuis, J J; Veltri, M; Viaud, B; Videau, I; Vieira, D; Vilasis-Cardona, X; Visniakov, J; Vollhardt, A; Volyanskyy, D; Voong, D; Vorobyev, A; Voss, H; Wandernoth, S; Wang, J; Ward, D R; Watson, N K; Webber, A D; Websdale, D; Whitehead, M; Wiedner, D; Wiggers, L; Wilkinson, G; Williams, M P; Williams, M; Wilson, F F; Wishahi, J; Witek, M; Witzeling, W; Wotton, S A; Wyllie, K; Xie, Y; Xing, F; Xing, Z; Yang, Z; Young, R; Yushchenko, O; Zangoli, M; Zavertyaev, M; Zhang, F; Zhang, L; Zhang, W C; Zhang, Y; Zhelezov, A; Zhong, L; Zvyagin, A

    2012-01-01

    First observations of the Cabibbo suppressed decays $\\bar{B}^0\\to D^+K^-\\pi^+\\pi^-$ and $B^-\\to D^0K^-\\pi^+\\pi^-$ are reported using 35~pb$^{-1}$ of data collected with the LHCb detector. Their branching fractions are measured with respect to the corresponding Cabibbo favored decays, from which we obtain ${\\cal{B}}(\\bar{B}^0\\to D^+K^-\\pi^+\\pi^-)/{\\cal{B}}(\\bar{B}^0\\to D^+\\pi^-\\pi^+\\pi^-)=(5.9\\pm1.1\\pm0.5)\\times10^{-2}$ and ${\\cal{B}}(B^-\\to D^0K^-\\pi^+\\pi^-)/{\\cal{B}}(B^-\\to D^0\\pi^-\\pi^+\\pi^-)=(9.4\\pm1.3\\pm0.9)\\times10^{-2}$, where the uncertainties are statistical and systematic, respectively. The $B^-\\to D^0K^-\\pi^+\\pi^-$ decay is particularly interesting, as it can be used in a similar way to $B^-\\to D^0K^-$ to measure the CKM phase $\\gamma$.

  17. Search for CP violation in $D^0 \\to K^+K^-,\\pi^+\\pi^-$ and $D^0 \\to \\pi^0\\pi^0$

    CERN Document Server

    Nanut, Tara

    2015-01-01

    We report updated measurements of indirect and direct CP asymmetry in decays $D^0 \\to K^+K^-,\\pi^+\\pi^-$ and a new measurement of direct and indirect CP asymmetry in decays $D^0 \\to \\pi^0\\pi^0$, using the full data sample of the Belle experiment.

  18. On nature of scalar and tensor mesons from the analysis of processes pi-pi-> pi-pi, K-Kbar, eta-eta

    CERN Document Server

    Surovtsev, Y S; Krupa, D; Nagy, M; Surovtsev, Yu. S.

    2006-01-01

    Analysis of the isoscalar S- and D-waves of processes pi-pi-> pi-pi, K-Kbar, eta-eta is carried out aimed at studying the status and QCD nature of scalar and tensor mesons below 2 GeV and 2.3 GeV, respectively. Assignment of these mesons to lower scalar and tensor nonets is proposed.

  19. A study of the radiative transition $\\pi \\pi \\to \\pi \\gamma^{*}$ with lattice QCD

    CERN Document Server

    Leskovec, Luka; Koutsou, Giannis; Meinel, Stefan; Negele, John W; Paul, Srijit; Petschlies, Marcus; Pochinsky, Andrew; Rendon, Gumaro; Syritsyn, Sergey

    2016-01-01

    Lattice QCD calculations of radiative transitions between hadrons have in the past been limited to processes of hadrons stable under the strong interaction. Recently developed methods for $1\\to2$ transition matrix elements in a finite volume now enable the determination of radiative decay rates of strongly unstable particles. Our lattice QCD study focuses on the process $\\pi \\pi \\to \\pi \\gamma^{*}$, where the $\\rho$ meson is present as an enhancement in the cross-section. We use $2+1$ flavors of clover fermions at a pion mass of approximately $320$ MeV and a lattice size of approximately $3.6$ fm. The required $2$-point and $3$-point correlation functions are constructed from a set of forward, sequential and stochastic light quark propagators. In addition to determining the $\\rho$ meson resonance parameters via the L\\"uscher method, the scattering phase shift is used in conjunction with the $1\\to2$ transition matrix element formalism of Brice\\~no, Hansen and Walker-Loud to compute the $\\pi\\pi\\to\\pi\\gamma^{*}$...

  20. A new method to measure the CP violating angle $\\gamma$ using $B^{+}_{-} \\to \\pi^{+}_{-} \\pi^{+}\\pi^{-}$ and $B^{+}_{-} \\to K^{+}_{-} \\pi^{+}\\pi^{-}$ decays

    CERN Document Server

    Blanco, R E; Méndez-Galain, R

    2001-01-01

    A new and simple procedure to measure the angle $\\gamma$ from $B^\\pm \\to \\pi^\\pm\\pi^+\\pi^-$ and $B^\\pm \\to K^\\pm\\pi^+\\pi-$ decays using SU(3) symmetry is presented. It is based on a full Dalitz plot analysis of these decays. All diagrams, including strong and electroweak penguins, are considered in the procedure. The method is also free from final state interaction problems. The theoretical error in the extraction of $\\gamma$ is only due to SU(3) assumptions and charm penguin uncertainties. We estimate it to be not larger than $5^o$. Taking into account the B-meson production in the first generation of B factories and recent measurements from CLEO, this method could bring the best measurement of $\\gamma$ in the next years.

  1. Measurement of $\\eta^\\prime\\rightarrow \\pi^+\\pi^- e^+e^-$ and $\\eta^\\prime\\rightarrow \\pi^+\\pi^-\\mu^+\\mu^-$

    CERN Document Server

    Ablikim, M; Albayrak, O; Ambrose, D J; An, F F; An, Q; Bai, J Z; Ferroli, R Baldini; Ban, Y; Becker, J; Bennett, J V; Bertani, M; Bian, J M; Boger, E; Bondarenko, O; Boyko, I; Briere, R A; Bytev, V; Cai, H; Cai, X; akir, O; Calcaterra, A; Cao, G F; Cetin, S A; Chang, J F; Chelkov, G; Chen, G; Chen, H S; Chen, J C; Chen, M L; Chen, S J; Chen, X; Chen, Y B; Cheng, H P; Chu, Y P; Cronin-Hennessy, D; Dai, H L; Dai, J P; Dedovich, D; Deng, Z Y; Denig, A; Denysenko, I; Destefanis, M; Ding, W M; Ding, Y; Dong, L Y; Dong, M Y; Du, S X; Fang, J; Fang, S S; Fava, L; Feng, C Q; Friedel, P; Fu, C D; Fu, J L; Gao, Y; Geng, C; Goetzen, K; Gong, W X; Gradl, W; Greco, M; Gu, M H; Gu, Y T; Guan, Y H; Guo, A Q; Guo, L B; Guo, T; Guo, Y P; Han, Y L; Harris, F A; He, K L; He, M; He, Z Y; Held, T; Heng, Y K; Hou, Z L; Hu, C; Hu, H M; Hu, J F; Hu, T; Huang, G M; Huang, G S; Huang, J S; Huang, L; Huang, X T; Huang, Y; Huang, Y P; Hussain, T; Ji, C S; Ji, Q; Ji, Q P; Ji, X B; Ji, X L; Jiang, L L; Jiang, X S; Jiao, J B; Jiao, Z; Jin, D P; Jin, S; Jing, F F; Kalantar-Nayestanaki, N; Kavatsyuk, M; Kopf, B; Kornicer, M; Kuehn, W; Lai, W; Lange, J S; Larin, P; Leyhe, M; Li, C H; Li, Cheng; Li, Cui; Li, D M; Li, F; Li, G; Li, H B; Li, J C; Li, K; Li, Lei; Li, Q J; Li, S L; Li, W D; Li, W G; Li, X L; Li, X N; Li, X Q; Li, X R; Li, Z B; Liang, H; Liang, Y F; Liang, Y T; Liao, G R; Liao, X T; Lin, D; Liu, B J; Liu, C L; Liu, C X; Liu, F H; Liu, Fang; Liu, Feng; Liu, H; Liu, H B; Liu, H H; Liu, H M; Liu, H W; Liu, J P; Liu, K; Liu, K Y; Liu, Kai; Liu, P L; Liu, Q; Liu, S B; Liu, X; Liu, Y B; Liu, Z A; Liu, Zhiqiang; Liu, Zhiqing; Loehner, H; Lu, G R; Lu, H J; Lu, J G; Lu, Q W; Lu, X R; Lu, Y P; Luo, C L; Luo, M X; Luo, T; Luo, X L; Lv, M; Ma, C L; Ma, F C; Ma, H L; Ma, Q M; Ma, S; Ma, T; Ma, X Y; Maas, F E; Maggiora, M; Malik, Q A; Mao, Y J; Mao, Z P; Messchendorp, J G; Min, J; Min, T J; Mitchell, R E; Mo, X H; Moeini, H; Morales, C Morales; Moriya, K; Muchnoi, N Yu; Muramatsu, H; Nefedov, Y; Nicholson, C; Nikolaev, I B; Ning, Z; Olsen, S L; Ouyang, Q; Pacetti, S; Park, J W; Pelizaeus, M; Peng, H P; Peters, K; Ping, J L; Ping, R G; Poling, R; Prencipe, E; Qi, M; Qian, S; Qiao, C F; Qin, L Q; Qin, X S; Qin, Y; Qin, Z H; Qiu, J F; Rashid, K H; Rong, G; Ruan, X D; Sarantsev, A; Schaefer, B D; Shao, M; Shen, C P; Shen, X Y; Sheng, H Y; Shepherd, M R; Song, W M; Song, X Y; Spataro, S; Spruck, B; Sun, D H; Sun, G X; Sun, J F; Sun, S S; Sun, Y J; Sun, Y Z; Sun, Z J; Sun, Z T; Tang, C J; Tang, X; Tapan, I; Thorndike, E H; Toth, D; Ullrich, M; Uman, I; Varner, G S; Wang, B Q; Wang, D; Wang, D Y; Wang, K; Wang, L L; Wang, L S; Wang, M; Wang, P; Wang, P L; Wang, Q J; Wang, S G; Wang, X F; Wang, X L; Wang, Y D; Wang, Y F; Wang, Y Q; Wang, Z; Wang, Z G; Wang, Z Y; Wei, D H; Wei, J B; Weidenkaff, P; Wen, Q G; Wen, S P; Werner, M; Wiedner, U; Wu, L H; Wu, N; Wu, S X; Wu, W; Wu, Z; Xia, L G; Xia, Y X; Xiao, Z J; Xie, Y G; Xiu, Q L; Xu, G F; Xu, G M; Xu, Q J; Xu, Q N; Xu, X P; Xu, Z R; Xue, F; Xue, Z; Yan, L; Yan, W B; Yan, Y H; Yang, H X; Yang, Y; Yang, Y X; Ye, H; Ye, M; Ye, M H; Yu, B X; Yu, C X; Yu, H W; Yu, J S; Yu, S P; Yuan, C Z; Yuan, Y; Zafar, A A; Zallo, A; Zang, S L; Zeng, Y; Zhang, B X; Zhang, B Y; Zhang, C; Zhang, C C; Zhang, D H; Zhang, H H; Zhang, H Y; Zhang, J Q; Zhang, J W; Zhang, J Y; Zhang, J Z; Zhang, LiLi; Zhang, R; Zhang, S H; Zhang, X J; Zhang, X Y; Zhang, Y; Zhang, Y H; Zhang, Z P; Zhang, Z Y; Zhang, Zhenghao; Zhao, G; Zhao, H S; Zhao, J W; Zhao, K X; Zhao, Lei; Zhao, Ling; Zhao, M G; Zhao, Q; Zhao, S J; Zhao, T C; Zhao, X H; Zhao, Y B; Zhao, Z G; Zhemchugov, A; Zheng, B; Zheng, J P; Zheng, Y H; Zhong, B; Zhou, L; Zhou, X; Zhou, X K; Zhou, X R; Zhu, C; Zhu, K; Zhu, K J; Zhu, S H; Zhu, X L; Zhu, Y C; Zhu, Y M; Zhu, Y S; Zhu, Z A; Zhuang, J; Zou, B S; Zou, J H

    2013-01-01

    Based on a sample of 225.3 million J/\\psi events accumulated with the BESIII detector at the BEPCII, the decays of \\eta' to pi+pi-l+l- are studied via J/\\psi to \\gamma\\eta'. A clear \\eta' signal is observed in the pi+pi-e+e- mass spectrum, and the branching fraction is measured to be \\BR(\\eta' to pi+pi-e+e-) = (2.11\\pm0.12 (stat.)\\pm0.15 (syst.))\\times10^{-3}, which is in good agreement with theoretical predictions and the previous measurement, but is determined with much higher precision. No \\eta' signal is found in the pi+ pi- mu+ mu- mass spectrum, and the upper limit is determined to be \\BR(\\eta' to pi+ pi- mu+ mu-)<2.9\\times10^{-5} at the 90% confidence level.

  2. Nonfactorizable Contributions to B {yields} {pi}{pi} Decays

    Energy Technology Data Exchange (ETDEWEB)

    Feldmann, T.

    2004-09-17

    We investigate to what extent the experimental information on B {yields} {pi}{pi} branching fractions and CP asymmetries can be used to better understand the QCD dynamics in these decays. For this purpose we decompose the independent isospin amplitudes into factorizable and non-factorizable contributions. The former can be estimated within the framework of QCD factorization for exclusive B decays. The latter vanish in the heavy-quark limit, m{sub b} {yields} {infinity}, and are treated as unknown hadronic parameters. We discuss at some length in which way the non-factorizable contributions are treated in different theoretical and phenomenological frameworks. We point out the potential differences between the phenomenological treatment of power-corrections in the ''BBNS approach'', and the appearance of power-suppressed operators in soft-collinear effective theory (SCET). On that basis we define a handful of different (but generic) scenarios where the non-factorizable part of isospin amplitudes is parameterized in terms of three or four unknowns, which can be constrained by data. We also give some short discussion on the implications of our analysis for B {yields} {pi}K decays. In particular, since non-factorizable QCD effects in B {yields} {pi}{pi} may be large, we cannot exclude sizeable non-factorizable effects, which violate SU(3){sub F} flavour symmetry, or even isospin symmetry (via long-distance QED effects). This may help to explain certain puzzles in connection with isospin-violating observables in B {yields} {pi}K decays.

  3. Electromagnetic corrections in eta --> 3 pi decays

    CERN Document Server

    Ditsche, Christoph; Meißner, Ulf-G

    2008-01-01

    We re-evaluate the electromagnetic corrections to eta --> 3 pi decays at next-to-leading order in the chiral expansion, arguing that effects of order e^2(m_u-m_d) disregarded so far are not negligible compared to other contributions of order e^2 times a light quark mass. Despite the appearance of the Coulomb pole in eta --> pi+ pi- pi0 and cusps in eta --> 3 pi0, the overall corrections remain small.

  4. Electromagnetic effects in eta --> 3 pi

    CERN Document Server

    Ditsche, Christoph; Meißner, Ulf-G

    2009-01-01

    We re-evaluate the electromagnetic corrections to eta --> 3 pi decays at next-to-leading order in the chiral expansion, arguing that effects of order e^2(m_d-m_u) disregarded so far are not negligible compared to other contributions of order e^2 times a light quark mass. Despite the appearance of the Coulomb pole in eta --> pi+ pi- pi0 and cusps in eta --> 3 pi0, the overall corrections remain small.

  5. A study of the centrally produced $\\pi0\\pi0\\pi0$ channel in pp interactions at 450 GeV/c

    CERN Document Server

    Barberis, D; Close, Francis Edwin; Danielsen, K M; Donskov, S V; Earl, B C; Evans, D; French, Bernard R; Hino, T; Inaba, S; Jacholkowski, A; Jacobsen, T; Khaustov, G V; Kinson, J B; Kirk, A; Kondashov, A A; Lednev, A A; Lenti, V; Minashvili, I A; Peigneux, J P; Romanovsky, V I; Rusakovitch, N A; Semenov, A A; Shagin, P M; Shimizu, H; Singovsky, A V; Sobol, A E; Stassinaki, M; Stroot, Jean-Pierre; Takamatsu, K; Tsuru, T; Villalobos Baillie, O; Votruba, M F; Yasu, Y

    2001-01-01

    The reaction pp -> pf (pi0pi0pi0) ps has been studied at 450 GeV/c. The pi0pi0pi0 effective mass spectrum shows clear eta(547) and pi2(1670) signals. Branching ratios for the eta(547) and pi_2(1670) are given as well as upper limits for the decays of the omega(782), a1(1260) and a2(1320) into 3pi0.

  6. The weighted vertex PI index

    CERN Document Server

    c, Aleksandar Ili\\'

    2011-01-01

    The vertex PI index is a distance--based molecular structure descriptor, that recently found numerous chemical applications. In order to increase diversity of this topological index for bipartite graphs, we introduce weighted version defined as $PI_w (G) = \\sum_{e = uv \\in E} (deg (u) + deg (v)) (n_u (e) + n_v (e))$, where $deg (u)$ denotes the vertex degree of $u$ and $n_u (e)$ denotes the number of vertices of $G$ whose distance to the vertex $u$ is smaller than the distance to the vertex $v$. We establish basic properties of $PI_w (G)$, and prove various lower and upper bounds. In particular, the path $P_n$ has minimal, while the complete tripartite graph $K_{n/3, n/3, n/3}$ has maximal weighed vertex $PI$ index among graphs with $n$ vertices. We also compute exact expressions for the weighted vertex PI index of the Cartesian product of graphs. Finally we present modifications of two inequalities and open new perspectives for the future research.

  7. Combined analysis of the pn -> d pi(+)pi(-) and pn -> pn pi(+)pi(-) cross sections and implications for the interpretation of the pn -> d pi(+)pi(-) data

    OpenAIRE

    Albaladejo, Miguel; Oset, Eulogi

    2013-01-01

    We use recent data that show a narrow peak around root s = 2.37 GeV in the pn -> d pi(+)pi(-) cross section, with about double strength at the peak than in the analogous pn -> d pi(0)pi(0) reaction, and, assuming that it is due to the excitation of a dibaryon resonance, we evaluate the cross section for the pn -> pn pi(+)pi(-) reaction, with the final pn unbound but with the same quantum numbers as the deuteron. We use accurate techniques to determine the final state interaction in the case o...

  8. {pi}{pi}-correlations in hot and dense matter; {pi}{pi}-Korrelationen in heisser und dichter Materie

    Energy Technology Data Exchange (ETDEWEB)

    Isselhorst, C.

    2006-07-01

    Properties of the {pi}{pi}-interactions in hot and dense matter are studied within a nonperturbative and symmetry conserving approach. The pion and its chiral partner, the {sigma}-meson, are described within the linear {sigma} model and special attention is given to the conservation of the underlying chiral symmetry. The first part deals with the properties of pion and {sigma} in the vacuum, the further being the ''Goldstone''-boson of the theory, while the latter is a broad resonance. The results in the vacuum are tested against experimental results like {pi}{pi}-phase shifts as well as the mass and the width of the {sigma}-meson. Besides the propagator of the {sigma}-meson, the preservation of the chiral symmetry is explicitly examined and chiral Ward identities for the n-point functions of the theory are fulfilled. Furthermore the {pi}{pi}-scattering matrix is calculated and shown to be consistent with predictions from chiral perturbation theory. In the second part of this work the model is extended to finite temperature with special emphasis on the chiral phase transition. The transition temperature and the critical exponent {beta} are determined, and the influence of the temperature on the propagator of the s-meson as well as on the {pi}{pi}-scattering matrix is examined. The third part deals with the properties of pion and {sigma} in dense matter. Additional couplings like the ones to particle-hole excitations and short range repulsion have to be included to ensure stability at nuclear matter density. At zero three momentum one observes a strong downward shift of the {sigma}-mass accompanied by an accumulation of strength near the two-pion threshhold in the spectral function. Taking into account a finite three momentum for the {pi}{pi}-pair, respectively the {sigma}-meson, one observes a weakening of the aforementioned effect. Having thus developed a model for the {pi}{pi}-interaction at finite temperature and density, we try to describe

  9. Raspberry Pi projects for kids

    CERN Document Server

    Bates, Daniel

    2014-01-01

    This tutorial contains all-important information about how to use your Raspberry Pi to develop any application you like. It is broken down into several action-packed projects, each containing easy-to-follow steps, just to show you how easy and fun computer programming can be!If you are someone with a big imagination and would like to dive straight into the realm of technology and computers, then this is the book for you. With only a Raspberry Pi and no prior experience required, you will be shown how to translate your ideas into computer programs, creating any game, tool, or animation you can

  10. Easy as Pi: A Network Coding Raspberry Pi Testbed

    DEFF Research Database (Denmark)

    Sørensen, Chres Wiant; Hernandez, Nestor; Cabrera Guerrero, Juan A.

    2016-01-01

    of the hardware, but also due to maintenance challenges. In this paper, we present the required key steps to design, setup and maintain an inexpensive testbed using Raspberry Pi devices for communications and storage networks with network coding capabilities. This testbed can be utilized for any applications...

  11. Resonance structure of $\\tau^{-} \\to K^{-}\\pi^{+}\\pi^{-}\

    CERN Document Server

    Asner, D M; Gronberg, J B; Hill, T S; Lange, D J; Morrison, R J; Briere, R A; Behrens, B H; Ford, W T; Gritsan, A; Roy, J D; Smith, J G; Alexander, J P; Baker, R; Bebek, C; Berger, B E; Berkelman, K; Blanc, F; Boisvert, V; Cassel, David G; Dickson, M; Drell, P S; Ecklund, K M; Ehrlich, R; Foland, A D; Gaidarev, P B; Galik, R S; Gibbons, L K; Gittelman, B; Gray, S W; Hartill, D L; Heltsley, B K; Hopman, P I; Jones, C D; Kreinick, D L; Lohner, M; Magerkurth, A; Meyer, T O; Mistry, N B; Ng, C R; Nordberg, E; Patterson, J R; Peterson, D; Riley, D; Thayer, J G; Thies, P G; Valant-Spaight, B L; Watburton, A; Avery, P; Prescott, C; Rubiera, A I; Yelton, J; Zheng, J; Brandenburg, G; Ershov, A; Gao, Y S; Kim, D Y J; Wilson, R; Browder, T E; Li, Y; Rodríguez, J L; Yamamoto, H; Bergfeld, T; Eisenstein, B I; Ernst, J; Gladding, G E; Gollin, G D; Hans, R M; Johnson, E; Karliner, I; Marsh, M A; Palmer, M; Plager, C; Sedlack, C; Selen, M; Thaler, J J; Williams, J; Edwards, K W; Janicek, R; Patel, P M; Sadoff, A J; Ammar, R; Bean, A; Besson, D; Davis, R; Kravchenko, I V; Kwak, N; Zhao, X; Anderson, S; Frolov, V V; Kubota, Y; Lee, S J; Mahapatra, R; O'Neill, J J; Poling, R A; Riehle, T; Smith, A; Urheim, J; Ahmed, S; Alam, M S; Athar, S B; Jian, L; Ling, L; Mahmood, A H; Saleem, M; Timm, S; Wappler, F; Anastassov, A; Duboscq, J E; Gan, K K; Gwon, C; Hart, T; Honscheid, K; Hufnagel, D; Kagan, H; Kass, R; Pedlar, T K; Schwarthoff, H; Thayer, J B; Von Törne, E; Zoeller, M M; Richichi, S J; Severini, H; Skubic, P L; Undrus, A; Chen, S; Fast, J; Hinson, J W; Lee, J; Menon, N; Miller, D H; Shibata, E I; Shipsey, I P J; Pavlunin, V; Cronin-Hennessy, D; Kwon, Y; Lyon, A L; Thorndike, E H; Jessop, C P; Marsiske, H; Perl, Martin Lewis; Savinov, V; Ugolini, D W; Zhou, X; Coan, T E; Fadeev, V; Maravin, Y; Narsky, I; Stroynowski, R; Ye, J; Wlodek, T; Artuso, M; Ayad, R; Boulahouache, C; Bukin, K; Dambasuren, E; Karamov, S; Kopp, S E; Majumder, G; Moneti, G C; Mountain, R; Schuh, S; Skwarnicki, T; Stone, S; Viehhauser, G; Wang, J C; Wolf, A; Wu, J; Csorna, S E; Danko, I; McLean, K W; Marka, S; Xu, Z; Godang, R; Kinoshita, K; Lai, I C; Schrenk, S; Bonvicini, G; Cinabro, D; Perera, L P; Zhou, G J; Eigen, G; Lipeles, E; Schmidtler, M; Shapiro, A; Sun, W M; Weinstein, A J; Würthwein, F; Jaffe, D E; Masek, G E; Paar, H P; Potter, E M; Prell, S; Sharma, V

    2000-01-01

    Using a sample of 4.7 fb/sup -1/ integrated luminosity accumulated with the CLEO II detector at the Cornell Electron Storage Ring (CESR) , we investigate the mass spectrum and resonant structure in tau /sup -/ to K/sup -/ pi /sup +/ pi /sup -/ nu /sub tau / decays. We measure the relative fractions of K/sub 1/(1270) and K/sub 1/(1400) resonances in these decays, as well as the K/sub 1/ masses and widths. Our fitted K/sub 1/ resonances are somewhat broader than previous hadroproduction measurements, and in agreement with recent CERN LEP results from tau decay. The larger central value of our measured width supports models which attribute the small tau /sup -/ to K/sup -/ pi /sup +/ pi /sup -/ nu /sub tau / branching fraction to larger K/sub 1/ widths than are presently tabulated. We also determine the K/sub a/-K/sub b/ mixing angle theta /sub K/. (22 refs) .

  12. Testing the dynamics of B ->pi pi and constraints onalpha

    Energy Technology Data Exchange (ETDEWEB)

    Grossman, Yuval; Hocker, Andreas; Ligeti, Zoltan; Pirjol, Dan

    2005-07-07

    In charmless nonleptonic B decays to {pi}{pi} or {rho}{rho}, the ''color allowed'' and ''color suppressed'' tree amplitudes can be studied in a systematic expansion in {alpha}{sub s}(m{sub b}) and {Lambda}{sub QCD}/m{sub b}. At leading order in this expansion their relative strong phase vanishes. The implications of this prediction are obscured by penguin contributions. They propose to use this prediction to test the relative importance of the various penguin amplitudes using experimental data. The present B {yields} {pi}{pi} data suggest that there are large corrections to the heavy quark limit, which can be due to power corrections to the tree amplitudes, large up-penguin amplitude, or enhanced weak annihilation. Because the penguin contributions are smaller, the heavy quark limit is more consistent with the B {yields} {rho}{rho} data, and its implications may become important for the extraction of {alpha} from this mode in the future.

  13. Observation of $\\psp$ decays to $\\rho(770)\\pi$ and $\\rho(2150)\\pi$

    CERN Document Server

    Ablikim, M; Ban, Y; Bian, J G; Cai, X; Chang, J F; Chen, H F; Chen, H S; Chen, H X; Chen, J C; Chen, M L; Chen, Y B; Chi, S P; Chu, Y P; Cui, X Z; Dai, H L; Dai, Y S; Deng, Z Y; Dong, L Y; Du, S X; Du, Z Z; Fang, J; Fang, S S; Fu, C D; Fu, H Y; Gao, C S; Gao, Y N; Gong, M Y; Gong, W X; Gu, S D; Guo, Y N; Guo, Y Q; He, K L; He, M; He, X; Heng, Y K; Hu, H M; Hu, T; Huang, G S; Huang, L; Huang, X P; Ji, X B; Jia, Q Y; Jiang, C H; Jiang, X S; Jin, D P; Jin, S; Jin, Y; Lai, Y F; Li, F; Li, G; Li, H H; Li, J; Li, J C; Li, Q J; Li, R B; Li, R Y; Li, S M; Li, W G; Li, X L; Li, X Q; Li, X S; Liang, Y F; Liao, H B; Liu, C X; Liu, F; Liu, H M; Liu, J B; Liu, J P; Liu, R G; Liu, Z A; Liu, Z X; Lu, F; Lu, G R; Lu, J G; Luo, C L; Luo, X L; Ma, F C; Ma, J M; Ma, L L; Ma, Q M; Ma, X Y; Mao, Z P; Mo, X H; Nie, J; Nie, Z D; Peng, H P; Qi, N D; Qian, C D; Qin, H; Qiu, J F; Ren, Z Y; Rong, G; Shan, L Y; Shang, L; Shen, D L; Shen, X Y; Sheng, H Y; Shi, F; Shi, X; Sun, H S; Sun, S S; Sun, Y Z; Sun, Z J; Tang, X; Tao, N; Tian, Y R; Tong, G L; Wang, D Y; Wang, J Z; Wang, K; Wang, L; Wang, L S; Wang, M; Wang, P; Wang, P L; Wang, S Z; Wang, W F; Wang, Y F; Wang, Z; Wang, Z Y; Wei, C L; Wei, D H; Wu, N; Wu, Y M; Xia, X M; Xie, X X; Xin, B; Xu, G F; Xu, H; Xu, Y; Xue, S T; Yan, M L; Yang, F; Yang, H X; Yang, J; Yang, S D; Yang, Y X; Ye, M; Ye, M H; Ye, Y X; Yi, L H; Yi, Z Y; Yu, C S; Yu, G W; Yuan, C Z; Yuan, J M; Yuan, Y; Yue, Q; Zang, S L; Zeng, Yu; Zeng, Y; Zhang, B X; Zhang, B Y; Zhang, C C; Zhang, D H; Zhang, H Y; Zhang, J; Zhang, J Y; Zhang, J W; Zhang, L S; Zhang, Q J; Zhang, S Q; Zhang Xiao Min; Zhang, X Y; Zhang, Y J; Zhang, Y Y; Zhang, Z P; Zhang, Z Q; Zhao, D X; Zhao, J B; Zhao, J W; Zhao, M G; Zhao, P P; Zhao, W R; Zhao, X J; Zhao, Y B; Zhao, Z G; Zheng, H Q; Zheng, J P; Zheng, L S; Zheng, Z P; Zhong, X C; Zhou, B Q; Zhou, G M; Zhou, L; Zhou, N F; Zhu, K J; Zhu, Q M; Zhu, Y C; Zhu, Y S; Zhu, Z A; Zhuang, B A; Zou, B S

    2004-01-01

    \\pspto \\rho\\pi is observed for the fisrt time in a data sample of 14M \\psp decays collected by the BESII detector at BEPC. The branching fraction is measured to be \\BR(pspto\\rho\\pi)=(5.1+-0.7+-0.8)10-5, where the first error is statistical and the second one is systematic. A high mass excited \\rho state wirh mass around 2.15GeV/c2 is also observed wirh \\BR(pspto \\rho(2150)\\pi) \\ra pi+pi-pi0) =(19.4+-2.5+11.2-2.1)10-5. The branching fraction of \\pspto pi+pi-pi0 is measued with improved precision, \\BR(\\pspto pi+pi-pi0)=(18.1+-1.8+-1.9)10-5. The results may shed light on the understanding of the longstanding "\\rhopi puzzle" between \\jpsi and \\psp hadronic decays.

  14. Measurement of branching fractions and mass spectra of B -> K pi pi gamma

    CERN Document Server

    Aubert, B; Boutigny, D; Couderc, F; Karyotakis, Yu; Lees, J P; Poireau, V; Tisserand, V; Zghiche, A; Graugès-Pous, E; Palano, A; Pompili, A; Chen, J C; Qi, N D; Rong, G; Wang, P; Zhu, Y S; Eigen, G; Ofte, I; Stugu, B; Abrams, G S; Borgland, A W; Breon, A B; Brown, D N; Button-Shafer, J; Cahn, R N; Charles, E; Day, C T; Gill, M S; Gritsan, A V; Groysman, Y; Jacobsen, R G; Kadel, R W; Kadyk, J; Kerth, L T; Kolomensky, Yu G; Kukartsev, G; Lynch, G; Mir, L M; Oddone, P J; Orimoto, T J; Pripstein, M; Roe, N A; Ronan, Michael T; Wenzel, W A; Barrett, M; Ford, K E; Harrison, T J; Hart, A J; Hawkes, C M; Morgan, S E; Watson, A T; Fritsch, M; Goetzen, K; Held, T; Koch, H; Lewandowski, B; Pelizaeus, M; Peters, K; Schröder, T; Steinke, M; Boyd, J T; Burke, J P; Chevalier, N; Cottingham, W N; Kelly, M P; Latham, T E; Wilson, F F; Çuhadar-Dönszelmann, T; Hearty, C; Knecht, N S; Mattison, T S; McKenna, J A; Thiessen, D; Khan, A; Kyberd, P; Teodorescu, L; Blinov, A E; Blinov, V E; Druzhinin, V P; Golubev, V B; Ivanchenko, V N; Kravchenko, E A; Onuchin, A P; Serednyakov, S I; Skovpen, Yu I; Solodov, E P; Yushkov, A N; Best, D; Bruinsma, M; Chao, M; Eschrich, I; Kirkby, D; Lankford, A J; Mandelkern, M A; Mommsen, R K; Röthel, W; Stoker, D P; Buchanan, C; Hartfiel, B L; Weinstein, A J R; Foulkes, S D; Gary, J W; Long, O; Shen, B C; Wang, K; Del Re, D; Hadavand, H K; Hill, E J; MacFarlane, D B; Paar, H P; Rahatlou, S; Sharma, V; Berryhill, J W; Campagnari, C; Cunha, A; Dahmes, B; Hong, T M; Lu, A; Mazur, M A; Richman, J D; Verkerke, W; Beck, T W; Eisner, A M; Flacco, C J; Heusch, C A; Kroseberg, J; Lockman, W S; Nesom, G; Schalk, T; Schumm, B A; Seiden, A; Spradlin, P; Williams, D C; Wilson, M G; Albert, J; Chen, E; Dubois-Felsmann, G P; Dvoretskii, A; Hitlin, D G; Narsky, I; Piatenko, T; Porter, F C; Ryd, A; Samuel, A; Yang, S; Jayatilleke, S M; Mancinelli, G; Meadows, B T; Sokoloff, M D; Blanc, F; Bloom, P; Chen, S; Ford, W T; Nauenberg, U; Olivas, A; Rankin, P; Ruddick, W O; Smith, J G; Ulmer, K A; Zhang, J; Zhang, L; Chen, A; Eckhart, E A; Harton, J L; Soffer, A; Toki, W H; Wilson, R J; Zeng, Q; Spaan, B; Altenburg, D; Brandt, T; Brose, J; Dickopp, M; Feltresi, E; Hauke, A; Lacker, H M; Maly, E; Nogowski, R; Otto, S; Petzold, A; Schott, G; Schubert, J; Schubert, K R; Schwierz, R; Sundermann, J E; Bernard, D; Bonneaud, G R; Grenier, P; Schrenk, S; Thiebaux, C; Vasileiadis, G; Verderi, M; Bard, D J; Clark, P J; Muheim, F; Playfer, S; Xie, Y; Andreotti, M; Azzolini, V; Bettoni, D; Bozzi, C; Calabrese, R; Cibinetto, G; Luppi, E; Negrini, M; Piemontese, L; Sarti, A; Anulli, F; Baldini-Ferroli, R; Calcaterra, A; De, R; Sangro; Finocchiaro, G; Patteri, P; Peruzzi, I M; Piccolo, M; Zallo, A; Buzzo, A; Capra, R; Contri, R; Crosetti, G; Lo Vetere, M; Macri, M; Monge, M R; Passaggio, S; Patrignani, C; Robutti, E; Santroni, A; Tosi, S; Bailey, S; Brandenburg, G; Chaisanguanthum, K S; Morii, M; Won, E; Dubitzky, R S; Langenegger, U; Marks, J; Uwer, U; Bhimji, W; Bowerman, D A; Dauncey, P D; Egede, U; Gaillard, J R; Morton, G W; Nash, J A; Nikolich, M B; Taylor, G P; Charles, M J; Grenier, G J; Mallik, U; Mohapatra, A K; Cochran, J; Crawley, H B; Lamsa, J; Meyer, W T; Prell, S; Rosenberg, E I; Rubin, A E; Yi, J; Arnaud, N; Davier, M; Giroux, X; Grosdidier, G; Höcker, A; Le Diberder, F R; Lepeltier, V; Lutz, A M; Petersen, T C; Pierini, M; Plaszczynski, S; Schune, M H; Wormser, G; Cheng, C H; Lange, D J; Simani, M C; Wright, D M; Bevan, A J; Chavez, C A; Coleman, J P; Forster, I J; Fry, J R; Gabathuler, Erwin; Gamet, R; Hutchcroft, D E; Parry, R J; Payne, D J; Touramanis, C; Cormack, C M; Di Lodovico, F; Brown, C L; Cowan, G; Flack, R L; Flächer, H U; Green, M G; Jackson, P S; McMahon, T R; Ricciardi, S; Salvatore, F; Winter, M A; Brown, D; Davis, C L; Allison, J; Barlow, N R; Barlow, R J; Hodgkinson, M C; Lafferty, G D; Naisbit, M T; Williams, J C; Chen, C; Farbin, A; Hulsbergen, W D; Jawahery, A; Kovalskyi, D; Lae, C K; Lillard, V; Roberts, D A; Blaylock, G; Dallapiccola, C; Hertzbach, S S; Kofler, R; Koptchev, V B; Moore, T B; Saremi, S; Stängle, H; Willocq, S; Cowan, R; Koeneke, K; Sciolla, G; Sekula, S J; Taylor, F; Yamamoto, R K; Patel, P M; Robertson, S H; Lazzaro, A; Lombardo, V; Palombo, F; Bauer, J M; Cremaldi, L M; Eschenburg, V; Godang, R; Kroeger, R; Reidy, J; Sanders, D A; Summers, D J; Zhao, H W; Brunet, S; Côté, D; Taras, P; Nicholson, H; Cavallo, N; Fabozzi, F; Gatto, C; Lista, L; Monorchio, D; Paolucci, P; Piccolo, D; Sciacca, C; Baak, M; Bulten, H; Raven, G; Snoek, H L; Wilden, L; Jessop, C P; LoSecco, J M; Allmendinger, T; Benelli, G; Gan, K K; Honscheid, K; Hufnagel, D; Kagan, H; Kass, R; Pulliam, T; Rahimi, A M; Ter-Antonian, R; Wong, Q K; Brau, J E; Frey, R; Igonkina, O; Lu, M; Potter, C T; Sinev, N B; Strom, D; Torrence, E; Colecchia, F; Dorigo, A; Galeazzi, F; Margoni, M; Morandin, M; Posocco, M; Rotondo, M; Simonetto, F; Stroili, R; Voci, C; Benayoun, M; Briand, H; Chauveau, J; David, P; Del Buono, L; La Vaissière, C de; Hamon, O; John, M J J; Leruste, P; Malcles, J; Ocariz, J; Roos, L; Therin, G; Behera, P K; Gladney, L; Guo, Q H; Panetta, J; Biasini, M; Covarelli, R; Pioppi, M; Angelini, C; Batignani, G; Bettarini, S; Bondioli, M; Bucci, F; Calderini, G; Carpinelli, M; Forti, F; Giorgi, M A; Lusiani, A; Marchiori, G; Morganti, M; Neri, N; Paoloni, E; Rama, M; Rizzo, G; Simi, G; Walsh, J; Haire, M; Judd, D; Paick, K; Wagoner, D E; Danielson, N; Elmer, P; Lau, Y P; Lü, C; Miftakov, V; Olsen, J; Smith, A J S; Telnov, A V; Bellini, F; Cavoto, G; D'Orazio, A; Di Marco, E; Faccini, R; Ferrarotto, F; Ferroni, F; Gaspero, M; Li Gioi, L; Mazzoni, M A; Morganti, S; Piredda, G; Polci, F; Safai, F; Tehrani; Voena, C; Christ, S; Schröder, H; Wagner, G; Waldi, R; Adye, T; De Groot, N; Franek, B J; Gopal, G P; Olaiya, E O; Aleksan, Roy; Emery, S; Gaidot, A; Ganzhur, S F; Giraud, P F; Graziani, G; Hamel de Monchenault, G; Kozanecki, Witold; Legendre, M; London, G W; Mayer, B; Vasseur, G; Yéche, C; Zito, M; Purohit, M V; Weidemann, A W; Wilson, J R; Yumiceva, F X; Abe, T; Aston, D; Bartoldus, R; Berger, N; Boyarski, A M; Buchmüller, O L; Claus, R; Convery, M R; Cristinziani, M; De Nardo, Gallieno; Dingfelder, J C; Dong, D; Dorfan, J; Dujmic, D; Dunwoodie, W M; Fan, S; Field, R C; Glanzman, T; Gowdy, S J; Hadig, T; Halyo, V; Hast, C; Hrynóva, T; Innes, W R; Kelsey, M H; Kim, P; Kocian, M L; Leith, D W G S; Libby, J; Luitz, S; Lüth, V; Lynch, H L; Marsiske, H; Messner, R; Müller, D R; O'Grady, C P; Ozcan, V E; Perazzo, A; Perl, M; Ratcliff, B N; Roodman, A; Salnikov, A A; Schindler, R H; Schwiening, J; Snyder, A; Soha, A; Stelzer, J; Strube, J; Su, D; Sullivan, M K; Vavra, J; Wagner, S R; Weaver, M; Wisniewski, W J; Wittgen, M; Wright, D H; Yarritu, A K; Young, C C; Burchat, P R; Edwards, A J; Majewski, S A; Petersen, B A; Roat, C; Ahmed, M; Ahmed, S; Alam, M S; Ernst, J A; Saeed, M A; Saleem, M; Wappler, F R; Bugg, W; Krishnamurthy, M; Spanier, S M; Eckmann, R; Kim, H; Ritchie, J L; Satpathy, A; Schwitters, R F; Izen, J M; Kitayama, I; Lou, X C; Ye, S; Bianchi, F; Bóna, M; Gallo, F; Gamba, D; Bosisio, L; Cartaro, C; Cossutti, F; Della Ricca, G; Dittongo, S; Grancagnolo, S; Lanceri, L; Poropat, P; Vitale, L; Vuagnin, G; Martínez-Vidal, F; Panvini, R S; Banerjee, S W; Bhuyan, B; Brown, C M; Fortin, D; Hamano, K; Jackson, P D; Kowalewski, R V; Roney, J M; Sobie, R J; Back, J J; Harrison, P F; Mohanty, G B; Band, H R; Chen, X; Cheng, B; Dasu, S; Datta, M; Eichenbaum, A M; Flood, K T; Graham, M; Hollar, J J; Johnson, J R; Kutter, P E; Li, H; Liu, R; Mihályi, A; Pan, Y; Prepost, R; Tan, P; Von Wimmersperg-Töller, J H; Wu, J; Wu, S L; Yu, Z; Greene, M G; Neal, H

    2005-01-01

    We present a measurement of the partial branching fractions and mass spectra of the exclusive radiative penguin processes B -> K pi pi gamma in the range m_Kpipi pi+ pi-. Using 232 million e+ e- -> B Bbar events recorded by the BaBar experiment at the PEP-II asymmetric-energy storage ring, we measure the branching fractions BR(B+ -> K+ pi- pi+ gamma) = (2.95 +- 0.13 (stat.) +- 0.20 (syst.)) x 10^-5, BR(B0 -> K+ pi- pi0 gamma) = (4.07 +- 0.22 (stat.) +- 0.31 (syst.)) x 10^-5, BR(B0 -> K0 pi+ pi- gamma) = (1.85 +- 0.21 (stat.) +- 0.12 (syst.)) x 10^-5, and BR(B+ -> K0 pi+ pi0 gamma) = (4.56 +- 0.42 (stat.) +- 0.31 (syst.)) x 10^-5.

  15. Improved Measurements of CP-Violating Asymmetries in B0 --> pi+pi- Decays

    CERN Document Server

    Aubert, B; Abrams, G S; Adye, T; Ahmed, S; Alam, M S; Albert, J; Aleksan, Roy; Allison, J; Allmendinger, T; Altenburg, D; Andreotti, M; Angelini, C; Anulli, F; Aston, D; Azzolini, V; Baak, M; Back, J J; Bailey, S; Baldini-Ferroli, R; Band, H R; Banerjee, Sw; Barate, R; Bard, D J; Barlow, N R; Barlow, R J; Barrett, M; Bartoldus, R; Batignani, G; Bauer, J M; Beck, T W; Behera, P K; Bellini, F; Benayoun, M; Berger, N; Bernard, D; Berryhill, J W; Best, D; Bettarini, S; Bettoni, D; Bevan, A J; Bhimji, W; Bianchi, F; Biasini, M; Blanc, F; Blaylock, G; Blinov, A E; Blinov, V E; Bloom, P; Bóna, M; Bondioli, M; Bonneaud, G R; Borgland, A W; Bosisio, L; Boutigny, D; Bowerman, D A; Boyarski, A M; Boyd, J T; Bozzi, C; Brandenburg, G; Brandt, T; Brau, J E; Breon, A B; Briand, H; Brochard, F; Brose, J; Brown, C L; Brown, C M; Brown, D; Brown, D N; Bruinsma, M; Brunet, S; Bucci, F; Buchanan, C; Buchmüller, O L; Bugg, W; Bulten, H; Burchat, Patricia R; Button-Shafer, J; Buzzo, A; Côté, D; Cahn, R N; Calabrese, R; Calcaterra, A; Calderini, G; Campagnari, C; Capra, R; Carpinelli, M; Cartaro, C; Cavallo, N; Cavoto, G; Chaisanguanthum, K S; Chao, M; Charles, E; Charles, M J; Chauveau, J; Chavez, C A; Chen, A; Chen, E; Chen, J C; Chen, S; Cheng, B; Cheng, C H; Chevalier, N; Christ, S; Cibinetto, G; Clark, P J; Claus, R; Cochran, J; Colecchia, F; Coleman, J P; Contri, R; Convery, M R; Cormack, C M; Cossutti, F; Cottingham, W N; Couderc, F; Covarelli, R; Cowan, G; Cowan, R; Crawley, H B; Cremaldi, L M; Cristinziani, M; Crosetti, G; Çuhadar-Dönszelmann, T; Dahmes, B; Dallapiccola, C; Danielson, N; Dasu, S; Datta, M; Dauncey, P D; David, P; Davier, M; Davis, C L; Day, C T; De Groot, N; De Nardo, Gallieno; Del Buono, L; Della Ricca, G; Di Lodovico, F; Dickopp, M; Dittongo, S; Dong, D; Dorfan, J; Dorigo, A; Druzhinin, V P; Dubitzky, R S; Dubois-Felsmann, G P; Dujmic, D; Dunwoodie, W M; Dvoretskii, A; Eckmann, R; Edwards, A J; Egede, U; Eichenbaum, A M; Eigen, G; Eisner, A M; Elmer, P; Elsen, E E; Emery, S; Ernst, J A; Eschenburg, V; Eschrich, I; Fabozzi, F; Faccini, R; Fan, S; Farbin, A; Feltresi, E; Ferrarotto, F; Ferroni, F; Field, R C; Finocchiaro, G; Flack, R L; Flächer, H U; Flood, K T; Ford, K E; Ford, W T; Forster, I J; Forti, F; Fortin, D; Foulkes, S D; Franek, B J; Frey, R; Fritsch, M; Fry, J R; Gabathuler, Erwin; Gaidot, A; Gaillard, J M; Gaillard, J R; Galeazzi, F; Gallo, F; Gamba, D; Gamet, R; Gan, K K; Ganzhur, S F; Gary, J W; Gaspero, M; Gatto, C; Geddes, N I; Gill, M S; Giorgi, M A; Giraud, P F; Giroux, X; Gladney, L; Glanzman, T; Godang, R; Goetzen, K; Golubev, V B; Gopal, G P; Gowdy, S J; Graham, M; Grancagnolo, S; Green, M G; Greene, M G; Grenier, G J; Grenier, P; Gritsan, A V; Grosdidier, G; Groysman, Y; Guo, Q H; Hadavand, H K; Hadig, T; Haire, M; Halyo, V; Hamel de Monchenault, G; Hamon, O; Harrison, P F; Harrison, T J; Hart, A J; Hart, P A; Hartfiel, B L; Harton, J L; Hast, C; Hauke, A; Hawkes, C M; Hearty, C; Held, T; Hertzbach, S S; Heusch, C A; Hicheur, A; Hill, E J; Hitlin, D G; Höcker, A; Hodgkinson, M C; Hollar, J J; Honscheid, K; Hrynóva, T; Hufnagel, D; Hulsbergen, W D; Hutchcroft, D E; Igonkina, O; Innes, W R; Ivanchenko, V N; Izen, J M; Jackson, P D; Jackson, P S; Jacobsen, R G; Jawahery, A; Jayatilleke, S M; Jessop, C P; John, M J J; Johnson, J R; Judd, D; Kadel, R W; Kadyk, J; Kagan, H; Karyotakis, Yu; Kass, R; Kelly, M P; Kelsey, M H; Kerth, L T; Khan, A; Kim, H; Kim, P; Kirkby, D; Kitayama, I; Knecht, N S; Koch, H; Kocian, M L; Kofler, R; Kolomensky, Yu G; Koptchev, V B; Kovalskyi, D; Kowalewski, R V; Kozanecki, Witold; Kravchenko, E A; Krishnamurthy, M; Kroeger, R; Kroseberg, J; Kukartsev, G; Kutter, P E; Kyberd, P; Lacker, H M; Lae, C K; Lafferty, G D; Lamsa, J; Lanceri, L; Lange, D J; Langenegger, U; Lankford, A J; Laplace, S; Latham, T E; Lau, Y P; Lavin, D; Lazzaro, A; Le Diberder, F R; Lees, J P; Legendre, M; Leith, D W G S; Lepeltier, V; Leruste, P; Lewandowski, B; Li Gioi, L; Li, H; Libby, J; Lillard, V; Lista, L; Liu, R; LoSecco, J M; Lo Vetere, M; Lockman, W S; Lombardo, V; London, G W; Long, O; Lou, X C; Lu, A; Lü, C; Luitz, S; Luppi, E; Lusiani, A; Lüth, V; Lutz, A M; Lynch, G; Lynch, H L; Lyon, A J; MacFarlane, D B; Macri, M; Malcles, J; Mallik, U; Mancinelli, G; Mandelkern, M A; Manfredi, P F; Mangeol, D J J; Marchiori, G; Margoni, M; Marsiske, H; Martínez-Vidal, F; Mattison, T S; Mayer, B; Mazur, M A; Mazzoni, M A; McKenna, J A; McMahon, T R; Meadows, B T; Messner, R; Meyer, T I; Meyer, W T; Miftakov, V; Mihályi, A; Mir, L M; Mohanty, G B; Mohapatra, A K; Mommsen, R K; Monge, M R; Monorchio, D; Moore, T B; Morandin, M; Morgan, S E; Morganti, M; Morganti, S; Morii, M; Morton, G W; Muheim, F; Müller, D R; Müller-Pfefferkorn, R; Narsky, I; Nash, J A; Nauenberg, U; Neal, H; Negrini, M; Neri, N; Nesom, G; Nicholson, H; Nikolich, M B; Nogowski, R; O'Grady, C P; Ocariz, J; Oddone, P J; Ofte, I; Olaiya, E O; Olivas, A; Olsen, J; Onuchin, A P; Orimoto, T J; Otto, S; Ozcan, V E; Paar, H P; Paick, K; Palano, A; Palombo, F; Pan, Y; Panetta, J; Panvini, R S; Paoloni, E; Paolucci, P; Parry, R J; Passaggio, S; Patel, P M; Patrignani, C; Patteri, P; Payne, D J; Pelizaeus, M; Perazzo, A; Perl, M; Peruzzi, I M; Petersen, B A; Petersen, T C; Petrak, S; Petzold, A; Piatenko, T; Piccolo, D; Piccolo, M; Piemontese, L; Pierini, M; Pioppi, M; Piredda, G; Pivk, M; Plaszczynski, S; Playfer, S; Pompili, A; Poropat, P; Porter, F C; Posocco, M; Potter, C T; Prell, S; Prepost, R; Pripstein, M; Pulliam, T; Purohit, M V; Qi, N D; Rahatlou, S; Rahimi, A M; Rama, M; Rankin, P; Ratcliff, B N; Raven, G; Re, V; Reidy, J; Ricciardi, S; Richman, J D; Ritchie, J L; Rizzo, G; Roat, C; Roberts, D A; Robertson, S H; Robutti, E; Roe, N A; Röthel, W; Ronan, Michael T; Roney, J M; Rong, G; Roodman, A; Roos, L; Rosenberg, E I; Rotondo, M; Rubin, A E; Ryd, A; Saeed, M A; Safai-Tehrani, F; Saleem, M; Salnikov, A A; Salvatore, F; Samuel, A; Sanders, D A; Sandrelli, F; Santroni, A; Saremi, S; Sarti, A; Satpathy, A; Schalk, T; Schindler, R H; Schott, G; Schrenk, S; Schubert, J; Schubert, Klaus R; Schumm, B A; Schune, M H; Schwiening, J; Schwierz, R; Schwitters, R F; Sciacca, C; Sciolla, G; Seiden, A; Sekula, S J; Serednyakov, S I; Sharma, V; Shelkov, V G; Shen, B C; Simani, M C; Simi, G; Simonetto, F; Sinev, N B; Skovpen, Yu I; Sloane, R J; Smith, A J S; Smith, J G; Snoek, H L; Snyder, A; Sobie, R J; Soffer, A; Soha, A; Sokoloff, M D; Solodov, E P; Spaan, B; Spanier, S M; Spradlin, P; Stängle, H; Steinke, M; Stelzer, J; Stoker, D P; Stroili, R; Strom, D; Stugu, B; Su, D; Sullivan, M K; Summers, D J; Sundermann, J E; T'Jampens, S; Tan, P; Tantot, L; Taras, P; Taylor, F; Taylor, G P; Telnov, A V; Teodorescu, L; Ter-Antonian, R; Therin, G; Thiebaux, C; Thiessen, D; Tiozzo, G; Tisserand, V; Toki, W H; Torrence, E; Tosi, S; Touramanis, C; Treadwell, E; Vasileiadis, G; Vasseur, G; Vavra, J; Verderi, M; Verkerke, W; Vitale, L; Voci, C; Voena, C; Vuagnin, G; Wagner, G; Wagner, S R; Wagoner, D E; Waldi, R; Walsh, J; Wang, K; Wang, P; Wappler, F R; Watson, A T; Weaver, M; Weidemann, A W; Weinstein, A J R; Wenzel, W A; Wilden, L; Williams, D C; Williams, J C; Willocq, S; Wilson, F F; Wilson, J R; Wilson, M G; Wilson, R J; Winter, M A; Wisniewski, W J; Wittgen, M; Won, E; Wong, Q K; Wormser, G; Wright, D H; Wright, D M; Wu, J; Wu, S L; Xie, Y; Yamamoto, R K; Yang, S; Yarritu, A K; Ye, S; Yéche, C; Yi, J; Young, C C; Yu, Z; Yumiceva, F X; Yushkov, A N; Zallo, A; Zeng, Q; Zghiche, A; Zhang, J; Zhang, L; Zhao, H W; Zhu, Y S; Zito, M; De Sangro, R; Del Re, D; La Vaissière, C de

    2005-01-01

    We present preliminary updated measurements of the CP-violating parameters $S_{\\pi\\pi}$ and $C_{\\pi\\pi}$ in $B^0\\to\\pi^+\\pi^-$ decays. Using a sample of 227 million $\\Upsilon(4S)\\to B\\bar{B}$ decays collected with the BaBar detector at the PEP-II asymmetric-energy $e^+e^-$ collider at SLAC, we observe $467\\pm 33$ signal decays and measure $S_{\\pi\\pi}$ and $C_{\\pi\\pi} = -0.30\\pm 0.17 ({\\rm stat})\\pm 0.03 ({\\rm syst})$, and $C_{\\pi\\pi} = -0.09\\pm 0.15 ({\\rm stat})\\pm 0.04 ({\\rm syst})$.

  16. PWA of 3pi Final States and a Search for the pi1(1600)

    CERN Document Server

    Mitchell, R E

    2006-01-01

    Partial wave analyses (PWA) of the 3pi systems in the reactions pi- p --> pi+ pi- pi- p (the ``charged'' mode) and pi- p --> pi- pi0 pi0 p (the ``neutral'' mode) with an 18.3 GeV/c pion beam were performed using high statistics data from the E852 experiment. Conventional signals, such as the a1(1260), the a2(1320), and the pi2(1670), were found to be remarkably stable to the choice of waves included in the fit. In contrast, possible evidence for the pi1(1600) in the JPC = 1-+ exotic wave amplitude disappears when additional decay modes of conventional mesons (especially those of the pi2(1670)) are included in the PWA fit.

  17. Production of {pi}{sup 0}{pi}{sup 0} and {pi}{sup +}{pi}{sup +} pairs in proton-proton collisions

    Energy Technology Data Exchange (ETDEWEB)

    Skorodko, Tatiana

    2009-07-17

    The {pi}{sup 0}{pi}{sup 0} production in proton-proton collisions has been measured in the energy range from threshold up to 1.3 GeV using the WASA 4{pi} detector setup with an internal pellet target at the CELSIUS storage ring in Uppsala. In addition the {pi}{sup +}{pi}{sup +} production has been measured at an incident energy of 1.1 GeV. The {pi}{sup 0}{pi}{sup 0} and {pi}{sup +}{pi}{sup +} data taken at WASA constitute the first exclusively measured samples of solid statistics in the considered energy range. Total and differential cross sections for the pp{yields}pp{pi}{sup 0}{pi}{sup 0} and pp{yields}nn{pi}{sup +}{pi}{sup +} reactions are systematically compared to the Valencia model predictions. At incident energies close to threshold, i.e. up to 0.9 GeV, the {pi}{sup 0}{pi}{sup 0} data can be successfully explained by excitation and decay of the Roper resonance. Its direct decay into the N{sigma} channel is found to be by far the dominating two-pion decay process. in favor of a monopole excitation of the Roper resonance. At energy T{sub p}>1 GeV, i.e. in the energy region, which is beyond the Roper excitation but at the onset of {delta}{delta} excitation, a behavior is observed which is different from the theoretical prediction both in differential and total cross sections. The differential cross sections for {pi}{sup 0}{pi}{sup 0} channel in the {delta}{delta} region can be described, if the special configuration ({delta}{delta}){sub 0} is assumed. Moreover, the {pi}{sup 0}{pi}{sup 0} data exhibit a small systematic low-mass enhancement in the {pi}{sup 0}{pi}{sup 0} invariant mass spectrum. The total pp{pi}{sup 0}{pi}{sup 0} cross sections fall behind theoretical predictions, whereas the nn{pi}{sup +}{pi}{sup +} cross section is a factor of five larger that expected. A model-unconstrained isospin decomposition of the total cross sections points to a s-channel-like energy dependence of the Roper excitation as well as to a significant contribution of an

  18. Observation of the decay $B^0_s \\to \\phi\\pi^+\\pi^-$ and evidence for $B^0 \\to \\phi\\pi^+\\pi^-$

    CERN Document Server

    Aaij, Roel; Adinolfi, Marco; Ajaltouni, Ziad; Akar, Simon; Albrecht, Johannes; Alessio, Federico; Alexander, Michael; Ali, Suvayu; Alkhazov, Georgy; Alvarez Cartelle, Paula; Alves Jr, Antonio Augusto; Amato, Sandra; Amerio, Silvia; Amhis, Yasmine; An, Liupan; Anderlini, Lucio; Andreassi, Guido; Andreotti, Mirco; Andrews, Jason; Appleby, Robert; Archilli, Flavio; d'Argent, Philippe; Arnau Romeu, Joan; Artamonov, Alexander; Artuso, Marina; Aslanides, Elie; Auriemma, Giulio; Baalouch, Marouen; Babuschkin, Igor; Bachmann, Sebastian; Back, John; Badalov, Alexey; Baesso, Clarissa; Baker, Sophie; Baldini, Wander; Barlow, Roger; Barschel, Colin; Barsuk, Sergey; Barter, William; Baszczyk, Mateusz; Batozskaya, Varvara; Batsukh, Baasansuren; Battista, Vincenzo; Bay, Aurelio; Beaucourt, Leo; Beddow, John; Bedeschi, Franco; Bediaga, Ignacio; Bel, Lennaert; Bellee, Violaine; Belloli, Nicoletta; Belous, Konstantin; Belyaev, Ivan; Ben-Haim, Eli; Bencivenni, Giovanni; Benson, Sean; Benton, Jack; Berezhnoy, Alexander; Bernet, Roland; Bertolin, Alessandro; Betancourt, Christopher; Betti, Federico; Bettler, Marc-Olivier; van Beuzekom, Martinus; Bezshyiko, Iaroslava; Bifani, Simone; Billoir, Pierre; Bird, Thomas; Birnkraut, Alex; Bitadze, Alexander; Bizzeti, Andrea; Blake, Thomas; Blanc, Frederic; Blouw, Johan; Blusk, Steven; Bocci, Valerio; Boettcher, Thomas; Bondar, Alexander; Bondar, Nikolay; Bonivento, Walter; Bordyuzhin, Igor; Borgheresi, Alessio; Borghi, Silvia; Borisyak, Maxim; Borsato, Martino; Bossu, Francesco; Boubdir, Meriem; Bowcock, Themistocles; Bowen, Espen Eie; Bozzi, Concezio; Braun, Svende; Britsch, Markward; Britton, Thomas; Brodzicka, Jolanta; Buchanan, Emma; Burr, Christopher; Bursche, Albert; Buytaert, Jan; Cadeddu, Sandro; Calabrese, Roberto; Calvi, Marta; Calvo Gomez, Miriam; Camboni, Alessandro; Campana, Pierluigi; Campora Perez, Daniel Hugo; Capriotti, Lorenzo; Carbone, Angelo; Carboni, Giovanni; Cardinale, Roberta; Cardini, Alessandro; Carniti, Paolo; Carson, Laurence; Carvalho Akiba, Kazuyoshi; Casse, Gianluigi; Cassina, Lorenzo; Castillo Garcia, Lucia; Cattaneo, Marco; Cauet, Christophe; Cavallero, Giovanni; Cenci, Riccardo; Charles, Matthew; Charpentier, Philippe; Chatzikonstantinidis, Georgios; Chefdeville, Maximilien; Chen, Shanzhen; Cheung, Shu-Faye; Chobanova, Veronika; Chrzaszcz, Marcin; Cid Vidal, Xabier; Ciezarek, Gregory; Clarke, Peter; Clemencic, Marco; Cliff, Harry; Closier, Joel; Coco, Victor; Cogan, Julien; Cogneras, Eric; Cogoni, Violetta; Cojocariu, Lucian; Collazuol, Gianmaria; Collins, Paula; Comerma-Montells, Albert; Contu, Andrea; Cook, Andrew; Coombs, George; Coquereau, Samuel; Corti, Gloria; Corvo, Marco; Costa Sobral, Cayo Mar; Couturier, Benjamin; Cowan, Greig; Craik, Daniel Charles; Crocombe, Andrew; Cruz Torres, Melissa Maria; Cunliffe, Samuel; Currie, Robert; D'Ambrosio, Carmelo; Da Cunha Marinho, Franciole; Dall'Occo, Elena; Dalseno, Jeremy; David, Pieter; Davis, Adam; De Aguiar Francisco, Oscar; De Bruyn, Kristof; De Capua, Stefano; De Cian, Michel; De Miranda, Jussara; De Paula, Leandro; De Serio, Marilisa; De Simone, Patrizia; Dean, Cameron Thomas; Decamp, Daniel; Deckenhoff, Mirko; Del Buono, Luigi; Demmer, Moritz; Dendek, Adam; Derkach, Denis; Deschamps, Olivier; Dettori, Francesco; Dey, Biplab; Di Canto, Angelo; Dijkstra, Hans; Dordei, Francesca; Dorigo, Mirco; Dosil Suárez, Alvaro; Dovbnya, Anatoliy; Dreimanis, Karlis; Dufour, Laurent; Dujany, Giulio; Dungs, Kevin; Durante, Paolo; Dzhelyadin, Rustem; Dziurda, Agnieszka; Dzyuba, Alexey; Déléage, Nicolas; Easo, Sajan; Ebert, Marcus; Egede, Ulrik; Egorychev, Victor; Eidelman, Semen; Eisenhardt, Stephan; Eitschberger, Ulrich; Ekelhof, Robert; Eklund, Lars; Ely, Scott; Esen, Sevda; Evans, Hannah Mary; Evans, Timothy; Falabella, Antonio; Farley, Nathanael; Farry, Stephen; Fay, Robert; Fazzini, Davide; Ferguson, Dianne; Fernandez Prieto, Antonio; Ferrari, Fabio; Ferreira Rodrigues, Fernando; Ferro-Luzzi, Massimiliano; Filippov, Sergey; Fini, Rosa Anna; Fiore, Marco; Fiorini, Massimiliano; Firlej, Miroslaw; Fitzpatrick, Conor; Fiutowski, Tomasz; Fleuret, Frederic; Fohl, Klaus; Fontana, Marianna; Fontanelli, Flavio; Forshaw, Dean Charles; Forty, Roger; Franco Lima, Vinicius; Frank, Markus; Frei, Christoph; Fu, Jinlin; Furfaro, Emiliano; Färber, Christian; Gallas Torreira, Abraham; Galli, Domenico; Gallorini, Stefano; Gambetta, Silvia; Gandelman, Miriam; Gandini, Paolo; Gao, Yuanning; Garcia Martin, Luis Miguel; García Pardiñas, Julián; Garra Tico, Jordi; Garrido, Lluis; Garsed, Philip John; Gascon, David; Gaspar, Clara; Gavardi, Laura; Gazzoni, Giulio; Gerick, David; Gersabeck, Evelina; Gersabeck, Marco; Gershon, Timothy; Ghez, Philippe; Gianì, Sebastiana; Gibson, Valerie; Girard, Olivier Göran; Giubega, Lavinia-Helena; Gizdov, Konstantin; Gligorov, Vladimir; Golubkov, Dmitry; Golutvin, Andrey; Gomes, Alvaro; Gorelov, Igor Vladimirovich; Gotti, Claudio; Govorkova, Ekaterina; Grabalosa Gándara, Marc; Graciani Diaz, Ricardo; Granado Cardoso, Luis Alberto; Graugés, Eugeni; Graverini, Elena; Graziani, Giacomo; Grecu, Alexandru; Griffith, Peter; Grillo, Lucia; Gruberg Cazon, Barak Raimond; Grünberg, Oliver; Gushchin, Evgeny; Guz, Yury; Gys, Thierry; Göbel, Carla; Hadavizadeh, Thomas; Hadjivasiliou, Christos; Haefeli, Guido; Haen, Christophe; Haines, Susan; Hall, Samuel; Hamilton, Brian; Han, Xiaoxue; Hansmann-Menzemer, Stephanie; Harnew, Neville; Harnew, Samuel; Harrison, Jonathan; Hatch, Mark; He, Jibo; Head, Timothy; Heister, Arno; Hennessy, Karol; Henrard, Pierre; Henry, Louis; Hernando Morata, Jose Angel; van Herwijnen, Eric; Heß, Miriam; Hicheur, Adlène; Hill, Donal; Hombach, Christoph; Hopchev, P H; Hulsbergen, Wouter; Humair, Thibaud; Hushchyn, Mikhail; Hussain, Nazim; Hutchcroft, David; Idzik, Marek; Ilten, Philip; Jacobsson, Richard; Jaeger, Andreas; Jalocha, Pawel; Jans, Eddy; Jawahery, Abolhassan; Jiang, Feng; John, Malcolm; Johnson, Daniel; Jones, Christopher; Joram, Christian; Jost, Beat; Jurik, Nathan; Kandybei, Sergii; Kanso, Walaa; Karacson, Matthias; Kariuki, James Mwangi; Karodia, Sarah; Kecke, Matthieu; Kelsey, Matthew; Kenyon, Ian; Kenzie, Matthew; Ketel, Tjeerd; Khairullin, Egor; Khanji, Basem; Khurewathanakul, Chitsanu; Kirn, Thomas; Klaver, Suzanne; Klimaszewski, Konrad; Koliiev, Serhii; Kolpin, Michael; Komarov, Ilya; Koopman, Rose; Koppenburg, Patrick; Kosmyntseva, Alena; Kozachuk, Anastasiia; Kozeiha, Mohamad; Kravchuk, Leonid; Kreplin, Katharina; Kreps, Michal; Krokovny, Pavel; Kruse, Florian; Krzemien, Wojciech; Kucewicz, Wojciech; Kucharczyk, Marcin; Kudryavtsev, Vasily; Kuonen, Axel Kevin; Kurek, Krzysztof; Kvaratskheliya, Tengiz; Lacarrere, Daniel; Lafferty, George; Lai, Adriano; Lanfranchi, Gaia; Langenbruch, Christoph; Latham, Thomas; Lazzeroni, Cristina; Le Gac, Renaud; van Leerdam, Jeroen; Lees, Jean-Pierre; Leflat, Alexander; Lefrançois, Jacques; Lefèvre, Regis; Lemaitre, Florian; Lemos Cid, Edgar; Leroy, Olivier; Lesiak, Tadeusz; Leverington, Blake; Li, Yiming; Likhomanenko, Tatiana; Lindner, Rolf; Linn, Christian; Lionetto, Federica; Liu, Bo; Liu, Xuesong; Loh, David; Longstaff, Iain; Lopes, Jose; Lucchesi, Donatella; Lucio Martinez, Miriam; Luo, Haofei; Lupato, Anna; Luppi, Eleonora; Lupton, Oliver; Lusiani, Alberto; Lyu, Xiao-Rui; Machefert, Frederic; Maciuc, Florin; Maev, Oleg; Maguire, Kevin; Malde, Sneha; Malinin, Alexander; Maltsev, Timofei; Manca, Giulia; Mancinelli, Giampiero; Manning, Peter Michael; Maratas, Jan; Marchand, Jean François; Marconi, Umberto; Marin Benito, Carla; Marino, Pietro; Marks, Jörg; Martellotti, Giuseppe; Martin, Morgan; Martinelli, Maurizio; Martinez Santos, Diego; Martinez Vidal, Fernando; Martins Tostes, Danielle; Massacrier, Laure Marie; Massafferri, André; Matev, Rosen; Mathad, Abhijit; Mathe, Zoltan; Matteuzzi, Clara; Mauri, Andrea; Maurin, Brice; Mazurov, Alexander; McCann, Michael; McCarthy, James; McNab, Andrew; McNulty, Ronan; Meadows, Brian; Meier, Frank; Meissner, Marco; Melnychuk, Dmytro; Merk, Marcel; Merli, Andrea; Michielin, Emanuele; Milanes, Diego Alejandro; Minard, Marie-Noelle; Mitzel, Dominik Stefan; Mogini, Andrea; Molina Rodriguez, Josue; Monroy, Igancio Alberto; Monteil, Stephane; Morandin, Mauro; Morawski, Piotr; Mordà, Alessandro; Morello, Michael Joseph; Moron, Jakub; Morris, Adam Benjamin; Mountain, Raymond; Muheim, Franz; Mulder, Mick; Mussini, Manuel; Müller, Dominik; Müller, Janine; Müller, Katharina; Müller, Vanessa; Naik, Paras; Nakada, Tatsuya; Nandakumar, Raja; Nandi, Anita; Nasteva, Irina; Needham, Matthew; Neri, Nicola; Neubert, Sebastian; Neufeld, Niko; Neuner, Max; Nguyen, Anh Duc; Nguyen, Thi Dung; Nguyen-Mau, Chung; Nieswand, Simon; Niet, Ramon; Nikitin, Nikolay; Nikodem, Thomas; Novoselov, Alexey; O'Hanlon, Daniel Patrick; Oblakowska-Mucha, Agnieszka; Obraztsov, Vladimir; Ogilvy, Stephen; Oldeman, Rudolf; Onderwater, Gerco; Otalora Goicochea, Juan Martin; Otto, Adam; Owen, Patrick; Oyanguren, Maria Aranzazu; Pais, Preema Rennee; Palano, Antimo; Palombo, Fernando; Palutan, Matteo; Panman, Jacob; Papanestis, Antonios; Pappagallo, Marco; Pappalardo, Luciano; Parker, William; Parkes, Christopher; Passaleva, Giovanni; Pastore, Alessandra; Patel, Girish; Patel, Mitesh; Patrignani, Claudia; Pearce, Alex; Pellegrino, Antonio; Penso, Gianni; Pepe Altarelli, Monica; Perazzini, Stefano; Perret, Pascal; Pescatore, Luca; Petridis, Konstantinos; Petrolini, Alessandro; Petrov, Aleksandr; Petruzzo, Marco; Picatoste Olloqui, Eduardo; Pietrzyk, Boleslaw; Pikies, Malgorzata; Pinci, Davide; Pistone, Alessandro; Piucci, Alessio; Playfer, Stephen; Plo Casasus, Maximo; Poikela, Tuomas; Polci, Francesco; Poluektov, Anton; Polyakov, Ivan; Polycarpo, Erica; Pomery, Gabriela Johanna; Popov, Alexander; Popov, Dmitry; Popovici, Bogdan; Poslavskii, Stanislav; Potterat, Cédric; Price, Eugenia; Price, Joseph David; Prisciandaro, Jessica; Pritchard, Adrian; Prouve, Claire; Pugatch, Valery; Puig Navarro, Albert; Punzi, Giovanni; Qian, Wenbin; Quagliani, Renato; Rachwal, Bartolomiej; Rademacker, Jonas; Rama, Matteo; Ramos Pernas, Miguel; Rangel, Murilo; Raniuk, Iurii; Ratnikov, Fedor; Raven, Gerhard; Redi, Federico; Reichert, Stefanie; dos Reis, Alberto; Remon Alepuz, Clara; Renaudin, Victor; Ricciardi, Stefania; Richards, Sophie; Rihl, Mariana; Rinnert, Kurt; Rives Molina, Vicente; Robbe, Patrick; Rodrigues, Ana Barbara; Rodrigues, Eduardo; Rodriguez Lopez, Jairo Alexis; Rodriguez Perez, Pablo; Rogozhnikov, Alexey; Roiser, Stefan; Rollings, Alexandra Paige; Romanovskiy, Vladimir; Romero Vidal, Antonio; Ronayne, John William; Rotondo, Marcello; Rudolph, Matthew Scott; Ruf, Thomas; Ruiz Valls, Pablo; Saborido Silva, Juan Jose; Sadykhov, Elnur; Sagidova, Naylya; Saitta, Biagio; Salustino Guimaraes, Valdir; Sanchez Mayordomo, Carlos; Sanmartin Sedes, Brais; Santacesaria, Roberta; Santamarina Rios, Cibran; Santimaria, Marco; Santovetti, Emanuele; Sarti, Alessio; Satriano, Celestina; Satta, Alessia; Saunders, Daniel Martin; Savrina, Darya; Schael, Stefan; Schellenberg, Margarete; Schiller, Manuel; Schindler, Heinrich; Schlupp, Maximilian; Schmelling, Michael; Schmelzer, Timon; Schmidt, Burkhard; Schneider, Olivier; Schopper, Andreas; Schubert, Konstantin; Schubiger, Maxime; Schune, Marie Helene; Schwemmer, Rainer; Sciascia, Barbara; Sciubba, Adalberto; Semennikov, Alexander; Sergi, Antonino; Serra, Nicola; Serrano, Justine; Sestini, Lorenzo; Seyfert, Paul; Shapkin, Mikhail; Shapoval, Illya; Shcheglov, Yury; Shears, Tara; Shekhtman, Lev; Shevchenko, Vladimir; Siddi, Benedetto Gianluca; Silva Coutinho, Rafael; Silva de Oliveira, Luiz Gustavo; Simi, Gabriele; Simone, Saverio; Sirendi, Marek; Skidmore, Nicola; Skwarnicki, Tomasz; Smith, Eluned; Smith, Iwan Thomas; Smith, Jackson; Smith, Mark; Snoek, Hella; Sokoloff, Michael; Soler, Paul; Souza De Paula, Bruno; Spaan, Bernhard; Spradlin, Patrick; Sridharan, Srikanth; Stagni, Federico; Stahl, Marian; Stahl, Sascha; Stefko, Pavol; Stefkova, Slavorima; Steinkamp, Olaf; Stemmle, Simon; Stenyakin, Oleg; Stevenson, Scott; Stoica, Sabin; Stone, Sheldon; Storaci, Barbara; Stracka, Simone; Straticiuc, Mihai; Straumann, Ulrich; Sun, Liang; Sutcliffe, William; Swientek, Krzysztof; Syropoulos, Vasileios; Szczekowski, Marek; Szumlak, Tomasz; T'Jampens, Stephane; Tayduganov, Andrey; Tekampe, Tobias; Tellarini, Giulia; Teubert, Frederic; Thomas, Eric; van Tilburg, Jeroen; Tilley, Matthew James; Tisserand, Vincent; Tobin, Mark; Tolk, Siim; Tomassetti, Luca; Tonelli, Diego; Topp-Joergensen, Stig; Toriello, Francis; Tournefier, Edwige; Tourneur, Stephane; Trabelsi, Karim; Traill, Murdo; Tran, Minh Tâm; Tresch, Marco; Trisovic, Ana; Tsaregorodtsev, Andrei; Tsopelas, Panagiotis; Tully, Alison; Tuning, Niels; Ukleja, Artur; Ustyuzhanin, Andrey; Uwer, Ulrich; Vacca, Claudia; Vagnoni, Vincenzo; Valassi, Andrea; Valat, Sebastien; Valenti, Giovanni; Vallier, Alexis; Vazquez Gomez, Ricardo; Vazquez Regueiro, Pablo; Vecchi, Stefania; van Veghel, Maarten; Velthuis, Jaap; Veltri, Michele; Veneziano, Giovanni; Venkateswaran, Aravindhan; Vernet, Maxime; Vesterinen, Mika; Viaud, Benoit; Vieira, Daniel; Vieites Diaz, Maria; Viemann, Harald; Vilasis-Cardona, Xavier; Vitti, Marcela; Volkov, Vladimir; Vollhardt, Achim; Voneki, Balazs; Vorobyev, Alexey; Vorobyev, Vitaly; Voß, Christian; de Vries, Jacco; Vázquez Sierra, Carlos; Waldi, Roland; Wallace, Charlotte; Wallace, Ronan; Walsh, John; Wang, Jianchun; Ward, David; Wark, Heather Mckenzie; Watson, Nigel; Websdale, David; Weiden, Andreas; Whitehead, Mark; Wicht, Jean; Wilkinson, Guy; Wilkinson, Michael; Williams, Mark Richard James; Williams, Matthew; Williams, Mike; Williams, Timothy; Wilson, Fergus; Wimberley, Jack; Wishahi, Julian; Wislicki, Wojciech; Witek, Mariusz; Wormser, Guy; Wotton, Stephen; Wraight, Kenneth; Wyllie, Kenneth; Xie, Yuehong; Xing, Zhou; Xu, Zhirui; Yang, Zhenwei; Yin, Hang; Yu, Jiesheng; Yuan, Xuhao; Yushchenko, Oleg; Zarebski, Kristian Alexander; Zavertyaev, Mikhail; Zhang, Liming; Zhang, Yanxi; Zhang, Yu; Zhelezov, Alexey; Zheng, Yangheng; Zhokhov, Anatoly; Zhu, Xianglei; Zhukov, Valery; Zucchelli, Stefano

    2016-01-01

    The first observation of the rare decay$B^0_s \\to \\phi\\pi^+\\pi^-$ and evidence for $B^0 \\to \\phi\\pi^+\\pi^-$ are reported, using $pp$ collision data recorded by the LHCb detector at centre-of-mass energies $\\sqrt{s} = 7$ and 8~TeV, corresponding to an integrated luminosity of $3{\\mbox{\\,fb}^{-1}}$. The branching fractions in the $\\pi^+\\pi^-$ invariant mass range $400pi^+\\pi^-)<1600{\\mathrm{\\,Me\\kern -0.1em V\\!/}c^2}$ are $[3.48\\pm 0.23\\pm 0.17\\pm 0.35]\\times 10^{-6}$ and $[1.82\\pm 0.25\\pm 0.41\\pm 0.14]\\times 10^{-7}$ for $B^0_s \\to \\phi\\pi^+\\pi^-$ and $B^0 \\to \\phi\\pi^+\\pi^-$ respectively, where the uncertainties are statistical, systematic and from the normalisation mode $B^0_s \\to \\phi\\phi $. A combined analysis of the $\\pi^+\\pi^-$ mass spectrum and the decay angles of the final-state particles identifies the exclusive decays $B^0_s \\to \\phi f_0(980) $, $B_s^0 \\to \\phi f_2(1430) $, and $B^0_s \\to \\phi\\rho$ with branching fractions of $[1.12\\pm 0.16^{+0.09}_{-0.08}\\pm 0.11]\\times 10^{-6}$, $[0.61\\pm...

  19. Observation of the decay $B^0_s\\to \\phi\\pi^+\\pi^-$ and evidence for $B^0\\to \\phi\\pi^+\\pi^-$

    CERN Document Server

    LHCb Collaboration

    2016-01-01

    The first observation of the rare decay $B^0_s\\to\\phi\\pi^+\\pi^-$ and evidence for $B^0\\to\\phi\\pi^+\\pi^-$ are reported, using $pp$ collision data recorded by the LHCb detector at centre-of-mass energies $\\sqrt{s} = 7$ and 8 TeV, corresponding to an integrated luminosity of $3 {\\rm fb}^{-1}$. The branching fractions in the $\\pi^+\\pi^-$ invariant mass range $400\\pm(\\pi^+\\pi^-)<1600{\\mathrm{\\,Me\\kern -0.1em V\\!/}c^2}$ are $[3.48\\pm 0.23\\pm 0.17\\pm 0.35]\\times 10^{-6}$ and $[1.82\\pm 0.25\\pm 0.41\\pm 0.14]\\times 10^{-7}$ for $B^0_s\\to\\phi\\pi^+\\pi^-$ and $B^0\\to\\phi\\pi^+\\pi^-$ respectively, where the uncertainties are statistical, systematic and from the normalisation mode $B^0_s\\to\\phi\\phi$. A combined analysis of the $\\pi^+\\pi^-$ mass spectrum and the decay angles of the final-state particles identifies the exclusive decays $B^0_s\\to\\phi f_0(980)$, $B_s^0\\to\\phi f_2(1430)$, and $B^0_s\\to\\phi\\rho$ with branching fractions of $[1.12\\pm 0.16^{+0.09}_{-0.08}\\pm 0.11]\\times 10^{-6}$, $[0.61\\pm 0.13^{+0.12}_{-0.05}\\p...

  20. Two-pion decay modes of the N*(1440) in n p $\\to$ d $\\pi \\pi$

    CERN Document Server

    Alvarez-Ruso, L

    2001-01-01

    A simple model for the n p -> d pi pi reaction has been developed. It is shown that the deuteron momentum spectra measured at T_n = 795 MeV can be understood in terms of the Roper excitation and its N pi pi decay modes. A similar pattern, recently observed in p p -> p p pi+ pi-, can be explained in the same way.

  1. Measurement of the $\\omega \\to \\pi^+ \\pi^- \\pi^0$ Dalitz plot distribution

    CERN Document Server

    :,; Augustyniak, W; Bardan, W; Bashkanov, M; Bergmann, F S; Berłowski, M; Bhatt, H; Bondar, A; Büscher, M; Calén, H; Ciepał, I; Clement, H; Czerwiński, E; Demmich, K; Engels, R; Erven, A; Erven, W; Eyrich, W; Fedorets, P; Föhl, K; Fransson, K; Goldenbaum, F; Goswami, A; Grigoryev, K; Gullström, C -O; Heijkenskjöld, L; Hejny, V; Hüsken, N; Jarczyk, L; Johansson, T; Kamys, B; Kemmerling, G; Khan, F A; Khatri, G; Khoukaz, A; Khreptak, O; Kirillov, D A; Kistryn, S; Kleines, H; Kłos, B; Krzemień, W; Kulessa, P; Kupść, A; Kuzmin, A; Lalwani, K; Lersch, D; Lorentz, B; Magiera, A; Maier, R; Marciniewski, P; Mariański, B; Morsch, H -P; Moskal, P; Ohm, H; del Rio, E Perez; Piskunov, N M; Prasuhn, D; Pszczel, D; Pysz, K; Pyszniak, A; Ritman, J; Roy, A; Rudy, Z; Rundel, O; Sawant, S; Schadmand, S; Schätti-Ozerianska, I; Sefzick, T; Serdyuk, V; Shwartz, B; Sitterberg, K; Skorodko, T; Skurzok, M; Smyrski, J; Sopov, V; Stassen, R; Stepaniak, J; Stephan, E; Sterzenbach, G; Stockhorst, H; Ströher, H; Szczurek, A; Trzciński, A; Varma, R; Wolke, M; Wrońska, A; Wüstner, P; Yamamoto, A; Zabierowski, J; Zieliński, M J; Złomańczuk, J; Żuprański, P; Żurek, M; Kubis, B; Leupold, S

    2016-01-01

    Using the production reactions $pd\\to {}^3\\mbox{He}\\,\\omega$ and $pp\\to pp\\omega$, the Dalitz plot distribution for the $\\omega \\to \\pi^+ \\pi^- \\pi^0$ decay is studied with the WASA detector at COSY, based on a combined data sample of $ (4.408\\pm 0.042) \\times 10^4$ events. The Dalitz plot density is parametrised by a product of the $P$-wave phase space and a polynomial expansion in the normalised polar Dalitz plot variables $Z$ and $\\phi$. For the first time, a deviation from pure $P$-wave phase space is observed with a significance of $4.1\\sigma$. The deviation is parametrised by a linear term $1+2\\alpha Z$, with $\\alpha$ determined to be $+0.147\\pm0.036$, consistent with the expectations of $\\rho$-meson-type final-state interactions of the $P$-wave pion pairs.

  2. Measurement of the Branching Fraction and Decay Rate Asymmetry of B to D_pi+ pi- pi0 K-

    Energy Technology Data Exchange (ETDEWEB)

    Aubert, B.; Barate, R.; Boutigny, D.; Couderc, F.; Karyotakis, Y.; Lees, J.P.; Poireau, V.; Tisserand, V.; Zghiche, A.; /Annecy, LAPP; Grauges, E.; /Barcelona, IFAE; Palano, A.; Pappagallo, M.; Pompili, A.; /Bari U. /INFN, Bari; Chen, J.C.; Qi, N.D.; Rong, G.; Wang, P.; Zhu, Y.S.; /Beijing, Inst. High Energy Phys.; Eigen, G.; Ofte, I.; Stugu, B.

    2005-06-10

    The authors report the observation of the decay B{sup -} {yields} D{sub {pi}{sup +}{pi}{sup -}{pi}{sup 0}}K{sup -}, where D{sub {pi}{sup +}{pi}{sup -}{pi}{sup 0}} indicates a neutral D meson detected in the final state {pi}{sup +}{pi}{sup -}{pi}{sup 0}, excluding K{sub S}{sup 0}{pi}{sup 0}. This doubly Cabibbo-suppressed decay chain can be used to measure the CKM phase {gamma}. Using about 229 million e{sup +}e{sup -} {yields} B{bar B} events recorded by the BABAR experiment at the PEP-II e{sup +}e{sup -} storage ring, they measure the branching fraction {Beta}(B{sup -} {yields} D{sub {pi}{sup +}{pi}{sup -}{pi}{sup 0}K{sup -}}) = (5.5 {+-} 1.0 (stat.) {+-} 0.7 (syst.)) x 10{sup -6} and the decay rate asymmetry A = -0.02 {+-} 0.16 (stat.) {+-} 0.03 (syst.) for the full decay chain.

  3. Properties of the light scalar mesons face the experimental data on the $\\phi\\to\\pi^0\\pi^0\\gamma$ decay and the $\\pi\\pi$ scattering

    CERN Document Server

    Achasov, N N

    2006-01-01

    The high-statistical KLOE data on the $\\phi\\to\\pi^0\\pi^0\\gamma$ decay are described simultaneously with the data on $\\pi\\pi$ scattering and the $\\pi\\pi\\to K\\bar K$ reaction. The description is carried out taking into account the chiral shielding of the putative $\\sigma (600)$ meson and it's mixing with the well-established $f_0(980)$ meson. It is shown that the data don't contradict the existence of the $\\sigma (600)$ meson and yield evidence in favor of the four-quark nature of the $\\sigma (600)$ and $f_0(980)$ mesons.

  4. $CP$ violation for $B^{0}\\rightarrow \\rho^{0}(\\omega)\\rho^{0}(\\omega) \\rightarrow \\pi^+\\pi^-\\pi^+\\pi^-$ in QCD factorization

    CERN Document Server

    Lü, Gang; Guo, Xin-Heng; Zhang, Zhen-Hua; Wei, Ke-Wei

    2014-01-01

    In the QCD factorization (QCDF) approach we study the direct $CP$ violation in $\\bar{B}^{0}\\rightarrow\\rho^0(\\omega)\\rho^0(\\omega)\\rightarrow\\pi^+\\pi^-\\pi^+\\pi^-$ via the $\\rho-\\omega$ mixing mechanism. We find that the $CP$ violation can be enhanced by double $\\rho-\\omega$ mixing when the masses of the $\\pi^+\\pi^-$ pairs are in the vicinity of the $\\omega$ resonance, and the maximum $CP$ violation can reach 28{\\%}. We also compare the results from the naive factorization and the QCD factorization.

  5. Raspberry Pi for secret agents

    CERN Document Server

    Sjogelid, Stefan

    2015-01-01

    This book is an easy-to-follow guide with practical examples in each chapter. Suitable for the novice and expert alike, each topic provides a fast and easy way to get started with exciting applications and also guides you through setting up the Raspberry Pi as a secret agent toolbox.

  6. Stochastic Pi-calculus Revisited

    DEFF Research Database (Denmark)

    Cardelli, Luca; Mardare, Radu Iulian

    2013-01-01

    We develop a version of stochastic Pi-calculus with a semantics based on measure theory. We dene the behaviour of a process in a rate environment using measures over the measurable space of processes induced by structural congruence. We extend the stochastic bisimulation to include the concept of...

  7. Facts About Delta Pi Epsilon

    Science.gov (United States)

    Delta Pi Epsilon Journal, 1976

    1976-01-01

    The article discusses the purpose and structure of Delta Pi Epsilon and the general qualifications for membership. Service projects and publications, research awards, timely facts, the year of each chapter's origination, national presidents, and executive secretaries for the last 40 years are listed. (BP)

  8. Measurement of pi(0)pi(0) production in the nuclear medium by pi(-) interactions at 0.408 GeV/c.

    Science.gov (United States)

    Starostin, A; Staudenmaier, H M; Allgower, C E; Bekrenev, V; Berger, E; Briscoe, W J; Clajus, M; Comfort, J R; Craig, K; Grosnick, D; Isenhower, D; Knecht, N; Koetke, D; Koulbardis, A; Kozlenko, N; Kruglov, S; Kycia, T; Lolos, G; Lopatin, I; Manley, D M; Manweiler, B; Marusić, A; McDonald, S; Nefkens, B M; Olmsted, J; Papandreou, Z; Peaslee, D; Peterson, R J; Phaisangittisakul, N; Prakhov, S; Pulver, M; Ramirez, A F; Sadler, M; Shafi, A; Slaus, I; Spinka, H; Stanislaus, S; Supek, I; Tippens, W B

    2000-12-25

    We report on an investigation of the (pi(-),pi(0)pi(0)) reaction by means of measurements of the pi(0)pi(0) invariant mass distributions from pi(-) interactions on H, D, C, Al, and Cu targets at p(pi(-)) = 0.408 GeV/c. The sharp, strong peak in the pi(+)pi(-) invariant mass near 2m(pi) reported by the CHAOS Collaboration is not seen in our pi(0)pi(0) data. However, we do observe a change in the shape of the pi(0)pi(0) invariant mass spectrum for the different targets, indicating that the pi(0)pi(0) interaction diminishes in the nuclear medium as represented by nuclei D, C, Al, and Cu, compared to hydrogen.

  9. Measurement of CP observables in B +/- -> DK +/- and B +/- -> D pi +/- with two- and four-body D decays

    NARCIS (Netherlands)

    Aaij, R.; Beteta, C. Abellan; Adeva, B.; Adinolfi, M.; Ajaltouni, Z.; Akar, S.; Albrecht, J.; Alessio, F.; Alexander, M.; Ali, S.; Alkhazov, G.; Cartelle, P. Alvarez; Alves, A. A.; Amato, S.; Amerio, S.; Amhis, Y.; An, L.; Anderlini, L.; Andreassi, G.; Andreotti, M.; Andrews, J. E.; Appleby, R. B.; Gutierrez, O. Aquines; Archilli, F.; d'Argent, P.; Artamonov, A.; Artuso, M.; Aslanides, E.; Auriemma, G.; Baalouch, M.; Bachmann, S.; Back, J. J.; Badalov, A.; Baesso, C.; Baker, S.; Baldini, W.; Barlow, R. J.; Barschel, C.; Barsuk, S.; Barter, W.; Batozskaya, V.; Battista, V.; Beaucourt, L.; Beddow, J.; Bedeschi, F.; Bediaga, I.; Bel, L. J.; Bellee, V.; Belloli, N.; Belyaev, I.; Ben-Haim, E.; Bencivenni, G.; Benson, S.; Benton, J.; Berezhnoy, A.; Bernet, R.; Bertolin, A.; Betti, F.; Bettler, M. -O.; van beuzekom, M.; Bifani, S.; Billoir, P.; Bird, T.; Birnkraut, A.; Bizzeti, A.; Blake, T.; Blanc, F.; Blouw, J.; Blusk, S.; Bocci, V.; Bondar, A.; Bondar, N.; Bonivento, W.; Borgheresi, A.; Borghi, S.; Borisyak, M.; Borsato, M.; Boubdir, M.; Bowcock, T. J. V.; Bowen, E.; Bozzi, C.; Braun, S.; Britsch, M.; Britton, T.; Brodzicka, J.; Buchanan, E.; Burr, C.; Bursche, A.; Buytaert, J.; Cadeddu, S.; Calabrese, R.; Calvi, M.; Calvo Gomez, M.; Campana, P.; Perez, D. Campora; Capriotti, L.; Carbone, A.; Carboni, G.; Cardinale, R.; Cardini, A.; Carniti, P.; Carson, L.; Akiba, K. Carvalho; Casse, G.; Cassina, L.; Garcia, L. Castillo; Cattaneo, M.; Cauet, Ch.; Cavallero, G.; Cenci, R.; Charles, M.; Charpentier, Ph.; Chatzikonstantinidis, G.; Chefdeville, M.; Cheung, S. -F.; Chrzaszcz, M.; Vidal, X. Cid; Ciezarek, G.; Clarke, P. E. L.; Clemencic, M.; Cliff, H. V.; Closier, J.; Coco, V.; Cogan, J.; Cogneras, E.; Cogoni, V.; Cojocariu, L.; Collazuol, G.; Collins, P.; Comerma-Montells, A.; Contu, A.; Cook, A.; Coombes, M.; Coquereau, S.; Corti, G.; Corvo, M.; Couturier, B.; Cowan, G. A.; Craik, D. C.; Crocombe, A.; Cruz Torres, M.; Cunliffe, S.; Currie, R.; D'Ambrosio, C.; Dall'Occo, E.; Dalseno, J.; David, P. N. Y.; Davis, A.; De Aguiar Francisco, O.; De Bruyn, K.; De Capua, S.; De Cian, M.; De Miranda, J. M.; De Paula, L.; De Simone, P.; Dean, C. -T.; Decamp, D.; Deckenhoff, M.; Del Buono, L.; Deleage, N.; Demmer, M.; Derkach, D.; Deschamps, O.; Dettori, F.; Dey, B.; Di Canto, A.; Di Ruscio, F.; Dordei, F.; Dorigo, M.; Dosil Suarez, A.; Dovbnya, A.; Dreimanis, K.; Dufour, L.; Dujany, G.; Dungs, K.; Durante, P.; Dzhelyadin, R.; Dziurda, A.; Dzyuba, A.; Easo, S.; Egede, U.; Egorychev, V.; Eidelman, S.; Eisenhardt, S.; Eitschberger, U.; Ekelhof, R.; Eklund, L.; El Rifai, I.; Elsasser, Ch.; Ely, S.; Esen, S.; Evans, H. M.; Evans, T.; Falabella, A.; Farber, C.; Farley, N.; Farry, S.; Fay, R.; Fazzini, D.; Ferguson, D.; Fernandez Albor, V.; Ferrari, F.; Ferreira Rodrigues, F.; Ferro-Luzzi, M.; Filippov, S.; Fiore, M.; Fiorini, M.; Firlej, M.; Fitzpatrick, C.; Fiutowski, T.; Fleuret, F.; Fohl, K.; Fontana, M.; Fontanelli, F.; Forshaw, D. C.; Forty, R.; Frei, C.; Frosini, M.; Furfaro, E.; Gallas Torreira, A.; Galli, D.; Gallorini, S.; Gambetta, S.; Gandelman, M.; Gandini, P.; Garcia Pardinas, J.; Tico, J. Garra; Garrido, L.; Garsed, P. J.; Gascon, D.; Gaspar, C.; Gavardi, L.; Gazzoni, G.; Gerick, D.; Gersabeck, E.; Gersabeck, M.; Gershon, T.; Ghez, Ph.; Giani, S.; Gibson, V.; Girard, O. G.; Giubega, L.; Gligorov, V. V.; Gobel, C.; Golubkov, D.; Golutvin, A.; Gotti, C.; Gandara, M. Grabalosa; Graciani Diaz, R.; Cardoso, L. A. Granado; Grauges, E.; Graverini, E.; Graziani, G.; Grecu, A.; Griffith, P.; Grillo, L.; Gruenberg, O.; Gui, B.; Gushchin, E.; Guz, Yu.; Gys, T.; Hadavizadeh, T.; Hadjivasiliou, C.; Haefeli, G.; Haen, C.; Haines, S. C.; Hall, S.; Hamilton, B.; Hansmann-Menzemer, S.; Harnew, N.; Harnew, S. T.; Harrison, J.; He, J.; Head, T.; Heister, A.; Hennessy, K.; Henrard, P.; Henry, L.; Hernando Morata, J. A.; van Herwijnen, E.; Hess, M.; Hicheur, A.; Hill, D.; Hoballah, M.; Hombach, C.; Hongming, L.; Hulsbergen, W.; Humair, T.; Hushchyn, M.; Hutchcroft, D.; Idzik, M.; Ilten, R.; Jacobsson, R.; Jalocha, J.; Jans, E.; Jawahery, A.; John, M.; Johnson, D.; Jones, C. R.; Joram, C.; Jost, B.; Jurik, N.; Kandybei, S.; Kanso, W.; Karacson, M.; Karbach, T. M.; Karodia, S.; Kecke, M.; Kelsey, M.; Kenyon, I. R.; Kenzie, M.; Ketel, T.; Khairullin, E.; Khanji, B.; Khurewathanaku, C.; Kirn, T.; Klaver, S.; Klimaszewski, K.; Kolpin, M.; Komarov, I.; Koppenburg, R.; Kozeiha, M.; Kravchuk, L.; Kreplin, K.; Kreps, M.; Krokovny, P.; Krzemien, W.; Kucewicz, W.; Kucharczyk, M.; Kudryavtsev, V.; Kuonen, A. K.; Kurek, K.; Kvaratskheliya, T.; Lacarrere, D.; Lafferty, G.; Lai, A.; Lambert, D.; Lanfranchi, G.; Langenbruch, C.; Langhans, B.; Latham, T.; Lazzeroni, C.; Le Gac, R.; van Leerdam, J.; Lees, J. -P.; Lefevre, R.; Leflat, A.

    2016-01-01

    Measurements of CP observables in B-+/- -> DK +/- and B-+/- -> D pi(+/-) decays are presented where the D meson is reconstructed in the final states K-+/-pi(-/+), pi K-+/-(-/+), K+K-, pi(+)pi(-), K-+/-pi(-/+)pi(+)pi(-), pi K-+/-(-/+)pi(+)pi(-) and pi(+)pi(-)pi(+)pi(-). This analysis uses a sample of

  10. Isospin effects in the exclusive dp -> 3He{\\pi}+{\\pi}- reaction

    CERN Document Server

    Mielke, M; Chiladze, D; Dymov, S; Fritzsch, C; Gebel, R; Goslawski, P; Hartmann, M; Kacharava, A; Khoukaz, A; Kulessa, P; Lorentz, B; Mersmann, T; Mikirtychiants, S; Ohm, H; Papenbrock, M; Rausmann, T; Serdyuk, V; Ströher, H; Täschner, A; Valdau, Y; Wilkin, C

    2014-01-01

    The differential cross section for the exclusive dp -> 3He{\\pi}+{\\pi}- reaction has been measured with high resolution and large statistics over a large fraction of the backward 3He hemisphere at the excess energy 265 MeV using the COSY-ANKE magnetic spectrometer. Though the well-known ABC enhancement is observed in the {\\pi}+{\\pi}- spectrum, the differences detected between the {\\pi}+3He and {\\pi}-3He invariant-mass distributions show that there must be some isospin-one {\\pi}{\\pi} production even at relatively low excess energies. The invariant-mass differences are modeled in terms of the sequential decay N*(1440) -> Delta(1232){\\pi} -> N{\\pi}{\\pi}.

  11. Direct CP violation in B{yields}{pi}{sup +}{pi}{sup -}{pi}: determination of {alpha} without discrete ambiguity

    Energy Technology Data Exchange (ETDEWEB)

    Leitner, O. [Department of Physics and Mathematical Physics, and Special Research Center for the Subatomic Structure of Matter, University of Adelaide, 5005, Adelaide (Australia); Laboratoire de Physique Corpusculaire, Universite Blaise Pascal, CNRS/IN2P3, 24 avenue des Landais, 63177, Aubiere Cedex (France); Guo, X.H.; Thomas, A.W. [Department of Physics and Mathematical Physics, and Special Research Center for the Subatomic Structure of Matter, University of Adelaide, 5005, Adelaide (Australia)

    2003-11-01

    Direct CP violation in the hadronic decays B{yields}{pi}{sup +}{pi}{sup -}{pi}{sup 0} is investigated near the peak of the {rho}{sup 0}, taking into account the effect of {rho}- {omega} mixing. The branching ratios for the processes B{sup {+-}}{sup ,0} {yields}{rho}{sup {+-}}{sup ,0}{pi}{sup {+-}}{sup ,0} and B{sup -}{yields}{omega}{pi}{sup -} are calculated as well. We find that the CP violating asymmetry is strongly dependent on the CKM matrix elements. For a fixed N{sub c}{sup eff}, the CP violating asymmetry, a{sub CP}, has a maximum of order -40% to - 70% for B{yields}{rho}{sup 0}({omega}) {pi}{sup 0} when the invariant mass of the {pi}{sup +}{pi}{sup -} pair is in the vicinity of the {omega} resonance. The sensitivity of the asymmetry to N{sub c}{sup eff} is small in that case. Moreover, we find that in the range of N{sub c}{sup eff} which is allowed by the most recent experimental branching ratios from the BABAR, BELLE and CLEO Collaborations, the sign of sin {delta} is always positive. Thus, a measurement of direct CP violation in the decays B{yields}{pi}{sup +}{pi}{sup -}{pi}{sup 0} would remove the mod ({pi}) ambiguity in the determination of the CP violating phase angle {alpha}. (orig.)

  12. Direct CP violation in B {yields} {pi}{sup +}{pi}{sup -}{pi}. Determination of {alpha} without discrete ambiguity

    Energy Technology Data Exchange (ETDEWEB)

    Leitner, O. [Department of Physics and Mathematical Physics and Special Research Centre for the Subatomic Structure of Matter, University of Adelaide, Adelaide 5005 (Australia)]|[Laboratoire de Physique Corpusculaire, IN2P3/CNRS, 24 avenue des Landais, Universite Blaise Pascal, F-63177 Aubiere Cedex (France); Guo, X-H.; Thomas, A.W. [Department of Physics and Mathematical Physics and Special Research Centre for the Subatomic Structure of Matter, University of Adelaide, Adelaide 5005 (Australia)

    2002-07-01

    Direct CP violation in the hadronic decays B-bar{sup 0} {yields} {pi}{sup +}{pi}{sup -}{pi}{sup 0} is investigated near the peak of the {rho}{sup 0} taking into account the effect of {rho} - {omega} mixing. Branching ratio for processes B{sup {+-}}{sup ,0} {yields} {rho}{sup {+-}}{sup ,0}{pi}{sup {+-}}{sup ,0} and B{sup -} {yields} {omega}{pi}{sup -} are calculated as well. We find that the CP violation asymmetry is strongly dependent on the CKM matrix elements. For a fixed N{sub c}{sup eff}, the CP violation asymmetry, a, has a maximum of order - 40% to - 70% for B-bar{sup 0} {yields} {rho}{sup 0}({omega}){pi}{sup 0} when the invariant mass of the {pi}{sup +}{pi}{sup -} pair is in the vicinity of the {omega} resonance. The sensitivity of the asymmetry to N{sub c}{sup eff} is small in that case. Moreover, we find that in the range of N{sub c}{sup eff} which is allowed by the most recent experimental branching ratios from the BABAR, BELLE and CLEO Collaborations, the sign of sin{delta} is always positive. Thus, a measurement of direct CP violation in decays B-bar{sup 0} {yields} {pi}{sup +}{pi}{sup -}{pi}{sup 0} would remove the mod({pi}) ambiguity in the determination of the CP violating phase angle {alpha}. (authors)

  13. Measurement of CP Asymmetries and Branching Fractions in B to pi pi and B to K pi Decays.

    Energy Technology Data Exchange (ETDEWEB)

    Aubert, B

    2006-09-26

    The authors present preliminary measurements of the Cp asymmetries and branching fractions for B {yields} {pi}{pi} and B {yields} K{pi} decays. A total of 347 million B{bar B} events collected by the BABAR detector at the PEP-II asymmetric-energy e{sup +}e{sup -} collider at SLAC are used for these results.

  14. First Observation of D-0 - (D)over-bar(0) Oscillations in D-0 -> K+pi(-)pi(+)pi(-) Decays and Measurement of the Associated Coherence Parameters

    NARCIS (Netherlands)

    Aaij, R.; Beteta, C. Abellan; Adeva, B.; Adinolfi, M.; Affolder, A.; Ajaltouni, Z.; Akar, S.; Albrecht, J.; Alessio, F.; Alexander, M.; Ali, S.; Alkhazov, G.; Cartelle, P. Alvarez; Alves, A. A.; Amato, S.; Amerio, S.; Amhis, Y.; An, L.; Anderlini, L.; Andreassi, G.; Andreotti, M.; Andrews, J. E.; Appleby, R. B.; Gutierrez, O. Aquines; Archilli, F.; d'Argent, P.; Artamonov, A.; Artuso, M.; Aslanides, E.; Auriemma, G.; Baalouch, M.; Bachmann, S.; Back, J. J.; Badalov, A.; Baesso, C.; Baldini, W.; Barlow, R. J.; Barschel, C.; Barsuk, S.; Barter, W.; Batozskaya, V.; Battista, V.; Beaucourt, L.; Beddow, J.; Bedeschi, F.; Bediaga, I.; Bel, L. J.; Bellee, V.; Belloli, N.; Belyaev, I.; Ben-Haim, E.; Bencivenni, G.; Benson, S.; Benton, J.; Berezhnoy, A.; Bernet, R.; Bertolin, A.; Betti, F.; Bettler, M. -O.; van Beuzekom, M.; Bifani, S.; Billoir, P.; Bird, T.; Birnkraut, A.; Bizzeti, A.; Blake, T.; Blanc, F.; Blouw, J.; Blusk, S.; Bocci, V.; Bondar, A.; Bondar, N.; Bonivento, W.; Borgheresi, A.; Borghi, S.; Borisyak, M.; Borsato, M.; Bowcock, T. J. V.; Bowen, E.; Bozzi, C.; Braun, S.; Britsch, M.; Britton, T.; Brodzicka, J.; Brook, N. H.; Buchanan, E.; Burr, C.; Bursche, A.; Buytaert, J.; Cadeddu, S.; Calabrese, R.; Calvi, M.; Calvo Gomez, M.; Campana, P.; Perez, D. Campora; Capriotti, L.; Carbone, A.; Carboni, G.; Cardinale, R.; Cardini, A.; Carniti, P.; Carson, L.; Carvalho Akiba, K.; Casse, G.; Cassina, L.; Garcia, L. Castillo; Cattaneo, M.; Cauet, Ch.; Cavallero, G.; Cenci, R.; Charles, M.; Charpentier, Ph.; Chefdeville, M.; Cheung, S. -F.; Chiapolini, N.; Chrzaszcz, M.; Vidal, X. Cid; Ciezarek, G.; Clarke, P. E. L.; Clemencic, M.; Cliff, H. V.; Closier, J.; Coco, V.; Cogan, J.; Cogneras, E.; Cogoni, V.; Cojocariu, L.; Collazuol, G.; Collins, P.; Comerma-Montells, A.; Contu, A.; Cook, A.; Coombes, M.; Coquereau, S.; Corti, G.; Corvo, M.; Couturier, B.; Cowan, G. A.; Craik, D. C.; Crocombe, A.; Cruz Torres, M.; Cunliffe, S.; Currie, R.; D'Ambrosio, C.; Dall'Occo, E.; Dalseno, J.; David, P. N. Y.; Davis, A.; De Aguiar Francisco, O.; De Bruyn, K.; De Capua, S.; De Cian, M.; De Miranda, J. M.; De Paula, L.; De Simone, P.; Dean, C. -T.; Decamp, D.; Deckenhoff, M.; Del Buono, L.; Deleage, N.; Demmer, M.; Derkach, D.; Deschamps, O.; Dettori, F.; Dey, B.; Di Canto, A.; Di Ruscio, F.; Donleavy, S.; Dordei, F.; Dorigo, M.; Suarez, A. Dosil; Dovbnya, A.; Dreimanis, K.; Dufour, L.; Dujany, G.; Dungs, K.; Durante, P.; Dzhelyadin, R.; Dziurda, A.; Dzyuba, A.; Easo, S.; Egede, U.; Egorychev, V.; Eidelman, S.; Eisenhardt, S.; Eitschberger, U.; Ekelhof, R.; Eklund, L.; El Rifai, I.; Elsasser, Ch.; Ely, S.; Esen, S.; Evans, H. M.; Evans, T.; Falabella, A.; Farber, C.; Farley, N.; Farry, S.; Fay, R.; Fazzini, D.; Ferguson, D.; Albor, V. Fernandez; Ferrari, F.; Ferreira Rodrigues, F.; Ferro-Luzzi, M.; Filippov, S.; Fiore, M.; Fiorini, M.; Firlej, M.; Fitzpatrick, C.; Fiutowski, T.; Fleuret, F.; Fohl, K.; Fol, P.; Fontana, M.; Fontanelli, F.; Forshaw, D. C.; Forty, R.; Frei, C.; Frosini, M.; Furfaro, E.; Gallas Torreira, A.; Galli, D.; Gallorini, S.; Gambetta, S.; Gandelman, M.; Gandini, P.; Pardinas, J. Garcia; Tico, J. Garra; Garrido, L.; Gascon, D.; Gaspar, C.; Gavardi, L.; Gazzoni, G.; Gerick, D.; Gersabeck, E.; Gersabeck, M.; Gershon, T.; Ghez, Ph.; Gian, S.; Gibson, V.; Girard, O. G.; Giubega, L.; Gligorov, V. V.; Gobel, C.; Golubkov, D.; Golutvin, A.; Gotti, C.; Gandara, M. Grabalosa; Graciani Diaz, R.; Cardoso, L. A. Granado; Grauges, E.; Graverini, E.; Graziani, G.; Grecu, A.; Griffith, P.; Grillo, L.; Gruenberg, O.; Gui, B.; Gushchin, E.; Guz, Yu.; Gys, T.; Hadavizadeh, T.; Hadjivasiliou, C.; Haefeli, G.; Haen, C.; Haines, S. C.; Hall, S.; Hamilton, B.; Hansmann-Menzemer, S.; Harnew, N.; Harnew, S. T.; Harrison, J.; He, J.; Head, T.; Heijne, V.; Heister, A.; Hennessy, K.; Henrard, P.; Henry, L.; Morata, J. A. Hernando; van Herwijnen, E.; Hess, M.; Hicheur, A.; Hill, D.; Hoballah, M.; Hombach, C.; Hongming, L.; Hulsbergen, W.; Humair, T.; Hushchyn, M.; Hutchcroft, D.; Hynds, D.; Idzik, M.; Ilten, P.; Jacobsson, R.; Jalocha, J.; Jans, E.; Jawahery, A.; John, M.; Johnson, D.; Jones, C. R.; Joram, C.; Jost, B.; Jurik, N.; Kandybei, S.; Kanso, W.; Karacson, M.; Karbach, T. M.; Karodia, S.; Kecke, M.; Kelsey, M.; Kenyon, I. R.; Kenzie, M.; Ketel, T.; Khairullin, E.; Khanji, B.; Khurewathanakul, C.; Kirn, T.; Klaver, S.; Klimaszewski, K.; Kochebina, O.; Kolpin, M.; Komarov, I.; Koppenburg, P.; Kozeiha, M.; Kravchuk, L.; Kreplin, K.; Kreps, M.; Krokovny, P.; Krzemien, W.; Kucewicz, W.; Kucharczyk, M.; Kudryavtsev, V.; Kuonen, A. K.; Kurek, K.; Kvaratskheliya, T.; Lacarrere, D.; Lafferty, G.; Lai, A.; Lambert, D.; Lanfranchi, G.; Langenbruch, C.; Langhans, B.; Latham, T.; Lazzeroni, C.; Le Gac, R.; van Leerdam, J.; Lees, J. -P.; Lefesvre, R.; Leflat, A.; Lefrancois, J.; Lemos Cid, E.; Leroy, O.; Lesiak, T.; Leverington, B.; Likhomanenko, T.; Liles, M.; Lindner, R.; Linn, C.; Lionetto, F.; Loh, D.; Longstaff, I.; Lopes, J. H.; Lucchesi, D.; Lucio Martinez, M.; Luo, H.; Lupato, A.; Luppi, E.; Lupton, O.; Lusardi, N.; Lusiani, A.; Machefert, F.; Maciuc, F.; Maev, O.; Maguire, K.; Malde, S.; Malinin, A.; Manca, G.; Mancinelli, G.; Manning, P.; Mapelli, A.; Maratas, J.; Marchand, J. F.; Marconi, U.; Marin Benito, C.; Marino, P.; Marks, J.; Martellotti, G.; Martinelli, M.; Martinez Santos, D.; Martinez Vidal, F.; Martins Tostes, D.; Massacrier, L. M.; Massafferri, A.; Matev, R.; Mathad, A.; Mathe, Z.; Matteuzzi, C.; Mauri, A.; Maurin, B.; Mazurov, A.; McCann, M.; McCarthy, J.; Mcnab, A.; McNulty, R.; Meadows, B.; Meier, F.; Melnychuk, D.; Merk, M.; Merli, A.; Michielin, E.; Milanes, D. A.; Minard, M. -N.; Mitzel, D. S.; Molina Rodriguez, J.; Monroy, I. A.; Monteil, S.; Morandin, M.; Morawski, P.; Morda, A.; Morello, M. J.; Moron, J.; Morris, A. B.; Mountain, R.; Muheim, F.; Mueller, J.; Mueller, K.; Mueller, V.; Mussini, M.; Muster, B.; Naik, P.; Nakada, T.; Nandakumar, R.; Nandi, A.; Nasteva, I.; Needham, M.; Neri, N.; Neubert, S.; Neufeld, N.; Neuner, M.; Nguyen, A. D.; Nguyen-Mau, C.; Niess, V.; Nieswand, S.; Niet, R.; Nikitin, N.; Nikodem, T.; Novoselov, A.; O'Hanlon, D. P.; Oblakowska-Mucha, A.; Obraztsov, V.; Ogilvy, S.; Okhrimenko, O.; Oldeman, R.; Onderwater, C. J. G.; Osorio Rodrigues, B.; Otalora Goicochea, J. M.; Otto, A.; Owen, P.; Oyanguren, A.; Palano, A.; Palombo, F.; Palutan, M.; Papanestis, A.; Pappagallo, M.; Pappalardo, L. L.; Pappenheimer, C.; Parker, W.; Parkes, C.; Passaleva, G.; Patel, G. D.; Patrignani, C.; Pearce, A.; Pellegrino, A.; Penso, G.; Altarelli, M. Pepe; Perazzini, S.; Perret, P.; Pescatore, L.; Petridis, K.; Petrolini, A.; Petruzzo, M.; Picatoste Olloqui, E.; Pietrzyk, B.; Pikies, M.; Pinci, D.; Pistone, A.; Piucci, A.; Playfer, S.; Plo Casasus, M.; Poikela, T.; Polci, F.; Poluektov, A.; Polyakov, I.; Polycarpo, E.; Popov, A.; Popov, D.; Popovici, B.; Potterat, C.; Price, E.; Price, J. D.; Prisciandaro, J.; Pritchard, A.; Prouve, C.; Pugatch, V.; Navarro, A. Puig; Punzi, G.; Qian, W.; Quagliani, R.; Rachwal, B.; Rademacker, J. H.; Rama, M.; Ramos Pernas, M.; Rangel, M. S.; Raniuk, I.; Raven, G.; Redi, F.; Reichert, S.; Dos Reis, A. C.; Renaudin, V.; Ricciardi, S.; Richards, S.; Rihl, M.; Rinnert, K.; Rives Molina, V.; Rodrigues, A. B.; Rodriguez Lopez, J. A.; Rodriguez Perez, P.; Rogozhnikov, A.; Roiser, S.; Romanovsky, V.; Romero Vidal, A.; Ronayne, J. W.; Rotondo, M.; Ruf, T.; Ruiz Valls, P.; Saborido Silva, J. J.; Sagidova, N.; Saitta, B.; Salustino Guimaraes, V.; Sanchez Mayordomo, C.; Sanmartin Sedes, B.; Santacesaria, R.; Santamarina Rios, C.; Santimaria, M.; Santovetti, E.; Sarti, A.; Satriano, C.; Satta, A.; Saunders, D. M.; Savrina, D.; Schael, S.; Schindler, H.; Schlupp, M.; Schmelling, M.; Schmelzer, T.; Schmidt, B.; Schneider, O.; Schopper, A.; Schubiger, M.; Schune, M. -H.; Schwemmer, R.; Sciascia, B.; Sciubba, A.; Semennikov, A.; Sergi, A.; Serra, N.; Serrano, J.; Sestini, L.; Seyfert, P.; Shapkin, M.; Shapoval, I.; Shcheglov, Y.; Shears, T.; Shekhtman, L.; Shevchenko, V.; Shires, A.; Siddi, B. G.; Coutinho, R. Silva; Silva de Oliveira, L.; Simi, G.; Sirendi, M.; Skidmore, N.; Skwarnicki, T.; Smith, I. T.; Snoek, H.; Sokoloff, M. D.; Soler, F. J. P.; Soomro, F.; Souza, D.; Souza De Paula, B.; Spaan, B.; Spradlin, P.; Sridharan, S.; Stagni, F.; Stahl, M.; Stahl, S.; Stefkova, S.; Steinkamp, O.; Stenyakin, O.; Stevenson, S.; Stone, S.; Storaci, B.; Stracka, S.; Straticiuc, M.; Straumann, U.; Sutcliffe, W.; Swientek, K.; Swientek, S.; Syropoulos, V.; Szczekowski, M.; Szumlak, T.; T'Jampens, S.; Tayduganov, A.; Tekampe, T.; Tellarini, G.; Teubert, F.; van Tilburg, J.; Tisserand, V.; Tobin, M.; Todd, J.; Tolk, S.; Tomassetti, L.; Tonelli, D.; Topp-Joergensen, S.; Tournefier, E.; Tourneur, S.; Trabelsi, K.; Traill, M.; Tresch, M.; Trisovic, A.; Tsaregorodtsev, A.; Tsopelas, P.; Tuning, N.; Ukleja, A.; Ustyuzhanin, A.; Uwer, U.; Vacca, C.; Vagnoni, V.; Valenti, G.; Vallier, A.; Gomez, R. Vazquez; Vazquez Regueiro, P.; Vazquez Sierra, C.; Vecchi, S.; van Veghel, M.; Velthuis, J. J.; Veltri, M.; Veneziano, G.; Vesterinen, M.; Viaud, B.; Vieira, D.; Vieites Diaz, M.; Vilasis-Cardona, X.; Volkov, V.; Vollhardt, A.; Voong, D.; Vorobyev, A.; Vorobyev, V.; Vo, C.; Waldi, R.; Wallace, C.; Wallace, R.; Ward, D. R.; Watson, N. K.; Websdale, D.; Weiden, A.; Whitehead, M.; Wicht, J.; Wilkinson, G.; Williams, T.; Wilson, F. F.; Wimberley, J.; Wishahi, J.; Wislicki, W.; Witek, M.; Wormser, G.; Wotton, S. A.; Wraight, K.; Wright, S.; Wyllie, K.; Xie, Y.; Yang, Z.; Yu, J.; Yuan, X.; Yushchenko, O.; Zangoli, M.; Zavertyaev, M.; Zhelezov, A.; Zhokhov, A.; Zhong, L.; Zhukov, V.; Zucchelli, S.

    2016-01-01

    Charm meson oscillations are observed in a time-dependent analysis of the ratio of D-0 -> K+pi(-)pi(+)pi(-) to D-0 -> K-pi(+)pi(-)pi(+) decay rates, using data corresponding to an integrated luminosity of 3.0 fb(-1) recorded by the LHCb experiment. The measurements presented are sensitive to the pha

  15. Coordination polymers assembled through pi-pi interactions

    CERN Document Server

    Plummer, E A

    2001-01-01

    Chapter one is a review of the relevant literature. In chapter two the coordination chemistry of biphenyl-tailed terpyridines with octahedral metal dications is investigated. The effect of different metal ions on their aggregation modes in the solid state is also investigated. In chapter three the coordination chemistry of polyaryl-tailed terpyridines with octahedral metal dications is investigated. The effect of different aryl tails on their aggregation modes in the solid state is investigated. In chapter four the pi-pi aggregation of molecular boxes through biphenyl tails is studied. In chapter five the immobilisation of aryl tailed complexes into polyelectrolyte films has been investigated, and the arrangement of these complexes in the films has been compared with same complexes in the crystal, thus moving from three dimensional aggregation to two dimensions.

  16. Resolution to the B -> pi K puzzle

    CERN Document Server

    Li, H; Sanda, A I; Li, Hsiang-nan; Mishima, Satoshi

    2005-01-01

    We calculate the important next-to-leading-order contributions to the B -> pi K, pi pi decays from the vertex corrections, the quark loops, and the magnetic penguins in the perturbative QCD approach. It is found that the latter two reduce the leading-order penguin amplitudes by about 10%, and modify only the B -> pi K branching ratios. The main effect of the vertex corrections is to increase the small color-suppressed tree amplitude by a factor of 3, which then resolves the large difference between the direct CP asymmetries of the B^0 -> pi^\\mp K^\\pm and B^\\pm -> pi^0 K^\\pm modes. The puzzle from the large B^0 -> pi^0 pi^0 branching ratio still remains.

  17. Measurement of Branching Fractions and Mass Spectra of B to K pi pi gamma

    Energy Technology Data Exchange (ETDEWEB)

    Aubert, B.; Barate, R.; Boutigny, D.; Couderc, F.; Karyotakis, Y.; Lees, J.P.; Poireau, V.; Tisserand, V.; Zghiche, A.; /Annecy, LAPP; Grauges, E.; /Barcelona, IFAE; Palano, A.; Pappagallo, M.; Pompili, A.; /Bari U. /INFN, Bari; Chen, J.C.; Qi, N.D.; Rong, G.; Wang, P.; Zhu, Y.S.; /Beijing, Inst. High Energy Phys.; Eigen, G.; Ofte, I.; Stugu, B.

    2005-07-12

    The authors present a measurement of the partial branching fractions and mass spectra of the exclusive radiative penguin processes B {yields} K{pi}{pi}{gamma} in the range m{sub K{pi}{pi}} < 1.8 GeV/c{sup 2}. They reconstruct four final states: K{sup +}{pi}{sup -}{pi}{sup +}{gamma}, K{sup +}{pi}{sup -}{pi}{sup 0}{gamma}, K{sub S}{sup 0}{pi}{sup -}{pi}{sup +}{gamma}, and K{sub S}{sup 0}{pi}{sup +}{pi}{sup 0}{gamma}, where K{sub S}{sup 0} {yields} {pi}{sup +}{pi}{sup -}. Using 232 million e{sup +}e{sup -} {yields} B{bar B} events recorded by the BABAR experiment at the PEP-II asymmetric-energy storage ring, they measure the branching fractions {Beta}(B{sup +} {yields} K{sup +}{pi}{sup -}{pi}{sup +}{gamma}) = (2.95 {+-} 0.13(stat.) {+-} 0.20(syst)) x 10{sup -5}, {Beta}(B{sup 0} {yields} K{sup +}{pi}{sup -}{pi}{sup 0}{gamma}) = (4.07 {+-} 0.22(stat.) {+-} 0.31(syst.)) x 10{sup -5}, {Beta}(B{sup 0} {yields} K{sup 0}{pi}{sup +}{pi}{sup -}{gamma}) = (1.85 {+-} 0.21(stat.) {+-} 0.12(syst.)) x 10{sup -5}, and {Beta}(B{sup +} {yields} K{sup 0}{pi}{sup +}{pi}{sup 0}{gamma}) = (4.56 {+-} 0.42(stat.) {+-} 0.31(syst.)) x 10{sup -5}.

  18. Roy-Steiner equations for gamma gamma -> pi pi

    CERN Document Server

    Hoferichter, Martin; Schat, Carlos

    2011-01-01

    Starting from hyperbolic dispersion relations, we derive a system of Roy--Steiner equations for pion Compton scattering that respects analyticity, unitarity, gauge invariance, and crossing symmetry. It thus maintains all symmetries of the underlying quantum field theory. To suppress the dependence of observables on high-energy input, we also consider once- and twice-subtracted versions of the equations, and identify the subtraction constants with dipole and quadrupole pion polarizabilities. Based on the assumption of Mandelstam analyticity, we determine the kinematic range in which the equations are valid. As an application, we consider the resolution of the $\\gamma\\gamma\\to\\pi\\pi$ partial waves by a Muskhelishvili--Omn\\`es representation with finite matching point. We find a sum rule for the isospin-two $S$-wave, which, together with chiral constraints, produces an improved prediction for the charged-pion quadrupole polarizability $(\\alpha_2-\\beta_2)^{\\pi^\\pm}=(15.3\\pm 3.7)\\cdot 10^{-4} {\\rm fm}^5$. We inves...

  19. Precision measurement of the ratio BR(K{sub S{yields}{pi}}{sup +{pi}-}e{sup +}e{sup -})/BR(K{sub L{yields}{pi}}{sup +{pi}-{pi}}{sub D}{sup 0})

    Energy Technology Data Exchange (ETDEWEB)

    Batley, J.R. [Cavendish Laboratory, University of Cambridge, Cambridge, CB3 0HE (United Kingdom); Kalmus, G.E. [Cavendish Laboratory, University of Cambridge, Cambridge, CB3 0HE (United Kingdom); Rutherford Appleton Laboratory, Chilton, Didcot, OX11 0QX (United Kingdom); Lazzeroni, C. [Cavendish Laboratory, University of Cambridge, Cambridge, CB3 0HE (United Kingdom); School of Physics and Astronomy, University of Birmingham, Birmingham B15 2TT (United Kingdom); Munday, D.J. [Cavendish Laboratory, University of Cambridge, Cambridge, CB3 0HE (United Kingdom); Patel, M. [Cavendish Laboratory, University of Cambridge, Cambridge, CB3 0HE (United Kingdom); Imperial College London, Blackett Laboratory, Physics Department, Prince Consort Road, London SW7 2AZ (United Kingdom); Slater, M.W. [Cavendish Laboratory, University of Cambridge, Cambridge, CB3 0HE (United Kingdom); School of Physics and Astronomy, University of Birmingham, Birmingham B15 2TT (United Kingdom); Wotton, S.A. [Cavendish Laboratory, University of Cambridge, Cambridge, CB3 0HE (United Kingdom); Arcidiacono, R. [CERN, CH-1211 Geneve 23 (Switzerland); Sezione dell' INFN di Torino, I-10125 Torino (Italy); Dipartimento di Fisica Sperimentale dell' Universita, I-10125 Torino (Italy); Bocquet, G.; Ceccucci, A. [CERN, CH-1211 Geneve 23 (Switzerland); Cundy, D. [CERN, CH-1211 Geneve 23 (Switzerland); Istituto di Cosmogeofisica del CNR di Torino, I-10133 Torino (Italy); Doble, N. [CERN, CH-1211 Geneve 23 (Switzerland); Sezione dell' INFN di Pisa, I-56100 Pisa (Italy); Dipartimento di Fisica dell' Universita, I-56100 Pisa (Italy); Falaleev, V.; Gatignon, L.; Gonidec, A.; Grafstroem, P.; Kubischta, W. [CERN, CH-1211 Geneve 23 (Switzerland); Marchetto, F. [CERN, CH-1211 Geneve 23 (Switzerland); Sezione dell' INFN di Torino, I-10125 Torino (Italy); Mikulec, I. [CERN, CH-1211 Geneve 23 (Switzerland); Osterreichische Akademie der Wissenschaften, Institut fuer Hochenergiephysik, A-10560 Wien (Austria)

    2011-01-03

    The K{sub S{yields}{pi}}{sup +{pi}-}e{sup +}e{sup -} decay mode was investigated using the data collected in 2002 by the NA48/1 Collaboration. With about 23 k K{sub S{yields}{pi}}{sup +{pi}-}e{sup +}e{sup -} events and 59 k K{sub L{yields}{pi}}{sup +{pi}-{pi}}{sub D}{sup 0} normalization decays, the K{sub S{yields}{pi}}{sup +{pi}-}e{sup +}e{sup -} branching ratio relative to the K{sub L{yields}{pi}}{sup +{pi}-{pi}}{sub D}{sup 0} one was determined to be BR(K{sub S{yields}{pi}}{sup +{pi}-}e{sup +}e{sup -})/BR(K{sub L{yields}{pi}}{sup +{pi}-{pi}}{sub D}{sup 0})=(3.28{+-}0.06{sub stat{+-}}0.04{sub syst})x10{sup -2}. This result was used to set the upper limit |g{sub E1}/g{sub BR}|<3.0 at 90% CL on the presence, in the decay amplitude, of an E1 direct emission (g{sub E1}) term relative to the dominant inner bremsstrahlung (g{sub BR}) term. The CP-violating asymmetry A{sub {phi}} in the sin{phi}cos{phi} distribution of K{sub S{yields}{pi}}{sup +{pi}-}e{sup +}e{sup -} events, where {phi} is the angle between the {pi}{sup +{pi}-} and the e{sup +}e{sup -} decay planes in the kaon centre of mass, was found to be A{sub {phi}=}(-0.4{+-}0.8)%, consistent with zero. These results are in good agreement with a description of the K{sub S{yields}{pi}}{sup +{pi}-}e{sup +}e{sup -} decay amplitude dominated by the CP-even inner bremsstrahlung process.

  20. Perturbative framework for the study of the properties of the pi(+)pi(-) atom

    OpenAIRE

    Lyubovitskij, V. E.; Lipartia, E. Z.; Rusetsky, A. G.

    1997-01-01

    The perturbative framework is developed for the calculation of the pi(+)pi(-) atom characteristics (energy level shift and lifetime) on the basis of the field-theoretical Bethe-Salpeter approach. A closed expression for the first-order correction to the pi(+)pi(-) atom lifetime has been obtained.

  1. Search for CP and $P$ violating pseudoscalar decays into $\\pi\\pi$

    CERN Document Server

    Ablikim, M

    2011-01-01

    Using a sample of $(225.2\\pm 2.8)\\times 10^6$ $J/\\psi$ events collected with the Beijing Spectrometer (BESIII) at the Beijing Electron-Positron Collider, CP and $P$ violating decays of $\\eta$, $\\eta'$ and $\\etac$ into $\\pi^+\\pi^-$ and $\\pi^0 \\pi^0$ are searched for in $\\jpsi$ radiative decays. No significant $\\eta$, $\\eta'$ or $\\etac$ signal is observed, and 90% confidence level upper limits of $\\BR(\\eta \\to \\pi^+\\pi^-)<3.9\\times 10^{-4}$, $\\BR(\\eta' \\to \\pi^+\\pi^-)<5.5\\times 10^{-5}$, $\\BR(\\etac \\to \\pi^+\\pi^-)<1.3\\times 10^{-4}$, $\\BR(\\eta \\to \\pi^0 \\pi^0)<6.9\\times 10^{-4}$, $\\BR(\\eta' \\to \\pi^0 \\pi^0)<4.5\\times 10^{-4}$ and $\\BR(\\etac \\to \\pi^0 \\pi^0)<4.2\\times 10^{-5}$ are obtained.

  2. Chiral-loop and vector-meson contributions to $\\eta \\to \\pi \\pi \\gamma \\gamma$ decays

    CERN Document Server

    Ametller, L; Bramon, A; Talavera, P; Ametller, Ll.

    1997-01-01

    The process eta -> pi0 pi0 gamma gamma is discussed in Chiral Perturbation Theory (ChPT) extending two recent analyses. Special attention is devoted to one-loop corrections, eta-eta' mixing effects and vector-meson dominance of ChPT counter-terms. The less interesting eta -> pi^+ pi^- gamma gamma transition is briefly discussed too.

  3. Decay width of $d^*(2380)\\to NN \\pi\\pi$ processes

    CERN Document Server

    Dong, Yubing; Shen, Pengnian; Zhang, Zongye

    2016-01-01

    The decay widths of four-body double-pion decays $\\ds\\to pn \\pi^0\\pi^0$, $\\ds\\to pn \\pi^+\\pi^-$, and iso-scalar parts of $\\ds\\to pp \\pi^0\\pi^-$ and $\\ds\\to nn \\pi^+\\pi^0$ are explicitly calculated with the help of the $d^*$ wave function obtained in a chiral SU(3) quark model calculation. The effect of the dynamical structure on $\\ds$'s width is analyzed both in the single $\\Delta\\Delta$ channel and coupled $\\Delta\\Delta$ and $CC$ channel approximations. It is found that in the coupled-channel approximation, the obtained partial decay widths of $\\ds\\to pn \\pi^0\\pi^0$, $\\ds\\to pn \\pi^+\\pi^-$, and those of $d^*$ to the iso-scalar parts of $pp \\pi^0\\pi^-$ and $nn \\pi^+\\pi^0$ are about $7.4$MeV, $16.4$MeV, $3.5$MeV and $3.5$MeV, respectively As a consequence, the total width is about $64.5$MeV. These widths are consistent with those estimated by using the corresponding cross section data in our previous investigation and also the observed data. But in the single $\\Delta\\Delta$ channel approximation, the widths ar...

  4. The e+ e- --> 3(pi+pi-), 2(pi+pi-pi0) and K+K- 2(pi+pi-) Cross Sections at Center-of-Mass Energies from Production Threshold to 4.5 GeV Measured with Initial-State Radiation

    CERN Document Server

    Aubert, B; Boutigny, D; Couderc, F; Karyotakis, Yu; Lees, J P; Poireau, V; Tisserand, V; Zghiche, A; Graugès-Pous, E; Palano, A; Pappagallo, M; Chen, J C; Qi, N D; Rong, G; Wang, P; Zhu, Y S; Eigen, G; Ofte, I; Stugu, B; Abrams, G S; Battaglia, M; Best, D S; Brown, D N; Button-Shafer, J; Cahn, R N; Charles, E; Day, C T; Gill, M S; Gritsan, A V; Groysman, Y; Jacobsen, R G; Kadel, R W; Kadyk, J A; Kerth, L T; Kolomensky, Yu G; Kukartsev, G; Lynch, G; Mir, L M; Oddone, P J; Orimoto, T J; Pripstein, M; Roe, N A; Ronan, M T; Wenzel, W A; Barrett, M; Ford, K E; Harrison, T J; Hart, A J; Hawkes, C M; Morgan, S E; Watson, A T; Fritsch, M; Goetzen, K; Held, T; Koch, H; Lewandowski, B; Pelizaeus, M; Peters, K; Schröder, T; Steinke, M; Boyd, J T; Burke, J P; Cottingham, W N; Walker, D; Çuhadar-Dönszelmann, T; Fulsom, B G; Hearty, C; Knecht, N S; Mattison, T S; McKenna, J A; Khan, A; Kyberd, P; Saleem, M; Teodorescu, L; Blinov, V E; Bukin, A D; Druzhinin, V P; Golubev, V B; Kravchenko, E A; Onuchin, A P; Serednyakov, S I; Skovpen, Yu I; Solodov, E P; Todyshev, K Y; Bondioli, M; Bruinsma, M; Chao, M; Curry, S; Eschrich, I; Kirkby, D; Lankford, A J; Lund, P; Mandelkern, M A; Mommsen, R K; Röthel, W; Stoker, D P; Abachi, S; Buchanan, C; Foulkes, S D; Gary, J W; Long, O; Shen, B C; Wang, K; Zhang, L; Del Re, D; Hadavand, H K; Hill, E J; Paar, H P; Rahatlou, S; Sharma, V; Berryhill, J W; Campagnari, C; Cunha, A; Dahmes, B; Hong, T M; Richman, J D; Beck, T W; Eisner, A M; Flacco, C J; Heusch, C A; Kroseberg, J; Lockman, W S; Nesom, G; Schalk, T; Schumm, B A; Seiden, A; Spradlin, P; Williams, D C; Wilson, M G; Albert, J; Chen, E; Dubois-Felsmann, G P; Dvoretskii, A; Hitlin, D G; Narsky, I; Piatenko, T; Porter, F C; Ryd, A; Samuel, A; Andreassen, R; Mancinelli, G; Meadows, B T; Sokoloff, M D; Blanc, F; Bloom, P C; Chen, S; Ford, W T; Hirschauer, J F; Kreisel, A; Nauenberg, U; Olivas, A; Ruddick, W O; Smith, J G; Ulmer, K A; Wagner, S R; Zhang, J; Chen, A; Eckhart, E A; Soffer, A; Toki, W H; Wilson, R J; Winklmeier, F; Zeng, Q; Altenburg, D; Feltresi, E; Hauke, A; Jasper, H; Spaan, B; Brandt, T; Dickopp, M; Klose, V; Lacker, H M; Nogowski, R; Otto, S; Petzold, A; Schubert, J; Schubert, K R; Schwierz, R; Sundermann, J E; Volk, A; Bernard, D; Bonneaud, G R; Grenier, P; Latour, E; Schrenk, S; Thiebaux, C; Vasileiadis, G; Verderi, M; Bard, D J; Clark, P J; Gradl, W; Muheim, F; Playfer, S; Xie, Y; Andreotti, M; Bettoni, D; Bozzi, C; Calabrese, R; Cibinetto, G; Luppi, E; Negrini, M; Piemontese, L; Anulli, F; Baldini-Ferroli, R; Calcaterra, A; De Sangro, R; Finocchiaro, G; Pacetti, S; Patteri, P; Peruzzi, I M; Piccolo, M; Zallo, A; Buzzo, A; Capra, R; Contri, R; Lo Vetere, M; Macri, M M; Monge, M R; Passaggio, S; Patrignani, C; Robutti, E; Santroni, A; Tosi, S; Brandenburg, G; Chaisanguanthum, K S; Morii, M; Wu, J; Dubitzky, R S; Marks, J; Schenk, S; Uwer, U; Bhimji, W; Bowerman, D A; Dauncey, P D; Egede, U; Flack, R L; Gaillard, J R; Nash, J A; Nikolich, M B; Panduro-Vazquez, W; Chai, X; Charles, M J; Mader, W F; Mallik, U; Ziegler, V; Cochran, J; Crawley, H B; Dong, L; Eyges, V; Meyer, W T; Prell, S; Rosenberg, E I; Rubin, A E; Schott, G; Arnaud, N; Davier, M; Grosdidier, G; Höcker, A; Le Diberder, F R; Lepeltier, V; Lutz, A M; Oyanguren, A; Petersen, T C; Pruvot, S; Rodier, S; Roudeau, P; Schune, M H; Stocchi, A; Wang, W F; Wormser, G; Cheng, C H; Lange, D J; Wright, D M; Bevan, A J; Chavez, C A; Forster, I J; Fry, J R; Gabathuler, E; Gamet, R; George, K A; Hutchcroft, D E; Payne, D J; Schofield, K C; Touramanis, C; Di Lodovico, F; Menges, W; Sacco, R; Brown, C L; Cowan, G; Flächer, H U; Green, M G; Hopkins, D A; Jackson, P S; McMahon, T R; Ricciardi, S; Salvatore, F; Davis, C L; Allison, J; Barlow, N R; Barlow, R J; Chia, Y M; Edgar, C L; Kelly, M P; Lafferty, G D; Naisbit, M T; Williams, J C; Yi, J I; Chen, C; Hulsbergen, W D; Jawahery, A; Kovalskyi, D; Lae, C K; Roberts, D A; Simi, G; Blaylock, G; Dallapiccola, C; Hertzbach, S S; Kofler, R; Li, X; Moore, T B; Saremi, S; Stängle, H; Willocq, S Y; Cowan, R; Koeneke, K; Sciolla, G; Sekula, S J; Spitznagel, M; Taylor, F; Yamamoto, R K; Kim, H; Patel, P M; Potter, C T; Robertson, S H; Lazzaro, A; Lombardo, V; Palombo, F; Bauer, J M; Cremaldi, L; Eschenburg, V; Godang, R; Kroeger, R; Reidy, J; Sanders, D A; Summers, D J; Zhao, H W; Brunet, S; Côté, D; Taras, P; Viaud, F B; Nicholson, H; Cavallo, N; De Nardo, Gallieno; Fabozzi, F; Gatto, C; Lista, L; Monorchio, D; Paolucci, P; Piccolo, D; Sciacca, C; Baak, M; Bulten, H; Raven, G; Snoek, H L; Jessop, C P; LoSecco, J M; Allmendinger, T; Benelli, G; Gan, K K; Honscheid, K; Hufnagel, D; Jackson, P D; Kagan, H; Kass, R; Pulliam, T; Rahimi, A M; Ter-Antonian, R; Wong, Q K; Blount, N L; Brau, J E; Frey, R; Igonkina, O; Lu, M; Rahmat, R; Sinev, N B; Strom, D; Strube, J; Torrence, E; Galeazzi, F; Margoni, M; Morandin, M; Pompili, A; Posocco, M; Rotondo, M; Simonetto, F; Stroili, R; Voci, C; Benayoun, M; Chauveau, J; David, P; Del Buono, L; La Vaissière, C de; Hamon, O; Hartfiel, B L; John, M J J; Leruste, P; Malcles, J; Ocariz, J; Roos, L; Therin, G; Behera, P K; Gladney, L; Panetta, J; Biasini, M; Covarelli, R; Pioppi, M; Angelini, C; Batignani, G; Bettarini, S; Bucci, F; Calderini, G; Carpinelli, M; Cenci, R; Forti, F; Giorgi, M A; Lusiani, A; Marchiori, G; Mazur, M A; Morganti, M; Neri, N; Paoloni, E; Rama, M; Rizzo, G; Walsh, J; Haire, M; Judd, D; Wagoner, D E; Biesiada, J; Danielson, N; Elmer, P; Lau, Y P; Lü, C; Olsen, J; Smith, A J S; Telnov, A V; Bellini, F; Cavoto, G; D'Orazio, A; Di Marco, E; Faccini, R; Ferrarotto, F; Ferroni, F; Gaspero, M; Li Gioi, L; Mazzoni, M A; Morganti, S; Piredda, G; Polci, F; Safai-Tehrani, F; Voena, C; Schröder, H; Waldi, R; Adye, T; De Groot, N; Franek, B; Olaiya, E O; Wilson, F F; Emery, S; Gaidot, A; Ganzhur, S F; Hamel de Monchenault, G; Kozanecki, Witold; Legendre, M; Mayer, B; Vasseur, G; Yéche, C; Zito, M; Park, W; Purohit, M V; Weidemann, A W; Wilson, J R; Allen, M T; Aston, D; Bartoldus, R; Berger, N; Boyarski, A M; Claus, R; Coleman, J P; Convery, M R; Cristinziani, M; Dingfelder, J C; Dong, D; Dorfan, J; Dujmic, D; Dunwoodie, W M; Field, R C; Glanzman, T; Gowdy, S J; Halyo, V; Hast, C; Hrynóva, T; Innes, W R; Kelsey, M H; Kim, P; Kocian, M L; Leith, D W G S; Libby, J; Luitz, S; Lüth, V; Lynch, H L; MacFarlane, D B; Marsiske, H; Messner, R; Müller, D R; O'Grady, C P; Ozcan, V E; Perazzo, A; Perl, M; Ratcliff, B N; Roodman, A; Salnikov, A A; Schindler, R H; Schwiening, J; Snyder, A; Stelzer, J; Su, D; Sullivan, M K; Suzuki, K; Swain, S K; Thompson, J M; Vavra, J; Van Bakel, N; Weaver, M; Weinstein, A J R; Wisniewski, W J; Wittgen, M; Wright, D H; Yarritu, A K; Yi, K; Young, C C; Burchat, P R; Edwards, A J; Majewski, S A; Petersen, B A; Roat, C; Wilden, L; Ahmed, S; Alam, M S; Bula, R; Ernst, J A; Jain, V; Pan, B; Saeed, M A; Wappler, F R; Zain, S B; Bugg, W; Krishnamurthy, M; Spanier, S M; Eckmann, R; Ritchie, J L; Satpathy, A; Schwitters, R F; Izen, J M; Kitayama, I; Lou, X C; Ye, S; Bianchi, F; Bóna, M; Gallo, F; Gamba, D; Bomben, M; Bosisio, L; Cartaro, C; Cossutti, F; Della Ricca, G; Dittongo, S; Grancagnolo, S; Lanceri, L; Vitale, L; Azzolini, V; Martínez-Vidal, F; Panvini, R S; Banerjee, Sw; Bhuyan, B; Brown, C M; Fortin, D; Hamano, K; Kowalewski, R V; Nugent, I M; Roney, J M; Sobie, R J; Back, J J; Harrison, P F; Latham, T E; Mohanty, G B; Band, H R; Chen, X; Cheng, B; Dasu, S; Datta, M; Eichenbaum, A M; Flood, K T; Graham, M T; Hollar, J J; Johnson, J R; Kutter, P E; Li, H; Liu, R; Mellado, B; Mihályi, A; Mohapatra, A K; Pan, Y; Pierini, M; Prepost, R; Tan, P; Wu, S L; Yu, Z; Neal, H

    2006-01-01

    We study the processes e+ e- --> 3(pi+pi-)gamma, 2(pi+pi-pi0)gamma and K+ K- 2(pi+pi-)gamma, with the photon radiated from the initial state. About 20,000, 33,000 and 4,000 fully reconstructed events, respectively, have been selected from 232 fb-1 of BaBar data. The invariant mass of the hadronic final state defines the effective e+e- center-of-mass energy, so that these data can be compared with the corresponding direct e+e- measurements. From the 3(pi+pi-), 2(pi+pi-pi0) and K+ K- 2(pi+pi-) mass spectra, the cross sections for the processes e+ e- --> 3(pi+pi-), e+ e- --> 2(pi+pi-pi0) and e+ e- --> K+ K- 2(pi+pi-) are measured for center-of-mass energies from production threshold to 4.5 GeV. The uncertainty in the cross section measurement is typically 6-15%. We observe the J/psi in all these final states and measure the corresponding branching fractions.

  5. Dalitz Analysis of the Decay $D^{0}\\to K^{-}\\pi^{+}\\pi^{0}$

    CERN Document Server

    Kopp, S E; Mahmood, A H; Csorna, S E; Danko, I; McLean, K W; Xu, Z; Godang, R; Bonvicini, G; Cinabro, D; Dubrovin, M; McGee, S; Zhou, G J; Bornheim, A; Lipeles, E; Pappas, S P; Schmidtler, M; Shapiro, A; Sun, W M; Weinstein, A J; Jaffe, D E; Masek, G; Paar, H P; Asner, D M; Eppich, A; Hill, T S; Morrison, R J; Briere, R A; Chen, G P; Ferguson, T; Vogel, H; Gritsan, A; Alexander, J P; Baker, R; Bebek, C; Berger, B E; Berkelman, K; Blanc, F; Boisvert, V; Cassel, David G; Drell, P S; Duboscq, J E; Ecklund, K M; Ehrlich, R; Foland, A D; Gaidarev, P B; Gibbons, L K; Gittelman, B; Gray, S W; Hartill, D L; Heltsley, B K; Hopman, P I; Hsu, L; Jones, C D; Kandaswamy, J; Kreinick, D L; Lohner, M; Magerkurth, A; Meyer, T O; Mistry, N B; Nordberg, E; Palmer, M; Patterson, J R; Peterson, D; Riley, D; Romano, A; Thayer, J G; Urner, D; Valant-Spaight, B L; Viehhauser, G; Warburton, A; Avery, P; Prescott, C; Rubiera, A I; Stöck, H; Yelton, J; Brandenburg, G; Ershov, A; Kim, D Y J; Wilson, R; Bergfeld, T; Eisenstein, B I; Ernst, J; Gladding, G E; Gollin, G D; Hans, R M; Johnson, E; Karliner, I; Marsh, M A; Plager, C; Sedlack, C; Selen, M; Thaler, J J; Williams, J; Edwards, K W; Janicek, R; Patel, P M; Sadoff, A J; Ammar, R; Bean, A; Besson, D; Zhao, X; Anderson, S; Frolov, V V; Kubota, Y; Lee, S J; Mahapatra, R; O'Neill, J J; Poling, R A; Riehle, T; Smith, A; Stepaniak, C J; Urheim, J; Ahmed, S; Alam, M S; Athar, S B; Jian, L; Ling, L; Saleem, M; Timm, S; Wappler, F; Anastassov, A; Eckhart, E; Gan, K K; Gwon, C; Hart, T; Honscheid, K; Hufnagel, D; Kagan, H; Kass, R; Pedlar, T K; Schwarthoff, H; Thayer, J B; Von Törne, E; Zoeller, M M; Richichi, S J; Severini, H; Skubic, P L; Undrus, A; Savinov, V; Chen, S; Fast, J; Hinson, J W; Lee, J; Miller, D H; Shibata, E I; Shipsey, I P J; Pavlunin, V; Cronin-Hennessy, D; Lyon, A L; Thorndike, E H; Coan, T E; Fadeev, V; Gao, Y S; Maravin, Y; Narsky, I; Stroynowski, R; Ye, J; Wlodek, T; Artuso, M; Ayad, R; Boulahouache, C; Bukin, K; Dambasuren, E; Majumder, G; Moneti, G C; Mountain, R; Schuh, S; Skwarnicki, T; Stone, S; Wang, J C; Wolf, A; Wu, J

    2001-01-01

    We use data collected with the CLEO II detector to perform a high-statistics measurement of the resonant substructure in $D^0 \\to K^-\\pi^+\\pi^0$ decays. We find the Dalitz Plot is well represented by a combination of seven quasi-two-body decay channels ($\\bar{K}^{*0} \\pi^0$, $K^- \\rho$, $K^{*-} \\pi^+$, $K^*_0(1430)^-\\pi^+$, $\\bar{K}^*_0(1430)^0 \\pi^0$, $K^- \\rho^+(1700)$, and $K^*(1680)^- \\pi^+$), plus a small non-resonant component. Using the amplitudes and phases from this analysis, we calculate an integrated CP asymmetry of $-0.031 \\pm 0.086$.

  6. Precision determination of the $\\pi N$ scattering lengths and the charged $\\pi NN$ coupling constant

    CERN Document Server

    Ericson, Torleif Eric Oskar; Thomas, A W

    2000-01-01

    We critically evaluate the isovector GMO sumrule for the charged $\\pi N N$ coupling constant using recent precision data from $\\pi ^-$p and $\\pi^-$d atoms and with careful attention to systematic errors. From the $\\pi ^-$d scattering length we deduce the pion-proton scattering lengths ${1/2}(a_{\\pi ^-p}+a_{\\pi ^-n})=(-20\\pm 6$(statistic)$ \\pm 10$ (systematic))~$\\cdot 10^{-4}m_{\\pi_c}^{-1}$ and ${1/2}(a_{\\pi ^-p}-a_{\\pi ^-n})=(903 \\pm 14)\\cdot 10^{-4}m_{\\pi_c}^{-1}$. From this a direct evaluation gives $g^2_c(GMO) =14.20\\pm 0.07$(statistic)$\\pm 0.13$(systematic) or $f^2_c= 0.0786\\pm 0.0008$.

  7. Dynamics of the pi(-)p-->pi(0)pi(0)n reaction for p(pi(-))<750 MeV/c.

    Science.gov (United States)

    Craig, K; Comfort, J R; Allgower, C E; Bekrenev, V; Berger, E; Briscoe, W J; Clajus, M; Draper, B; Grosnick, D; Isenhower, D; Knecht, N; Koetke, D; Koulbardis, A; Kozlenko, N; Kruglov, S; Lolos, G J; Lopatin, I; Manley, D M; Manweiler, R; Marusić, A; McDonald, S; Nefkens, B M K; Olmsted, J; Papandreou, Z; Peaslee, D; Phaisangittisakul, N; Prakhov, S; Price, J W; Pulver, M; Ramirez, A F; Sadler, M E; Shafi, A; Spinka, H; Stanislaus, S; Starostin, A; Supek, I; Staudenmaier, H M; Tippens, W B

    2003-09-05

    Data are presented for the reaction pi(-)p-->pi(0)pi(0)n in the range from threshold to p(pi(-))=750 MeV/c. The systematics of the data and multipole analyses are examined for sensitivity to a f(0)(600) ("sigma") meson. A one-pion-exchange mechanism is found to be very weak, or absent. The reaction appears to become dominated by sequential pi(0) decays through the Delta(1232) resonance as the beam momentum increases, along with substantial interference effects from several competing mechanisms.

  8. PI3K pathway in NSCLC

    Directory of Open Access Journals (Sweden)

    Alex eMartínez Martí

    2012-01-01

    Full Text Available The phosphatidylinositol 3-kinases (PI3Ks are members of a family of intracellular lipid kinases that phosphorylate the 3’-hydroxyl group of phosphatidylinositol and phosphoinositides. PI3K regulate signaling pathways for neoplasia, including cell proliferation, adhesion, survival and motility. Different classes of PI3K have distinct roles in cellular signal transduction. PI3K pathway is activated by several different mechanisms in cancers, including, somatic mutation and gene amplification. In this review, we examine the literature addressing PI3K mutation status and gene amplification, with an emphasis on non-small cell lung cancer (NSCLC.

  9. Lifetime Measurements of $ \\pi ^+ \\pi ^- $ and $\\pi^{+-} K^{-+}$ Atoms to Test Low-Energy QCD Predictions

    CERN Multimedia

    Ponta, T C; Dumitriu, D E; Afanasyev, L; Zhabitskiy, M; Rykalin, V; Hons, Z; Schacher, J; Yazkov, V; Gerndt, J; Detraz, C C; Guaraldo, C; Dreossi, D; Smolik, J; Gorchakov, O; Nikitin, M; Dudarev, A; Kluson, J; Hansroul, M; Okada, K; Constantinescu, S; Kruglov, V; Komarov, V; Takeutchi, F; Tarta, P D; Kuptsov, A; Nemenov, L; Karpukhin, V; Shliapnikov, P; Brekhovskikh, V; Saborido silva, J J; Drijard, D; Rappazzo, G F; Pentia, M C; Gugiu, M M; Kruglova, L; Pustylnik, Z; Trojek, T; Vrba, T; Iliescu, M A; Duma, M; Ciocarlan, C; Kulikov, A; Ol'shevskiy, V; Ryazantsev, A; Chiba, M; Anania, A; Tarasov, A; Gritsay, K; Lapchine, V; Cechak, T; Lopez aguera, A

    2002-01-01

    %PS212 \\\\ \\\\ The proposed experiment aims to measure the lifetime of $ \\pi ^+ \\pi ^- $ atoms in the ground state with 10\\% precision, using the 24~GeV/c proton beam of the CERN Proton Synchrotron. As the value of the above lifetime of order 10$ ^- ^{1} ^{5} $s is dictated by a strong interaction at low energy, the precise measurement of this quantity enables to determine a combination of S-wave pion scattering lengths to 5\\%. Pion scattering lengths have been calculated in the framework of chiral perturbation theory and values predicted at the same level of accuracy have, up to now, never been confronted with accurate experimental data. Such a measurement would submit the understanding of chiral symmetry breaking of QCD to a crucial test.

  10. {tau}{yields}{omega}3{pi}{nu} decays

    Energy Technology Data Exchange (ETDEWEB)

    Gao, J.; Li, B.A. [Kentucky Univ., Lexington, KY (United States). Dept. of Physics and Astronomy

    2001-11-01

    A theoretical study of the anomalous decay mode {tau}{yields}{omega}{pi}{pi}{pi}{nu} is presented. The theoretical value of the branching ratio of {tau}{sup -}{yields}{omega}{pi}{sup -}{pi}{sup 0}{pi}{sup 0}{nu} agrees well with the data. The branching ratio of {tau}{sup -}{yields}{omega}{pi}{sup +}{pi}{sup -}{pi}{sup -}{nu}{sub {tau}} is predicted. It is found that the vertices of a{sub 1}{rho}{pi} and {omega}{rho}{pi} play a dominant role in these two decay modes. CVC is satisfied, and there is no adjustable parameter. (orig.)

  11. CP content of D->h+h-pi0

    CERN Document Server

    Libby, J

    2015-01-01

    Quantum-correlated psi(3770)->DDbar decays collected by the CLEO-c experiment are used to perform measurements of F+, the fractional CP-even content of the self-conjugate decays D->pi+pi-pi0 and D->K+K-pi0. Values of 0.973+/-0.017 and 0.732+/-0.055 are obtained for pi+pi-pi0 and K+K-pi0, respectively. The high CP-even content of D->pi+pi-pi0, in particular, makes this a promising mode for improving the precision on gamma and for measurements of CP violation in D decay.

  12. The $\\pi\\pi\\to\\pi\\gamma^\\star$ amplitude and the resonant $\\rho\\to\\pi\\gamma^\\star$ transition from lattice QCD

    CERN Document Server

    Briceño, Raúl A; Edwards, Robert G; Shultz, Christian J; Thomas, Christopher E; Wilson, David J

    2016-01-01

    We present a determination of the $P$-wave $\\pi\\pi\\to\\pi\\gamma^\\star$ transition amplitude from lattice quantum chromodynamics. Matrix elements of the vector current in a finite-volume are extracted from three-point correlation functions, and from these we determine the infinite-volume amplitude using a generalization of the Lellouch-L\\"uscher formalism. We determine the amplitude for a range of discrete values of the $\\pi\\pi$ energy and virtuality of the photon, and observe the expected dynamical enhancement due to the $\\rho$ resonance. Describing the energy dependence of the amplitude, we are able to analytically continue into the complex energy plane and from the residue at the $\\rho$ pole extract the $\\rho\\to \\pi \\gamma^\\star$ transition form factor. This calculation, at $m_\\pi\\approx 400$ MeV, is the first to determine the form factor of an unstable hadron within a first principles approach to QCD.

  13. $B \\to D^{*}\\pi^{+}\\pi^{-}\\pi^{-}\\pi^{o}$, $D^{(*)}\\omega\\pi^{-}$ and the Observation of a Wide $1^{-} \\omega\\pi^{-}$ Enhancement at 1418 MeV

    CERN Document Server

    Artuso, M; Boulahouache, C; Bukin, K; Dambasuren, E; Karamov, S; Majumder, G; Moneti, G C; Mountain, R; Schuh, S; Skwarnicki, T; Stone, S; Viehhauser, G; Wang, J C; Wolf, A; Wu, J; Kopp, S E; Mahmood, A H; Csorna, S E; Danko, I; McLean, K W; Marka, S; Xu, Z; Godang, R; Kinoshita, K; Lai, I C; Schrenk, S; Bonvicini, G; Cinabro, D; McGee, S; Perera, L P; Zhou, G J; Lipeles, E; Pappas, S P; Schmidtler, M; Shapiro, A; Sun, W M; Weinstein, A J; Würthwein, F; Jaffe, D E; Masek, G E; Paar, H P; Potter, E M; Prell, S; Sharma, V; Asner, D M; Eppich, A; Hill, T S; Morrison, R J; Briere, R A; Chen, G P; Ferguson, T; Behrens, B H; Ford, W T; Gritsan, A; Roy, J D; Smith, J G; Alexander, J P; Baker, R; Bebek, C; Berger, B E; Berkelman, K; Blanc, F; Boisvert, V; Cassel, David G; Dickson, M; Drell, P S; Ecklund, K M; Ehrlich, R; Foland, A D; Gaidarev, P B; Gibbons, L K; Gittelman, B; Gray, S W; Hartill, D L; Heltsley, B K; Hopman, P I; Jones, C D; Kreinick, D L; Lohner, M; Magerkurth, A; Meyer, T O; Mistry, N B; Nordberg, E; Patterson, J R; Peterson, D; Riley, D; Thayer, J G; Urner, D; Valant-Spaight, B L; Warburton, A; Avery, P; Prescott, C; Rubiera, A I; Yelton, J; Zheng, J; Brandenburg, G; Ershov, A; Gao, Y S; Kim, D Y J; Wilson, R; Browder, T E; Li, Y; Rodríguez, J L; Yamamoto, H; Bergfeld, T; Eisenstein, B I; Ernst, J; Gladding, G E; Gollin, G D; Hans, R M; Johnson, E; Karliner, I; Marsh, M A; Palmer, M; Plager, C; Sedlack, C; Selen, M; Thaler, J J; Williams, J; Edwards, K W; Janicek, R; Patel, P M; Sadoff, A J; Ammar, R; Bean, A; Besson, D; Davis, R; Kwak, N; Zhao, X; Anderson, S; Frolov, V V; Kubota, Y; Lee, S J; Mahapatra, R; O'Neill, J J; Poling, R A; Riehle, T; Smith, A; Stepaniak, C J; Urheim, J; Ahmed, S; Alam, M S; Athar, S B; Jian, L; Ling, L; Saleem, M; Timm, S; Wappler, F; Anastassov, A; Duboscq, J E; Eckhart, E; Gan, K K; Gwon, C; Hart, T; Honscheid, K; Hufnagel, D; Kagan, H; Kass, R; Pedlar, T K; Schwarthoff, H; Thayer, J B; Von Törne, E; Zoeller, M M; Richichi, S J; Severini, H; Skubic, P L; Undrus, A; Chen, S; Fast, J; Hinson, J W; Lee, J; Miller, D H; Shibata, E I; Shipsey, I P J; Pavlunin, V; Cronin-Hennessy, D; Lyon, A L; Thorndike, E H; Jessop, C P; Marsiske, H; Perl, Martin Lewis; Savinov, V; Zhou, X; Coan, T E; Fadeev, V; Maravin, Y; Narsky, I; Stroynowski, R; Ye, J; Wlodek, T

    2001-01-01

    We report on the observation of B->D{*}pi+pi-pi-pio decays. The branching ratios for D*+ and D*o are (1.72+/-0.14+/-0.24)% and (1.80+/-0.24+/-0.25)%, respectively. Each final state has a D{*} omega pi- component, with branching ratios (0.29+/-0.03+/-0.04)% and (0.45+/-0.10+/-0.07)% for the D*+ and D*o modes, respectively. We also observe B->D omega pi- decays. The branching ratios for D+ and Do are (0.28+/-0.05+/-0.03)% and (0.41+/-0.07+/-0.04)%, respectively. The omega pi- appears to come from the decay of a wide 1- resonance. A fit to a Breit-Wigner shape gives a mass of 1418+/-26+/-19 MeV and width of 388+/-44+/-32 MeV. We identify this object as the rho(1450) or rho'.

  14. First observation and measurement of the resonant structure of the lambda_b->lambda_c pi-pi+pi- decay mode

    Energy Technology Data Exchange (ETDEWEB)

    Azzurri, P.; Barria, P.; Ciocci, M.A.; Donati, S.; Vataga, E.

    2009-12-01

    The authors present the first observation of the {Lambda}{sub b}{sup 0} {yields} {Lambda}{sub c}{sup +}{pi}{sup -}{pi}{sup +}{pi}{sup -} decay using data from an integrated luminosity of approximately 2.4 fb{sup -1} of p{bar p} collisions at {radical}s = 1.96 TeV, collected with the CDF II detector at the Fermilab Tevatron. They also present the first observation of the resonant decays {Lambda}{sub b}{sup 0} {yields} {Sigma}{sub c}(2455){sup 0} {pi}{sup +}{pi}{sup -} {yields} {Lambda}{sub c}{sup +}{pi}{sup -}{pi}{sup +}{pi}{sup -}, {Lambda}{sub b}{sup 0} {yields} {Sigma}{sub c}(2455){sup ++}{pi}{sup -}{pi}{sup -} {yields} {Lambda}{sub c}{sup +}{pi}{sup -}{pi}{sup +}{pi}{sup -}, {Lambda}{sub b}{sup 0} {yields} {Lambda}{sub c}(2595){sup +}{pi}{sup -} {yields} {Lambda}{sub c}{sup +}{pi}{sup -}{pi}{sup +}{pi}{sup -} and {Lambda}{sub b}{sup 0} {yields} {Lambda}{sub c}(2625){sup +}{pi}{sup -} {yields} {Lambda}{sub c}{sup +}{pi}{sup -}{pi}{sup +}{pi}{sup -}, and measure their relative branching ratios.

  15. Pi pi scattering lengths at O(p^6) revisited

    CERN Document Server

    Guo, Z -H

    2009-01-01

    This article completes a former work where part of the O(p^6) low-energy constants entering in the pi pi scattering were estimated. Some resonance contributions were missed in former calculations and appreciable differences appeared with respect to our outcome. Here, we provide the full results for all the contributing O(p^6) couplings. We also perform a reanalysis of the hadronic inputs used for the estimation (resonance masses, widths...). Their reliability was checked together with the impact of the input uncertainties on the determinations of the chiral couplings and the scattering lengths aIJ. Our outcome is found in agreement with former works though with slightly larger errors. However, the effect in the final values of the aIJ is negligible after combining them with the other uncertainties. Based on this consistency, we conclude that the previous scattering length determinations seem to be rather solid and reliable, with the O(p^6) LECs quite under control. Nevertheless, the uncertainties found in the...

  16. Three-body system of $\\pi \\pi \\Sigma_c$

    CERN Document Server

    Long, Bingwei

    2016-01-01

    The existence of near-threshold charmed baryon $\\Lambda_c^+(2595)$ implies the pion and the lightest, isospin-$1$ charmed baryon $\\Sigma_c$ interact very strongly at extremely low energies. Using the two-flavor version of heavy hadron chiral perturbation theory, I explore the direct consequences of this strong force by investigating whether the $\\Sigma_c$ can trap two very soft pions to form any visible hadronic states. The answer is positive. It is found without tuning any free parameters or ultraviolet cutoff that the state in question, with quantum numbers $I(J^P) = 1({\\frac{1}{2}}^+)$, presents itself as a resonance pole only a few MeVs away from the $\\pi \\pi \\Sigma_c$ threshold. Subleading corrections are estimated with power-counting arguments, and the smallness of pion momenta is found to facilitate the reliability of the analysis. Because of its proximity in mass, this excited $\\Sigma_c$ resonance is speculated to be related to the broad resonance labeled as $\\Lambda_c^+(2765)$.

  17. Measuring the FSR-inclusive $\\pi^{+}\\pi^{-}$ cross section

    CERN Document Server

    Gluza, J; Jadach, Stanislaw; Jegerlehner, F

    2003-01-01

    Final state radiation (FSR) in pion--pair production cannot be calculated reliably because of the composite structure of the pions. However, FSR corrections have to be taken into account for a precise evaluation of the hadronic contribution to g-2 of the muon. The role of FSR in both energy scan and radiative return experiments is discussed. It is shown how FSR influences the pion form factor extraction from experimental data and, as a consequence, the evaluation of a_mu^had. In fact the O(alpha) FSR corrections should be included to reach the precision we are aiming at. We argue that for an extraction of the desired FSR--inclusive cross section sigma^(gamma)_had a photon--inclusive scan measurement of the ``e+e- to pi+pi- + photons'' cross section is needed. For exclusive scan and radiative return measurements in contrast we have to rely on ad hoc FSR models if we want to obtain either sigma^(gamma)_had or the FSR--exclusive cross section sigma^(0)_had. We thus advocate to consider seriously precise photon--...

  18. Search for b--> u transitions in B- -> [K+pi-pi0]_D K-

    CERN Document Server

    Aubert, B; Bóna, M; Boutigny, D; Couderc, F; Karyotakis, Yu; Lees, J P; Poireau, V; Tisserand, V; Zghiche, A; Graugès-Pous, E; Palano, A; Chen, J C; Qi, N D; Rong, G; Wang, P; Zhu, Y S; Eigen, G; Ofte, I; Stugu, B; Abrams, G S; Battaglia, M; Brown, D N; Button-Shafer, J; Cahn, R N; Charles, E; Gill, M S; Groysman, Y; Jacobsen, R G; Kadyk, J A; Kerth, L T; Kolomensky, Yu G; Kukartsev, G; Lynch, G; Mir, L M; Orimoto, T J; Pripstein, M; Roe, N A; Ronan, M T; Wenzel, W A; Del Amo-Sánchez, P; Barrett, M; Ford, K E; Hart, A J; Harrison, T J; Hawkes, C M; Morgan, S E; Watson, A T; Held, T; Koch, H; Lewandowski, B; Pelizaeus, M; Peters, K; Schröder, T; Steinke, M; Boyd, J T; Burke, J P; Cottingham, W N; Walker, D; Asgeirsson, D J; Çuhadar-Dönszelmann, T; Fulsom, B G; Hearty, C; Knecht, N S; Mattison, T S; McKenna, J A; Khan, A; Kyberd, P; Saleem, M; Sherwood, D J; Teodorescu, L; Blinov, V E; Bukin, A D; Druzhinin, V P; Golubev, V B; Onuchin, A P; Serednyakov, S I; Skovpen, Yu I; Solodov, E P; Todyshev, Yu K; Best, D S; Bondioli, M; Bruinsma, M; Chao, M; Curry, S; Eschrich, I; Kirkby, D; Lankford, A J; Lund, P; Mandelkern, M A; Mommsen, R K; Röthel, W; Stoker, D P; Abachi, S; Buchanan, C; Gary, J W; Long, O; Shen, B C; Wang, K; Zhang, L; Hadavand, H K; Hill, E J; Paar, H P; Rahatlou, S; Sharma, V; Berryhill, J W; Campagnari, C; Cunha, A; Dahmes, B; Hong, T M; Kovalskyi, D; Richman, J D; Beck, T W; Eisner, A M; Flacco, C J; Heusch, C A; Kroseberg, J; Lockman, W S; Nesom, G; Schalk, T; Schumm, B A; Seiden, A; Spradlin, P; Williams, D C; Wilson, M G; Albert, J; Chen, E; Dvoretskii, A; Fang, F; Hitlin, D G; Narsky, I; Piatenko, T; Porter, F C; Ryd, A; Samuel, A; Mancinelli, G; Meadows, B T; Mishra, K; Sokoloff, M D; Blanc, F; Bloom, P C; Chen, S; Ford, W T; Hirschauer, J F; Kreisel, A; Nagel, M; Nauenberg, U; Olivas, A; Ruddick, W O; Smith, J G; Ulmer, K A; Wagner, S R; Zhang, J; Chen, A; Eckhart, E A; Soffer, A; Toki, W H; Wilson, R J; Winklmeier, F; Zeng, Q; Altenburg, D D; Feltresi, E; Hauke, A; Jasper, H; Merkel, J; Petzold, A; Spaan, B; Brandt, T; Klose, V; Lacker, H M; Mader, W F; Nogowski, R; Schubert, J; Schubert, K R; Schwierz, R; Sundermann, J E; Volk, A; Bernard, D; Bonneaud, G R; Latour, E; Thiebaux, C; Verderi, M; Clark, P J; Gradl, W; Muheim, F; Playfer, S; Robertson, A I; Xie, Y; Andreotti, M; Bettoni, D; Bozzi, C; Calabrese, R; Cibinetto, G; Luppi, E; Negrini, M; Petrella, A; Piemontese, L; Prencipe, E; Anulli, F; Baldini-Ferroli, R; Calcaterra, A; De Sangro, R; Finocchiaro, G; Pacetti, S; Patteri, P; Peruzzi, I M; Piccolo, M; Rama, M; Zallo, A; Buzzo, A; Capra, R; Contri, R; Lo Vetere, M; Macri, M M; Monge, M R; Passaggio, S; Patrignani, C; Robutti, E; Santroni, A; Tosi, S; Brandenburg, G; Chaisanguanthum, K S; Morii, M; Wu, J; Dubitzky, R S; Marks, J; Schenk, S; Uwer, U; Bard, D J; Bhimji, W; Bowerman, D A; Dauncey, P D; Egede, U; Flack, R L; Nash, J A; Nikolich, M B; Panduro-Vazquez, W; Behera, P K; Chai, X; Charles, M J; Mallik, U; Meyer, N T; Ziegler, V; Cochran, J; Crawley, H B; Dong, L; Eyges, V; Meyer, W T; Prell, S; Rosenberg, E I; Rubin, A E; Gritsan, A V; Denig, A G; Fritsch, M; Schott, G; Arnaud, N; Davier, M; Grosdidier, G; Höcker, A; Le Diberder, F R; Lepeltier, V; Lutz, A M; Oyanguren, A; Pruvot, S; Rodier, S; Roudeau, P; Schune, M H; Stocchi, A; Wang, W F; Wormser, G; Cheng, C H; Lange, D J; Wright, D M; Chavez, C A; Forster, I J; Fry, J R; Gabathuler, E; Gamet, R; George, K A; Hutchcroft, D E; Payne, D J; Schofield, K C; Touramanis, C; Bevan, A J; Di Lodovico, F; Menges, W; Sacco, R; Cowan, G; Flächer, H U; Hopkins, D A; Jackson, P S; McMahon, T R; Ricciardi, S; Salvatore, F; Wren, A C; Davis, C L; Allison, J; Barlow, N R; Barlow, R J; Chia, Y M; Edgar, C L; Lafferty, G D; Naisbit, M T; Williams, J C; Yi, J I; Chen, C; Hulsbergen, W D; Jawahery, A; Lae, C K; Roberts, D A; Simi, G; Blaylock, G; Dallapiccola, C; Hertzbach, S S; Li, X; Moore, T B; Saremi, S; Stängle, H; Cowan, R; Sciolla, G; Sekula, S J; Spitznagel, M; Taylor, F; Yamamoto, R K; Kim, H; Mclachlin, S E; Patel, P M; Robertson, S H; Lazzaro, A; Lombardo, V; Palombo, F; Bauer, J M; Cremaldi, L; Eschenburg, V; Godang, R; Kroeger, R; Sanders, D A; Summers, D J; Zhao, H W; Brunet, S; Côté, D; Simard, M; Taras, P; Viaud, F B; Nicholson, H; Cavallo, N; De Nardo, Gallieno; Fabozzi, F; Gatto, C; Lista, L; Monorchio, D; Paolucci, P; Piccolo, D; Sciacca, C; Baak, M A; Raven, G; Snoek, H L; Jessop, C P; LoSecco, J M; Allmendinger, T; Benelli, G; Corwin, L A; Gan, K K; Honscheid, K; Hufnagel, D; Jackson, P D; Kagan, H; Kass, R; Rahimi, A M; Regensburger, J J; Ter-Antonian, R; Wong, Q K; Blount, N L; Brau, J E; Frey, R; Igonkina, O; Kolb, J A; Lu, M; Rahmat, R; Sinev, N B; Strom, D; Strube, J; Torrence, E; Gaz, A; Margoni, M; Morandin, M; Pompili, A; Posocco, M; Rotondo, M; Simonetto, F; Stroili, R; Voci, C; Benayoun, M; Briand, H; Chauveau, J; David, P; Del Buono, L; La Vaissière, C de; Hamon, O; Hartfiel, B L; John, M J J; Leruste, P; Malcles, J; Ocariz, J; Roos, L; Therin, G; Gladney, L; Panetta, J; Biasini, M; Covarelli, R; Angelini, C; Batignani, G; Bettarini, S; Bucci, F; Calderini, G; Carpinelli, M; Cenci, R; Forti, F; Giorgi, M A; Lusiani, A; Marchiori, G; Mazur, M A; Morganti, M; Neri, N; Paoloni, E; Rizzo, G; Walsh, J J; Haire, M; Judd, D; Wagoner, D E; Biesiada, J; Danielson, N; Elmer, P; Lau, Y P; Lü, C; Olsen, J; Smith, A J S; Telnov, A V; Bellini, F; Cavoto, G; D'Orazio, A; Del Re, D; Di Marco, E; Faccini, R; Ferrarotto, F; Ferroni, F; Gaspero, M; Li Gioi, L; Mazzoni, M A; Morganti, S; Piredda, G; Polci, F; Safai-Tehrani, F; Voena, C; Ebert, M; Schröder, H; Waldi, R; Adye, T; De Groot, N; Franek, B; Olaiya, E O; Wilson, F F; Aleksan, R; Emery, S; Gaidot, A; Ganzhur, S F; Hamel de Monchenault, G; Kozanecki, Witold; Legendre, M; Vasseur, G; Yéche, C; Zito, M; Chen, X R; Liu, H; Park, W; Purohit, M V; Wilson, J R; Allen, M T; Aston, D; Bartoldus, R; Bechtle, P; Berger, N; Claus, R; Coleman, J P; Convery, M R; Cristinziani, M; Dingfelder, J C; Dorfan, J; Dubois-Felsmann, G P; Dujmic, D; Dunwoodie, W M; Field, R C; Glanzman, T; Gowdy, S J; Graham, M T; Grenier, P; Halyo, V; Hast, C; Hrynóva, T; Innes, W R; Kelsey, M H; Kim, P; Leith, D W G S; Li, S; Luitz, S; Lüth, V; Lynch, H L; MacFarlane, D B; Marsiske, H; Messner, R; Müller, D R; O'Grady, C P; Ozcan, V E; Perazzo, A; Perl, M; Pulliam, T; Ratcliff, B N; Roodman, A; Salnikov, A A; Schindler, R H; Schwiening, J; Snyder, A; Stelzer, J; Su, D; Sullivan, M K; Suzuki, K; Swain, S K; Thompson, J M; Vavra, J; Van, N; Weaver, M; Weinstein, A J R; Wisniewski, W J; Wittgen, M; Wright, D H; Yarritu, A K; Yi, K; Young, C C; Burchat, P R; Edwards, A J; Majewski, S A; Petersen, B A; Roat, C; Wilden, L; Ahmed, S; Alam, M S; Bula, R; Ernst, J A; Jain, V; Pan, B; Saeed, M A; Wappler, F R; Zain, S B; Bugg, W; Krishnamurthy, M; Spanier, S M; Eckmann, R; Ritchie, J L; Satpathy, A; Schilling, C J; Schwitters, R F; Izen, J M; Lou, X C; Ye, S; Bianchi, F; Gallo, F; Gamba, D; Bomben, M; Bosisio, L; Cartaro, C; Cossutti, F; Della Ricca, G; Dittongo, S; Lanceri, L; Vitale, L; Azzolini, V; Lopez-March, N; Martínez-Vidal, F; Banerjee, Sw; Bhuyan, B; Brown, C M; Fortin, D; Hamano, K; Kowalewski, R V; Nugent, I M; Roney, J M; Sobie, R J; Back, J J; Harrison, P F; Latham, T E; Mohanty, G B; Pappagallo, M; Band, H R; Chen, X; Cheng, B; Dasu, S; Datta, M; Flood, K T; Hollar, J J; Kutter, P E; Mellado, B; Mihályi, A; Pan, Y; Pierini, M; Prepost, R; Wu, S L; Yu, Z; Neal, H

    2006-01-01

    We search for decays of a B meson into a neutral D meson and a kaon, with the D meson decaying into K+pi-pi0. This final state can be reached through the b --> c transition B- -> D0K- followed by the doubly Cabibbo-suppressed D0 --> K+pi-pi0, or the b --> u transition B- --> D0bar K- followed by the Cabibbo-favored D0bar --> K+ pi-pi0. The interference of these two amplitudes is sensitive to the angle gamma of the unitarity triangle. We present preliminary results based on 226 10^{6} e+e- --> Y(4s) --> BBbar events collected with the BABAR detector at SLAC. We find no significant evidence for these decays and we set a limit R_ADS =(BR(B- -->[K+pi-pi0]_D K-)+ BR(B- --> [K-pi+pi0]_D K+))/(BR(B- -->[K-pi+pi0]_D K-)+ BR(B- --> [K+pi-pi0]_D K+)) D0bar K-)|/|A(B- --> D0bar K-)| < 0.185 at 95% confidence level.

  19. Amplitude analysis of the $\\chi_{c1} \\to \\eta\\pi^+\\pi^-$ decays

    CERN Document Server

    Kornicer, Mihajlo

    2016-01-01

    Using $448.0 \\times 10^6$~$\\psi(3686)$ events collected with the BESIII detector, an amplitude analysis is performed for $\\psi(3686)\\to\\gamma\\chi_{c1}$, $\\chi_{c1}\\to\\eta\\pi^+\\pi^-$ decays. The most dominant two-body structure observed is $a_0(980)^{\\pm}\\pi^{\\mp}$; $a_0(980)^{\\pm}\\to\\eta\\pi^{\\pm}$. The $a_0(980)$ line shape is modeled using a dispersion relation, and a significant non-zero $a_0(980)$ coupling to the $\\eta^{\\prime}\\pi$ channel is measured. We observe $\\chi_{c1}\\to a_2(1700)\\pi$ production for the first time, with a significance larger than 17$\\sigma$. The production of mesons with exotic quantum numbers, $J^{PC}=1^{-+}$, is investigated, and upper limits for the branching fractions $\\chi_{c1}\\to \\pi_1(1400)^{\\pm}\\pi^{\\mp}$, $\\chi_{c1}\\to \\pi_1(1600)^{\\pm}\\pi^{\\mp}$, and $\\chi_{c1}\\to\\pi_1(2015)^{\\pm}\\pi^{\\mp}$, with subsequent $\\pi_1(X)^{\\pm} \\to \\eta\\pi^{\\pm}$ decay, are determined.

  20. QCD at $\\Theta \\sim \\pi$

    CERN Document Server

    Smilga, A V

    1999-01-01

    Taking into account the quadratic in quark mass terms in the effective chiral lagrangian, we show that, at \\theta \\sim \\pi, the theory with 2 light quarks of equal mass involves two degenerate vacuum states separated by a barrier. For three flavors, the energy barrier between two vacua appears already in the leading order in mass. This corresponds to the first order phase transition at different vacua is calculated. In the immediate vicinity of the phase transition point, two minima of the potential still exist, but one of them becomes metastable. The probability of the false vacuum decay is estimated.

  1. Search for the suppressed decays $B^{+}\\rightarrow K^{+}K^{+}\\pi^{-}$ and $B^{+}\\rightarrow \\pi^{+}\\pi^{+}K^{-}$

    CERN Document Server

    Aaij, Roel; Adinolfi, Marco; Ajaltouni, Ziad; Akar, Simon; Albrecht, Johannes; Alessio, Federico; Alexander, Michael; Ali, Suvayu; Alkhazov, Georgy; Alvarez Cartelle, Paula; Alves Jr, Antonio Augusto; Amato, Sandra; Amerio, Silvia; Amhis, Yasmine; An, Liupan; Anderlini, Lucio; Andreassi, Guido; Andreotti, Mirco; Andrews, Jason; Appleby, Robert; Aquines Gutierrez, Osvaldo; Archilli, Flavio; d'Argent, Philippe; Arnau Romeu, Joan; Artamonov, Alexander; Artuso, Marina; Aslanides, Elie; Auriemma, Giulio; Baalouch, Marouen; Babuschkin, Igor; Bachmann, Sebastian; Back, John; Badalov, Alexey; Baesso, Clarissa; Baldini, Wander; Barlow, Roger; Barschel, Colin; Barsuk, Sergey; Barter, William; Batozskaya, Varvara; Batsukh, Baasansuren; Battista, Vincenzo; Bay, Aurelio; Beaucourt, Leo; Beddow, John; Bedeschi, Franco; Bediaga, Ignacio; Bel, Lennaert; Bellee, Violaine; Belloli, Nicoletta; Belous, Konstantin; Belyaev, Ivan; Ben-Haim, Eli; Bencivenni, Giovanni; Benson, Sean; Benton, Jack; Berezhnoy, Alexander; Bernet, Roland; Bertolin, Alessandro; Betti, Federico; Bettler, Marc-Olivier; van Beuzekom, Martinus; Bezshyiko, Iaroslava; Bifani, Simone; Billoir, Pierre; Bird, Thomas; Birnkraut, Alex; Bitadze, Alexander; Bizzeti, Andrea; Blake, Thomas; Blanc, Frederic; Blouw, Johan; Blusk, Steven; Bocci, Valerio; Boettcher, Thomas; Bondar, Alexander; Bondar, Nikolay; Bonivento, Walter; Borgheresi, Alessio; Borghi, Silvia; Borisyak, Maxim; Borsato, Martino; Bossu, Francesco; Boubdir, Meriem; Bowcock, Themistocles; Bowen, Espen Eie; Bozzi, Concezio; Braun, Svende; Britsch, Markward; Britton, Thomas; Brodzicka, Jolanta; Buchanan, Emma; Burr, Christopher; Bursche, Albert; Buytaert, Jan; Cadeddu, Sandro; Calabrese, Roberto; Calvi, Marta; Calvo Gomez, Miriam; Camboni, Alessandro; Campana, Pierluigi; Campora Perez, Daniel; Campora Perez, Daniel Hugo; Capriotti, Lorenzo; Carbone, Angelo; Carboni, Giovanni; Cardinale, Roberta; Cardini, Alessandro; Carniti, Paolo; Carson, Laurence; Carvalho Akiba, Kazuyoshi; Casse, Gianluigi; Cassina, Lorenzo; Castillo Garcia, Lucia; Cattaneo, Marco; Cauet, Christophe; Cavallero, Giovanni; Cenci, Riccardo; Charles, Matthew; Charpentier, Philippe; Chatzikonstantinidis, Georgios; Chefdeville, Maximilien; Chen, Shanzhen; Cheung, Shu-Faye; Chobanova, Veronika; Chrzaszcz, Marcin; Cid Vidal, Xabier; Ciezarek, Gregory; Clarke, Peter; Clemencic, Marco; Cliff, Harry; Closier, Joel; Coco, Victor; Cogan, Julien; Cogneras, Eric; Cogoni, Violetta; Cojocariu, Lucian; Collazuol, Gianmaria; Collins, Paula; Comerma-Montells, Albert; Contu, Andrea; Cook, Andrew; Coquereau, Samuel; Corti, Gloria; Corvo, Marco; Costa Sobral, Cayo Mar; Couturier, Benjamin; Cowan, Greig; Craik, Daniel Charles; Crocombe, Andrew; Cruz Torres, Melissa Maria; Cunliffe, Samuel; Currie, Robert; D'Ambrosio, Carmelo; Dall'Occo, Elena; Dalseno, Jeremy; David, Pieter; Davis, Adam; De Aguiar Francisco, Oscar; De Bruyn, Kristof; De Capua, Stefano; De Cian, Michel; De Miranda, Jussara; De Paula, Leandro; De Serio, Marilisa; De Simone, Patrizia; Dean, Cameron Thomas; Decamp, Daniel; Deckenhoff, Mirko; Del Buono, Luigi; Demmer, Moritz; Derkach, Denis; Deschamps, Olivier; Dettori, Francesco; Dey, Biplab; Di Canto, Angelo; Dijkstra, Hans; Dordei, Francesca; Dorigo, Mirco; Dosil Su{á}rez, Alvaro; Dovbnya, Anatoliy; Dreimanis, Karlis; Dufour, Laurent; Dujany, Giulio; Dungs, Kevin; Durante, Paolo; Dzhelyadin, Rustem; Dziurda, Agnieszka; Dzyuba, Alexey; D{é}l{é}age, Nicolas; Easo, Sajan; Ebert, Marcus; Egede, Ulrik; Egorychev, Victor; Eidelman, Semen; Eisenhardt, Stephan; Eitschberger, Ulrich; Ekelhof, Robert; Eklund, Lars; Elsasser, Christian; Ely, Scott; Esen, Sevda; Evans, Hannah Mary; Evans, Timothy; Falabella, Antonio; Farley, Nathanael; Farry, Stephen; Fay, Robert; Fazzini, Davide; Ferguson, Dianne; Fernandez Albor, Victor; Fernandez Prieto, Antonio; Ferrari, Fabio; Ferreira Rodrigues, Fernando; Ferro-Luzzi, Massimiliano; Filippov, Sergey; Fini, Rosa Anna; Fiore, Marco; Fiorini, Massimiliano; Firlej, Miroslaw; Fitzpatrick, Conor; Fiutowski, Tomasz; Fleuret, Frederic; Fohl, Klaus; Fontana, Marianna; Fontanelli, Flavio; Forshaw, Dean Charles; Forty, Roger; Franco Lima, Vinicius; Frank, Markus; Frei, Christoph; Fu, Jinlin; Furfaro, Emiliano; F{ä}rber, Christian; Gallas Torreira, Abraham; Galli, Domenico; Gallorini, Stefano; Gambetta, Silvia; Gandelman, Miriam; Gandini, Paolo; Gao, Yuanning; Garcia Martin, Luis Miguel; Garc{í}a Pardi{ñ}as, Juli{á}n; Garra Tico, Jordi; Garrido, Lluis; Garsed, Philip John; Gascon, David; Gaspar, Clara; Gavardi, Laura; Gazzoni, Giulio; Gerick, David; Gersabeck, Evelina; Gersabeck, Marco; Gershon, Timothy; Ghez, Philippe; Gian{ì}, Sebastiana; Gibson, Valerie; Girard, Olivier G{ö}ran; Giubega, Lavinia-Helena; Gizdov, Konstantin; Gligorov, V.V.; Golubkov, Dmitry; Golutvin, Andrey; Gomes, Alvaro; Gorelov, Igor Vladimirovich; Gotti, Claudio; Grabalosa G{á}ndara, Marc; Graciani Diaz, Ricardo; Granado Cardoso, Luis Alberto; Graugés, Eugeni; Graverini, Elena; Graziani, Giacomo; Grecu, Alexandru; Griffith, Peter; Grillo, Lucia; Gruberg Cazon, Barak Raimond; Gr{ü}nberg, Oliver; Gushchin, Evgeny; Guz, Yury; Gys, Thierry; G{ö}bel, Carla; Hadavizadeh, Thomas; Hadjivasiliou, Christos; Haefeli, Guido; Haen, Christophe; Haines, Susan; Hall, Samuel; Hamilton, Brian; Han, Xiaoxue; Hansmann-Menzemer, Stephanie; Harnew, Neville; Harnew, Samuel; Harrison, Jonathan; Hatch, Mark; He, Jibo; Head, Timothy; Heister, Arno; Hennessy, Karol; Henrard, Pierre; Henry, Louis; Hernando Morata, Jose Angel; van Herwijnen, Eric; Heß, Miriam; Hicheur, Adl{è}ne; Hill, Donal; Hombach, Christoph; Hulsbergen, Wouter; Humair, Thibaud; Hushchyn, Mikhail; Hussain, Nazim; Hutchcroft, David; Idzik, Marek; Ilten, Philip; Jacobsson, Richard; Jaeger, Andreas; Jalocha, Pawel; Jans, Eddy; Jawahery, Abolhassan; John, Malcolm; Johnson, Daniel; Jones, Christopher; Joram, Christian; Jost, Beat; Jurik, Nathan; Kandybei, Sergii; Kanso, Walaa; Karacson, Matthias; Kariuki, James Mwangi; Karodia, Sarah; Kecke, Matthieu; Kelsey, Matthew; Kenyon, Ian; Kenzie, Matthew; Ketel, Tjeerd; Khairullin, Egor; Khanji, Basem; Khurewathanakul, Chitsanu; Kirn, Thomas; Klaver, Suzanne; Klimaszewski, Konrad; Koliiev, Serhii; Kolpin, Michael; Komarov, Ilya; Koopman, Rose; Koppenburg, Patrick; Kozachuk, Anastasiia; Kozeiha, Mohamad; Kravchuk, Leonid; Kreplin, Katharina; Kreps, Michal; Krokovny, Pavel; Kruse, Florian; Krzemien, Wojciech; Kucewicz, Wojciech; Kucharczyk, Marcin; Kudryavtsev, Vasily; Kuonen, Axel Kevin; Kurek, Krzysztof; Kvaratskheliya, Tengiz; Lacarrere, Daniel; Lafferty, George; Lai, Adriano; Lambert, Dean; Lanfranchi, Gaia; Langenbruch, Christoph; Langhans, Benedikt; Latham, Thomas; Lazzeroni, Cristina; Le Gac, Renaud; van Leerdam, Jeroen; Lees, Jean-Pierre; Leflat, Alexander; Lefran{ç}ois, Jacques; Lef{è}vre, Regis; Lemaitre, Florian; Lemos Cid, Edgar; Leroy, Olivier; Lesiak, Tadeusz; Leverington, Blake; Li, Yiming; Likhomanenko, Tatiana; Lindner, Rolf; Linn, Christian; Lionetto, Federica; Liu, Bo; Liu, Xuesong; Loh, David; Longstaff, Iain; Lopes, Jose; Lucchesi, Donatella; Lucio Martinez, Miriam; Luo, Haofei; Lupato, Anna; Luppi, Eleonora; Lupton, Oliver; Lusiani, Alberto; Lyu, Xiao-Rui; Machefert, Frederic; Maciuc, Florin; Maev, Oleg; Maguire, Kevin; Malde, Sneha; Malinin, Alexander; Maltsev, Timofei; Manca, Giulia; Mancinelli, Giampiero; Manning, Peter Michael; Maratas, Jan; Marchand, Jean Fran{ç}ois; Marconi, Umberto; Marin Benito, Carla; Marino, Pietro; Marks, J{ö}rg; Martellotti, Giuseppe; Martin, Morgan; Martinelli, Maurizio; Martinez Santos, Diego; Martinez Vidal, Fernando; Martins Tostes, Danielle; Massacrier, Laure Marie; Massafferri, Andr{é}; Matev, Rosen; Mathad, Abhijit; Mathe, Zoltan; Matteuzzi, Clara; Mauri, Andrea; Maurin, Brice; Mazurov, Alexander; McCann, Michael; McCarthy, James; McNab, Andrew; McNulty, Ronan; Meadows, Brian; Meier, Frank; Meissner, Marco; Melnychuk, Dmytro; Merk, Marcel; Merli, Andrea; Michielin, Emanuele; Milanes, Diego Alejandro; Minard, Marie-Noelle; Mitzel, Dominik Stefan; Mogini, Andrea; Molina Rodriguez, Josue; Monroy, Ignacio Alberto; Monteil, Stephane; Morandin, Mauro; Morawski, Piotr; Mord{à}, Alessandro; Morello, Michael Joseph; Moron, Jakub; Morris, Adam Benjamin; Mountain, Raymond; Muheim, Franz; Mulder, Mick; Mussini, Manuel; M{ü}ller, Dominik; M{ü}ller, Janine; M{ü}ller, Katharina; M{ü}ller, Vanessa; Naik, Paras; Nakada, Tatsuya; Nandakumar, Raja; Nandi, Anita; Nasteva, Irina; Needham, Matthew; Neri, Nicola; Neubert, Sebastian; Neufeld, Niko; Neuner, Max; Nguyen, Anh Duc; Nguyen-Mau, Chung; Nieswand, Simon; Niet, Ramon; Nikitin, Nikolay; Nikodem, Thomas; Novoselov, Alexey; O'Hanlon, Daniel Patrick; Oblakowska-Mucha, Agnieszka; Obraztsov, Vladimir; Ogilvy, Stephen; Oldeman, Rudolf; Onderwater, Gerco; Otalora Goicochea, Juan Martin; Otto, Adam; Owen, Patrick; Oyanguren, Maria Aranzazu; Pais, Preema Rennee; Palano, Antimo; Palombo, Fernando; Palutan, Matteo; Panman, Jacob; Papanestis, Antonios; Pappagallo, Marco; Pappalardo, Luciano; Pappenheimer, Cheryl; Parker, William; Parkes, Christopher; Passaleva, Giovanni; Pastore, Alessandra; Patel, Girish; Patel, Mitesh; Patrignani, Claudia; Pearce, Alex; Pellegrino, Antonio; Penso, Gianni; Pepe Altarelli, Monica; Perazzini, Stefano; Perret, Pascal; Pescatore, Luca; Petridis, Konstantinos; Petrolini, Alessandro; Petrov, Aleksandr; Petruzzo, Marco; Picatoste Olloqui, Eduardo; Pietrzyk, Boleslaw; Pikies, Malgorzata; Pinci, Davide; Pistone, Alessandro; Piucci, Alessio; Playfer, Stephen; Plo Casasus, Maximo; Poikela, Tuomas; Polci, Francesco; Poluektov, Anton; Polyakov, Ivan; Polycarpo, Erica; Pomery, Gabriela Johanna; Popov, Alexander; Popov, Dmitry; Popovici, Bogdan; Potterat, C{é}dric; Price, Eugenia; Price, Joseph David; Prisciandaro, Jessica; Pritchard, Adrian; Prouve, Claire; Pugatch, Valery; Puig Navarro, Albert; Punzi, Giovanni; Qian, Wenbin; Quagliani, Renato; Rachwal, Bartolomiej; Rademacker, Jonas; Rama, Matteo; Ramos Pernas, Miguel; Rangel, Murilo; Raniuk, Iurii; Raven, Gerhard; Redi, Federico; Reichert, Stefanie; dos Reis, Alberto; Remon Alepuz, Clara; Renaudin, Victor; Ricciardi, Stefania; Richards, Sophie; Rihl, Mariana; Rinnert, Kurt; Rives Molina, Vicente; Robbe, Patrick; Rodrigues, Ana Barbara; Rodrigues, Eduardo; Rodriguez Lopez, Jairo Alexis; Rodriguez Perez, Pablo; Rogozhnikov, Alexey; Roiser, Stefan; Romanovskiy, Vladimir; Romero Vidal, Antonio; Ronayne, John William; Rotondo, Marcello; Rudolph, Matthew Scott; Ruf, Thomas; Ruiz Valls, Pablo; Saborido Silva, Juan Jose; Sadykhov, Elnur; Sagidova, Naylya; Saitta, Biagio; Salustino Guimaraes, Valdir; Sanchez Mayordomo, Carlos; Sanmartin Sedes, Brais; Santacesaria, Roberta; Santamarina Rios, Cibran; Santimaria, Marco; Santovetti, Emanuele; Sarti, Alessio; Satriano, Celestina; Satta, Alessia; Saunders, Daniel Martin; Savrina, Darya; Schael, Stefan; Schellenberg, Margarete; Schiller, Manuel; Schindler, Heinrich; Schlupp, Maximilian; Schmelling, Michael; Schmelzer, Timon; Schmidt, Burkhard; Schneider, Olivier; Schopper, Andreas; Schubert, Konstantin; Schubiger, Maxime; Schune, Marie Helene; Schwemmer, Rainer; Sciascia, Barbara; Sciubba, Adalberto; Semennikov, Alexander; Sergi, Antonino; Serra, Nicola; Serrano, Justine; Sestini, Lorenzo; Seyfert, Paul; Shapkin, Mikhail; Shapoval, Illya; Shcheglov, Yury; Shears, Tara; Shekhtman, Lev; Shevchenko, Vladimir; Shires, Alexander; Siddi, Benedetto Gianluca; Silva Coutinho, Rafael; Silva de Oliveira, Luiz Gustavo; Simi, Gabriele; Simone, Saverio; Sirendi, Marek; Skidmore, Nicola; Skwarnicki, Tomasz; Smith, Eluned; Smith, Iwan Thomas; Smith, Jackson; Smith, Mark; Snoek, Hella; Sokoloff, Michael; Soler, Paul; Souza, Daniel; Souza De Paula, Bruno; Spaan, Bernhard; Spradlin, Patrick; Sridharan, Srikanth; Stagni, Federico; Stahl, Marian; Stahl, Sascha; Stefko, Pavol; Stefkova, Slavorima; Steinkamp, Olaf; Stemmle, Simon; Stenyakin, Oleg; Stevenson, Scott; Stoica, Sabin; Stone, Sheldon; Storaci, Barbara; Stracka, Simone; Straticiuc, Mihai; Straumann, Ulrich; Sun, Liang; Sutcliffe, William; Swientek, Krzysztof; Syropoulos, Vasileios; Szczekowski, Marek; Szumlak, Tomasz; T'Jampens, Stephane; Tayduganov, Andrey; Tekampe, Tobias; Tellarini, Giulia; Teubert, Frederic; Thomas, Christopher; Thomas, Eric; van Tilburg, Jeroen; Tisserand, Vincent; Tobin, Mark; Tolk, Siim; Tomassetti, Luca; Tonelli, Diego; Topp-Joergensen, Stig; Toriello, Francis; Tournefier, Edwige; Tourneur, Stephane; Trabelsi, Karim; Traill, Murdo; Tran, Minh T{â}m; Tresch, Marco; Trisovic, Ana; Tsaregorodtsev, Andrei; Tsopelas, Panagiotis; Tully, Alison; Tuning, Niels; Ukleja, Artur; Ustyuzhanin, Andrey; Uwer, Ulrich; Vacca, Claudia; Vagnoni, Vincenzo; Valat, Sebastien; Valenti, Giovanni; Vallier, Alexis; Vazquez Gomez, Ricardo; Vazquez Regueiro, Pablo; Vecchi, Stefania; van Veghel, Maarten; Velthuis, Jaap; Veltri, Michele; Veneziano, Giovanni; Venkateswaran, Aravindhan; Vernet, Maxime; Vesterinen, Mika; Viaud, Benoit; Vieira, Daniel; Vieites Diaz, Maria; Vilasis-Cardona, Xavier; Volkov, Vladimir; Vollhardt, Achim; Voneki, Balazs; Voong, David; Vorobyev, Alexey; Vorobyev, Vitaly; Voß, Christian; de Vries, Jacco; V{á}zquez Sierra, Carlos; Waldi, Roland; Wallace, Charlotte; Wallace, Ronan; Walsh, John; Wang, Jianchun; Ward, David; Wark, Heather Mckenzie; Watson, Nigel; Websdale, David; Weiden, Andreas; Whitehead, Mark; Wicht, Jean; Wilkinson, Guy; Wilkinson, Michael; Williams, Mark Richard James; Williams, Matthew; Williams, Mike; Williams, Timothy; Wilson, Fergus; Wimberley, Jack; Wishahi, Julian; Wislicki, Wojciech; Witek, Mariusz; Wormser, Guy; Wotton, Stephen; Wraight, Kenneth; Wright, Simon; Wyllie, Kenneth; Xie, Yuehong; Xing, Zhou; Xu, Zhirui; Yang, Zhenwei; Yin, Hang; Yu, Jiesheng; Yuan, Xuhao; Yushchenko, Oleg; Zangoli, Maria; Zarebski, Kristian Alexander; Zavertyaev, Mikhail; Zhang, Liming; Zhang, Yanxi; Zhang, Yu; Zhelezov, Alexey; Zheng, Yangheng; Zhokhov, Anatoly; Zhu, Xianglei; Zhukov, Valery; Zucchelli, Stefano

    2017-01-01

    A search is made for the highly-suppressed B meson decays $B^{+}\\rightarrow K^{+}K^{+}\\pi^{-}$ and $B^{+}\\rightarrow \\pi^{+}\\pi^{+}K^{-}$ using a data sample corresponding to an integrated luminosity of 3.0 $fb^{-1}$ collected by the LHCb experiment in proton-proton collisions at centre-of-mass energies of 7 and 8 TeV. No evidence is found for the decays, and upper limits at 90\\% confidence level are determined to be $\\mathcal{B}(B^{+}\\rightarrow K^{+}K^{+}\\pi^{-}) < 1.1\\times 10^{-8}$ and $\\mathcal{B}(B^{+}\\rightarrow \\pi^{+}\\pi^{+}K^{-}) < 4.6\\times 10^{-8}$.

  2. A study of $CP$ violation in $B^\\mp \\rightarrow Dh^\\mp$ ($h=K,\\pi$) with the modes $D \\rightarrow K^\\mp \\pi^\\pm \\pi^0$, $D \\rightarrow \\pi^+\\pi^-\\pi^0$ and $D \\rightarrow K^+K^-\\pi^0$

    CERN Document Server

    Aaij, Roel; Adinolfi, Marco; Affolder, Anthony; Ajaltouni, Ziad; Akar, Simon; Albrecht, Johannes; Alessio, Federico; Alexander, Michael; Ali, Suvayu; Alkhazov, Georgy; Alvarez Cartelle, Paula; Alves Jr, Antonio Augusto; Amato, Sandra; Amerio, Silvia; Amhis, Yasmine; An, Liupan; Anderlini, Lucio; Anderson, Jonathan; Andreotti, Mirco; Andrews, Jason; Appleby, Robert; Aquines Gutierrez, Osvaldo; Archilli, Flavio; d'Argent, Philippe; Artamonov, Alexander; Artuso, Marina; Aslanides, Elie; Auriemma, Giulio; Baalouch, Marouen; Bachmann, Sebastian; Back, John; Badalov, Alexey; Baesso, Clarissa; Baldini, Wander; Barlow, Roger; Barschel, Colin; Barsuk, Sergey; Barter, William; Batozskaya, Varvara; Battista, Vincenzo; Bay, Aurelio; Beaucourt, Leo; Beddow, John; Bedeschi, Franco; Bediaga, Ignacio; Bel, Lennaert; Belyaev, Ivan; Ben-Haim, Eli; Bencivenni, Giovanni; Benson, Sean; Benton, Jack; Berezhnoy, Alexander; Bernet, Roland; Bertolin, Alessandro; Bettler, Marc-Olivier; van Beuzekom, Martinus; Bien, Alexander; Bifani, Simone; Bird, Thomas; Birnkraut, Alex; Bizzeti, Andrea; Blake, Thomas; Blanc, Frédéric; Blouw, Johan; Blusk, Steven; Bocci, Valerio; Bondar, Alexander; Bondar, Nikolay; Bonivento, Walter; Borghi, Silvia; Borsato, Martino; Bowcock, Themistocles; Bowen, Espen Eie; Bozzi, Concezio; Braun, Svende; Brett, David; Britsch, Markward; Britton, Thomas; Brodzicka, Jolanta; Brook, Nicholas; Bursche, Albert; Buytaert, Jan; Cadeddu, Sandro; Calabrese, Roberto; Calvi, Marta; Calvo Gomez, Miriam; Campana, Pierluigi; Campora Perez, Daniel; Capriotti, Lorenzo; Carbone, Angelo; Carboni, Giovanni; Cardinale, Roberta; Cardini, Alessandro; Carniti, Paolo; Carson, Laurence; Carvalho Akiba, Kazuyoshi; Casanova Mohr, Raimon; Casse, Gianluigi; Cassina, Lorenzo; Castillo Garcia, Lucia; Cattaneo, Marco; Cauet, Christophe; Cavallero, Giovanni; Cenci, Riccardo; Charles, Matthew; Charpentier, Philippe; Chefdeville, Maximilien; Chen, Shanzhen; Cheung, Shu-Faye; Chiapolini, Nicola; Chrzaszcz, Marcin; Cid Vidal, Xabier; Ciezarek, Gregory; Clarke, Peter; Clemencic, Marco; Cliff, Harry; Closier, Joel; Coco, Victor; Cogan, Julien; Cogneras, Eric; Cogoni, Violetta; Cojocariu, Lucian; Collazuol, Gianmaria; Collins, Paula; Comerma-Montells, Albert; Contu, Andrea; Cook, Andrew; Coombes, Matthew; Coquereau, Samuel; Corti, Gloria; Corvo, Marco; Couturier, Benjamin; Cowan, Greig; Craik, Daniel Charles; Crocombe, Andrew; Cruz Torres, Melissa Maria; Cunliffe, Samuel; Currie, Robert; D'Ambrosio, Carmelo; Dalseno, Jeremy; David, Pieter; Davis, Adam; De Bruyn, Kristof; De Capua, Stefano; De Cian, Michel; De Miranda, Jussara; De Paula, Leandro; De Silva, Weeraddana; De Simone, Patrizia; Dean, Cameron Thomas; Decamp, Daniel; Deckenhoff, Mirko; Del Buono, Luigi; Déléage, Nicolas; Derkach, Denis; Deschamps, Olivier; Dettori, Francesco; Dey, Biplab; Di Canto, Angelo; Di Ruscio, Francesco; Dijkstra, Hans; Donleavy, Stephanie; Dordei, Francesca; Dorigo, Mirco; Dosil Suárez, Alvaro; Dossett, David; Dovbnya, Anatoliy; Dreimanis, Karlis; Dufour, Laurent; Dujany, Giulio; Dupertuis, Frederic; Durante, Paolo; Dzhelyadin, Rustem; Dziurda, Agnieszka; Dzyuba, Alexey; Easo, Sajan; Egede, Ulrik; Egorychev, Victor; Eidelman, Semen; Eisenhardt, Stephan; Eitschberger, Ulrich; Ekelhof, Robert; Eklund, Lars; El Rifai, Ibrahim; Elsasser, Christian; Ely, Scott; Esen, Sevda; Evans, Hannah Mary; Evans, Timothy; Falabella, Antonio; Färber, Christian; Farinelli, Chiara; Farley, Nathanael; Farry, Stephen; Fay, Robert; Ferguson, Dianne; Fernandez Albor, Victor; Ferrari, Fabio; Ferreira Rodrigues, Fernando; Ferro-Luzzi, Massimiliano; Filippov, Sergey; Fiore, Marco; Fiorini, Massimiliano; Firlej, Miroslaw; Fitzpatrick, Conor; Fiutowski, Tomasz; Fol, Philip; Fontana, Marianna; Fontanelli, Flavio; Forty, Roger; Francisco, Oscar; Frank, Markus; Frei, Christoph; Frosini, Maddalena; Fu, Jinlin; Furfaro, Emiliano; Gallas Torreira, Abraham; Galli, Domenico; Gallorini, Stefano; Gambetta, Silvia; Gandelman, Miriam; Gandini, Paolo; Gao, Yuanning; García Pardiñas, Julián; Garofoli, Justin; Garra Tico, Jordi; Garrido, Lluis; Gascon, David; Gaspar, Clara; Gastaldi, Ugo; Gauld, Rhorry; Gavardi, Laura; Gazzoni, Giulio; Geraci, Angelo; Gerick, David; Gersabeck, Evelina; Gersabeck, Marco; Gershon, Timothy; Ghez, Philippe; Gianelle, Alessio; Gianì, Sebastiana; Gibson, Valerie; Giubega, Lavinia-Helena; Gligorov, Vladimir; Göbel, Carla; Golubkov, Dmitry; Golutvin, Andrey; Gomes, Alvaro; Gotti, Claudio; Grabalosa Gándara, Marc; Graciani Diaz, Ricardo; Granado Cardoso, Luis Alberto; Graugés, Eugeni; Graverini, Elena; Graziani, Giacomo; Grecu, Alexandru; Greening, Edward; Gregson, Sam; Griffith, Peter; Grillo, Lucia; Grünberg, Oliver; Gui, Bin; Gushchin, Evgeny; Guz, Yury; Gys, Thierry; Hadjivasiliou, Christos; Haefeli, Guido; Haen, Christophe; Haines, Susan; Hall, Samuel; Hamilton, Brian; Hampson, Thomas; Han, Xiaoxue; Hansmann-Menzemer, Stephanie; Harnew, Neville; Harnew, Samuel; Harrison, Jonathan; He, Jibo; Head, Timothy; Heijne, Veerle; Hennessy, Karol; Henrard, Pierre; Henry, Louis; Hernando Morata, Jose Angel; van Herwijnen, Eric; Heß, Miriam; Hicheur, Adlène; Hill, Donal; Hoballah, Mostafa; Hombach, Christoph; Hulsbergen, Wouter; Humair, Thibaud; Hussain, Nazim; Hutchcroft, David; Hynds, Daniel; Idzik, Marek; Ilten, Philip; Jacobsson, Richard; Jaeger, Andreas; Jalocha, Pawel; Jans, Eddy; Jawahery, Abolhassan; Jing, Fanfan; John, Malcolm; Johnson, Daniel; Jones, Christopher; Joram, Christian; Jost, Beat; Jurik, Nathan; Kandybei, Sergii; Kanso, Walaa; Karacson, Matthias; Karbach, Moritz; Karodia, Sarah; Kelsey, Matthew; Kenyon, Ian; Kenzie, Matthew; Ketel, Tjeerd; Khanji, Basem; Khurewathanakul, Chitsanu; Klaver, Suzanne; Klimaszewski, Konrad; Kochebina, Olga; Kolpin, Michael; Komarov, Ilya; Koopman, Rose; Koppenburg, Patrick; Korolev, Mikhail; Kravchuk, Leonid; Kreplin, Katharina; Kreps, Michal; Krocker, Georg; Krokovny, Pavel; Kruse, Florian; Kucewicz, Wojciech; Kucharczyk, Marcin; Kudryavtsev, Vasily; Kurek, Krzysztof; Kvaratskheliya, Tengiz; La Thi, Viet Nga; Lacarrere, Daniel; Lafferty, George; Lai, Adriano; Lambert, Dean; Lambert, Robert W; Lanfranchi, Gaia; Langenbruch, Christoph; Langhans, Benedikt; Latham, Thomas; Lazzeroni, Cristina; Le Gac, Renaud; van Leerdam, Jeroen; Lees, Jean-Pierre; Lefèvre, Regis; Leflat, Alexander; Lefrançois, Jacques; Leroy, Olivier; Lesiak, Tadeusz; Leverington, Blake; Li, Yiming; Likhomanenko, Tatiana; Liles, Myfanwy; Lindner, Rolf; Linn, Christian; Lionetto, Federica; Liu, Bo; Lohn, Stefan; Longstaff, Iain; Lopes, Jose; Lowdon, Peter; Lucchesi, Donatella; Luo, Haofei; Lupato, Anna; Luppi, Eleonora; Lupton, Oliver; Machefert, Frederic; Maciuc, Florin; Maev, Oleg; Maguire, Kevin; Malde, Sneha; Malinin, Alexander; Manca, Giulia; Mancinelli, Giampiero; Manning, Peter Michael; Mapelli, Alessandro; Maratas, Jan; Marchand, Jean François; Marconi, Umberto; Marin Benito, Carla; Marino, Pietro; Märki, Raphael; Marks, Jörg; Martellotti, Giuseppe; Martinelli, Maurizio; Martinez Santos, Diego; Martinez Vidal, Fernando; Martins Tostes, Danielle; Massafferri, André; Matev, Rosen; Mathad, Abhijit; Mathe, Zoltan; Matteuzzi, Clara; Mauri, Andrea; Maurin, Brice; Mazurov, Alexander; McCann, Michael; McCarthy, James; McNab, Andrew; McNulty, Ronan; Meadows, Brian; Meier, Frank; Meissner, Marco; Merk, Marcel; Milanes, Diego Alejandro; Minard, Marie-Noelle; Mitzel, Dominik Stefan; Molina Rodriguez, Josue; Monteil, Stephane; Morandin, Mauro; Morawski, Piotr; Mordà, Alessandro; Morello, Michael Joseph; Moron, Jakub; Morris, Adam Benjamin; Mountain, Raymond; Muheim, Franz; Müller, Janine; Müller, Katharina; Müller, Vanessa; Mussini, Manuel; Muster, Bastien; Naik, Paras; Nakada, Tatsuya; Nandakumar, Raja; Nasteva, Irina; Needham, Matthew; Neri, Nicola; Neubert, Sebastian; Neufeld, Niko; Neuner, Max; Nguyen, Anh Duc; Nguyen, Thi-Dung; Nguyen-Mau, Chung; Niess, Valentin; Niet, Ramon; Nikitin, Nikolay; Nikodem, Thomas; Ninci, Daniele; Novoselov, Alexey; O'Hanlon, Daniel Patrick; Oblakowska-Mucha, Agnieszka; Obraztsov, Vladimir; Ogilvy, Stephen; Okhrimenko, Oleksandr; Oldeman, Rudolf; Onderwater, Gerco; Osorio Rodrigues, Bruno; Otalora Goicochea, Juan Martin; Otto, Adam; Owen, Patrick; Oyanguren, Maria Aranzazu; Palano, Antimo; Palombo, Fernando; Palutan, Matteo; Panman, Jacob; Papanestis, Antonios; Pappagallo, Marco; Pappalardo, Luciano; Parkes, Christopher; Passaleva, Giovanni; Patel, Girish; Patel, Mitesh; Patrignani, Claudia; Pearce, Alex; Pellegrino, Antonio; Penso, Gianni; Pepe Altarelli, Monica; Perazzini, Stefano; Perret, Pascal; Pescatore, Luca; Petridis, Konstantinos; Petrolini, Alessandro; Petruzzo, Marco; Picatoste Olloqui, Eduardo; Pietrzyk, Boleslaw; Pilař, Tomas; Pinci, Davide; Pistone, Alessandro; Playfer, Stephen; Plo Casasus, Maximo; Poikela, Tuomas; Polci, Francesco; Poluektov, Anton; Polyakov, Ivan; Polycarpo, Erica; Popov, Alexander; Popov, Dmitry; Popovici, Bogdan; Potterat, Cédric; Price, Eugenia; Price, Joseph David; Prisciandaro, Jessica; Pritchard, Adrian; Prouve, Claire; Pugatch, Valery; Puig Navarro, Albert; Punzi, Giovanni; Qian, Wenbin; Quagliani, Renato; Rachwal, Bartolomiej; Rademacker, Jonas; Rakotomiaramanana, Barinjaka; Rama, Matteo; Rangel, Murilo; Raniuk, Iurii; Rauschmayr, Nathalie; Raven, Gerhard; Redi, Federico; Reichert, Stefanie; Reid, Matthew; dos Reis, Alberto; Ricciardi, Stefania; Richards, Sophie; Rihl, Mariana; Rinnert, Kurt; Rives Molina, Vincente; Robbe, Patrick; Rodrigues, Ana Barbara; Rodrigues, Eduardo; Rodriguez Lopez, Jairo Alexis; Rodriguez Perez, Pablo; Roiser, Stefan; Romanovsky, Vladimir; Romero Vidal, Antonio; Rotondo, Marcello; Rouvinet, Julien; Ruf, Thomas; Ruiz, Hugo; Ruiz Valls, Pablo; Saborido Silva, Juan Jose; Sagidova, Naylya; Sail, Paul; Saitta, Biagio; Salustino Guimaraes, Valdir; Sanchez Mayordomo, Carlos; Sanmartin Sedes, Brais; Santacesaria, Roberta; Santamarina Rios, Cibran; Santimaria, Marco; Santovetti, Emanuele; Sarti, Alessio; Satriano, Celestina; Satta, Alessia; Saunders, Daniel Martin; Savrina, Darya; Schiller, Manuel; Schindler, Heinrich; Schlupp, Maximilian; Schmelling, Michael; Schmelzer, Timon; Schmidt, Burkhard; Schneider, Olivier; Schopper, Andreas; Schune, Marie Helene; Schwemmer, Rainer; Sciascia, Barbara; Sciubba, Adalberto; Semennikov, Alexander; Sepp, Indrek; Serra, Nicola; Serrano, Justine; Sestini, Lorenzo; Seyfert, Paul; Shapkin, Mikhail; Shapoval, Illya; Shcheglov, Yury; Shears, Tara; Shekhtman, Lev; Shevchenko, Vladimir; Shires, Alexander; Silva Coutinho, Rafael; Simi, Gabriele; Sirendi, Marek; Skidmore, Nicola; Skillicorn, Ian; Skwarnicki, Tomasz; Smith, Edmund; Smith, Eluned; Smith, Jackson; Smith, Mark; Snoek, Hella; Sokoloff, Michael; Soler, Paul; Soomro, Fatima; Souza, Daniel; Souza De Paula, Bruno; Spaan, Bernhard; Spradlin, Patrick; Sridharan, Srikanth; Stagni, Federico; Stahl, Marian; Stahl, Sascha; Steinkamp, Olaf; Stenyakin, Oleg; Sterpka, Christopher Francis; Stevenson, Scott; Stoica, Sabin; Stone, Sheldon; Storaci, Barbara; Stracka, Simone; Straticiuc, Mihai; Straumann, Ulrich; Stroili, Roberto; Sun, Liang; Sutcliffe, William; Swientek, Krzysztof; Swientek, Stefan; Syropoulos, Vasileios; Szczekowski, Marek; Szczypka, Paul; Szumlak, Tomasz; T'Jampens, Stephane; Tekampe, Tobias; Teklishyn, Maksym; Tellarini, Giulia; Teubert, Frederic; Thomas, Christopher; Thomas, Eric; van Tilburg, Jeroen; Tisserand, Vincent; Tobin, Mark; Todd, Jacob; Tolk, Siim; Tomassetti, Luca; Tonelli, Diego; Topp-Joergensen, Stig; Torr, Nicholas; Tournefier, Edwige; Tourneur, Stephane; Trabelsi, Karim; Tran, Minh Tâm; Tresch, Marco; Trisovic, Ana; Tsaregorodtsev, Andrei; Tsopelas, Panagiotis; Tuning, Niels; Ukleja, Artur; Ustyuzhanin, Andrey; Uwer, Ulrich; Vacca, Claudia; Vagnoni, Vincenzo; Valenti, Giovanni; Vallier, Alexis; Vazquez Gomez, Ricardo; Vazquez Regueiro, Pablo; Vázquez Sierra, Carlos; Vecchi, Stefania; Velthuis, Jaap; Veltri, Michele; Veneziano, Giovanni; Vesterinen, Mika; Viaud, Benoit; Vieira, Daniel; Vieites Diaz, Maria; Vilasis-Cardona, Xavier; Vollhardt, Achim; Volyanskyy, Dmytro; Voong, David; Vorobyev, Alexey; Vorobyev, Vitaly; Voß, Christian; de Vries, Jacco; Waldi, Roland; Wallace, Charlotte; Wallace, Ronan; Walsh, John; Wandernoth, Sebastian; Wang, Jianchun; Ward, David; Watson, Nigel; Websdale, David; Weiden, Andreas; Whitehead, Mark; Wiedner, Dirk; Wilkinson, Guy; Wilkinson, Michael; Williams, Mark Richard James; Williams, Matthew; Williams, Mike; Wilson, Fergus; Wimberley, Jack; Wishahi, Julian; Wislicki, Wojciech; Witek, Mariusz; Wormser, Guy; Wotton, Stephen; Wright, Simon; Wyllie, Kenneth; Xie, Yuehong; Xu, Zhirui; Yang, Zhenwei; Yuan, Xuhao; Yushchenko, Oleg; Zangoli, Maria; Zavertyaev, Mikhail; Zhang, Liming; Zhang, Yanxi; Zhelezov, Alexey; Zhokhov, Anatoly; Zhong, Liang

    2015-01-01

    An analysis of the decays of $B^\\mp \\rightarrow D K^\\mp$ and $B^\\mp \\rightarrow D \\pi^\\mp $ is presented in which the $D$ meson is reconstructed in the three-body final states $K^\\mp \\pi^\\pm \\pi^0$, $\\pi^+ \\pi^- \\pi^0$ and $K^+ K^- \\pi^0$. Using data from LHCb corresponding to an integrated luminosity of 3.0~fb$^{-1}$ of $pp$ collisions, measurements of several $CP$ observables are performed. First observations are obtained of the suppressed ADS decay $B^\\mp \\rightarrow [\\pi^\\mp K^\\pm \\pi^0]_D \\pi^\\mp$ and the quasi-GLW decay $B^\\mp \\rightarrow [K^+ K^- \\pi^0]_D \\pi^\\mp$. The results are interpreted in the context of the unitarity triangle angle $\\gamma$ and related parameters.

  3. New ISR Cross Section Results on KS KL pi0 and KS KL pi0 pi0 From BABAR

    CERN Document Server

    ,

    2016-01-01

    We present preliminary measurements of the cross sections for e+e- --> KS KL pi0 and KS KL pi0 pi0 obtained using the technique of Initial State Radiation with 469 fb^-1 of e+e- collision data collected with the BABAR detector at or near the Upsilon(4S) resonance. The resonant substructure of KS KL pi0 is investigated, and branching fractions for the decays of the charmonium resonances J/psi and psi(2S) into these final states are measured.

  4. $CP$ violation for $B^+_{c}\\rightarrow D_{(s)}^+\\pi^+\\pi^-$ in Perturbative QCD

    CERN Document Server

    Lü, Gang; Wang, Yu-Ting

    2016-01-01

    In the perturbative QCD (PQCD) approach we study the direct $CP$ violation in $B^+_{c}\\rightarrow D_{(s)}^+\\rho^0(\\omega) \\rightarrow D_{(s)}^+\\pi^+\\pi^-$ via the $\\rho-\\omega$ mixing mechanism. We find that the $CP$ violation can be enhanced by $\\rho-\\omega$ mixing when the invariant masses of the $\\pi^+\\pi^-$ pairs are in the vicinity of the $\\omega$ resonance. For the decay process $B^+_{c}\\rightarrow D^+\\rho^0(\\omega) \\rightarrow D^+\\pi^+\\pi^-$, the maximum $CP$ violation can reach 7.5 {\\%}.

  5. On the pi pi continuum in the nucleon form factors and the proton radius puzzle

    CERN Document Server

    Hoferichter, M; de Elvira, J Ruiz; Hammer, H -W; Meißner, U -G

    2016-01-01

    We present an improved determination of the $\\pi\\pi$ continuum contribution to the isovector spectral functions of the nucleon electromagnetic form factors. Our analysis includes the most up-to-date results for the $\\pi\\pi\\to\\bar N N$ partial waves extracted from Roy-Steiner equations, consistent input for the pion vector form factor, and a thorough discussion of isospin-violating effects and uncertainty estimates. As an application, we consider the $\\pi\\pi$ contribution to the isovector electric and magnetic radii by means of sum rules, which, in combination with the accurately known neutron electric radius, are found to slightly prefer a small proton charge radius.

  6. New dispersion relations in the description of $\\pi\\pi$ scattering amplitudes

    CERN Document Server

    Kaminski, R; Grynkiewicz, P; Peláez, J R; Ynduráin, F J

    2009-01-01

    We present a set of once subtracted dispersion relations which implement crossing symmetry conditions for the $\\pi\\pi$ scattering amplitudes below 1 GeV. We compare and discuss the results obtained for the once and twice subtracted dispersion relations, known as Roy's equations, for three $\\pi\\pi$ partial JI waves, S0, P and S2. We also show that once subtracted dispersion relations provide a stringent test of crossing and analyticity for $\\pi\\pi$ partial wave amplitudes, remarkably precise in the 400 to 1.1 GeV region, where the resulting uncertainties are significantly smaller than those coming from standard Roy's equations, given the same input.

  7. LHCb: Evidence of CP violation in charmless three-body decays $B^\\pm\\rightarrow K^\\pm\\pi^+\\pi^-$, $B^\\pm\\rightarrow K^\\pm K^+K^-$, $B^\\pm\\rightarrow K^+ K^-\\pi^\\pm$ and $B^\\pm\\rightarrow \\pi^\\pm\\pi^+\\pi^-$

    CERN Multimedia

    Lopes, J H

    2013-01-01

    Evidence of CP violation in charmless three-body decays $B^\\pm\\rightarrow K^\\pm\\pi^+\\pi^-$, $B^\\pm\\rightarrow K^\\pm K^+K^-$, $B^\\pm\\rightarrow K^+ K^-\\pi^\\pm$ and $B^\\pm\\rightarrow \\pi^\\pm\\pi^+\\pi^-$

  8. Search for b--> u transitions in B- -> [K+pi-pi0]_D K-

    CERN Document Server

    Bóna, M; Karyotakis, Yu; Lees, J P; Poireau, V; Prudent, X; Tisserand, V; Zghiche, A; Garra Tico, J; Graugès-Pous, E; López, L; Palano, A; Eigen, G; Stugu, B; Sun, L; Abrams, G S; Battaglia, M; Brown, D N; Button-Shafer, J; Cahn, R N; Groysman, Y; Jacobsen, R G; Kadyk, J A; Kerth, L T; Kolomensky, Yu G; Kukartsev, G; Lopes-Pegna, D; Lynch, G; Mir, L M; Orimoto, T J; Ronan, M T; Tackmann, K; Wenzel, W A; Del Amo-Sánchez, P; Hawkes, C M; Watson, A T; Held, T; Koch, H; Lewandowski, B; Pelizaeus, M; Schröder, T; Steinke, M; Walker, D; Asgeirsson, D J; Çuhadar-Dönszelmann, T; Fulsom, B G; Hearty, C; Mattison, T S; McKenna, J A; Khan, A; Saleem, M; Teodorescu, L; Blinov, V E; Bukin, A D; Druzhinin, V P; Golubev, V B; Onuchin, A P; Serednyakov, S I; Skovpen, Yu I; Solodov, E P; Todyshev, K Yu; Bondioli, M; Curry, S; Eschrich, I; Kirkby, D; Lankford, A J; Lund, P; Mandelkern, M; Martin, E C; Stoker, D P; Abachi, S; Buchanan, C; Foulkes, S D; Gary, J W; Liu, F; Long, O; Shen, B C; Zhang, L; Paar, H P; Rahatlou, S; Sharma, V; Berryhill, J W; Campagnari, C; Cunha, A; Dahmes, B; Hong, T M; Kovalskyi, D; Richman, J D; Beck, T W; Eisner, A M; Flacco, C J; Heusch, C A; Kroseberg, J; Lockman, W S; Schalk, T; Schumm, B A; Seiden, A; Wilson, M G; Winstrom, L O; Chen, E; Cheng, C H; Fang, F; Hitlin, D G; Narsky, I; Piatenko, T; Porter, F C; Andreassen, R; Mancinelli, G; Meadows, B T; Mishra, K; Sokoloff, M D; Blanc, F; Bloom, P C; Chen, S; Ford, W T; Hirschauer, J F; Kreisel, A; Nagel, M; Nauenberg, U; Olivas, A; Smith, J G; Ulmer, K A; Wagner, S R; Zhang, J; Gabareen, A M; Soffer, A; Toki, W H; Wilson, R J; Winklmeier, F; Altenburg, D D; Feltresi, E; Hauke, A; Jasper, H; Merkel, J; Petzold, A; Spaan, B; Wacker, K; Klose, V; Kobel, M J; Lacker, H M; Mader, W F; Nogowski, R; Schubert, J; Schubert, K R; Schwierz, R; Sundermann, J E; Volk, A; Bernard, D; Bonneaud, G R; Latour, E; Lombardo, V; Thiebaux, C; Verderi, M; Clark, P J; Gradl, W; Muheim, F; Playfer, S; Robertson, A I; Xie, Y; Andreotti, M; Bettoni, D; Bozzi, C; Calabrese, R; Cecchi, A; Cibinetto, G; Franchini, P; Luppi, E; Negrini, M; Petrella, A; Piemontese, L; Prencipe, E; Santoro, V; Anulli, F; Baldini-Ferroli, R; Calcaterra, A; De Sangro, R; Finocchiaro, G; Pacetti, S; Patteri, P; Peruzzi, I M; Piccolo, M; Rama, M; Zallo, A; Buzzo, A; Contri, R; Lo Vetere, M; Macri, M M; Monge, M R; Passaggio, S; Patrignani, C; Robutti, E; Santroni, A; Tosi, S; Chaisanguanthum, K S; Morii, M; Wu, J; Dubitzky, R S; Marks, J; Schenk, S; Uwer, U; Bard, D J; Dauncey, P D; Flack, R L; Nash, J A; Panduro-Vazquez, W; Tibbetts, M; Behera, P K; Chai, X; Charles, M J; Mallik, U; Ziegler, V; Cochran, J; Crawley, H B; Dong, L; Eyges, V; Meyer, W T; Prell, S; Rosenberg, E I; Rubin, A E; Gao, Y Y; Gritsan, A V; Guo, Z J; Lae, C K; Denig, A G; Fritsch, M; Schott, G; Arnaud, N; Bequilleux, J; Davier, M; Grosdidier, G; Höcker, A; Lepeltier, V; Le Diberder, F; Lutz, A M; Pruvot, S; Rodier, S; Roudeau, P; Schune, M H; Serrano, J; Sordini, V; Stocchi, A; Wang, W F; Wormser, G; Lange, D J; Wright, D M; Bingham, I; Chavez, C A; Forster, I J; Fry, J R; Gabathuler, E; Gamet, R; Hutchcroft, D E; Payne, D J; Schofield, K C; Touramanis, C; Bevan, A J; George, K A; Di Lodovico, F; Menges, W; Sacco, R; Cowan, G; Flächer, H U; Hopkins, D A; Paramesvaran, S; Salvatore, F; Wren, A C; Brown, D N; Davis, C L; Allison, J; Barlow, N R; Barlow, R J; Chia, Y M; Edgar, C L; Lafferty, G D; West, T J; Yi, J I; Anderson, J; Chen, C; Jawahery, A; Roberts, D A; Simi, G; Tuggle, J M; Blaylock, G; Dallapiccola, C; Hertzbach, S S; Li, X; Moore, T B; Salvati, E; Saremi, S; Cowan, R; Dujmic, D; Fisher, P H; Koeneke, K; Sciolla, G; Sekula, S J; Spitznagel, M; Taylor, F; Yamamoto, R K; Zhao, M; Zheng, Y; Mclachlin, S E; Patel, P M; Robertson, S H; Lazzaro, A; Palombo, F; Bauer, J M; Cremaldi, L; Eschenburg, V; Godang, R; Kroeger, R; Sanders, D A; Summers, D J; Zhao, H W; Brunet, S; Côté, D; Simard, M; Taras, P; Viaud, F B; Nicholson, H; De Nardo, Gallieno; Fabozzi, F; Lista, L; Monorchio, D; Sciacca, C; Baak, M A; Raven, G; Snoek, H L; Jessop, C P; LoSecco, J M; Benelli, G; Corwin, L A; Honscheid, K; Kagan, H; Kass, R; Morris, J P; Rahimi, A M; Regensburger, J J; Wong, Q K; Blount, N L; Brau, J E; Frey, R; Igonkina, O; Kolb, J A; Lu, M; Rahmat, R; Sinev, N B; Strom, D; Strube, J; Torrence, E; Gagliardi, N; Gaz, A; Margoni, M; Morandin, M; Pompili, A; Posocco, M; Rotondo, M; Simonetto, F; Stroili, R; Voci, C; Ben-Haim, E; Briand, H; Calderini, G; Chauveau, J; David, P; Del Buono, L; De La Vaissière, C; Hamon, O; Leruste, P; Malcles, J; Ocariz, J; Pérez, A; Gladney, L; Biasini, M; Covarelli, R; Manoni, E; Angelini, C; Batignani, G; Bettarini, S; Carpinelli, M; Cenci, R; Cervelli, A; Forti, F; Giorgi, M A; Lusiani, A; Marchiori, G; Mazur, M A; Morganti, M; Neri, N; Paoloni, E; Rizzo, G; Walsh, J J; Haire, M; Biesiada, J; Elmer, P; Lau, Y P; Lü, C; Olsen, J; Smith, A J S; Telnov, A V; Baracchini, E; Bellini, F; Cavoto, G; D'Orazio, A; Del Re, D; Di Marco, E; Faccini, R; Ferrarotto, F; Ferroni, F; Gaspero, M; Jackson, P D; Li Gioi, L; Mazzoni, M A; Morganti, S; Piredda, G; Polci, F; Renga, F; Voena, C; Ebert, M; Hartmann, T; Schröder, H; Waldi, R; Adye, T; Castelli, G; Franek, B; Olaiya, E O; Ricciardi, S; Röthel, W; Wilson, F F; Aleksan, R; Emery, S; Escalier, M; Gaidot, A; Ganzhur, S F; Hamel de Monchenault, G; Kozanecki, W; Vasseur, G; Yéche, C; Zito, M; Chen, X R; Liu, H; Park, W; Purohit, M V; Wilson, J R; Allen, M T; Aston, D; Bartoldus, R; Bechtle, P; Berger, N; Claus, R; Coleman, J P; Convery, M R; Dingfelder, J C; Dorfan, J; Dubois-Felsmann, G P; Dunwoodie, W; Field, R C; Glanzman, T; Gowdy, S J; Graham, M T; Grenier, P; Hast, C; Hrynóva, T; Innes, W R; Kaminski, J; Kelsey, M H; Kim, H; Kim, P; Kocian, M L; Leith, D W G S; Li, S; Luitz, S; Lüth, V; Lynch, H L; MacFarlane, D B; Marsiske, H; Messner, R; Müller, D R; O'Grady, C P; Ofte, I; Perazzo, A; Perl, M; Pulliam, T; Ratcliff, B N; Roodman, A; Salnikov, A A; Schindler, R H; Schwiening, J; Snyder, A; Stelzer, J; Su, D; Sullivan, M K; Suzuki, K; Swain, S K; Thompson, J M; Vavra, J; Van Bakel, N; Wagner, A P; Weaver, M; Wisniewski, W J; Wittgen, M; Wright, D H; Yarritu, A K; Yi, K; Young, C C; Burchat, P R; Edwards, A J; Majewski, S A; Petersen, B A; Wilden, L; Ahmed, S; Alam, M S; Bula, R; Ernst, J A; Jain, V; Pan, B; Saeed, M A; Wappler, F R; Zain, S B; Bugg, W; Krishnamurthy, M; Spanier, S M; Eckmann, R; Ritchie, J L; Ruland, A M; Schilling, C J; Schwitters, R F; Izen, J M; Lou, X C; Ye, S; Bianchi, F; Gallo, F; Gamba, D; Pelliccioni, M; Bomben, M; Bosisio, L; Cartaro, C; Cossutti, F; Della Ricca, G; Lanceri, L; Vitale, L; Azzolini, V; Lopez-March, N; Martínez-Vidal, F; Milanes, D A; Oyanguren, A; Albert, J; Banerjee, Sw; Bhuyan, B; Hamano, K; Kowalewski, R; Nugent, I M; Roney, J M; Sobie, R J; Harrison, P F; Ilic, J; Latham, T E; Mohanty, G B; Pappagallo, M; Band, H R; Chen, X; Dasu, S; Flood, K T; Hollar, J J; Kutter, P E; Pan, Y; Pierini, M; Prepost, R; Wu, S L; Neal, H

    2007-01-01

    We search for decays of a B meson into a neutral D meson and a kaon, with the D meson decaying into K+pi-pi0. This final state can be reached through the b --> c transition B- -> D0K- followed by the doubly Cabibbo-suppressed D0 --> K+pi-pi0, or the b --> u transition B- --> D0bar K- followed by the Cabibbo-favored D0bar --> K+ pi-pi 0. The interference of these two amplitudes is sensitive to the angle gamma of the unitarity triangle. We present preliminary results based on 226 10^{6} e+e- --> Y(4s) --> BBbar events collected with the BABAR detector at SLAC. We find no significant evidence for these decays and we set a limit R_ADS =(BR(B- -->[K+pi-pi0]_D K-)+ BR(B+ --> [K-pi+pi0]_D K+))/(BR(B- -->[K-p i+pi0]_D K-)+ BR(B+ --> [K+pi-pi0]_D K+)) D0bar K-)|/|A(B- --> D0bar K-)| < 0.185 at 95% confidence level.

  9. Main: 1PI2 [RPSD[Archive

    Lifescience Database Archive (English)

    Full Text Available 1PI2 大豆 Soybean Glycine max (L.) Merrill Bowman-Birk Type Proteinase Inhibitor D-Ii...0 1992 EMBL; M20733; AAA33954.1; -.|PIR; S07941; S07941.|PDB; 1PI2; X-ray; @=18-81.|InterPro; IPR000877; Pro...gth: 83 AA, Molecular weight: 9468 Da MCILSFLKSDQSSSYDDDEYSKPCCDLCMCTRSMPPQCSCEDIRLNSCHSDCKSCMCTRSQPGQCRCLDTNDFCYKPCKSRDD soybean_1PI2.jpg ...

  10. Introduction to computer arhitecture with Raspberry Pi

    OpenAIRE

    2015-01-01

    The main goal of this thesis is to prepare and present the activities for primary school children on introduction to computer architecture with Raspberry Pi. Theoretical part of the work presents von Neumann architecture, Raspberry Pi and Kano computer kit. While presenting Raspberry Pi and Kano, we also tried to justify the use of such devices in classrooms. In second chapter, we analyzed curricula of Slovenia, Estonia, United states of America and United kingdom in order to give insig...

  11. Cusps in K --> 3 pi decays

    CERN Document Server

    Colangelo, G; Kubis, B; Rusetsky, A; Colangelo, Gilberto; Gasser, Juerg; Kubis, Bastian; Rusetsky, Akaki

    2006-01-01

    The pion mass difference generates a pronounced cusp in K --> 3 pi decays. As has recently been pointed out by Cabibbo and Isidori, an accurate measurement of the cusp may allow one to pin down the S-wave pi pi scattering lengths to high precision. Here, we present and illustrate an effective field theory framework that allows one to determine the structure of this cusp in a straightforward manner. The strictures imposed by analyticity and unitarity are respected automatically.

  12. Branching Fraction Measurements of Charged B Decays to K*+K+K-, K*+pi+K-, K*+K+pi- and K*+pi+pi- Final States

    CERN Document Server

    Aubert, B; Bóna, M; Boutigny, D; Couderc, F; Karyotakis, Yu; Lees, J P; Poireau, V; Tisserand, V; Zghiche, A; Graugès-Pous, E; Palano, A; Chen, J C; Qi, N D; Rong, G; Wang, P; Zhu, Y S; Eigen, G; Ofte, I; Stugu, B; Abrams, G S; Battaglia, M; Brown, D N; Button-Shafer, J; Cahn, R N; Charles, E; Gill, M S; Groysman, Y; Jacobsen, R G; Kadyk, J A; Kerth, L T; Kolomensky, Yu G; Kukartsev, G; Lynch, G; Mir, L M; Orimoto, T J; Pripstein, M; Roe, N A; Ronan, M T; Wenzel, W A; Del Amo-Sánchez, P; Barrett, M; Ford, K E; Harrison, T J; Hart, A J; Hawkes, C M; Morgan, S E; Watson, A T; Held, T; Koch, H; Lewandowski, B; Pelizaeus, M; Peters, K; Schröder, T; Steinke, M; Boyd, J T; Burke, J P; Cottingham, W N; Walker, D; Çuhadar-Dönszelmann, T; Fulsom, B G; Hearty, C; Knecht, N S; Mattison, T S; McKenna, J A; Khan, A; Kyberd, P; Saleem, M; Sherwood, D J; Teodorescu, L; Blinov, V E; Bukin, A D; Druzhinin, V P; Golubev, V B; Onuchin, A P; Serednyakov, S I; Skovpen, Yu I; Solodov, E P; Todyshev, K Yu; Best, D S; Bondioli, M; Bruinsma, M; Chao, M; Curry, S; Eschrich, I; Kirkby, D; Lankford, A J; Lund, P; Mandelkern, M A; Mommsen, R K; Röthel, W; Stoker, D P; Abachi, S; Buchanan, C; Foulkes, S D; Gary, J W; Long, O; Shen, B C; Wang, K; Zhang, L; Hadavand, H K; Hill, E J; Paar, H P; Rahatlou, S; Sharma, V; Berryhill, J W; Campagnari, C; Cunha, A; Dahmes, B; Hong, T M; Kovalskyi, D; Richman, J D; Beck, T W; Eisner, A M; Flacco, C J; Heusch, C A; Kroseberg, J; Lockman, W S; Nesom, G; Schalk, T; Schumm, B A; Seiden, A; Spradlin, P; Williams, D C; Wilson, M G; Albert, J; Chen, E; Dvoretskii, A; Fang, F; Hitlin, D G; Narsky, I; Piatenko, T; Porter, F C; Ryd, A; Samuel, A; Mancinelli, G; Meadows, B T; Mishra, K; Sokoloff, M D; Blanc, F; Bloom, P C; Chen, S; Ford, W T; Hirschauer, J F; Kreisel, A; Nagel, M; Nauenberg, U; Olivas, A; Ruddick, W O; Smith, J G; Ulmer, K A; Wagner, S R; Zhang, J; Chen, A; Eckhart, E A; Soffer, A; Toki, W H; Wilson, R J; Winklmeier, F; Zeng, Q; Altenburg, D D; Feltresi, E; Hauke, A; Jasper, H; Petzold, A; Spaan, B; Brandt, T; Klose, V; Lacker, H M; Mader, W F; Nogowski, R; Schubert, J; Schubert, K R; Schwierz, R; Sundermann, J E; Volk, A; Bernard, D; Bonneaud, G R; Grenier, P; Latour, E; Thiebaux, C; Verderi, M; Clark, P J; Gradl, W; Muheim, F; Playfer, S; Robertson, A I; Xie, Y; Andreotti, M; Bettoni, D; Bozzi, C; Calabrese, R; Cibinetto, G; Luppi, E; Negrini, M; Petrella, A; Piemontese, L; Prencipe, E; Anulli, F; Baldini-Ferroli, R; Calcaterra, A; De Sangro, R; Finocchiaro, G; Pacetti, S; Patteri, P; Peruzzi, I M; Piccolo, M; Rama, M; Zallo, A; Buzzo, A; Capra, R; Contri, R; Lo Vetere, M; Macri, M M; Monge, M R; Passaggio, S; Patrignani, C; Robutti, E; Santroni, A; Tosi, S; Brandenburg, G; Chaisanguanthum, K S; Morii, M; Wu, J; Dubitzky, R S; Marks, J; Schenk, S; Uwer, U; Bhimji, W; Bowerman, D A; Dauncey, P D; Egede, U; Flack, R L; Nash, J A; Nikolich, M B; Panduro-Vazquez, W; Behera, P K; Chai, X; Charles, M J; Mallik, U; Meyer, N T; Ziegler, V; Cochran, J; Crawley, H B; Dong, L; Eyges, V; Meyer, W T; Prell, S; Rosenberg, E I; Rubin, A E; Gritsan, A V; Denig, A G; Fritsch, M; Schott, G; Arnaud, N; Davier, M; Grosdidier, G; Höcker, A; Le Diberder, F R; Lepeltier, V; Lutz, A M; Oyanguren, A; Pruvot, S; Rodier, S; Roudeau, P; Schune, M H; Stocchi, A; Wang, W F; Wormser, G; Cheng, C H; Lange, D J; Wright, D M; Chavez, C A; Forster, I J; Fry, J R; Gabathuler, E; Gamet, R; George, K A; Hutchcroft, D E; Payne, D J; Schofield, K C; Touramanis, C; Bevan, A J; Di Lodovico, F; Menges, W; Sacco, R; Cowan, G; Flächer, H U; Hopkins, D A; Jackson, P S; McMahon, T R; Ricciardi, S; Salvatore, F; Wren, A C; Davis, C L; Allison, J; Barlow, N R; Barlow, R J; Chia, Y M; Edgar, C L; Lafferty, G D; Naisbit, M T; Williams, J C; Yi, J I; Chen, C; Hulsbergen, W D; Jawahery, A; Lae, C K; Roberts, D A; Simi, G; Blaylock, G; Dallapiccola, C; Hertzbach, S S; Li, X; Moore, T B; Saremi, S; Stängle, H; Cowan, R; Sciolla, G; Sekula, S J; Spitznagel, M; Taylor, F; Yamamoto, R K; Kim, H; Mclachlin, S E; Patel, P M; Robertson, S H; Lazzaro, A; Lombardo, V; Palombo, F; Bauer, J M; Cremaldi, L; Eschenburg, V; Godang, R; Kroeger, R; Sanders, D A; Summers, D J; Zhao, H W; Brunet, S; Côté, D; Simard, M; Taras, P; Viaud, F B; Nicholson, H; Cavallo, N; De Nardo, Gallieno; Fabozzi, F; Gatto, C; Lista, L; Monorchio, D; Paolucci, P; Piccolo, D; Sciacca, C; Baak, M; Raven, G; Snoek, H L; Jessop, C P; LoSecco, J M; Allmendinger, T; Benelli, G; Gan, K K; Honscheid, K; Hufnagel, D; Jackson, P D; Kagan, H; Kass, R; Rahimi, A M; Ter-Antonian, R; Wong, Q K; Blount, N L; Brau, J E; Frey, R; Igonkina, O; Lu, M; Rahmat, R; Sinev, N B; Strom, D; Strube, J; Torrence, E; Gaz, A; Margoni, M; Morandin, M; Pompili, A; Posocco, M; Rotondo, M; Simonetto, F; Stroili, R; Voci, C; Benayoun, M; Chauveau, J; Briand, H; David, P; Del Buono, L; La Vaissière, C de; Hamon, O; Hartfiel, B L; John, M J J; Leruste, P; Malcles, J; Ocariz, J; Roos, L; Therin, G; Gladney, L; Panetta, J; Biasini, M; Covarelli, R; Angelini, C; Batignani, G; Bettarini, S; Bucci, F; Calderini, G; Carpinelli, M; Cenci, R; Forti, F; Giorgi, M A; Lusiani, A; Marchiori, G; Mazur, M A; Morganti, M; Neri, N; Rizzo, G; Walsh, J J; Haire, M; Judd, D; Wagoner, D E; Biesiada, J; Danielson, N; Elmer, P; Lau, Y P; Lü, C; Olsen, J; Smith, A J S; Telnov, A V; Bellini, F; Cavoto, G; D'Orazio, A; Del Re, D; Di Marco, E; Faccini, R; Ferrarotto, F; Ferroni, F; Gaspero, M; Li Gioi, L; Mazzoni, M A; Morganti, S; Piredda, G; Polci, F; Safai-Tehrani, F; Voena, C; Ebert, M; Schröder, H; Waldi, R; Adye, T; De, N; Groot; Franek, B; Olaiya, E O; Wilson, F F; Aleksan, R; Emery, S; Gaidot, A; Ganzhur, S F; Hamel de Monchenault, G; Kozanecki, Witold; Legendre, M; Vasseur, G; Yéche, C; Zito, M; Chen, X R; Liu, H; Park, W; Purohit, M V; Wilson, J R; Allen, M T; Aston, D; Bartoldus, R; Bechtle, P; Berger, N; Claus, R; Coleman, J P; Convery, M R; Cristinziani, M; Dingfelder, J C; Dorfan, J; Dubois-Felsmann, G P; Dujmic, D; Dunwoodie, W M; Field, R C; Glanzman, T; Gowdy, S J; Graham, M T; Halyo, V; Hast, C; Hrynóva, T; Innes, W R; Kelsey, M H; Kim, P; Leith, D W G S; Li, S; Luitz, S; Lüth, V; Lynch, H L; MacFarlane, D B; Marsiske, H; Messner, R; Müller, D R; O'Grady, C P; Ozcan, V E; Perazzo, A; Perl, M; Pulliam, T; Ratcliff, B N; Roodman, A; Salnikov, A A; Schindler, R H; Schwiening, J; Snyder, A; Stelzer, J; Su, D; Sullivan, M K; Suzuki, K; Swain, S K; Thompson, J M; Vavra, J; Van Bakel, N; Weaver, M; Weinstein, A J R; Wisniewski, W J; Wittgen, M; Wright, D H; Yarritu, A K; Yi, K; Young, C C; Burchat, P R; Edwards, A J; Majewski, S A; Petersen, B A; Roat, C; Wilden, L; Ahmed, S; Alam, M S; Bula, R; Ernst, J A; Jain, V; Pan, B; Saeed, M A; Wappler, F R; Zain, S B; Bugg, W; Krishnamurthy, M; Spanier, S M; Eckmann, R; Ritchie, J L; Satpathy, A; Schilling, C J; Schwitters, R F; Izen, J M; Lou, X C; Ye, S; Bianchi, F; Gallo, F; Gamba, D; Bomben, M; Bosisio, L; Cartaro, C; Cossutti, F; Della Ricca, G; Dittongo, S; Lanceri, L; Vitale, L; Azzolini, V; Martínez-Vidal, F; Banerjee, Sw; Bhuyan, B; Brown, C M; Fortin, D; Hamano, K; Kowalewski, R V; Nugent, I M; Roney, J M; Sobie, R J; Back, J J; Harrison, P F; Latham, T E; Mohanty, G B; Pappagallo, M; Band, H R; Chen, X; Cheng, B; Dasu, S; Datta, M; Flood, K T; Hollar, J J; Kutter, P E; Mellado, B; Mihályi, A; Pan, Y; Pierini, M; Prepost, R; Wu, S L; Yu, Z; Neal, H; al, et

    2006-01-01

    Branching fraction and asymmetry measurements of charmless $B^+\\to K^{*+}h^+_1h^-_2$ (where $h_{1,2}$ = $K$, $\\pi$) decays are presented, using a data sample of 232 million $\\Upsilon(4S) \\to$ $BB$ decays collected with the BaBar detector at the SLAC PEP-II asymmetric-energy $B$ factory. Using a maximum likelihood fit, the following branching fraction results were obtained: ${\\cal B}$($B^+ \\to K^{*+}K^+ K^-)$ = (36.2 $\\pm$ 3.3 $\\pm$ 3.6) $\\times$ 10$^{-6}$ and ${\\cal B}$($B^+$ $\\to$ $K^{*+}\\pi^+\\pi^-$) = (75.3 $\\pm$ 6.0 $\\pm$ 8.1) $\\times$ 10$^{-6}$. Upper limits were set for ${\\cal B}$($B^+$ $\\to$ $K^{*+}\\pi^+ K^-$) $<$ 11.8 $\\times$ 10$^{-6}$ and ${\\cal B}$($B^+$ $\\to$ $K^{*+}K^+ \\pi^-$) $<$ 6.1 $\\times$ 10$^{-6}$ at 90% confidence level. The charge asymmetries for the decays $B^+ \\to K^{*+}K^+ K^-$ and $B^+$ $\\to$ $K^{*+}\\pi^+\\pi^-$ were measured to be ${\\cal A}_{K^*KK} = 0.11 \\pm 0.08 \\pm 0.03$ and ${\\cal A}_{K^*\\pi\\pi} = 0.07 \\pm 0.07 \\pm 0.04$, respectively. The first error quoted on branching frac...

  13. Targeting PI3 kinase in cancer.

    Science.gov (United States)

    Bauer, Todd M; Patel, Manish R; Infante, Jeffrey R

    2015-02-01

    The PI3K/Akt/mTOR pathway is the most frequently known activated aberrant pathway in human cancers. Pathologic activation can occur at multiple levels along the signaling pathway by a variety of mechanisms, including point mutations, amplifications, and inactivation of tumor suppressor genes. This pathway is also a known resistance pathway, as it can be activated by both receptor tyrosine kinases and other oncogenes. mTOR inhibitors were the first targeted molecules in this pathway, and have already been FDA-approved in multiple indications. Because of the broad potential applications of inhibiting this pathway upstream of mTOR, multiple compounds targeting PI3K are in development. In this review, we discuss the clinical development of these inhibitors, including dual PI3K/mTOR inhibitors, pan-PI3K inhibitors, and isoform-selective PI3K inhibitors. Common adverse events, including rash, nausea, vomiting, diarrhea, and hyperglycemia, have created a narrow therapeutic window for all classes of PI3K inhibitors. Furthermore, single agent clinical activity has also been limited, with the exception of isoform-selective inhibitors, particularly the PI3Kδ and PI3Kγ inhibitors in hematologic malignancies. The future role of inhibitors of the PI3K/Akt/mTOR pathway in the clinical practice of oncology likely depends on the development of patient selection strategies and the results of combination trials that are currently ongoing.

  14. The scalar mesons in multi-channel $\\pi\\pi$ scattering and decays of the $\\psi$ and $\\Upsilon$ families

    CERN Document Server

    Surovtsev, Yurii S; Gutsche, Thomas; Kaminski, Robert; Lyubovitskij, Valery E; Nagy, Miroslav

    2013-01-01

    The $f_0$ mesons are studied in a combined analysis of data on the isoscalar S-wave processes $\\pi\\pi\\to\\pi\\pi,K\\overline{K},\\eta\\eta$ and on decays $J/\\psi\\to\\phi(\\pi\\pi, K\\overline{K})$, $\\psi(2S)\\to J/\\psi(\\pi\\pi)$, and $\\Upsilon(2S)\\to\\Upsilon(1S)\\pi\\pi$ from the Argus, Crystal Ball, CLEO, CUSB, DM2, Mark II, Mark III, and BESIII collaborations. The method of analysis, based on analyticity and unitarity and using an uniformization procedure, is set forth with some details. Some spectroscopic implications from results of the analysis are discussed.

  15. On {pi}gp-continuous functions in topological spaces

    Energy Technology Data Exchange (ETDEWEB)

    Park, Jin Han E-mail: jihpark@pknu.ac.kr; Park, Jin Keun

    2004-05-01

    The concept of {pi}gp-closed sets was introduced by Park [On {pi}gp-closed sets in topological spaces, Indian J. Pure Appl. Math., in press]. The aim of this paper is to consider and characterize {pi}gp-irresolute and {pi}gp-continuous functions via the concept of {pi}gp-closed sets and to relate these concepts to the classes of {pi}GPO-compact spaces and {pi}GP-connected spaces.

  16. Study of $\\psi(2S)$ decays into $\\gamma K^+K^-$ and $\\gamma \\pi^+\\pi^-$

    CERN Document Server

    Ablikim, M; Bai, J Z; Ban, Y; Cai, X; Chen, H F; Chen, H S; Chen, H X; Chen, J C; Chen, Jin; Chen, Y B; Chu, Y P; Dai, Y S; Diao, L Y; Deng, Z Y; Dong, Q F; Du, S X; Fang, J; Fang, S S; Fu, C D; Gao, C S; Gao, Y N; Gu, S D; Gu, Y T; Guo, Y N; Guo, Z J; Harris, F A; LHe, K; He, M; Heng, Y K; Hou, J; Hu, H M; Hu, J H; Hu, T; Huang, X T; Ji, X B; Jiang, X S; Jiang, X Y; Jiao, J B; Jin, D P; Jin, S; Lai, Y F; Li, G; Li, H B; Li, J; Li, R Y; Li, S M; Li, W D; Li, W G; Li, X L; Li, X N; Li, X Q; Liang, Y F; Liao, H B; Liu, B J; Liu, C X; Liu, F; Liu, Fang; Liu, H H; Liu, H M; Liu, J; Liu, J B; Liu, J P; Liu, Jian; Liu, Q; Liu, R G; Liu, Z A; Lou, Y C; Lu, F; Lu, G R; Lu, J G; Lundborg, A; Luo, C L; Ma, F C; Ma, H L; Ma, L L; Ma, Q M; Mao, Z P; Mo, X H; Nie, J; Olsen, S L; Ping, R G; Qi, N D; Qin, H; Qiu, J F; Ren, Z Y; Rong, G; Ruan, X D; Shan, L Y; Shang, L; Shen, C P; Shen, D L; Shen, X Y; Sheng, H Y; Sun, H S; Sun, S S; Sun, Y Z; Sun, Z J; Tang, X; Tong, G L; Varner, G S; Wang, D Y; Wang, L; Wang, L L; Wang, L S; Wang, M; Wang, P; Wang, P L; Wang, Y F; Wang, Z; Wang, Z Y; Wang, Zheng; Wei, C L; Wei, D H; Weng, Y; Wiedner, U; Wu, N; Xia, X M; Xie, X X; Xu, G F; Xu, X P; Xu, Y; Yan, M L; Yang, H X; Yang, Y X; Ye, M H; Ye, Y X; Yu, G W; Yuan, C Z; Yuan, Y; Zhang, S L; Zeng, Y; Zhang, B X; Zhang, B Y; Zhang, C C; Zhang, D H; Zhang, H Q; Zhang, H Y; Zhang, J W; Zhang, J Y; Zhang, S H; Zhang, X Y; Zhang, Yiyun; Zhang, Z X; Zhang, Z P; Zhao, D X; Zhao, W J; Zhao, M G; Zhao, P P; Zhao, W R; Zhao, Z G; Zheng, H Q; Zheng, J P; Zheng, Z P; Zhou, L; Zhu, K J; Zhu, Q M; Zhu, Y C; Zhu, Y S; Zhu, Z A; Zhuang, B A; Zhuang, X A; Zou, B S

    2007-01-01

    Radiative charmonium decays from the BESII sample of 14$\\times10^{6}$ $\\psi(2S)$-events into two different final states, $\\gamma K^+K^-$ and $\\gamma\\pi^+\\pi^-$, are analyzed. Product branching fractions for $\\psi(2S)\\to\\gamma X\\to \\gamma\\pi^+\\pi^-$, $\\gamma K^+K^-$ are given, where $X=f_2(1270)$, $f_0(1500)$, and $f_0(1710)$ in $\\pi^+\\pi^-$ and $f_2(1270)$, $f_2'(1525)$, and $f_0(1700)$ in $K^+K^-$. An angular analysis gives the ratios of the helicity projections for the $f_2(1270)$ in $\\psi(2S)\\to\\gamma f_2(1270)\\to\\gamma\\pi^+\\pi^-$.

  17. Study of the pd(dp) -> 3He pi pi reactions close to threshold

    CERN Document Server

    Bellemann, F; Bisplinghoff, J; Bohlscheid, G; Ernst, J; Henrich, C; Hinterberger, F; Ibald, R; Jahn, R; Joosten, R; Kilian, K; Kozela, A; Machner, H; Magiera, A; Munkel, J; von Neumann-Cosel, P; von Rossen, P; Schnitker, H; Scho, K; Smyrski, J; Toelle, R; Wilkin, C

    2016-01-01

    New experimental data on the pd -> 3He pi+ pi- reaction obtained with the COSY-MOMO detector below the three-pion threshold are presented. The reaction was also studied in inverse kinematics with a deuteron beam and the higher counting rates achieved were especially important at low excess energies. The comparison of these data with inclusive pd -> 3He+X rates allowed estimates also to be made of pi0 pi0 production. The results confirm our earlier findings that close to threshold there is no enhancement at low excitation energies in the pi+ pi- system, where the data seem largely suppressed compared to phase space. Possible explanations for this behavior, such as strong p- waves in the pi+pi- -system or the influence of two-step processes, are explored.

  18. Revisiting the $B^{0} \\to \\pi^{0}\\pi^{0} $ decays in the perturbative QCD approach

    CERN Document Server

    Li, Yun-Feng

    2016-01-01

    We recalculate the branching ratio and CP asymmetry for $\\bar{B}^{0} (B^{0})\\to \\pi^{0}\\pi^{0}$ decays in the Perturbative QCD approach. In this approach, we consider all the possible diagrams including non-factorizable contributions and annihilation contributions, and identity principle is also taken into account. We obtain the branching ratio of $B^{0}\\to\\pi^{0}\\pi^{0}$ is about $1.2\\times10^{-6}$. Our result is in agreement with the latest measured branching ratio of $B^{0}\\to\\pi^{0}\\pi^{0}$ by the Belle and HFAG Collaborations. We also predict large direct CP asymmetry and mixing CP asymmetry in $B^{0}\\to\\pi^{0}\\pi^{0}$ decays, which can be tested by the running LHC-b experiments.

  19. Evidence for the decay $B_c^+ \\rightarrow J/\\psi 3\\pi^+ 2\\pi^-$

    CERN Document Server

    Aaij, Roel; Adinolfi, Marco; Affolder, Anthony; Ajaltouni, Ziad; Albrecht, Johannes; Alessio, Federico; Alexander, Michael; Ali, Suvayu; Alkhazov, Georgy; Alvarez Cartelle, Paula; Alves Jr, Antonio; Amato, Sandra; Amerio, Silvia; Amhis, Yasmine; An, Liupan; Anderlini, Lucio; Anderson, Jonathan; Andreassen, Rolf; Andreotti, Mirco; Andrews, Jason; Appleby, Robert; Aquines Gutierrez, Osvaldo; Archilli, Flavio; Artamonov, Alexander; Artuso, Marina; Aslanides, Elie; Auriemma, Giulio; Baalouch, Marouen; Bachmann, Sebastian; Back, John; Badalov, Alexey; Balagura, Vladislav; Baldini, Wander; Barlow, Roger; Barschel, Colin; Barsuk, Sergey; Barter, William; Batozskaya, Varvara; Bauer, Thomas; Bay, Aurelio; Beddow, John; Bedeschi, Franco; Bediaga, Ignacio; Belogurov, Sergey; Belous, Konstantin; Belyaev, Ivan; Ben-Haim, Eli; Bencivenni, Giovanni; Benson, Sean; Benton, Jack; Berezhnoy, Alexander; Bernet, Roland; Bettler, Marc-Olivier; van Beuzekom, Martinus; Bien, Alexander; Bifani, Simone; Bird, Thomas; Bizzeti, Andrea; Bjørnstad, Pål Marius; Blake, Thomas; Blanc, Frédéric; Blouw, Johan; Blusk, Steven; Bocci, Valerio; Bondar, Alexander; Bondar, Nikolay; Bonivento, Walter; Borghi, Silvia; Borgia, Alessandra; Borsato, Martino; Bowcock, Themistocles; Bowen, Espen Eie; Bozzi, Concezio; Brambach, Tobias; van den Brand, Johannes; Bressieux, Joël; Brett, David; Britsch, Markward; Britton, Thomas; Brook, Nicholas; Brown, Henry; Bursche, Albert; Busetto, Giovanni; Buytaert, Jan; Cadeddu, Sandro; Calabrese, Roberto; Callot, Olivier; Calvi, Marta; Calvo Gomez, Miriam; Camboni, Alessandro; Campana, Pierluigi; Campora Perez, Daniel; Caponio, Francesco; Carbone, Angelo; Carboni, Giovanni; Cardinale, Roberta; Cardini, Alessandro; Carranza-Mejia, Hector; Carson, Laurence; Carvalho Akiba, Kazuyoshi; Casse, Gianluigi; Cassina, Lorenzo; Castillo Garcia, Lucia; Cattaneo, Marco; Cauet, Christophe; Cenci, Riccardo; Charles, Matthew; Charpentier, Philippe; Cheung, Shu-Faye; Chiapolini, Nicola; Chrzaszcz, Marcin; Ciba, Krzystof; Cid Vidal, Xabier; Ciezarek, Gregory; Clarke, Peter; Clemencic, Marco; Cliff, Harry; Closier, Joel; Coca, Cornelia; Coco, Victor; Cogan, Julien; Cogneras, Eric; Collins, Paula; Comerma-Montells, Albert; Contu, Andrea; Cook, Andrew; Coombes, Matthew; Coquereau, Samuel; Corti, Gloria; Counts, Ian; Couturier, Benjamin; Cowan, Greig; Craik, Daniel Charles; Cruz Torres, Melissa Maria; Cunliffe, Samuel; Currie, Robert; D'Ambrosio, Carmelo; Dalseno, Jeremy; David, Pascal; David, Pieter; Davis, Adam; De Bruyn, Kristof; De Capua, Stefano; De Cian, Michel; De Miranda, Jussara; De Paula, Leandro; De Silva, Weeraddana; De Simone, Patrizia; Decamp, Daniel; Deckenhoff, Mirko; Del Buono, Luigi; Déléage, Nicolas; Derkach, Denis; Deschamps, Olivier; Dettori, Francesco; Di Canto, Angelo; Dijkstra, Hans; Donleavy, Stephanie; Dordei, Francesca; Dorigo, Mirco; Dosil Suárez, Alvaro; Dossett, David; Dovbnya, Anatoliy; Dupertuis, Frederic; Durante, Paolo; Dzhelyadin, Rustem; Dziurda, Agnieszka; Dzyuba, Alexey; Easo, Sajan; Egede, Ulrik; Egorychev, Victor; Eidelman, Semen; Eisenhardt, Stephan; Eitschberger, Ulrich; Ekelhof, Robert; Eklund, Lars; El Rifai, Ibrahim; Elsasser, Christian; Esen, Sevda; Falabella, Antonio; Färber, Christian; Farinelli, Chiara; Farley, Nathanael; Farry, Stephen; Ferguson, Dianne; Fernandez Albor, Victor; Ferreira Rodrigues, Fernando; Ferro-Luzzi, Massimiliano; Filippov, Sergey; Fiore, Marco; Fiorini, Massimiliano; Firlej, Miroslaw; Fitzpatrick, Conor; Fiutowski, Tomasz; Fontana, Marianna; Fontanelli, Flavio; Forty, Roger; Francisco, Oscar; Frank, Markus; Frei, Christoph; Frosini, Maddalena; Fu, Jinlin; Furfaro, Emiliano; Gallas Torreira, Abraham; Galli, Domenico; Gallorini, Stefano; Gambetta, Silvia; Gandelman, Miriam; Gandini, Paolo; Gao, Yuanning; Garofoli, Justin; Garra Tico, Jordi; Garrido, Lluis; Gaspar, Clara; Gauld, Rhorry; Gavardi, Laura; Gersabeck, Evelina; Gersabeck, Marco; Gershon, Timothy; Ghez, Philippe; Gianelle, Alessio; Giani', Sebastiana; Gibson, Valerie; Giubega, Lavinia-Helena; Gligorov, Vladimir; Göbel, Carla; Golubkov, Dmitry; Golutvin, Andrey; Gomes, Alvaro; Gordon, Hamish; Gotti, Claudio; Grabalosa Gándara, Marc; Graciani Diaz, Ricardo; Granado Cardoso, Luis Alberto; Graugés, Eugeni; Graziani, Giacomo; Grecu, Alexandru; Greening, Edward; Gregson, Sam; Griffith, Peter; Grillo, Lucia; Grünberg, Oliver; Gui, Bin; Gushchin, Evgeny; Guz, Yury; Gys, Thierry; Hadjivasiliou, Christos; Haefeli, Guido; Haen, Christophe; Hafkenscheid, Tom; Haines, Susan; Hall, Samuel; Hamilton, Brian; Hampson, Thomas; Han, Xiaoxue; Hansmann-Menzemer, Stephanie; Harnew, Neville; Harnew, Samuel; Harrison, Jonathan; Hartmann, Thomas; He, Jibo; Head, Timothy; Heijne, Veerle; Hennessy, Karol; Henrard, Pierre; Henry, Louis; Hernando Morata, Jose Angel; van Herwijnen, Eric; Heß, Miriam; Hicheur, Adlène; Hill, Donal; Hoballah, Mostafa; Hombach, Christoph; Hulsbergen, Wouter; Hunt, Philip; Hussain, Nazim; Hutchcroft, David; Hynds, Daniel; Idzik, Marek; Ilten, Philip; Jacobsson, Richard; Jaeger, Andreas; Jans, Eddy; Jaton, Pierre; Jawahery, Abolhassan; Jezabek, Marek; Jing, Fanfan; John, Malcolm; Johnson, Daniel; Jones, Christopher; Joram, Christian; Jost, Beat; Jurik, Nathan; Kaballo, Michael; Kandybei, Sergii; Kanso, Walaa; Karacson, Matthias; Karbach, Moritz; Kelsey, Matthew; Kenyon, Ian; Ketel, Tjeerd; Khanji, Basem; Khurewathanakul, Chitsanu; Klaver, Suzanne; Kochebina, Olga; Kolpin, Michael; Komarov, Ilya; Koopman, Rose; Koppenburg, Patrick; Korolev, Mikhail; Kozlinskiy, Alexandr; Kravchuk, Leonid; Kreplin, Katharina; Kreps, Michal; Krocker, Georg; Krokovny, Pavel; Kruse, Florian; Kucharczyk, Marcin; Kudryavtsev, Vasily; Kurek, Krzysztof; Kvaratskheliya, Tengiz; La Thi, Viet Nga; Lacarrere, Daniel; Lafferty, George; Lai, Adriano; Lambert, Dean; Lambert, Robert W; Lanciotti, Elisa; Lanfranchi, Gaia; Langenbruch, Christoph; Langhans, Benedikt; Latham, Thomas; Lazzeroni, Cristina; Le Gac, Renaud; van Leerdam, Jeroen; Lees, Jean-Pierre; Lefèvre, Regis; Leflat, Alexander; Lefrançois, Jacques; Leo, Sabato; Leroy, Olivier; Lesiak, Tadeusz; Leverington, Blake; Li, Yiming; Liles, Myfanwy; Lindner, Rolf; Linn, Christian; Lionetto, Federica; Liu, Bo; Liu, Guoming; Lohn, Stefan; Longstaff, Ian; Lopes, Jose; Lopez-March, Neus; Lowdon, Peter; Lu, Haiting; Lucchesi, Donatella; Luo, Haofei; Luppi, Eleonora; Lupton, Oliver; Machefert, Frederic; Machikhiliyan, Irina V; Maciuc, Florin; Maev, Oleg; Malde, Sneha; Manca, Giulia; Mancinelli, Giampiero; Manzali, Matteo; Maratas, Jan; Marchand, Jean François; Marconi, Umberto; Marin Benito, Carla; Marino, Pietro; Märki, Raphael; Marks, Jörg; Martellotti, Giuseppe; Martens, Aurelien; Martín Sánchez, Alexandra; Martinelli, Maurizio; Martinez Santos, Diego; Martinez Vidal, Fernando; Martins Tostes, Danielle; Massafferri, André; Matev, Rosen; Mathe, Zoltan; Matteuzzi, Clara; Mazurov, Alexander; McCann, Michael; McCarthy, James; McNab, Andrew; McNulty, Ronan; McSkelly, Ben; Meadows, Brian; Meier, Frank; Meissner, Marco; Merk, Marcel; Milanes, Diego Alejandro; Minard, Marie-Noelle; Molina Rodriguez, Josue; Monteil, Stephane; Moran, Dermot; Morandin, Mauro; Morawski, Piotr; Mordà, Alessandro; Morello, Michael Joseph; Moron, Jakub; Mountain, Raymond; Muheim, Franz; Müller, Katharina; Muresan, Raluca; Muster, Bastien; Naik, Paras; Nakada, Tatsuya; Nandakumar, Raja; Nasteva, Irina; Needham, Matthew; Neri, Nicola; Neubert, Sebastian; Neufeld, Niko; Neuner, Max; Nguyen, Anh Duc; Nguyen, Thi-Dung; Nguyen-Mau, Chung; Nicol, Michelle; Niess, Valentin; Niet, Ramon; Nikitin, Nikolay; Nikodem, Thomas; Novoselov, Alexey; Oblakowska-Mucha, Agnieszka; Obraztsov, Vladimir; Oggero, Serena; Ogilvy, Stephen; Okhrimenko, Oleksandr; Oldeman, Rudolf; Onderwater, Gerco; Orlandea, Marius; Otalora Goicochea, Juan Martin; Owen, Patrick; Oyanguren, Maria Arantza; Pal, Bilas Kanti; Palano, Antimo; Palombo, Fernando; Palutan, Matteo; Panman, Jacob; Papanestis, Antonios; Pappagallo, Marco; Pappalardo, Luciano; Parkes, Christopher; Parkinson, Christopher John; Passaleva, Giovanni; Patel, Girish; Patel, Mitesh; Patrignani, Claudia; Pazos Alvarez, Antonio; Pearce, Alex; Pellegrino, Antonio; Pepe Altarelli, Monica; Perazzini, Stefano; Perez Trigo, Eliseo; Perret, Pascal; Perrin-Terrin, Mathieu; Pescatore, Luca; Pesen, Erhan; Petridis, Konstantin; Petrolini, Alessandro; Picatoste Olloqui, Eduardo; Pietrzyk, Boleslaw; Pilař, Tomas; Pinci, Davide; Pistone, Alessandro; Playfer, Stephen; Plo Casasus, Maximo; Polci, Francesco; Poluektov, Anton; Polycarpo, Erica; Popov, Alexander; Popov, Dmitry; Popovici, Bogdan; Potterat, Cédric; Powell, Andrew; Prisciandaro, Jessica; Pritchard, Adrian; Prouve, Claire; Pugatch, Valery; Puig Navarro, Albert; Punzi, Giovanni; Qian, Wenbin; Rachwal, Bartolomiej; Rademacker, Jonas; Rakotomiaramanana, Barinjaka; Rama, Matteo; Rangel, Murilo; Raniuk, Iurii; Rauschmayr, Nathalie; Raven, Gerhard; Reichert, Stefanie; Reid, Matthew; dos Reis, Alberto; Ricciardi, Stefania; Richards, Alexander; Rinnert, Kurt; Rives Molina, Vincente; Roa Romero, Diego; Robbe, Patrick; Roberts, Douglas; Rodrigues, Ana Barbara; Rodrigues, Eduardo; Rodriguez Perez, Pablo; Roiser, Stefan; Romanovsky, Vladimir; Romero Vidal, Antonio; Rotondo, Marcello; Rouvinet, Julien; Ruf, Thomas; Ruffini, Fabrizio; Ruiz, Hugo; Ruiz Valls, Pablo; Sabatino, Giovanni; Saborido Silva, Juan Jose; Sagidova, Naylya; Sail, Paul; Saitta, Biagio; Salustino Guimaraes, Valdir; Sanmartin Sedes, Brais; Santacesaria, Roberta; Santamarina Rios, Cibran; Santovetti, Emanuele; Sapunov, Matvey; Sarti, Alessio; Satriano, Celestina; Satta, Alessia; Savrie, Mauro; Savrina, Darya; Schiller, Manuel; Schindler, Heinrich; Schlupp, Maximilian; Schmelling, Michael; Schmidt, Burkhard; Schneider, Olivier; Schopper, Andreas; Schune, Marie Helene; Schwemmer, Rainer; Sciascia, Barbara; Sciubba, Adalberto; Seco, Marcos; Semennikov, Alexander; Senderowska, Katarzyna; Sepp, Indrek; Serra, Nicola; Serrano, Justine; Seyfert, Paul; Shapkin, Mikhail; Shapoval, Illya; Shcheglov, Yury; Shears, Tara; Shekhtman, Lev; Shevchenko, Oksana; Shevchenko, Vladimir; Shires, Alexander; Sidorov, Fedor; Silva Coutinho, Rafael; Simi, Gabriele; Sirendi, Marek; Skidmore, Nicola; Skwarnicki, Tomasz; Smith, Anthony; Smith, Edmund; Smith, Eluned; Smith, Jackson; Smith, Mark; Snoek, Hella; Sokoloff, Michael; Soler, Paul; Soomro, Fatima; Souza, Daniel; Souza De Paula, Bruno; Spaan, Bernhard; Sparkes, Ailsa; Spinella, Franco; Spradlin, Patrick; Stagni, Federico; Stahl, Sascha; Steinkamp, Olaf; Stevenson, Scott; Stoica, Sabin; Stone, Sheldon; Storaci, Barbara; Stracka, Simone; Straticiuc, Mihai; Straumann, Ulrich; Stroili, Roberto; Subbiah, Vijay Kartik; Sun, Liang; Sutcliffe, William; Swientek, Krzysztof; Swientek, Stefan; Syropoulos, Vasileios; Szczekowski, Marek; Szczypka, Paul; Szilard, Daniela; Szumlak, Tomasz; T'Jampens, Stephane; Teklishyn, Maksym; Tellarini, Giulia; Teubert, Frederic; Thomas, Christopher; Thomas, Eric; van Tilburg, Jeroen; Tisserand, Vincent; Tobin, Mark; Tolk, Siim; Tomassetti, Luca; Tonelli, Diego; Topp-Joergensen, Stig; Torr, Nicholas; Tournefier, Edwige; Tourneur, Stephane; Tran, Minh Tâm; Tresch, Marco; Tsaregorodtsev, Andrei; Tsopelas, Panagiotis; Tuning, Niels; Ubeda Garcia, Mario; Ukleja, Artur; Ustyuzhanin, Andrey; Uwer, Ulrich; Vagnoni, Vincenzo; Valenti, Giovanni; Vallier, Alexis; Vazquez Gomez, Ricardo; Vazquez Regueiro, Pablo; Vázquez Sierra, Carlos; Vecchi, Stefania; Velthuis, Jaap; Veltri, Michele; Veneziano, Giovanni; Vesterinen, Mika; Viaud, Benoit; Vieira, Daniel; Vilasis-Cardona, Xavier; Vollhardt, Achim; Volyanskyy, Dmytro; Voong, David; Vorobyev, Alexey; Vorobyev, Vitaly; Voß, Christian; Voss, Helge; de Vries, Jacco; Waldi, Roland; Wallace, Charlotte; Wallace, Ronan; Wandernoth, Sebastian; Wang, Jianchun; Ward, David; Watson, Nigel; Websdale, David; Whitehead, Mark; Wicht, Jean; Wiedner, Dirk; Wilkinson, Guy; Williams, Matthew; Williams, Mike; Wilson, Fergus; Wimberley, Jack; Wishahi, Julian; Wislicki, Wojciech; Witek, Mariusz; Wormser, Guy; Wotton, Stephen; Wright, Simon; Wu, Suzhi; Wyllie, Kenneth; Xie, Yuehong; Xing, Zhou; Yang, Zhenwei; Yuan, Xuhao; Yushchenko, Oleg; Zangoli, Maria; Zavertyaev, Mikhail; Zhang, Feng; Zhang, Liming; Zhang, Wen Chao; Zhang, Yanxi; Zhelezov, Alexey; Zhokhov, Anatoly; Zhong, Liang; Zvyagin, Alexander

    2014-01-01

    Evidence is presented for the decay $B_c+\\rightarrow J/\\psi 3\\pi^+2\\pi^-$ using proton-proton collision data, corresponding to an integrated luminosity of 3fb$^{-1}$, collected with the LHCb detector. A signal yield of $32\\pm8$ decays is found with a significance of 4.5 standard deviations. The ratio of the branching fraction of the $B_c^+\\rightarrow J/\\psi 3\\pi^+ 2\\pi^-$ decay to that of the $B_c^+ \\rightarrow J/\\psi \\pi^+$ decay is measured to be $$ \\frac{Br (B_c^+ \\rightarrow J/\\psi 3\\pi^+2\\pi^)}{Br (B_c^+ \\rightarrow J/\\psi \\pi^+)} = 1.74\\pm0.44\\pm0.24, $$ where the first uncertainty is statistical and the second is systematic.

  20. Temporal integration of the pi 1/pi 3 pathway in normal and dichromatic vision.

    Science.gov (United States)

    Friedman, L J; Yim, M H; Pugh, E N

    1984-01-01

    Stiles' pi 1 and pi 3 mechanisms are thought to reflect adaptation events at two sites in a single pathway, the first site controlled by the short-wavelength cones alone, the second site controlled by opposing signals from these cones vs the other cone classes. We examined this pathway's temporal integration under conditions that yield the full gamut of possible adaptation states at the two sites. Critical duration of the pi 1/pi 3 pathway was always about 200 msec. In addition, we examined the pi 1 and pi 3 mechanisms of dichromatic vision. Our results suggest that protanopic and deuteranopic vision are characterized by a pi 1/pi 3 pathway similar to that in normal color vision.

  1. Measurement of the Branching Ratio Lambda_c+ -> p pi+ pi-

    Energy Technology Data Exchange (ETDEWEB)

    Lopez-Hinojosa, Guillermo; /San Luis Potosi U.

    2008-03-01

    The confirmation of the Cabibbo-suppressed charm baryon decay mode {Lambda}{sub c}{sup +} {yields} p{pi}{sup +}{pi}{sup -} is reported. All data analyzed are from SELEX, a fixed target experiment at Fermilab that took data during 1996 and 1997, mainly with a 600 GeV/c {Sigma}{sup -} beam. The branching ratio of the Cabibbo-suppressed decay mode {Lambda}{sub c}{sup +} {yields} p{pi}{sup +}{pi}{sup -} relative to the Cabibbo-favored mode {Lambda}{sub c}{sup +} {yields} pK{sup -}{pi}{sup +} is measured to be: {Gamma}({Lambda}{sub c}{sup +} {yields} p{pi}{sup +}{pi}{sup -})/{Gamma}({Lambda}{sub c}{sup +} {yields} pK{sup -}{pi}{sup +}) = 0.103 {+-} 0.022.

  2. A measurement of the CP-conserving component of the Decay $K^{O}_{S} \\to \\pi^{+}\\pi^{-}\\pi^{0}$

    CERN Document Server

    Batley, J Richard; Munday, D J; Patel, M; Slater, M W; Wotton, S A; Arcidiacono, R; Bocquet, G; Ceccucci, A; Cundy, Donald C; Doble, Niels T; Falaleev, V; Gatignon, L; Gonidec, A; Grafström, P; Kubischta, Werner; Marchetto, F; Mikulec, I; Norton, A; Panzer-Steindel, B; Rubin, P; Wahl, H; Goudzovski, E; Gurev, D; Khristov, P Z; Kekelidze, V D; Litov, L; Madigozhin, D T; Molokanova, N A; Potrebenikov, Yu K; Stoynev, S; Zinchenko, A I; Monnier, E; Swallow, E; Winston, R; Sacco, R; Walker, A; Baldini, W; Dalpiaz, P; Frabetti, P L; Gianoli, A; Martini, M; Petrucci, F; Scarpa, M; Savrié, M; Bizzeti, A; Calvetti, M; Collazuol, G; Graziani, G; Iacopini, E; Lenti, M; Martelli, F; Ruggiero, G; Veltri, M; Behler, M; Eppard, K; Eppard, M; Hirstius, A; Kleinknecht, K; Koch, U; Masetti, L; Marouelli, P; Moosbrugger, U; Morales-Morales, C; Peters, A; Wache, M; Wanke, R; Winhart, A; Dabrowski, A; Fonseca-Martin, T; Velasco, M; Anzivino, Giuseppina; Cenci, P; Imbergamo, E; Lamanna, G; Lubrano, P; Michetti, A; Nappi, A; Pepé, M; Petrucci, M C; Piccini, M; Valdata, M; Cerri, C; Costantini, F; Fantechi, R; Fiorini, L; Giudici, Sergio; Mannelli, I; Pierazzini, G M; Sozzi, M; Cheshkov, C; Chèze, J B; De Beer, M; Debu, P; Gouge, G; Marel, Gérard; Mazzucato, E; Peyaud, B; Vallage, B; Holder, M; Maier, A; Ziolkowski, M; Biino, C; Cartiglia, N; Clemencic, M; Goy-Lopez, S; Menichetti, E; Pastrone, N; Wislicki, W; Dibon, Heinz; Jeitler, Manfred; Markytan, Manfred; Neuhofer, G

    2005-01-01

    The NA48 collaboration has measured the amplitude of the CP-conserving component of the decay K^0_S -> \\pi^+ \\pi^- \\pi^0 relative to K^0_L -> \\pi ^+ \\pi^- \\pi ^0. For the characteristic parameter \\lambda, the values Re \\lambda = 0.038 +- 0.010 and Im \\lambda = - 0.013 +- 0.007 have been extracted. These values agree with earlier measurements and with theoretical predictions from chiral perturbation theory.

  3. Upper limit on the eta -> pi+pi- branching ratio with the KLOE experiment

    OpenAIRE

    KLOE collaboration

    2004-01-01

    We have searched with the KLOE detector for the P and CP violating decay eta -> pi^+pi^- in a sample of 1.55 x 10^7 eta's from the decay phi -> eta gamma of phi mesons produced in e+e- annihilations at DAFNE. No signal is found. We obtain the upper limit BR(eta -> pi^+pi^-) < 1.3 x 10^-5 at 90% confidence level.

  4. I=2 $\\pi\\pi$ scattering using G-parity boundary condition

    OpenAIRE

    Kim, Changhoan

    2003-01-01

    To make the $\\pi\\pi$ state with non-zero relative momentum as the leading exponential, we impose anti-periodic boundary condition on the pion, which is implemented by imposing G-parity or H-parity on the quark fields at the boundary. With this, we calculate the I=2 $\\pi\\pi$ phase shift from lattice simulation by using L\\"uscher's formula.

  5. Search for CP and P violating pseudoscalar decays into pi pi

    NARCIS (Netherlands)

    Ablikim, M.; Achasov, M. N.; Alberto, D.; An, Q.; An, Z. H.; Bai, J. Z.; Baldini, R.; Ban, Y.; Becker, J.; Berger, N.; Bertani, M.; Bian, J. M.; Bondarenko, O.; Boyko, I.; Briere, R. A.; Bytev, V.; Cai, X.; Calcaterra, A. C.; Cao, G. F.; Cao, X. X.; Chang, J. F.; Chelkov, G.; Chen, G.; Chen, H. S.; Chen, J. C.; Chen, M. L.; Chen, S. J.; Chen, Y.; Chen, Y. B.; Cheng, H. P.; Chu, Y. P.; Cronin-Hennessy, D.; Dai, H. L.; Dai, J. P.; Dedovich, D.; Deng, Z. Y.; Denysenko, I.; Destefanis, M.; Ding, Y.; Dong, L. Y.; Dong, M. Y.; Du, S. X.; Fan, R. R.; Fang, J.; Fang, S. S.; Feng, C. Q.; Fu, C. D.; Fu, J. L.; Gao, Y.; Geng, C.; Goetzen, K.; Gong, W. X.; Greco, M.; Grishin, S.; Gu, M. H.; Gu, Y. T.; Guan, Y. H.; Guo, A. Q.; Guo, L. B.; Guo, Y. P.; Hao, X. Q.; Harris, F. A.; He, K. L.; He, M.; He, Z. Y.; Heng, Y. K.; Hou, Z. L.; Hu, H. M.; Hu, J. F.; Hu, T.; Huang, B.; Huang, G. M.; Huang, J. S.; Huang, X. T.; Huang, Y. P.; Hussain, T.; Ji, C. S.; Ji, Q.; Ji, X. B.; Ji, X. L.; Jia, L. K.; Jiang, L. L.; Jiang, X. S.; Jiao, J. B.; Jiao, Z.; Jin, D. P.; Jin, S.; Jing, F. F.; Kalantar-Nayestanaki, N.; Kavatsyuk, M.; Komamiya, S.; Kuehn, W.; Lange, J. S.; Leung, J. K. C.; Li, Cheng; Li, Cui; Li, D. M.; Li, F.; Li, G.; Li, H. B.; Li, J. C.; Li, Lei; Li, N. B.; Li, Q. J.; Li, W. D.; Li, W. G.; Li, X. L.; Li, X. N.; Li, X. Q.; Li, X. R.; Li, Z. B.; Liang, H.; Liang, Y. F.; Liang, Y. T.; Liao, G. R.; Liao, X. T.; Liu, B. J.; Liu, B. J.; Liu, C. L.; Liu, C. X.; Liu, C. Y.; Liu, F. H.; Liu, Fang; Liu, Feng; Liu, G. C.; Liu, H.; Liu, H. B.; Liu, H. M.; Liu, H. W.; Liu, J. P.; Liu, K.; Liu, K.; Liu, K. Y.; Liu, Q.; Liu, S. B.; Liu, X.; Liu, X. H.; Liu, Y. B.; Liu, Y. W.; Liu, Yong; Liu, Z. A.; Liu, Z. Q.; Loehner, H.; Lu, G. R.; Lu, H. J.; Lu, J. G.; Lu, Q. W.; Lu, X. R.; Lu, Y. P.; Luo, C. L.; Luo, M. X.; Luo, T.; Luo, X. L.; Ma, C. L.; Ma, F. C.; Ma, H. L.; Ma, Q. M.; Ma, T.; Ma, X.; Ma, X. Y.; Maggiora, M.; Malik, Q. A.; Mao, H.; Mao, Y. J.; Mao, Z. P.; Messchendorp, J. G.; Min, J.; Mitchell, R. E.; Mo, X. H.; Muchnoi, N. Yu.; Nefedov, Y.; Nikolaev, I. B.; Ning, Z.; Olsen, S. L.; Ouyang, Q.; Pacetti, S.; Pelizaeus, M.; Peters, K.; Ping, J. L.; Ping, R. G.; Poling, R.; Pun, C. S. J.; Qi, M.; Qian, S.; Qiao, C. F.; Qin, X. S.; Qiu, J. F.; Rashid, K. H.; Rong, G.; Ruan, X. D.; Sarantsev, A.; Schulze, J.; Shao, M.; Shen, C. P.; Shen, X. Y.; Sheng, H. Y.; Shepherd, M. R.; Song, X. Y.; Sonoda, S.; Spataro, S.; Spruck, B.; Sun, D. H.; Sun, G. X.; Sun, J. F.; Sun, S. S.; Sun, X. D.; Sun, Y. J.; Sun, Y. Z.; Sun, Z. J.; Sun, Z. T.; Tang, C. J.; Tang, X.; Tang, X. F.; Tian, H. L.; Toth, D.; Varner, G. S.; Wan, X.; Wang, B. Q.; Wang, K.; Wang, L. L.; Wang, L. S.; Wang, M.; Wang, P.; Wang, P. L.; Wang, Q.; Wang, S. G.; Wang, X. L.; Wang, Y. D.; Wang, Y. F.; Wang, Y. Q.; Wang, Z.; Wang, Z. G.; Wang, Z. Y.; Wei, D. H.; Wen, Q. G.; Wen, S. P.; Wiedner, U.; Wu, L. H.; Wu, N.; Wu, W.; Wu, Z.; Xiao, Z. J.; Xie, Y. G.; Xu, G. F.; Xu, G. M.; Xu, H.; Xu, Y.; Xu, Z. R.; Xu, Z. Z.; Xue, Z.; Yan, L.; Yan, W. B.; Yan, Y. H.; Yang, H. X.; Yang, M.; Yang, T.; Yang, Y.; Yang, Y. X.; Ye, M.; Ye, M. H.; Yu, B. X.; Yu, C. X.; Yu, L.; Yu, S. P. Yu; Yuan, C. Z.; Yuan, W. L.; Yuan, Y.; Zafar, A. A.; Zallo, A.; Zeng, Y.; Zhang, B. X.; Zhang, B. Y.; Zhang, C. C.; Zhang, D. H.; Zhang, H. H.; Zhang, H. Y.; Zhang, J.; Zhang, J. W.; Zhang, J. Y.; Zhang, J. Z.; Zhang, L.; Zhang, S. H.; Zhang, T. R.; Zhang, X. J.; Zhang, X. Y.; Zhang, Y.; Zhang, Y. H.; Zhang, Z. P.; Zhang, Z. Y.; Zhao, G.; Zhao, H. S.; Zhao, Jiawei; Zhao, Jingwei; Zhao, Lei; Zhao, Ling; Zhao, M. G.; Zhao, Q.; Zhao, S. J.; Zhao, T. C.; Zhao, X. H.; Zhao, Y. B.; Zhao, Z. G.; Zhao, Z. L.; Zhemchugov, A.; Zheng, B.; Zheng, J. P.; Zheng, Y. H.; Zheng, Z. P.; Zhong, B.; Zhong, J.; Zhong, L.; Zhou, L.; Zhou, X. K.; Zhou, X. R.; Zhu, C.; Zhu, K.; Zhu, K. J.; Zhu, S. H.; Zhu, X. L.; Zhu, X. W.; Zhu, Y. S.; Zhu, Z. A.; Zhuang, J.; Zou, B. S.; Zou, J. H.; Zuo, J. X.

    2011-01-01

    Using a sample of (225.2 +/- 2.8) x 10(6) J/psi events collected with the Beijing Spectrometer at the Beijing Electron-Positron Collider, CP and P violating decays of eta, eta', and eta(c) into pi(+)pi(-) and pi(0)pi(0) are searched for in J/psi radiative decays. No significant eta, eta', or eta(c)

  6. In-medium modifications of the pi pi interaction in photon-induced reactions

    NARCIS (Netherlands)

    Messchendorp, JG; Janssen, S; Kotulla, M; Ahrens, J; Annand, JRH; Beck, R; Bloch, F; Caselotti, G; Fog, L; Hornidge, D; Krusche, B; Langgartner, W; McGeorge, JC; MacGregor, IJD; Mengel, K; Metag, V.; Novotny, R; Owens, RO; Pfeiffer, M; Sack, S; Sanderson, R.; Schadmand, S

    2002-01-01

    Differential cross sections of the reactions (gamma,pi(0)pi(0)) and (gamma,pi(0)pi(+/-)) have been measured for several nuclei (H-1,C-12, and Pb-nat) at an incident-photon energy of E-gamma=400-460 MeV at the tagged-photon facility at MAMI-B using the TAPS spectrometer. A significant nuclear-mass de

  7. Study of the decays D r arrow K 3. pi

    Energy Technology Data Exchange (ETDEWEB)

    Anjos, J.C.; Appel, J.A.; Bean, A.; Bracker, S.B.; Browder, T.E.; Cremaldi, L.M.; Duboscq, J.E.; Elliott, J.R.; Escobar, C.O.; Gibney, M.C.; Hartner, G.F.; Huber, J.; Karchin, P.E.; Kumar, B.R.; Losty, M.J.; Luste, G.J.; Mantsch, P.M.; Martin, J.F.; McHugh, S.; Menary, S.R.; Morrison, R.J.; Nash, T.; Pinfold, J.; Punkar, G.; Purohit, M.V.; Ross, W.R.; Santoro, A.F.S.; Schmidt, D.M.; Shoup, A.L.; Sliwa, K.; Sokoloff, M.D.; Souza, M.H.G.; Sperka, D.; Spalding, W.J.; Streetman, M.E.; Stundzia, A.B.; Witherell, M.S. (University of California, Santa Barbara, California, 93106 (United States) Carleton University, Ottawa, Ontario, Canada K1S5B6 ( ) Centro Brasileiro de Pesquisas Fisicas, Rio de Janeiro (Brazil) University of Cincinnati, Cincinnati, Ohio 45221 (United States) University of Colorado, Boulder, Colorado 80309 (United States) Fermi National Accelerator Laboratory, Batavia, Illinois 60510 (United States) University of Mississippi, Oxford, Mississippi 38677 (United States) Nation

    1992-09-01

    We report measurements of the decays {ital D}{sup 0}{r arrow}{ital K}{sup {minus}}{pi}{sup +}{pi}{sup +}{pi}{sup {minus}}, {ital D}{sup +}{r arrow}{ital {bar K}}{sup 0}{pi}{sup +}{pi}{sup +}{pi}{sup {minus}}, {ital D}{sup +}{r arrow}{ital K}{sup {minus}}{pi}{sup +}{pi}{sup +}{pi}{sup 0}, and {ital D}{sup 0}{r arrow}{ital {bar K}}{sup 0}{pi}{sup +}{pi}{sup {minus}}{pi}{sup 0} from Fermilab photoproduction experiment E691. A complete resonant substructure analysis is used to determine the relative fractions and phases of amplitudes contributing to the decays {ital D}{sup 0}{r arrow}{ital K}{sup {minus}}{pi}{sup +}{pi}{sup +}{pi}{sup {minus}}, {ital D}{sup +}{r arrow}{ital {bar K}}{sup 0}{pi}{sup +}{pi}{sup +}{pi}{sup {minus}}, and {ital D}{sup +}{r arrow}{ital K}{sup {minus}}{pi}{sup +}{pi}{sup +}{pi}{sup 0}.

  8. Hamiltonian Structure of PI Hierarchy

    Directory of Open Access Journals (Sweden)

    Kanehisa Takasaki

    2007-03-01

    Full Text Available The string equation of type (2,2g+1 may be thought of as a higher order analogue of the first Painlevé equation that corresponds to the case of g = 1. For g > 1, this equation is accompanied with a finite set of commuting isomonodromic deformations, and they altogether form a hierarchy called the PI hierarchy. This hierarchy gives an isomonodromic analogue of the well known Mumford system. The Hamiltonian structure of the Lax equations can be formulated by the same Poisson structure as the Mumford system. A set of Darboux coordinates, which have been used for the Mumford system, can be introduced in this hierarchy as well. The equations of motion in these Darboux coordinates turn out to take a Hamiltonian form, but the Hamiltonians are different from the Hamiltonians of the Lax equations (except for the lowest one that corresponds to the string equation itself.

  9. First observation of $D^0- \\bar D^0$ oscillations in $D^0 \\to K^+\\pi^-\\pi^+\\pi^-$ decays and measurement of the associated coherence parameters

    CERN Document Server

    Aaij, Roel; Adeva, Bernardo; Adinolfi, Marco; Affolder, Anthony; Ajaltouni, Ziad; Akar, Simon; Albrecht, Johannes; Alessio, Federico; Alexander, Michael; Ali, Suvayu; Alkhazov, Georgy; Alvarez Cartelle, Paula; Alves Jr, Antonio Augusto; Amato, Sandra; Amerio, Silvia; Amhis, Yasmine; An, Liupan; Anderlini, Lucio; Andreassi, Guido; Andreotti, Mirco; Andrews, Jason; Appleby, Robert; Aquines Gutierrez, Osvaldo; Archilli, Flavio; d'Argent, Philippe; Artamonov, Alexander; Artuso, Marina; Aslanides, Elie; Auriemma, Giulio; Baalouch, Marouen; Bachmann, Sebastian; Back, John; Badalov, Alexey; Baesso, Clarissa; Baldini, Wander; Barlow, Roger; Barschel, Colin; Barsuk, Sergey; Barter, William; Batozskaya, Varvara; Battista, Vincenzo; Bay, Aurelio; Beaucourt, Leo; Beddow, John; Bedeschi, Franco; Bediaga, Ignacio; Bel, Lennaert; Bellee, Violaine; Belloli, Nicoletta; Belyaev, Ivan; Ben-Haim, Eli; Bencivenni, Giovanni; Benson, Sean; Benton, Jack; Berezhnoy, Alexander; Bernet, Roland; Bertolin, Alessandro; Betti, Federico; Bettler, Marc-Olivier; van Beuzekom, Martinus; Bifani, Simone; Billoir, Pierre; Bird, Thomas; Birnkraut, Alex; Bizzeti, Andrea; Blake, Thomas; Blanc, Frédéric; Blouw, Johan; Blusk, Steven; Bocci, Valerio; Bondar, Alexander; Bondar, Nikolay; Bonivento, Walter; Borgheresi, Alessio; Borghi, Silvia; Borisyak, Maxim; Borsato, Martino; Bowcock, Themistocles; Bowen, Espen Eie; Bozzi, Concezio; Braun, Svende; Britsch, Markward; Britton, Thomas; Brodzicka, Jolanta; Brook, Nicholas; Buchanan, Emma; Burr, Christopher; Bursche, Albert; Buytaert, Jan; Cadeddu, Sandro; Calabrese, Roberto; Calvi, Marta; Calvo Gomez, Miriam; Campana, Pierluigi; Campora Perez, Daniel; Capriotti, Lorenzo; Carbone, Angelo; Carboni, Giovanni; Cardinale, Roberta; Cardini, Alessandro; Carniti, Paolo; Carson, Laurence; Carvalho Akiba, Kazuyoshi; Casse, Gianluigi; Cassina, Lorenzo; Castillo Garcia, Lucia; Cattaneo, Marco; Cauet, Christophe; Cavallero, Giovanni; Cenci, Riccardo; Charles, Matthew; Charpentier, Philippe; Chefdeville, Maximilien; Chen, Shanzhen; Cheung, Shu-Faye; Chiapolini, Nicola; Chrzaszcz, Marcin; Cid Vidal, Xabier; Ciezarek, Gregory; Clarke, Peter; Clemencic, Marco; Cliff, Harry; Closier, Joel; Coco, Victor; Cogan, Julien; Cogneras, Eric; Cogoni, Violetta; Cojocariu, Lucian; Collazuol, Gianmaria; Collins, Paula; Comerma-Montells, Albert; Contu, Andrea; Cook, Andrew; Coombes, Matthew; Coquereau, Samuel; Corti, Gloria; Corvo, Marco; Couturier, Benjamin; Cowan, Greig; Craik, Daniel Charles; Crocombe, Andrew; Cruz Torres, Melissa Maria; Cunliffe, Samuel; Currie, Robert; D'Ambrosio, Carmelo; Dall'Occo, Elena; Dalseno, Jeremy; David, Pieter; Davis, Adam; De Aguiar Francisco, Oscar; De Bruyn, Kristof; De Capua, Stefano; De Cian, Michel; De Miranda, Jussara; De Paula, Leandro; De Simone, Patrizia; Dean, Cameron Thomas; Decamp, Daniel; Deckenhoff, Mirko; Del Buono, Luigi; Déléage, Nicolas; Demmer, Moritz; Derkach, Denis; Deschamps, Olivier; Dettori, Francesco; Dey, Biplab; Di Canto, Angelo; Di Ruscio, Francesco; Dijkstra, Hans; Donleavy, Stephanie; Dordei, Francesca; Dorigo, Mirco; Dosil Suárez, Alvaro; Dovbnya, Anatoliy; Dreimanis, Karlis; Dufour, Laurent; Dujany, Giulio; Dungs, Kevin; Durante, Paolo; Dzhelyadin, Rustem; Dziurda, Agnieszka; Dzyuba, Alexey; Easo, Sajan; Egede, Ulrik; Egorychev, Victor; Eidelman, Semen; Eisenhardt, Stephan; Eitschberger, Ulrich; Ekelhof, Robert; Eklund, Lars; El Rifai, Ibrahim; Elsasser, Christian; Ely, Scott; Esen, Sevda; Evans, Hannah Mary; Evans, Timothy; Falabella, Antonio; Färber, Christian; Farley, Nathanael; Farry, Stephen; Fay, Robert; Fazzini, Davide; Ferguson, Dianne; Fernandez Albor, Victor; Ferrari, Fabio; Ferreira Rodrigues, Fernando; Ferro-Luzzi, Massimiliano; Filippov, Sergey; Fiore, Marco; Fiorini, Massimiliano; Firlej, Miroslaw; Fitzpatrick, Conor; Fiutowski, Tomasz; Fleuret, Frederic; Fohl, Klaus; Fol, Philip; Fontana, Marianna; Fontanelli, Flavio; Forshaw, Dean Charles; Forty, Roger; Frank, Markus; Frei, Christoph; Frosini, Maddalena; Fu, Jinlin; Furfaro, Emiliano; Gallas Torreira, Abraham; Galli, Domenico; Gallorini, Stefano; Gambetta, Silvia; Gandelman, Miriam; Gandini, Paolo; Gao, Yuanning; García Pardiñas, Julián; Garra Tico, Jordi; Garrido, Lluis; Gascon, David; Gaspar, Clara; Gavardi, Laura; Gazzoni, Giulio; Gerick, David; Gersabeck, Evelina; Gersabeck, Marco; Gershon, Timothy; Ghez, Philippe; Gianì, Sebastiana; Gibson, Valerie; Girard, Olivier Göran; Giubega, Lavinia-Helena; Gligorov, V.V.; Göbel, Carla; Golubkov, Dmitry; Golutvin, Andrey; Gomes, Alvaro; Gotti, Claudio; Grabalosa Gándara, Marc; Graciani Diaz, Ricardo; Granado Cardoso, Luis Alberto; Graugés, Eugeni; Graverini, Elena; Graziani, Giacomo; Grecu, Alexandru; Griffith, Peter; Grillo, Lucia; Grünberg, Oliver; Gui, Bin; Gushchin, Evgeny; Guz, Yury; Gys, Thierry; Hadavizadeh, Thomas; Hadjivasiliou, Christos; Haefeli, Guido; Haen, Christophe; Haines, Susan; Hall, Samuel; Hamilton, Brian; Han, Xiaoxue; Hansmann-Menzemer, Stephanie; Harnew, Neville; Harnew, Samuel; Harrison, Jonathan; He, Jibo; Head, Timothy; Heijne, Veerle; Heister, Arno; Hennessy, Karol; Henrard, Pierre; Henry, Louis; Hernando Morata, Jose Angel; van Herwijnen, Eric; Heß, Miriam; Hicheur, Adlène; Hill, Donal; Hoballah, Mostafa; Hombach, Christoph; Hongming, Li; Hulsbergen, Wouter; Humair, Thibaud; Hushchyn, Mikhail; Hussain, Nazim; Hutchcroft, David; Hynds, Daniel; Idzik, Marek; Ilten, Philip; Jacobsson, Richard; Jaeger, Andreas; Jalocha, Pawel; Jans, Eddy; Jawahery, Abolhassan; John, Malcolm; Johnson, Daniel; Jones, Christopher; Joram, Christian; Jost, Beat; Jurik, Nathan; Kandybei, Sergii; Kanso, Walaa; Karacson, Matthias; Karbach, Moritz; Karodia, Sarah; Kecke, Matthieu; Kelsey, Matthew; Kenyon, Ian; Kenzie, Matthew; Ketel, Tjeerd; Khairullin, Egor; Khanji, Basem; Khurewathanakul, Chitsanu; Kirn, Thomas; Klaver, Suzanne; Klimaszewski, Konrad; Kochebina, Olga; Kolpin, Michael; Komarov, Ilya; Koopman, Rose; Koppenburg, Patrick; Kozeiha, Mohamad; Kravchuk, Leonid; Kreplin, Katharina; Kreps, Michal; Krokovny, Pavel; Kruse, Florian; Krzemien, Wojciech; Kucewicz, Wojciech; Kucharczyk, Marcin; Kudryavtsev, Vasily; Kuonen, Axel Kevin; Kurek, Krzysztof; Kvaratskheliya, Tengiz; Lacarrere, Daniel; Lafferty, George; Lai, Adriano; Lambert, Dean; Lanfranchi, Gaia; Langenbruch, Christoph; Langhans, Benedikt; Latham, Thomas; Lazzeroni, Cristina; Le Gac, Renaud; van Leerdam, Jeroen; Lees, Jean-Pierre; Lefèvre, Regis; Leflat, Alexander; Lefrançois, Jacques; Lemos Cid, Edgar; Leroy, Olivier; Lesiak, Tadeusz; Leverington, Blake; Li, Yiming; Likhomanenko, Tatiana; Liles, Myfanwy; Lindner, Rolf; Linn, Christian; Lionetto, Federica; Liu, Bo; Liu, Xuesong; Loh, David; Longstaff, Iain; Lopes, Jose; Lucchesi, Donatella; Lucio Martinez, Miriam; Luo, Haofei; Lupato, Anna; Luppi, Eleonora; Lupton, Oliver; Lusardi, Nicola; Lusiani, Alberto; Machefert, Frederic; Maciuc, Florin; Maev, Oleg; Maguire, Kevin; Malde, Sneha; Malinin, Alexander; Manca, Giulia; Mancinelli, Giampiero; Manning, Peter Michael; Mapelli, Alessandro; Maratas, Jan; Marchand, Jean François; Marconi, Umberto; Marin Benito, Carla; Marino, Pietro; Marks, Jörg; Martellotti, Giuseppe; Martin, Morgan; Martinelli, Maurizio; Martinez Santos, Diego; Martinez Vidal, Fernando; Martins Tostes, Danielle; Massacrier, Laure Marie; Massafferri, André; Matev, Rosen; Mathad, Abhijit; Mathe, Zoltan; Matteuzzi, Clara; Mauri, Andrea; Maurin, Brice; Mazurov, Alexander; McCann, Michael; McCarthy, James; McNab, Andrew; McNulty, Ronan; Meadows, Brian; Meier, Frank; Meissner, Marco; Melnychuk, Dmytro; Merk, Marcel; Merli, Andrea; Michielin, Emanuele; Milanes, Diego Alejandro; Minard, Marie-Noelle; Mitzel, Dominik Stefan; Molina Rodriguez, Josue; Monroy, Ignacio Alberto; Monteil, Stephane; Morandin, Mauro; Morawski, Piotr; Mordà, Alessandro; Morello, Michael Joseph; Moron, Jakub; Morris, Adam Benjamin; Mountain, Raymond; Muheim, Franz; Müller, Dominik; Müller, Janine; Müller, Katharina; Müller, Vanessa; Mussini, Manuel; Muster, Bastien; Naik, Paras; Nakada, Tatsuya; Nandakumar, Raja; Nandi, Anita; Nasteva, Irina; Needham, Matthew; Neri, Nicola; Neubert, Sebastian; Neufeld, Niko; Neuner, Max; Nguyen, Anh Duc; Nguyen-Mau, Chung; Niess, Valentin; Nieswand, Simon; Niet, Ramon; Nikitin, Nikolay; Nikodem, Thomas; Novoselov, Alexey; O'Hanlon, Daniel Patrick; Oblakowska-Mucha, Agnieszka; Obraztsov, Vladimir; Ogilvy, Stephen; Okhrimenko, Oleksandr; Oldeman, Rudolf; Onderwater, Gerco; Osorio Rodrigues, Bruno; Otalora Goicochea, Juan Martin; Otto, Adam; Owen, Patrick; Oyanguren, Maria Aranzazu; Palano, Antimo; Palombo, Fernando; Palutan, Matteo; Panman, Jacob; Papanestis, Antonios; Pappagallo, Marco; Pappalardo, Luciano; Pappenheimer, Cheryl; Parker, William; Parkes, Christopher; Passaleva, Giovanni; Patel, Girish; Patel, Mitesh; Patrignani, Claudia; Pearce, Alex; Pellegrino, Antonio; Penso, Gianni; Pepe Altarelli, Monica; Perazzini, Stefano; Perret, Pascal; Pescatore, Luca; Petridis, Konstantinos; Petrolini, Alessandro; Petruzzo, Marco; Picatoste Olloqui, Eduardo; Pietrzyk, Boleslaw; Pikies, Malgorzata; Pinci, Davide; Pistone, Alessandro; Piucci, Alessio; Playfer, Stephen; Plo Casasus, Maximo; Poikela, Tuomas; Polci, Francesco; Poluektov, Anton; Polyakov, Ivan; Polycarpo, Erica; Popov, Alexander; Popov, Dmitry; Popovici, Bogdan; Potterat, Cédric; Price, Eugenia; Price, Joseph David; Prisciandaro, Jessica; Pritchard, Adrian; Prouve, Claire; Pugatch, Valery; Puig Navarro, Albert; Punzi, Giovanni; Qian, Wenbin; Quagliani, Renato; Rachwal, Bartolomiej; Rademacker, Jonas; Rama, Matteo; Ramos Pernas, Miguel; Rangel, Murilo; Raniuk, Iurii; Raven, Gerhard; Redi, Federico; Reichert, Stefanie; dos Reis, Alberto; Renaudin, Victor; Ricciardi, Stefania; Richards, Sophie; Rihl, Mariana; Rinnert, Kurt; Rives Molina, Vincente; Robbe, Patrick; Rodrigues, Ana Barbara; Rodrigues, Eduardo; Rodriguez Lopez, Jairo Alexis; Rodriguez Perez, Pablo; Rogozhnikov, Alexey; Roiser, Stefan; Romanovsky, Vladimir; Romero Vidal, Antonio; Ronayne, John William; Rotondo, Marcello; Ruf, Thomas; Ruiz Valls, Pablo; Saborido Silva, Juan Jose; Sagidova, Naylya; Saitta, Biagio; Salustino Guimaraes, Valdir; Sanchez Mayordomo, Carlos; Sanmartin Sedes, Brais; Santacesaria, Roberta; Santamarina Rios, Cibran; Santimaria, Marco; Santovetti, Emanuele; Sarti, Alessio; Satriano, Celestina; Satta, Alessia; Saunders, Daniel Martin; Savrina, Darya; Schael, Stefan; Schiller, Manuel; Schindler, Heinrich; Schlupp, Maximilian; Schmelling, Michael; Schmelzer, Timon; Schmidt, Burkhard; Schneider, Olivier; Schopper, Andreas; Schubiger, Maxime; Schune, Marie Helene; Schwemmer, Rainer; Sciascia, Barbara; Sciubba, Adalberto; Semennikov, Alexander; Sergi, Antonino; Serra, Nicola; Serrano, Justine; Sestini, Lorenzo; Seyfert, Paul; Shapkin, Mikhail; Shapoval, Illya; Shcheglov, Yury; Shears, Tara; Shekhtman, Lev; Shevchenko, Vladimir; Shires, Alexander; Siddi, Benedetto Gianluca; Silva Coutinho, Rafael; Silva de Oliveira, Luiz Gustavo; Simi, Gabriele; Sirendi, Marek; Skidmore, Nicola; Skwarnicki, Tomasz; Smith, Eluned; Smith, Iwan Thomas; Smith, Jackson; Smith, Mark; Snoek, Hella; Sokoloff, Michael; Soler, Paul; Soomro, Fatima; Souza, Daniel; Souza De Paula, Bruno; Spaan, Bernhard; Spradlin, Patrick; Sridharan, Srikanth; Stagni, Federico; Stahl, Marian; Stahl, Sascha; Stefkova, Slavomira; Steinkamp, Olaf; Stenyakin, Oleg; Stevenson, Scott; Stoica, Sabin; Stone, Sheldon; Storaci, Barbara; Stracka, Simone; Straticiuc, Mihai; Straumann, Ulrich; Sun, Liang; Sutcliffe, William; Swientek, Krzysztof; Swientek, Stefan; Syropoulos, Vasileios; Szczekowski, Marek; Szumlak, Tomasz; T'Jampens, Stephane; Tayduganov, Andrey; Tekampe, Tobias; Tellarini, Giulia; Teubert, Frederic; Thomas, Christopher; Thomas, Eric; van Tilburg, Jeroen; Tisserand, Vincent; Tobin, Mark; Todd, Jacob; Tolk, Siim; Tomassetti, Luca; Tonelli, Diego; Topp-Joergensen, Stig; Tournefier, Edwige; Tourneur, Stephane; Trabelsi, Karim; Traill, Murdo; Tran, Minh Tâm; Tresch, Marco; Trisovic, Ana; Tsaregorodtsev, Andrei; Tsopelas, Panagiotis; Tuning, Niels; Ukleja, Artur; Ustyuzhanin, Andrey; Uwer, Ulrich; Vacca, Claudia; Vagnoni, Vincenzo; Valenti, Giovanni; Vallier, Alexis; Vazquez Gomez, Ricardo; Vazquez Regueiro, Pablo; Vázquez Sierra, Carlos; Vecchi, Stefania; van Veghel, Maarten; Velthuis, Jaap; Veltri, Michele; Veneziano, Giovanni; Vesterinen, Mika; Viaud, Benoit; Vieira, Daniel; Vieites Diaz, Maria; Vilasis-Cardona, Xavier; Volkov, Vladimir; Vollhardt, Achim; Voong, David; Vorobyev, Alexey; Vorobyev, Vitaly; Voß, Christian; de Vries, Jacco; Waldi, Roland; Wallace, Charlotte; Wallace, Ronan; Walsh, John; Wang, Jianchun; Ward, David; Watson, Nigel; Websdale, David; Weiden, Andreas; Whitehead, Mark; Wicht, Jean; Wilkinson, Guy; Wilkinson, Michael; Williams, Mark Richard James; Williams, Matthew; Williams, Mike; Williams, Timothy; Wilson, Fergus; Wimberley, Jack; Wishahi, Julian; Wislicki, Wojciech; Witek, Mariusz; Wormser, Guy; Wotton, Stephen; Wraight, Kenneth; Wright, Simon; Wyllie, Kenneth; Xie, Yuehong; Xu, Zhirui; Yang, Zhenwei; Yin, Hang; Yu, Jiesheng; Yuan, Xuhao; Yushchenko, Oleg; Zangoli, Maria; Zavertyaev, Mikhail; Zhang, Liming; Zhang, Yanxi; Zhelezov, Alexey; Zhokhov, Anatoly; Zhong, Liang; Zhukov, Valery; Zucchelli, Stefano

    2016-01-01

    Charm meson oscillations are observed in a time-dependent analysis of the ratio of $D^0\\to K^+\\pi^-\\pi^+\\pi^-$ to $D^0\\to K^-\\pi^+\\pi^-\\pi^+$ decay rates, using data corresponding to an integrated luminosity of $3.0\\,{\\rm fb}^{-1}$ recorded by the LHCb experiment. The measurements presented are sensitive to the phase-space averaged ratio of doubly Cabibbo-suppressed to Cabibbo-favoured amplitudes $r_{D}^{K3\\pi}$ and the product of the coherence factor $R_{D}^{K3\\pi}$ and a charm mixing parameter $y^{'}_{K3\\pi}$. The constraints measured are $r_{D}^{K3\\pi}=(5.67 \\pm 0.12)\\times10^{-2}$, which is the most precise determination to date, and $R_{D}^{K3\\pi} \\cdot y^{'}_{K3\\pi} = (0.3 \\pm 1.8)\\times 10^{-3}$, which provides useful input for determinations of the CP-violating phase $\\gamma$ in $B^\\pm \\to D K^\\pm, D \\to K^\\mp\\pi^\\pm\\pi^\\mp\\pi^\\pm$ decays. The analysis also gives the most precise measurement of the $D^0\\to K^+\\pi^-\\pi^+\\pi^-$ branching fraction, and the first observation of $D^0-\\bar D^0$ oscillations...

  10. Search for D0--anti-D0 mixing in the decays D0 --> K+ pi- pi+ pi-

    CERN Document Server

    Aubert, B; Bóna, M; Boutigny, D; Couderc, F; Karyotakis, Yu; Lees, J P; Poireau, V; Tisserand, V; Zghiche, A; Graugès-Pous, E; Palano, A; Chen, J C; Qi, N D; Rong, G; Wang, P; Zhu, Y S; Eigen, G; Ofte, I; Stugu, B; Abrams, G S; Battaglia, M; Brown, D N; Button-Shafer, J; Cahn, R N; Charles, E; Gill, M S; Groysman, Y; Jacobsen, R G; Kadyk, J A; Kerth, L T; Kolomensky, Yu G; Kukartsev, G; Lynch, G; Mir, L M; Orimoto, T J; Pripstein, M; Roe, N A; Ronan, M T; Wenzel, W A; Del Amo-Sánchez, P; Barrett, M; Ford, K E; Hart, A J; Harrison, T J; Hawkes, C M; Morgan, S E; Watson, A T; Held, T; Koch, H; Lewandowski, B; Pelizaeus, M; Peters, K; Schröder, T; Steinke, M; Boyd, J T; Burke, J P; Cottingham, W N; Walker, D; Asgeirsson, D J; Çuhadar-Dönszelmann, T; Fulsom, B G; Hearty, C; Knecht, N S; Mattison, T S; McKenna, J A; Khan, A; Kyberd, P; Saleem, M; Sherwood, D J; Teodorescu, L; Blinov, V E; Bukin, A D; Druzhinin, V P; Golubev, V B; Onuchin, A P; Serednyakov, S I; Skovpen, Yu I; Solodov, E P; Todyshev, Y K; Best, D S; Bondioli, M; Bruinsma, M; Chao, M; Curry, S; Eschrich, I; Kirkby, D; Lankford, A J; Lund, P; Mandelkern, M A; Mommsen, R K; Röthel, W; Stoker, D P; Abachi, S; Buchanan, C; Foulkes, S D; Gary, J W; Long, O; Shen, B C; Wang, K; Zhang, L; Hadavand, H K; Hill, E J; Paar, H P; Rahatlou, S; Sharma, V; Berryhill, J W; Campagnari, C; Cunha, A; Dahmes, B; Hong, T M; Kovalskyi, D; Richman, J D; Beck, T W; Eisner, A M; Flacco, C J; Heusch, C A; Kroseberg, J; Lockman, W S; Nesom, G; Schalk, T; Schumm, B A; Seiden, A; Spradlin, P; Williams, D C; Wilson, M G; Albert, J; Chen, E; Dvoretskii, A; Fang, F; Hitlin, D G; Narsky, I; Piatenko, T; Porter, F C; Ryd, A; Samuel, A; Mancinelli, G; Meadows, B T; Mishra, K; Sokoloff, M D; Blanc, F; Bloom, P C; Chen, S; Ford, W T; Hirschauer, J F; Kreisel, A; Nagel, M; Nauenberg, U; Olivas, A; Ruddick, W O; Smith, J G; Ulmer, K A; Wagner, S R; Zhang, J; Chen, A; Eckhart, E A; Soffer, A; Toki, W H; Wilson, R J; Winklmeier, F; Zeng, Q; Altenburg, D D; Feltresi, E; Hauke, A; Jasper, H; Merkel, J; Petzold, A; Spaan, B; Brandt, T; Klose, V; Lacker, H M; Mader, W F; Nogowski, R; Schubert, J; Schubert, K R; Schwierz, R; Sundermann, J E; Volk, A; Bernard, D; Bonneaud, G R; Latour, E; Thiebaux, C; Verderi, M; Clark, P J; Gradl, W; Muheim, F; Playfer, S; Robertson, A I; Xie, Y; Andreotti, M; Bettoni, D; Bozzi, C; Calabrese, R; Cibinetto, G; Luppi, E; Negrini, M; Petrella, A; Piemontese, L; Prencipe, E; Anulli, F; Baldini-Ferroli, R; Calcaterra, A; De Sangro, R; Finocchiaro, G; Pacetti, S; Patteri, P; Peruzzi, I M; Piccolo, M; Rama, M; Zallo, A; Buzzo, A; Capra, R; Contri, R; Lo Vetere, M; Macri, M M; Monge, M R; Passaggio, S; Patrignani, C; Robutti, E; Santroni, A; Tosi, S; Brandenburg, G; Chaisanguanthum, K S; Morii, M; Wu, J; Dubitzky, R S; Marks, J; Schenk, S; Uwer, U; Bard, D J; Bhimji, W; Bowerman, D A; Dauncey, P D; Egede, U; Flack, R L; Nash, J A; Nikolich, M B; Panduro-Vazquez, W; Behera, P K; Chai, X; Charles, M J; Mallik, U; Meyer, N T; Ziegler, V; Cochran, J; Crawley, H B; Dong, L; Eyges, V; Meyer, W T; Prell, S; Rosenberg, E I; Rubin, A E; Gritsan, A V; Denig, A G; Fritsch, M; Schott, G; Arnaud, N; Davier, M; Grosdidier, G; Höcker, A; Le Diberder, F R; Lepeltier, V; Lutz, A M; Oyanguren, A; Pruvot, S; Rodier, S; Roudeau, P; Schune, M H; Stocchi, A; Wang, W F; Wormser, G; Cheng, C H; Lange, D J; Wright, D M; Chavez, C A; Forster, I J; Fry, J R; Gabathuler, E; Gamet, R; George, K A; Hutchcroft, D E; Payne, D J; Schofield, K C; Touramanis, C; Bevan, A J; Di Lodovico, F; Menges, W; Sacco, R; Cowan, G; Flächer, H U; Hopkins, D A; Jackson, P S; McMahon, T R; Ricciardi, S; Salvatore, F; Wren, A C; Davis, C L; Allison, J; Barlow, N R; Barlow, R J; Chia, Y M; Edgar, C L; Lafferty, G D; Naisbit, M T; Williams, J C; Yi, J I; Chen, C; Hulsbergen, W D; Jawahery, A; Lae, C K; Roberts, D A; Simi, G; Blaylock, G; Dallapiccola, C; Hertzbach, S S; Li, X; Moore, T B; Saremi, S; Stängle, H; Cowan, R; Sciolla, G; Sekula, S J; Spitznagel, M; Taylor, F; Yamamoto, R K; Zheng, Y; Kim, H; Mclachlin, S E; Patel, P M; Robertson, S H; Lazzaro, A; Lombardo, V; Palombo, F; Bauer, J M; Cremaldi, L; Eschenburg, V; Godang, R; Kroeger, R; Sanders, D A; Summers, D J; Zhao, H W; Brunet, S; Côté, D; Simard, M; Taras, P; Viaud, F B; Nicholson, H; Cavallo, N; De Nardo, Gallieno; Fabozzi, F; Gatto, C; Lista, L; Monorchio, D; Paolucci, P; Piccolo, D; Sciacca, C; Baak, M A; Raven, G; Snoek, H L; Jessop, C P; LoSecco, J M; Allmendinger, T; Benelli, G; Corwin, L A; Gan, K K; Honscheid, K; Hufnagel, D; Jackson, P D; Kagan, H; Kass, R; Rahimi, A M; Regensburger, J J; Ter-Antonian, R; Wong, Q K; Blount, N L; Brau, J E; Frey, R; Igonkina, O; Kolb, J A; Lu, M; Rahmat, R; Sinev, N B; Strom, D; Strube, J; Torrence, E; Gaz, A; Margoni, M; Morandin, M; Pompili, A; Posocco, M; Rotondo, M; Simonetto, F; Stroili, R; Voci, C; Benayoun, M; Briand, H; Chauveau, J; David, P; Del Buono, L; La Vaissière, C de; Hamon, O; Hartfiel, B L; John, M J J; Leruste, P; Malcles, J; Ocariz, J; Roos, L; Therin, G; Gladney, L; Panetta, J; Biasini, M; Covarelli, R; Angelini, C; Batignani, G; Bettarini, S; Bucci, F; Calderini, G; Carpinelli, M; Cenci, R; Forti, F; Giorgi, M A; Lusiani, A; Marchiori, G; Mazur, M A; Morganti, M; Neri, N; Paoloni, E; Rizzo, G; Walsh, J J; Haire, M; Judd, D; Wagoner, D E; Biesiada, J; Danielson, N; Elmer, P; Lau, Y P; Lü, C; Olsen, J; Smith, A J S; Telnov, A V; Bellini, F; Cavoto, G; D'Orazio, A; Del Re, D; Di Marco, E; Faccini, R; Ferrarotto, F; Ferroni, F; Gaspero, M; Li Gioi, L; Mazzoni, M A; Morganti, S; Piredda, G; Polci, F; Safai-Tehrani, F; Voena, C; Ebert, M; Schröder, H; Waldi, R; Adye, T; De Groot, N; Franek, B; Olaiya, E O; Wilson, F F; Aleksan, R; Emery, S; Gaidot, A; Ganzhur, S F; Hamel de Monchenault, G; Kozanecki, Witold; Legendre, M; Vasseur, G; Yéche, C; Zito, M; Chen, X R; Liu, H; Park, W; Purohit, M V; Wilson, J R; Allen, M T; Aston, D; Bartoldus, R; Bechtle, P; Berger, N; Claus, R; Coleman, J P; Convery, M R; Cristinziani, M; Dingfelder, J C; Dorfan, J; Dubois-Felsmann, G P; Dujmic, D; Dunwoodie, W M; Field, R C; Glanzman, T; Gowdy, S J; Graham, M T; Grenier, P; Halyo, V; Hast, C; Hrynóva, T; Innes, W R; Kelsey, M H; Kim, P; Leith, D W G S; Li, S; Luitz, S; Lüth, V; Lynch, H L; MacFarlane, D B; Marsiske, H; Messner, R; Müller, D R; O'Grady, C P; Ozcan, V E; Perazzo, A; Perl, M; Pulliam, T; Ratcliff, B N; Roodman, A; Salnikov, A A; Schindler, R H; Schwiening, J; Snyder, A; Stelzer, J; Su, D; Sullivan, M K; Suzuki, K; Swain, S K; Thompson, J M; Vavra, J; Van Bakel, N; Weaver, M; Weinstein, A J R; Wisniewski, W J; Wittgen, M; Wright, D H; Yarritu, A K; Yi, K; Young, C C; Burchat, P R; Edwards, A J; Majewski, S A; Petersen, B A; Roat, C; Wilden, L; Ahmed, S; Alam, M S; Bula, R; Ernst, J A; Jain, V; Pan, B; Saeed, M A; Wappler, F R; Zain, S B; Bugg, W; Krishnamurthy, M; Spanier, S M; Eckmann, R; Ritchie, J L; Satpathy, A; Schilling, C J; Schwitters, R F; Izen, J M; Lou, X C; Ye, S; Bianchi, F; Gallo, F; Gamba, D; Bomben, M; Bosisio, L; Cartaro, C; Cossutti, F; Della Ricca, G; Dittongo, S; Lanceri, L; Vitale, L; Azzolini, V; Lopez-March, N; Martínez-Vidal, F; Banerjee, Sw; Bhuyan, B; Brown, C M; Fortin, D; Hamano, K; Kowalewski, R V; Nugent, I M; Roney, J M; Sobie, R J; Back, J J; Harrison, P F; Latham, T E; Mohanty, G B; Pappagallo, M; Band, H R; Chen, X; Cheng, B; Dasu, S; Datta, M; Flood, K T; Hollar, J J; Kutter, P E; Mellado, B; Mihályi, A; Pan, Y; Pierini, M; Prepost, R; Wu, S L; Yu, Z; Neal, H; al, et

    2006-01-01

    We present a search for D0--anti-D0 mixing in the decays D0 --> K+ pi- pi+ pi- using 230.4 fb-1 of data collected with the BaBar detector at the PEP-II e+ e- collider at SLAC. Assuming CP conservation, we measure the time-integrated mixing rate R_M = (0.019 +0.016/-0.015(stat.) +/- 0.002(syst.))%, and R_M K+ pi- pi0, we find R_M = (0.020 +0.011/-0.010)%, where the uncertainty is statistical only. We determine the upper limit R_M < 0.042% at the 95% confidence level, and we find the combined data are consistent with the no-mixing hypothesis at the 2.1% confidence level.

  11. A model for the [gamma]p[yields][pi][sup +][pi][sup -]p reactions

    Energy Technology Data Exchange (ETDEWEB)

    Gomez Tejedor, J.A. (Dept. de Fisica Teorica, Centro Mixto Universidad de Valencia-CSIC, Burjassot (Spain) IFIC, Centro Mixto Universidad de Valencia-CSIC, Burjassot (Spain)); Oset, E. (Dept. de Fisica Teorica, Centro Mixto Universidad de Valencia-CSIC, Burjassot (Spain) IFIC, Centro Mixto Universidad de Valencia-CSIC, Burjassot (Spain))

    1994-05-09

    We have studied the [gamma]p[yields][pi][sup +][pi][sup -]p reaction using a model which includes N, [Delta](1232), N[sup *](1440) and N[sup *](1520) intermediate baryonic states and the [rho]-meson as intermediate 2[pi]-resonance. The model reproduces fairly well experimental cross sections below E[sub [gamma

  12. Phase motion of the scalar {pi}{pi} amplitudes in D{sup +}, D{sub s}{sup +} {yields} {pi}{sup -} {pi}{sup +}{pi}{sup +} decays

    Energy Technology Data Exchange (ETDEWEB)

    Ignacio Bediaga

    2003-08-13

    We make a direct and model-independent measurement of the low {pi}{sup +} {pi}{sup -} mass phase motion in the D{sup +} {yields} {pi}{sup -} {pi}{sup +}{pi}{sup +} decay. Our preliminary results show a strong phase variation, compatible with the isoscalar {sigma}(500) meson. This result confirms our previous result [1] where we found evidence for the existence of this scalar particle using full Dalitz-plot analysis. We apply the Amplitude Difference (AD) method [2] to the same Fermilab E791 data sample used in the preceding analysis. We also give an example of how we extract the phase motion of the scalar amplitude, looking at the f{sub 0}(980) in D{sub s}{sup +} {yields} {pi}{sup -} {pi}{sup +}{pi}{sup +} decay.

  13. OpenDomo en Raspberry Pi

    OpenAIRE

    Sánchez Herrero, David

    2013-01-01

    Portabilidad del sistema de control domótico OpenDomo a la arquitectura ARM (Raspberry Pi). Portabilitat del sistema de control domòtic OpenDomo a l'arquitectura ARM (Raspberry Pi). Master thesis for the Free software program.

  14. IoT con Raspberry Pi

    OpenAIRE

    García Muelas, Carlos

    2015-01-01

    Estudio de diferentes plataformas software y hardware del internet de las cosas. Aplicación real con Raspberry Pi. Estudi de diferents plataformes programari i maquinari de l'internet de les coses. Aplicació real amb Raspberry Pi. Bachelor thesis for the Telecommunication Technologies program on Telematics.

  15. Power Monitoring Using the Raspberry Pi

    Science.gov (United States)

    Snyder, Robin M.

    2014-01-01

    The Raspberry Pi is a credit card size low powered compute board with Ethernet connection, HDMI video output, audio, full Linux operating system run from an SD card, and more, all for $45. With cables, SD card, etc., the cost is about $70. Originally designed to help teach computer science principles to low income children and students, the Pi has…

  16. Dynamics of pi-junction interferometer circuits

    DEFF Research Database (Denmark)

    Kornkev, V.K.; Mozhaev, P.B.; Borisenko, I.V.;

    2002-01-01

    The pi-junction superconducting circuit dynamics was studied by means of numerical simulation technique. Parallel arrays consisting of Josephson junctions of both 0- and pi-type were studied as a model of high-T-c grain-boundary Josephson junction. The array dynamics and the critical current...

  17. Raspberry Pi home automation with Arduino

    CERN Document Server

    Dennis, Andrew K

    2015-01-01

    If you are new to the Raspberry Pi, the Arduino, or home automation and wish to develop some amazing projects using these tools, then this book is for you. Any experience in using the Raspberry Pi would be an added advantage.

  18. A Rapidly Converging Recursive Approach to Pi.

    Science.gov (United States)

    Dence, Joseph B.; Dence, Thomas P.

    1993-01-01

    Presents an algorithm to estimate pi by approximating a unit circle with a sequence of inscribed regular polygons. Demonstrates the application of the algorithm with a hand-held calculator and an Apple computer. Provides a program to calculate pi in Pascal programing language. (12 references) (MDH)

  19. Exotic and qq-bar resonances in the pi+pi-pi- system produced in pi-p collisions at 18 GeV/c

    Energy Technology Data Exchange (ETDEWEB)

    S. U. Chung; K. Danyo; R. W. Hackenburg; C. Olchanski; J. S. Suh; H. J. Willutzki; S. P. Denisov; V. Dorofeev; V. V. Lipaev; A. V. Popov; D. I. Ryabchikov; Z. Bar-Yam; J. P. Dowd; P. Eugenio; M. Hayek; W. Kern; E. King; N. Shenhav; V. A. Bodyagin; O. L. Kodolova; V. L. Korotkikh; M. A. Kostin; A. I. Ostrovidov; L. I. Sarycheva; I. N. Vardanyan; A. A. Yershov; D. S. Brown; X. L. Fan; D. Joffe; T. K. Pedlar; K. K. Seth; A. Tomaradze; T. Adams; J. M. Bishop; N. M. Cason; E. I. Ivanov; J. M. LoSecco; J. J. Manak; W. D. Shephard; D. L. Stienike; S. A. Taegar; G. S. Adams; J. P. Cummings; J. Hu; J. Kuhn; M. Lu; J. Napolitano; D. B. White; M. Witkowski; M. Nozar; X. Shen; D. P. Weygand

    2002-03-01

    A partial-wave analysis of the reaction pi{sup -}p-->pi{sup +}pi{sup -}pi{sup -}p at 18 GeV/c has been performed on a data sample of 250 000 events obtained in the Brookhaven experiment E852. The well-known a{sub 1}(1260), a{sub 2}(1320) and pi{sub 2}(1670) resonant states are observed. The existence of the pi(1800), a{sub 1}(1700) and a{sub 4}(2040) states is confirmed. The a{sub 3}(1874) state is also observed. The exotic 1{sup -+} pi{sub 1}(1600) state produced in the natural parity exchange process is found to decay in the rho(770)pi{sup -} channel. A mass-dependent fit results in a resonance mass of 1593{+-}8{sub -47}{sup +29} MeV/c{sup 2} and a width of 168{+-}20{sub -12}{sup +150} MeV/c{sup 2}.

  20. Easy as Pi: A Network Coding Raspberry Pi Testbed

    Directory of Open Access Journals (Sweden)

    Chres W. Sørensen

    2016-10-01

    Full Text Available In the near future, upcoming communications and storage networks are expected to tolerate major difficulties produced by huge amounts of data being generated from the Internet of Things (IoT. For these types of networks, strategies and mechanisms based on network coding have appeared as an alternative to overcome these difficulties in a holistic manner, e.g., without sacrificing the benefit of a given network metric when improving another. There has been recurrent issues on: (i making large-scale deployments akin to the Internet of Things; (ii assessing and (iii replicating the obtained results in preliminary studies. Therefore, finding testbeds that can deal with large-scale deployments and not lose historic data in order to evaluate these mechanisms are greatly needed and desirable from a research perspective. However, this can be hard to manage, not only due to the inherent costs of the hardware, but also due to maintenance challenges. In this paper, we present the required key steps to design, setup and maintain an inexpensive testbed using Raspberry Pi devices for communications and storage networks with network coding capabilities. This testbed can be utilized for any applications requiring results replicability.

  1. The role of the Roper resonance in $np \\to d (\\pi\\pi)^{0}$

    CERN Document Server

    Alvarez-Ruso, L

    1999-01-01

    In this work, a model for the n p --> d (pi pi) reaction is developed. It is shown that the structure of the deuteron momentum spectra for a neutron beam momentum of 1.46 GeV can be explained as a consequence of the interplay of two mechanisms involving the excitation of the N^*(1440) resonance and its subsequent decay into N (pi pi)^{T=0}_{S-wave} and Delta pi respectively. The relevance of the present analysis for the study of the Roper excitation and decay properties, as well as for the interpretation of other two-pion production experiments is discussed.

  2. PiMan: System Manager of the “Pi of the Sky” Experiment

    Directory of Open Access Journals (Sweden)

    Krzysztof Nawrocki

    2010-01-01

    Full Text Available This paper describes PiMan, a CORBA-based system manager of the “Pi of the Sky” experiment, whose prototype consisting of two cameras on parallactic mount is running at Las Campanas Observatory in Chile. We discuss in detail all software components of the “Pi of the Sky” system, interactions between them, and the architecture of the PiMan system. PiMan extension and other system software that will control and monitor final system being under construction, consisting of two sites with 16 CCD cameras installed on three mounts per site, is also described in this paper.

  3. Branching Fractions and CP Asymmetries in B0 -> pi0pi0, B+ -> pi+pi0 and B+ -> K+pi0 Decays and Isospin Analysis of the B -> pipi System

    CERN Document Server

    Aubert, B; Boutigny, D; Couderc, F; Karyotakis, Yu; Lees, J P; Poireau, V; Tisserand, V; Zghiche, A; Graugès-Pous, E; Palano, A; Pompili, A; Chen, J C; Qi, N D; Rong, G; Wang, P; Zhu, Y S; Eigen, G; Ofte, I; Stugu, B; Abrams, G S; Borgland, A W; Breon, A B; Brown, D N; Button-Shafer, J; Cahn, R N; Charles, E; Day, C T; Gill, M S; Gritsan, A V; Groysman, Y; Jacobsen, R G; Kadel, R W; Kadyk, J; Kerth, L T; Kolomensky, Yu G; Kukartsev, G; Lynch, G; Mir, L M; Oddone, P J; Orimoto, T J; Pripstein, M; Roe, N A; Ronan, Michael T; Wenzel, W A; Barrett, M; Ford, K E; Harrison, T J; Hart, A J; Hawkes, C M; Morgan, S E; Watson, A T; Fritsch, M; Goetzen, K; Held, T; Koch, H; Lewandowski, B; Pelizaeus, M; Schröder, T; Steinke, M; Boyd, J T; Chevalier, N; Cottingham, W N; Kelly, M P; Latham, T E; Wilson, F F; Çuhadar-Dönszelmann, T; Hearty, C; Knecht, N S; Mattison, T S; McKenna, J A; Thiessen, D; Khan, A; Kyberd, P; Teodorescu, L; Blinov, A E; Blinov, V E; Druzhinin, V P; Golubev, V B; Ivanchenko, V N; Kravchenko, E A; Onuchin, A P; Serednyakov, S I; Skovpen, Yu I; Solodov, E P; Yushkov, A N; Best, D; Bruinsma, M; Chao, M; Eschrich, I; Kirkby, D; Lankford, A J; Mandelkern, M A; Mommsen, R K; Röthel, W; Stoker, D P; Buchanan, C; Hartfiel, B L; Weinstein, A J R; Foulkes, S D; Gary, J W; Long, O; Shen, B C; Wang, K; Del Re, D; Hadavand, H K; Hill, E J; MacFarlane, D B; Paar, H P; Rahatlou, S; Sharma, V; Berryhill, J W; Campagnari, C; Cunha, A; Dahmes, B; Hong, T M; Lu, A; Mazur, M A; Richman, J D; Verkerke, W; Beck, T W; Eisner, A M; Heusch, C A; Kroseberg, J; Lockman, W S; Nesom, G; Schalk, T; Schumm, B A; Seiden, A; Spradlin, P; Williams, D C; Wilson, M G; Albert, J; Chen, E; Dubois-Felsmann, G P; Dvoretskii, A; Hitlin, D G; Narsky, I; Piatenko, T; Porter, F C; Ryd, A; Samuel, A; Yang, S; Jayatilleke, S M; Mancinelli, G; Meadows, B T; Sokoloff, M D; Blanc, F; Bloom, P; Chen, S; Ford, W T; Nauenberg, U; Olivas, A; Rankin, P; Ruddick, W O; Smith, J G; Ulmer, K A; Zhang, J; Zhang, L; Chen, A; Eckhart, E A; Harton, J L; Soffer, A; Toki, W H; Wilson, R J; Zeng, Q; Spaan, B; Altenburg, D; Brandt, T; Brose, J; Dickopp, M; Feltresi, E; Hauke, A; Lacker, H M; Nogowski, R; Otto, S; Petzold, A; Schubert, J; Schubert, Klaus R; Schwierz, R; Sundermann, J E; Bernard, D; Bonneaud, G R; Grenier, P; Schrenk, S; Thiebaux, C; Vasileiadis, G; Verderi, M; Bard, D J; Clark, P J; Muheim, F; Playfer, S; Xie, Y; Andreotti, M; Azzolini, V; Bettoni, D; Bozzi, C; Calabrese, R; Cibinetto, G; Luppi, E; Negrini, M; Piemontese, L; Sarti, A; Anulli, F; Baldini-Ferroli, R; Calcaterra, A; De Sangro, R; Finocchiaro, G; Patteri, P; Peruzzi, I M; Piccolo, M; Zallo, A; Buzzo, A; Capra, R; Contri, R; Crosetti, G; Lo Vetere, M; Macri, M; Monge, M R; Passaggio, S; Patrignani, C; Robutti, E; Santroni, A; Tosi, S; Bailey, S; Brandenburg, G; Chaisanguanthum, K S; Morii, M; Won, E; Dubitzky, R S; Langenegger, U; Marks, J; Uwer, U; Bhimji, W; Bowerman, D A; Dauncey, P D; Egede, U; Gaillard, J R; Morton, G W; Nash, J A; Nikolich, M B; Taylor, G P; Charles, M J; Grenier, G J; Mallik, U; Cochran, J; Crawley, H B; Lamsa, J; Meyer, W T; Prell, S; Rosenberg, E I; Rubin, A E; Yi, J; Arnaud, N; Davier, M; Giroux, X; Grosdidier, G; Höcker, A; Le Diberder, F R; Lepeltier, V; Lutz, A M; Petersen, T C; Plaszczynski, S; Schune, M H; Wormser, G; Cheng, C H; Lange, D J; Simani, M C; Wright, D M; Bevan, A J; Chavez, C A; Coleman, J P; Forster, I J; Fry, J R; Gabathuler, Erwin; Gamet, R; Hutchcroft, D E; Parry, R J; Payne, D J; Touramanis, C; Cormack, C M; Di Lodovico, F; Brown, C L; Cowan, G; Flack, R L; Flächer, H U; Green, M G; Jackson, P S; McMahon, T R; Ricciardi, S; Salvatore, F; Winter, M A; Brown, D; Davis, C L; Allison, J; Barlow, N R; Barlow, R J; Hodgkinson, M C; Lafferty, G D; Williams, J C; Chen, C; Farbin, A; Hulsbergen, W D; Jawahery, A; Kovalskyi, D; Lae, C K; Lillard, V; Roberts, D A; Blaylock, G; Dallapiccola, C; Hertzbach, S S; Kofler, R; Koptchev, V B; Moore, T B; Saremi, S; Stängle, H; Willocq, S; Cowan, R; Koeneke, K; Sciolla, G; Sekula, S J; Taylor, F; Yamamoto, R K; Patel, P M; Robertson, S H; Lazzaro, A; Lombardo, V; Palombo, F; Bauer, J M; Cremaldi, L M; Eschenburg, V; Godang, R; Kroeger, R; Reidy, J; Sanders, D A; Summers, D J; Zhao, H W; Brunet, S; Côté, D; Nicholson, H; Cavallo, N; Lista, L; Monorchio, D; Paolucci, P; Piccolo, D; Sciacca, C; Baak, M; Bulten, H; Raven, G; Snoek, H L; Wilden, L; Jessop, C P; LoSecco, J M; Allmendinger, T; Benelli, G; Gan, K K; Honscheid, K; Hufnagel, D; Kagan, H; Kass, R; Pulliam, T; Rahimi, A M; Ter-Antonian, R; Wong, Q K; Brau, J E; Frey, R; Igonkina, O; Lu, M; Potter, C T; Sinev, N B; Strom, D; Torrence, E; Colecchia, F; Dorigo, A; Galeazzi, F; Margoni, M; Morandin, M; Posocco, M; Rotondo, M; Simonetto, F; Stroili, R; Voci, C; Benayoun, M; Briand, H; Chauveau, J; David, P; La Vaissière, C de; Del Buono, L; Hamon, O; John, M J J; Leruste, P; Malcles, J; Ocariz, J; Roos, L; Therin, G; Behera, P K; Gladney, L; Guo, Q H; Panetta, J; Biasini, M; Covarelli, R; Pioppi, M; Angelini, C; Batignani, G; Bettarini, S; Bondioli, M; Bucci, F; Calderini, G; Carpinelli, M; Forti, F; Giorgi, M A; Lusiani, A; Marchiori, G; Morganti, M; Neri, N; Paoloni, E; Rama, M; Rizzo, G; Simi, G; Walsh, J; Haire, M; Judd, D; Paick, K; Wagoner, D E; Danielson, N; Elmer, P; Lau, Y P; Lü, C; Miftakov, V; Olsen, J; Smith, A J S; Telnov, A V; Bellini, F; Cavoto, G; D'Orazio, A; Di Marco, E; Faccini, R; Ferrarotto, F; Ferroni, F; Gaspero, M; Li Gioi, L; Mazzoni, M A; Morganti, S; Pierini, M; Piredda, G; Polci, F; Safai-Tehrani, F; Voena, C; Christ, S; Schröder, H; Wagner, G; Waldi, R; Adye, T; De Groot, N; Franek, B J; Gopal, G P; Olaiya, E O; Aleksan, Roy; Emery, S; Gaidot, A; Ganzhur, S F; Giraud, P F; Hamel de Monchenault, G; Kozanecki, Witold; Legendre, M; London, G W; Mayer, B; Schott, G; Vasseur, G; Yéche, C; Zito, M; Purohit, M V; Weidemann, A W; Wilson, J R; Yumiceva, F X; Abe, T; Allen, M; Aston, D; Bartoldus, R; Berger, N; Boyarski, A M; Buchmüller, O L; Claus, R; Convery, M R; Cristinziani, M; De Nardo, Gallieno; Dingfelder, J C; Dong, D; Dorfan, J; Dujmic, D; Dunwoodie, W M; Fan, S; Field, R C; Glanzman, T; Gowdy, S J; Hadig, T; Halyo, V; Hast, C; Hrynóva, T; Innes, W R; Kelsey, M H; Kim, P; Kocian, M L; Leith, D W G S; Libby, J; Luitz, S; Lüth, V; Lynch, H L; Marsiske, H; Messner, R; Müller, D R; O'Grady, C P; Ozcan, V E; Perazzo, A; Perl, M; Ratcliff, B N; Roodman, A; Salnikov, A A; Schindler, R H; Schwiening, J; Snyder, A; Soha, A; Stelzer, J; Strube, J; Su, D; Sullivan, M K; Thompson, J; Vavra, J; Wagner, S R; Weaver, M; Wisniewski, W J; Wittgen, M; Wright, D H; Yarritu, A K; Young, C C; Burchat, Patricia R; Edwards, A J; Majewski, S A; Petersen, B A; Roat, C; Ahmed, M; Ahmed, S; Alam, M S; Ernst, J A; Saeed, M A; Saleem, M; Wappler, F R; Bugg, W; Krishnamurthy, M; Spanier, S M; Eckmann, R; Kim, H; Ritchie, J L; Satpathy, A; Schwitters, R F; Izen, J M; Kitayama, I; Lou, X C; Ye, S; Bianchi, F; Bóna, M; Gallo, F; Gamba, D; Bosisio, L; Cartaro, C; Cossutti, F; Della Ricca, G; Dittongo, S; Grancagnolo, S; Lanceri, L; Poropat, P; Vuagnin, G; Martínez-Vidal, F; Panvini, R S; Banerjee, Sw; Bhuyan, B; Brown, C M; Fortin, D; Jackson, P D; Kowalewski, R V; Roney, J M; Sobie, R J; Back, J J; Harrison, P F; Mohanty, G B; Band, H R; Chen, X; Cheng, B; Dasu, S; Datta, M; Eichenbaum, A M; Flood, K T; Graham, M; Hollar, J J; Johnson, J R; Kutter, P E; Li, H; Liu, R; Mihályi, A; Pan, Y; Prepost, R; Tan, P; Von Wimmersperg-Töller, J H; Wu, J; Wu, S L; Yu, Z; Greene, M G; Neal, H

    2004-01-01

    Based on a sample of 227 million BBbar pairs collected by the BaBar detector at the PEP-II asymmetric-energy B Factory at SLAC, we measure the branching fraction B(B0 -> pi0pi0) = (1.17 +- 0.32 +- 0.10) x 1e-6, and the asymmetry C(pi0pi0) = -0.12 +- 0.56 +- 0.06. The B0 -> pi0pi0 signal has a significance of 5.0 sigma. We also measure B(B+ -> pi+pi0) = (5.8 +- 0.6 +- 0.4) x 1e-6, B(B+ -> K+pi0) = (12.0 +- 0.7 +- 0.6) x 1e-6, and the charge asymmetries A(pi+pi0) = -0.01 +- 0.10 +- 0.02 and A(K+pi0) = 0.06 +- 0.06 +- 0.01. Using isospin relations we find an upper bound on the angle difference |alpha - alpha(eff)| of 35 degrees at the 90% C.L.

  4. A solution to B --> pi pi puzzle and B --> K K

    CERN Document Server

    Baek, Seungwon

    2008-01-01

    The large ratio of color-suppressed tree amplitude to color-allowed one in $B \\to \\pi \\pi$ decays is difficult to understand within the Standard Model, which is known as the "$B \\to \\pi\\pi$ puzzle". The two tree diagrams contain the up- and charm-quark component of penguin amplitude, $P_{uc}$, which cannot be separated by measuring $B \\to \\pi \\pi$ decays alone. We show that the measurements of the branching ratio and direct CP asymmetry of $B^+ \\to K^+ \\bar{K^0}$ decay enable one to disentangle the $P_{uc}$ with two-fold ambiguity. One of the two degenerate solutions of the $P_{uc}$ can solve the $B \\to \\pi \\pi$ puzzle by giving $|C/T|\\sim 0.3$ which is consistent with the expectation in the Standard Model. We also show that the two solutions can be discriminated by the measurement of the indirect CP-asymmetry of $B^0 \\to K^0 \\ol{K^0}$. We point out that if the $B \\to \\pi \\pi$ puzzle is solved in this way, the corresponding puzzle in $B \\to \\pi K$ decays should have a different origin.

  5. Revision of absorption corrections for the $p p \\to p p \\pi^{+} \\pi^{-}$ process

    CERN Document Server

    Lebiedowicz, Piotr

    2015-01-01

    We include new additional absorption corrections into the Lebiedowicz-Szczurek (non-resonant) model for $p p \\to p p \\pi^+ \\pi^-$ or $p \\bar p \\to p \\bar p \\pi^+ \\pi^-$ processes. They are related to the $\\pi N$ nonperturbative interaction in the final state of the reaction. The role of the absorption corrections is quantified for several differential distributions for $\\sqrt{s}$ = 0.2, 1.96, 7, and 8 TeV. The new absorption corrections lead to further decrease of the cross section by about a factor of two. They change the shape of some distributions ($d \\sigma/dt$, $d \\sigma/dp_{t,p}$, $d \\sigma/d \\phi_{pp}$) but leave almost unchanged shape of other distributions ($d \\sigma/dM_{\\pi \\pi}$, $d \\sigma/dy_{\\pi}$, $d \\sigma /dp_{t,\\pi}$, $d \\sigma/d \\phi_{\\pi \\pi}$). The effect may have important impact on the interpretation of the recent STAR and CDF data as well as the forthcoming data of the ALICE, ATLAS + ALFA and CMS + TOTEM collaborations.

  6. Finite volume treatment of $\\pi\\pi$ scattering in the $\\rho$ channel

    CERN Document Server

    Albaladejo, M; Oller, J A; Roca, L

    2013-01-01

    We make a theoretical study of $\\pi\\pi$ scattering with quantum numbers $J^{PC}=1^{--}$ in a finite box. To calculate physical observables for infinite volume from lattice QCD, the finite box dependence of the potentials is not usually considered. We quantify such effects by means of two different approaches for vector-isovector $\\pi\\pi$ scattering based on Unitarized Chiral Perturbation Theory results: the Inverse Amplitude Method and another one based on the $N/D$ method. We take into account finite box effects stemming from higher orders through loops in the crossed $t,u-$channels as well as from the renormalization of the coupling constants. The main conclusion is that for $\\pi\\pi$ phase shifts in the isovector channel one can safely apply L\\"uscher based methods for finite box sizes of $L$ greater than $2 m_\\pi^{-1}$.

  7. I=2 pi-pi Scattering from Fully-Dynamical Mixed-Action Lattice QCD

    CERN Document Server

    Beane, S R; Orginos, K; Savage, M J; Beane, Silas R.; Bedaque, Paulo F.; Orginos, Kostas; Savage, Martin J.

    2006-01-01

    We compute the I=2 pi-pi scattering length at pion masses of m_pi= 294, 348 and 484 MeV in fully-dynamical lattice QCD using Luscher's finite-volume method. The calculation is performed with domain-wall valence-quark propagators on asqtad-improved MILC configurations with staggered sea quarks. Chiral perturbation theory is used to perform the extrapolation of the scattering length from lattice quark masses down to the physical value, and we find m_pi a_2 = -0.0426 +- 0.0006 +- 0.0003 +- 0.0018, in good agreement with experiment. The I=2 pi-pi scattering phase shift is calculated to be delta ~ -43 +- 10 +- 5 degrees at |p| ~ 544 MeV for m_pi ~ 484 MeV.

  8. Search for direct CP-violation in $K^{\\pm}\\to \\pi^{\\pm}\\pi^{0}\\pi^{0}$ decays

    CERN Document Server

    Batley, J Richard; Kalmus, George Ernest; Lazzeroni, C; Munday, D J; Slater, M W; Wotton, S A; Arcidiacono, R; Bocquet, G; Cabibbo, Nicola; Ceccucci, A; Cundy, Donald C; Falaleev, V; Fidecaro, Maria; Gatignon, L; Gonidec, A; Kubischta, Werner; Norton, A; Maier, A; Patel, M; Peters, A; Balev, S; Frabetti, P L; Goudzovski, E; Khristov, P Z; Kekelidze, V D; Kozhuharov, V; Litov, L; Madigozhin, D T; Marinova, E; Molokanova, N A; Polenkevich, I; Potrebenikov, Yu K; Stoynev, S; Zinchenko, A I; Monnier, E; Swallow, E; Winston, R; Rubin, P; Walker, A; Baldini, W; Cotta-Ramusino, A; Dalpiaz, P; Damiani, C; Fiorini, M; Gianoli, A; Martini, M; Petrucci, F; Savrié, M; Scarpa, M; Wahl, H; Bizzeti, A; Calvetti, M; Celeghini, E; Iacopini, E; Lenti, M; Martelli, F; Ruggiero, G; Veltri, M; Behler, M; Eppard, K; Kleinknecht, K; Marouelli, P; Masetti, L; Moosbrugger, U; Morales-Morales, C; Renk, B; Wache, M; Wanke, R; Winhart, A; Coward, D; Dabrowski, A; Fonseca-Martin, T; Shieh, M; Szleper, M; Velasco, M; Wood, M D; Anzivino, Giuseppina; Cenci, P; Imbergamo, E; Nappi, A; Pepé, M; Petrucci, M C; Piccini, M; Raggi, M; Valdata-Nappi, M; Cerri, C; Collazuol, G; Costantini, F; Di Lella, Luigi; Doble, Niels T; Fantechi, R; Fiorini, L; Giudici, Sergio; Lamanna, G; Mannelli, I; Michetti, A; Pierazzini, G M; Sozzi, M; Bloch-Devaux, B; Cheshkov, C; Chèze, J B; De Beer, M; Derré, J; Marel, Gérard; Mazzucato, E; Peyaud, B; Vallage, B; Ziolkowski, M; Bifani, S; Biino, C; Cartiglia, N; Clemencic, M; Goy-Lopez, S; Marchetto, F; Dibon, Heinz; Jeitler, Manfred; Markytan, Manfred; Mikulec, I; Neuhofer, G

    2006-01-01

    A search for direct CP-violation in K+- --> pi+-pi0pi0 decays based on 47.14 million events has been performed by the NA48/2 experiment at the CERN SPS. The asymmetry in the Dalitz plot linear slopes A_g=(g^+ - g^-)/(g^+ + g^-) is measured to be A_g=(1.8 +- 2.6).10^{-4}. The design of the experiment and the method of analysis provide good control of instrumental charge asymmetries in this measurement. The precision of the result is limited by statistics and is almost one order of magnitude better than that of previous measurements by other experiments.

  9. Acetone-water complexes at MRCI level using localized orbitals: n ->pi* and pi ->pi* electronic transitions

    DEFF Research Database (Denmark)

    Hoyau, S.; Ben Amor, N.; Borini, Stefano

    2008-01-01

    The n -> pi* and pi -> pi* vertical electronic transitions of acetone with two and four H2O which correspond to a first solvation shell are considered. By using localized orbitals, and thanks to the MRCI approach which permits to know the wave function, the role of the various solvent molecules...... is analysed in details. Distinguishing the solvent molecules allows one to consider them at different calculation levels. The methodology is to compare the spectra obtained with four H2O, with two H2O either in the acetone plane or in a perpendicular plane and when they are completely or partly frozen....

  10. Mass and width of sigma(750) scalar meson from measurements of pi(-)p->pi(-)pi(+)n on polarized target

    OpenAIRE

    Svec, M.

    1997-01-01

    Model independent amplitude analyses of $\\pi^- p_\\uparrow \\to \\pi^- \\pi^+ n$ on polarized target at 17.2 GeV/c reveal resonant structure of S-wave transversity amplitudes $|\\bar S|^2\\Sigma$ and $|S|^2\\Sigma$ near 750 MeV. Simultaneous fit to $|\\bar S|^2\\Sigma$ and $|S|^2\\Sigma$ with a single $\\sigma$ pole yields $m_\\sigma = 775 \\pm 17$ MeV and $\\Gamma_\\sigma = 147 \\pm 33$ MeV. Simultaneous fit with two common $\\sigma$ poles yields a lower $\\chi^2/dpt$. Their resonance parameters are $m_\\sigma...

  11. Investigation of {omega} {yields} {pi}{sup 0}{pi}{sup +}{pi}{sup -} in p-p collisions

    Energy Technology Data Exchange (ETDEWEB)

    Sawant, Siddhesh [Indian Institute of Technology Bombay, Mumbai (India); Collaboration: WASA-at-COSY-Collaboration

    2012-07-01

    The decay mechanism of the {omega} meson into {pi}{sup 0}{pi}{sup +}{pi}{sup -} can be investigated by comparing the experimentally obtained Dalitz plot with that of theoretical predictions. In order to obtain a high-statistics Dalitz plot, {omega} mesons are produced in proton beam-proton target collisions at T{sub p} = 2.063 GeV and in proton beam-deuteron target collisions at T{sub p} = 1.45 GeV and 1.5 GeV at the WASA-at-COSY facility. The poster presents the current status of the analysis with pp collision data.

  12. Exclusive diffractive production of $\\pi^{+}\\pi^{-}\\pi^{+}\\pi^{-}$ via the intermediate $\\sigma\\sigma$ and $\\rho\\rho$ states in proton-proton collisions within tensor pomeron approach

    CERN Document Server

    Lebiedowicz, Piotr; Szczurek, Antoni

    2016-01-01

    We present first predictions of the cross sections and differential distributions for the central exclusive reaction $pp \\to pp \\pi^{+} \\pi^{-} \\pi^{+} \\pi^{-}$ being studied at RHIC and LHC. The amplitudes for the processes are formulated in terms of the tensor pomeron and tensor $f_{2 R}$ reggeon exchanges with the vertices respecting the standard crossing and charge-conjugation relations of Quantum Field Theory. The $\\sigma \\sigma$ and $\\rho \\rho$ contributions to the $\\pi^{+} \\pi^{-} \\pi^{+} \\pi^{-}$ final state are considered focussing on their specificities. The correct inclusion of the pomeron spin structure seems crucial for the considered sequential mechanisms in particular for the $\\rho\\rho$ contribution which is treated here for the first time. The mechanism considered gives a significant contribution to the $pp \\to pp \\pi^{+} \\pi^{-} \\pi^{+} \\pi^{-}$ reaction. We adjust parameters of our model to the CERN-ISR experimental data and present several predictions for the STAR, ALICE, ATLAS and CMS expe...

  13. EKHARA Monte Carlo generator for e+e- to e+e-pi0 and e+e- to e+e- pi+pi- processes

    OpenAIRE

    Czyz, Henryk; Ivashyn, Sergiy

    2010-01-01

    We present EKHARA Monte Carlo event generator of reactions e+e- to e+e- pi0 and e+e- to e+e- pi+pi-. The newly added channel (e+e- to e+e-pi0) is important for gamma*gamma* physics and can be used for the pion transition form factor studies at meson factories.

  14. Measurement of the $pn \\to pp\\pi^0\\pi^-$ Reaction in Search for the Recently Observed Resonance Structure in $d\\pi^0\\pi^0$ and $d\\pi^+\\pi^-$ systems

    CERN Document Server

    Adlarson, P; Bardan, W; Bashkanov, M; Bergmann, F S; Berłowski, M; Bhatt, H; Büscher, M; Calén, H; Ciepał, I; Clement, H; Coderre, D; Czerwiński, E; Demmich, K; Doroshkevich, E; Engels, R; Erven, W; Eyrich, W; Fedorets, P; Föhl, K; Fransson, K; Goldenbaum, F; Goslawski, P; Goswami, A; Grigoryev, K; Gullström, C --O; Hauenstein, F; Heijkenskjöld, L; Hejny, V; Hinterberger, F; Hodana, M; Höistad, B; Jany, A; Jany, B R; Jarczyk, L; Johansson, T; Kamys, B; Kemmerling, G; Khan, F A; Khoukaz, A; Kirillov, D A; Kistryn, S; Klaja, J; Kleines, H; Kłos, B; Krapp, M; Krzemień, W; Kulessa, P; Kupść, A; Lalwani, K; Lersch, D; Li, L; Lorentz, B; Magiera, A; Maier, R; Marciniewski, P; Mariański, B; Mikirtychiants, M; Morsch, H --P; Moskal, P; Nandi, B K; Ohm, H; Ozerianska, I; del Rio, E Perez; Piskunov, N M; Pluciński, P; Podkopał, P; Prasuhn, D; Pricking, A; Pszczel, D; Pysz, K; Pyszniak, A; Redmer, C F; Ritman, J; Roy, A; Rudy, Z; Sawant, S; Schmidt, A; Schadmand, S; Sefzick, T; Serdyuk, V; Shah, N; Siemaszko, M; Siudak, R; Skorodko, T; Skurzok, M; Smyrski, J; Sopov, V; Stassen, R; Stepaniak, J; Stephan, E; Sterzenbach, G; Stockhorst, H; Ströher, H; Szczurek, A; Tolba, T; Trzciński, A; Varma, R; Wagner, G J; Węglorz, W; Wolke, M; Wro{ń}ska, A; Wüstner, P; Wurm, P; Yamamoto, A; Yuan, X; Zabierowski, J; Zheng, C; Zieliński, M J; Zipper, W; Złomańczuk, J; {Ż}uprański, P; {Ż}urek, M

    2013-01-01

    Exclusive measurements of the quasi-free $pn \\to pp\\pi^0\\pi^-$ reaction have been performed by means of $pd$ collisions at $T_p$ = 1.2 GeV using the WASA detector setup at COSY. Total and differential cross sections have been obtained covering the energy region $\\sqrt s$ = (2.35 - 2.46) GeV, which includes the region of the ABC effect and its associated resonance structure. No ABC effect, {\\it i.e.} low-mass enhancement is found in the $\\pi^0\\pi^-$-invariant mass spectrum -- in agreement with the constraint from Bose statistics that the isovector pion pair can not be in relative s-wave. At the upper end of the covered energy region $t$-channel processes for Roper, $\\Delta(1600)$ and $\\Delta\\Delta$ excitations provide a reasonable description of the data, but at low energies the measured cross sections are much larger than predicted by such processes. Adding a resonance amplitude for the resonance at $m$=~2.37 GeV with $\\Gamma$ =~70 MeV and $I(J^P)=~0(3^+)$ observed recently in $pn \\to d\\pi^0\\pi^0$ and $pn \\to...

  15. The e^+e^- -> 3(\\pi^+\\pi^-), 2(\\pi^+\\pi^-\\pi^0) and K^+K^-2(\\pi^+\\pi^-) Cross Sections at Center-of-Mass Energies 0.5--4.5 GeV Measured with Initial-State Radiation

    Energy Technology Data Exchange (ETDEWEB)

    Aubert, B.

    2006-02-08

    We study the processes e{sup +}e{sup -} {yields} 3({pi}{sup +}{pi}{sup -}){gamma}, 2({pi}{sup +}{pi}{sup -}{pi}{sup 0}){gamma} and K{sup +}K{sup -} 2({pi}{sup +} {sup -}){gamma}, with the photon radiated from the initial state. About 20,000, 33,000 and 4,000 fully reconstructed events, respectively, have been selected from 232 fb{sup -1} of BABAR data. The invariant mass of the hadronic final state defines the effective e{sup +}e{sup -} center-of-mass energy, so that these data can be compared with the corresponding direct e{sup +}e{sup -} measurements. From the 3({pi}{sup +}{pi}{sup -}), 2({pi}{sup +}{pi}{sup -}{pi}{sup 0}) and K{sup +}K{sup -} 2({pi}{sup +}{pi}{sup -}) mass spectra, the cross sections for the processes e{sup +}e{sup -} {yields} 3({pi}{sup +}{sup -}), e{sup +}e{sup -} {yields} 2({pi}{sup +}{pi}{sup -}{pi}{sup 0}) and e{sup +}e{sup -} {yields} K{sup +}K{sup -} 2({pi}{sup +}{pi}{sup -}) are measured for center-of-mass energies from production threshold to 4.5 GeV. The uncertainty in the cross section measurement is typically 6-15%. We observe the J/{psi} in all these final states and measure the corresponding branching fractions.

  16. Consequences of Widespread Piñon Mortality for Water Availability and Water Use Dynamics in Piñon-Juniper Woodlands

    Science.gov (United States)

    Morillas, L.; Pangle, R. E.; Krofcheck, D. J.; Pockman, W.; Litvak, M. E.

    2014-12-01

    Tree die-off events have showed a rapid increase in the last decade as a result of warmer temperatures and more severe drought. In the southwestern US, where piñon-juniper (PJ) woodlands occupy 24 million ha, the turn of the century drought (1999-2002) triggered 40-95% mortality of piñon pine (Pinus edulis) and 2-25% mortality of juniper (Juniperous monosperma). To determine the consequences of this disturbance on surface water balance we conducted a girdling experiment where all piñon trees above 7 cm of diameter at breast height in an area of 200 m2 were girdled in September 2009. We compared water and energy fluxes in this girdled site (PJG) using open-path eddy covariance (EC) to fluxes measured simultaneously in an intact PJ woodland less than 3 km away (PJC). In addition to evapotranspiration (ET) measurements from EC, canopy transpiration (ETc) was measured using sap flow probes (Granier thermal dissipation method) installed on five juniper and five piñon trees at each site. Soil water content (SWC) was also monitored using TDR probes (CS610, Campbell Scientific) under the three main cover types ( bare soil, under juniper and under piñon) and at three depths (5,10 and 30 cm depths) in both sites. Total ET at PJG decreased slowly, but progressively, relative to PJC following the girdling, with annual ET 5%, 10% and 19% lower in 2010, 2011 and 2012, respectively, in the girdled site. Following the girdling, canopy transpiration was significantly reduced at PJG, with an observed reduction of annual ETc at PJG of 45%, 59% and 71% from 2010 to 2012 compared to the PJC site. Our results suggest that girdling triggered a significant increase of soil evaporation and understory transpiration (not directly measured) as a result of canopy cover loss. This agrees with significant higher establishment of annual forbs seen at PJG relative to PJC and the increase of solar radiation reaching the soil surface as a result of canopy cover loss. Our results suggest pi

  17. Measurement of ${CP}\\xspace$ Violation Parameters with a Dalitz Plot Analysis of $B^\\pm \\to D_{\\pi^+\\pi^-\\pi^0} K^\\pm$

    CERN Document Server

    Aubert, B; Boutigny, D; Karyotakis, Yu; Lees, J P; Poireau, V; Prudent, X; Tisserand, V; Zghiche, A; Graugès-Pous, E; López, L; Palano, A; Chen, J C; Qi, N D; Rong, G; Wang, P; Zhu, Y S; Eigen, G; Ofte, I; Stugu, B; Abrams, G S; Battaglia, M; Brown, D N; Button-Shafer, J; Cahn, R N; Groysman, Y; Jacobsen, R G; Kadyk, J A; Kerth, L T; Kolomensky, Yu G; Kukartsev, G; Lopes-Pegna, D; Lynch, G; Mir, L M; Orimoto, T J; Pripstein, M; Roe, N A; Ronan, M T; Tackmann, K; Wenzel, W A; Del Amo-Sánchez, P; Barrett, M; Harrison, T J; Hart, A J; Hawkes, C M; Watson, A T; Held, T; Koch, H; Lewandowski, B; Pelizaeus, M; Schröder, T; Steinke, M; Boyd, J T; Burke, J P; Cottingham, W N; Walker, D; Asgeirsson, D J; Çuhadar-Dönszelmann, T; Fulsom, B G; Hearty, C; Knecht, N S; Mattison, T S; McKenna, J A; Khan, A; Kyberd, P; Saleem, M; Sherwood, D J; Teodorescu, L; Blinov, V E; Bukin, A D; Druzhinin, V P; Golubev, V B; Onuchin, A P; Serednyakov, S I; Skovpen, Yu I; Solodov, E P; Todyshev, K Yu; Bondioli, M; Bruinsma, M; Chao, M; Curry, S; Eschrich, I; Kirkby, D; Lankford, A J; Lund, P; Mandelkern, M A; Martin, E C; Stoker, D P; Abachi, S; Buchanan, C; Foulkes, S D; Gary, J W; Liu, F; Long, O; Shen, B C; Zhang, L; Hill, E J; Paar, H P; Rahatlou, S; Sharma, V; Berryhill, J W; Campagnari, C; Cunha, A; Dahmes, B; Hong, T M; Kovalskyi, D; Richman, J D; Beck, T W; Eisner, A M; Flacco, C J; Heusch, C A; Kroseberg, J; Lockman, W S; Schalk, T; Schumm, B A; Seiden, A; Williams, D C; Wilson, M G; Winstrom, L O; Chen, E; Cheng, C H; Dvoretskii, A; Fang, F; Hitlin, D G; Narsky, I; Piatenko, T; Porter, F C; Mancinelli, G; Meadows, B T; Mishra, K; Sokoloff, M D; Blanc, F; Bloom, P C; Chen, S; Ford, W T; Hirschauer, J F; Kreisel, A; Nagel, M; Nauenberg, U; Olivas, A; Smith, J G; Ulmer, K A; Wagner, S R; Zhang, J; Chen, A; Eckhart, E A; Soffer, A; Toki, W H; Wilson, R J; Winklmeier, F; Zeng, Q; Altenburg, D D; Feltresi, E; Hauke, A; Jasper, H; Merkel, J; Petzold, A; Spaan, B; Wacker, K; Brandt, T; Klose, V; Lacker, H M; Mader, W F; Nogowski, R; Schubert, J; Schubert, K R; Schwierz, R; Sundermann, J E; Volk, A; Bernard, D; Bonneaud, G R; Latour, E; Thiebaux, C; Verderi, M; Clark, P J; Gradl, W; Muheim, F; Playfer, S; Robertson, A I; Xie, Y; Andreotti, M; Bettoni, D; Bozzi, C; Calabrese, R; Cibinetto, G; Luppi, E; Negrini, M; Petrella, A; Piemontese, L; Prencipe, E; Anulli, F; Baldini-Ferroli, R; Calcaterra, A; De Sangro, R; Finocchiaro, G; Pacetti, S; Patteri, P; Peruzzi, I M; Piccolo, M; Rama, M; Zallo, A; Buzzo, A; Contri, R; Lo Vetere, M; Macri, M M; Monge, M R; Passaggio, S; Patrignani, C; Robutti, E; Santroni, A; Tosi, S; Chaisanguanthum, K S; Morii, M; Wu, J; Dubitzky, R S; Marks, J; Schenk, S; Uwer, U; Bard, D J; Dauncey, P D; Flack, R L; Nash, J A; Nikolich, M B; Panduro-Vazquez, W; Behera, P K; Chai, X; Charles, M J; Mallik, U; Meyer, N T; Ziegler, V; Cochran, J; Crawley, H B; Dong, L; Eyges, V; Meyer, W T; Prell, S; Rosenberg, E I; Rubin, A E; Gritsan, A V; Lae, C K; Denig, A G; Fritsch, M; Schott, G; Arnaud, N; Bequilleux, J; Davier, M; Grosdidier, G; Höcker, A; Lepeltier, V; Le Diberder, F R; Lutz, A M; Pruvot, S; Rodier, S; Roudeau, P; Schune, M H; Serrano, J; Sordini, V; Stocchi, A; Wang, W F; Wormser, G; Lange, D J; Wright, D M; Chavez, C A; Forster, I J; Fry, J R; Gabathuler, E; Gamet, R; Hutchcroft, D E; Payne, D J; Schofield, K C; Touramanis, C; Bevan, A J; George, K A; Di Lodovico, F; Menges, W; Sacco, R; Cowan, G; Flächer, H U; Hopkins, D A; Jackson, P S; McMahon, T R; Salvatore, F; Wren, A C; Davis, C L; Allison, J; Barlow, N R; Barlow, R J; Chia, Y M; Edgar, C L; Lafferty, G D; West, T J; Yi, J I; Chen, C; Hulsbergen, W D; Jawahery, A; Roberts, D A; Simi, G; Blaylock, G; Dallapiccola, C; Hertzbach, S S; Li, X; Moore, T B; Salvati, E; Saremi, S; Cowan, R; Sciolla, G; Sekula, S J; Spitznagel, M; Taylor, F; Yamamoto, R K; Kim, H; Mclachlin, S E; Patel, P M; Robertson, S H; Lazzaro, A; Lombardo, V; Palombo, F; Bauer, J M; Cremaldi, L; Eschenburg, V; Godang, R; Kroeger, R; Sanders, D A; Summers, D J; Zhao, H W; Brunet, S; Côté, D; Simard, M; Taras, P; Viaud, F B; Nicholson, H; Cavallo, N; De Nardo, Gallieno; Fabozzi, F; Gatto, C; Lista, L; Monorchio, D; Paolucci, P; Piccolo, D; Sciacca, C; Baak, M A; Raven, G; Snoek, H L; Jessop, C P; LoSecco, J M; Benelli, G; Corwin, L A; Gan, K K; Honscheid, K; Hufnagel, D; Kagan, H; Kass, R; Morris, J P; Rahimi, A M; Regensburger, J J; Ter-Antonian, R; Wong, Q K; Blount, N L; Brau, J E; Frey, R; Igonkina, O; Kolb, J A; Lu, M; Rahmat, R; Sinev, N B; Strom, D; Strube, J; Torrence, E; Gaz, A; Margoni, M; Morandin, M; Pompili, A; Posocco, M; Rotondo, M; Simonetto, F; Stroili, R; Voci, C; Ben-Haim, E; Briand, H; Chauveau, J; David, P; Del Buono, L; La Vaissière, C de; Hamon, O; Hartfiel, B L; Leruste, P; Malcles, J; Ocariz, J; Pérez, A; Prendki, J; Gladney, L; Biasini, M; Covarelli, R; Manoni, E; Angelini, C; Batignani, G; Bettarini, S; Calderini, G; Carpinelli, M; Cenci, R; Forti, F; G