Decay rate ratios of Υ(5S)→B anti B reactions

International Nuclear Information System (INIS)

Hwang, Dae Sung; Son, Hyungsuk

2010-01-01

We calculate the decay rate ratios for OZI allowed decays of Υ(5S) to two B mesons by using the decay amplitudes which incorporate the wave function of the Υ(5S) state. We obtain the result that the branching ratio of the Υ(5S) decay to B s * anti B s * is much larger than the branching ratio to B s anti B s * or anti B s B s * , in good agreement with the recent experimental results of CLEO and BELLE. This agreement with the experimental results is made possible since the nodes of the Υ(5S) radial wave function induce the nodes of the decay amplitude. We find that the results for the Υ(5S) decays to B u (*) anti B u (*) or B d (*) anti B d (*) pairs are sensitive to the parameter values used for the potential between heavy quarks. (orig.)

Nash y von Neumann: mundos posibles y juegos de lenguaje

Directory of Open Access Journals (Sweden)

Salazar , Boris

2004-06-01

Full Text Available Este ensayo emplea las nociones de juego de lenguaje y de equivalencia entre juegos para examinar la decisión de John Nash de no jugar el juego coalicional que propuso John von Neumann. El argumento central es que Nash concibió una clase de mundos posibles incompatible con la de von Neumann, y que en el origen de esa divergencia estarían sus distintas nociones de racionalidad.

Analysis list: Stat5b [Chip-atlas[Archive

Lifescience Database Archive (English)

Full Text Available Stat5b Blood,Breast + mm9 http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/target/Sta...t5b.1.tsv http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/target/Stat5b.5.tsv http://dbarchive.biosciencedbc....jp/kyushu-u/mm9/target/Stat5b.10.tsv http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/colo/Stat5b.Blood.tsv,http://dbarchive.bioscience...dbc.jp/kyushu-u/mm9/colo/Stat5b.Breast.tsv http://dbarchive.bioscience...dbc.jp/kyushu-u/mm9/colo/Blood.gml,http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/colo/Breast.gml ...

Study of the individual cytochrome b5 and cytochrome b5 reductase domains of Ncb5or reveals a unique heme pocket and a possible role of the CS domain.

Science.gov (United States)

Deng, Bin; Parthasarathy, Sudharsan; Wang, WenFang; Gibney, Brian R; Battaile, Kevin P; Lovell, Scott; Benson, David R; Zhu, Hao

2010-09-24

NADH cytochrome b(5) oxidoreductase (Ncb5or) is found in animals and contains three domains similar to cytochrome b(5) (b(5)), CHORD-SGT1 (CS), and cytochrome b(5) reductase (b(5)R). Ncb5or has an important function, as suggested by the diabetes and lipoatrophy phenotypes in Ncb5or null mice. To elucidate the structural and functional properties of human Ncb5or, we generated its individual b(5) and b(5)R domains (Ncb5or-b(5) and Ncb5or-b(5)R, respectively) and compared them with human microsomal b(5) (Cyb5A) and b(5)R (Cyb5R3). A 1.25 Å x-ray crystal structure of Ncb5or-b(5) reveals nearly orthogonal planes of the imidazolyl rings of heme-ligating residues His(89) and His(112), consistent with a highly anisotropic low spin EPR spectrum. Ncb5or is the first member of the cytochrome b(5) family shown to have such a heme environment. Like other b(5) family members, Ncb5or-b(5) has two helix-loop-helix motifs surrounding heme. However, Ncb5or-b(5) differs from Cyb5A with respect to location of the second heme ligand (His(112)) and of polypeptide conformation in its vicinity. Electron transfer from Ncb5or-b(5)R to Ncb5or-b(5) is much less efficient than from Cyb5R3 to Cyb5A, possibly as a consequence of weaker electrostatic interactions. The CS linkage probably obviates the need for strong interactions between b(5) and b(5)R domains in Ncb5or. Studies with a construct combining the Ncb5or CS and b(5)R domains suggest that the CS domain facilitates docking of the b(5) and b(5)R domains. Trp(114) is an invariant surface residue in all known Ncb5or orthologs but appears not to contribute to electron transfer from the b(5)R domain to the b(5) domain.

45 CFR 5b.11 - Exempt systems.

Science.gov (United States)

2010-10-01

... 45 Public Welfare 1 2010-10-01 2010-10-01 false Exempt systems. 5b.11 Section 5b.11 Public Welfare DEPARTMENT OF HEALTH AND HUMAN SERVICES GENERAL ADMINISTRATION PRIVACY ACT REGULATIONS § 5b.11 Exempt systems. (a) General policy. The Act permits certain types of specific systems of records to be exempt from...

¿Es posible combinar lo tradicional y lo moderno?

Directory of Open Access Journals (Sweden)

Hugo Celso Felipe Mansilla

2001-01-01

Full Text Available En contra de las actuales tendencias posmodérnicas, el autor postula una simbiosis entre los elementos positivos de lo premoderno y los correspondientes de la modernidad. Cree posible rescatar las llamadas tradiciones razonable, y combinarlas con lo positivo de la modernidad. Estos factores positivos de la tradicionalidad serían la religión en cuanto fuente de sentido y consuelo, la monarquía y la aristocracia hereditarias como modelos institucionales que nos unen con la historia, y la concepción del arte y la literatura como una estética fundamentada en lo bello. Esfuerzos sincretistas similares constituyen gran parte de la historia universal.

Muc5b is required for airway defence

Science.gov (United States)

Roy, Michelle G.; Livraghi-Butrico, Alessandra; Fletcher, Ashley A.; McElwee, Melissa M.; Evans, Scott E.; Boerner, Ryan M.; Alexander, Samantha N.; Bellinghausen, Lindsey K.; Song, Alfred S.; Petrova, Youlia M.; Tuvim, Michael J.; Adachi, Roberto; Romo, Irlanda; Bordt, Andrea S.; Bowden, M. Gabriela; Sisson, Joseph H.; Woodruff, Prescott G.; Thornton, David J.; Rousseau, Karine; de La Garza, Maria M.; Moghaddam, Seyed J.; Karmouty-Quintana, Harry; Blackburn, Michael R.; Drouin, Scott M.; Davis, C. William; Terrell, Kristy A.; Grubb, Barbara R.; O'Neal, Wanda K.; Flores, Sonia C.; Cota-Gomez, Adela; Lozupone, Catherine A.; Donnelly, Jody M.; Watson, Alan M.; Hennessy, Corinne E.; Keith, Rebecca C.; Yang, Ivana V.; Barthel, Lea; Henson, Peter M.; Janssen, William J.; Schwartz, David A.; Boucher, Richard C.; Dickey, Burton F.; Evans, Christopher M.

2014-01-01

Respiratory surfaces are exposed to billions of particulates and pathogens daily. A protective mucus barrier traps and eliminates them through mucociliary clearance (MCC). However, excessive mucus contributes to transient respiratory infections and to the pathogenesis of numerous respiratory diseases. MUC5AC and MUC5B are evolutionarily conserved genes that encode structurally related mucin glycoproteins, the principal macromolecules in airway mucus. Genetic variants are linked to diverse lung diseases, but specific roles for MUC5AC and MUC5B in MCC, and the lasting effects of their inhibition, are unknown. Here we show that mouse Muc5b (but not Muc5ac) is required for MCC, for controlling infections in the airways and middle ear, and for maintaining immune homeostasis in mouse lungs, whereas Muc5ac is dispensable. Muc5b deficiency caused materials to accumulate in upper and lower airways. This defect led to chronic infection by multiple bacterial species, including Staphylococcus aureus, and to inflammation that failed to resolve normally. Apoptotic macrophages accumulated, phagocytosis was impaired, and interleukin-23 (IL-23) production was reduced in Muc5b-/- mice. By contrast, in mice that transgenically overexpress Muc5b, macrophage functions improved. Existing dogma defines mucous phenotypes in asthma and chronic obstructive pulmonary disease (COPD) as driven by increased MUC5AC, with MUC5B levels either unaffected or increased in expectorated sputum. However, in many patients, MUC5B production at airway surfaces decreases by as much as 90%. By distinguishing a specific role for Muc5b in MCC, and by determining its impact on bacterial infections and inflammation in mice, our results provide a refined framework for designing targeted therapies to control mucin secretion and restore MCC.

Posibility for application of froth separation process in beneficiation of raw minerals

Directory of Open Access Journals (Sweden)

František Tichánek

2005-11-01

Full Text Available Froth separation belongs to newer flotation methods that are suitable for the separation of fine-grained raw materials whose size is too big for regular flotation. The technology of coarse-grained flotation has a significant economical effect because it allows a decrease in the costs for mineral processing. The article concerneds the posibility of using the froth separation process during the mineral processing of bituminous coal.

Análisis de los impactos ambientales generados por parques eólicos en base al nuevo Decreto-Ley 5/2014

OpenAIRE

Avilés Benítez, Antonio

2016-01-01

ANÁLISIS DE LOS IMPACTOS AMBIENTALES GENERADOS POR PARQUES EÓLICOS EN BASE AL NUEVO DECRETO-LEY 5/2014 Con el nuevo Decreto -ley 5/2014, de 22 de abril, de medidas normativas para reducir las trabas administrativas para las empresas, los parques eólicos se encuentran incluidos en el Anexo III, exigiéndoseles para su instalación tener favorable el trámite de Autorización Ambiental Unificada (AAU). Dicha autorización exige la redacción de un Estudio de Impacto Ambiental que analice y cuanti...

Anexo

Directory of Open Access Journals (Sweden)

Jaime Jaramillo Escobar

2013-09-01

Full Text Available Esta sección del Boletín tiene por objeto dar noticia de todos los libros colombianos que llegen a su conocimiento, se incluye aquí una breve mención de un volumen publicado por la Biblioteca Pública Piloto de Medellín en el 2010, con textos de algunos de los integrantes del Taller de poesía y creación literaria patrocinado por el Banco de la República.

Peak shifts due to B(*)-B(*) rescattering in Υ(5S) dipion transitions

International Nuclear Information System (INIS)

Meng Ce; Chao Kuangta

2008-01-01

We study the energy distributions of dipion transitions Υ(5S) to Υ(1S,2S,3S)π + π - in the final-state rescattering model. Since the Υ(5S) is well above the open bottom thresholds, the dipion transitions are expected to mainly proceed through the real processes Υ(5S)→B ( * ) B ( * ) and B ( * ) B ( * ) →Υ(1S,2S,3S)π + π - . We find that the energy distributions of Υ(1S,2S,3S)π + π - markedly differ from that of Υ(5S)→B ( * ) B ( * ) . In particular, the resonance peak will be pushed up by about 7-20 MeV for these dipion transitions relative to the main hadronic decay modes. These predictions can be used to test the final-state rescattering mechanism in hadronic transitions for heavy quarkonia above the open flavor thresholds.

Ultraviolet B Radiation Stimulates the Interaction between Nuclear Factor of Activated T Cells 5 (NFAT5) and Nuclear Factor-Kappa B (NF-κB) in Human Lens Epithelial Cells.

Science.gov (United States)

Chung, Inyoung; Hah, Young-Sool; Ju, SunMi; Kim, Ji-Hye; Yoo, Woong-Sun; Cho, Hee-Young; Yoo, Ji-Myong; Seo, Seong-Wook; Choi, Wan-Sung; Kim, Seong-Jae

2017-07-01

Nuclear factor-kappa B (NF-κB) has been proposed as a therapeutic target for the treatment of cataracts. The authors investigated the relationship between nuclear factor of activated T cells 5 (NFAT5) and NF-κB in ultraviolet B (UVB)-irradiated human lens epithelial (HLE) cells. Human lens epithelial B-3 (HLE-B3) cells were exposed to UVB light at a dose of 10 mJ/cm 2 and then incubated for 24 h. Cell viability was assessed by using the Cell Counting Kit-8 (CCK-8) assay. Gene expression level of NFAT5 was determined using real-time quantitative polymerase chain reaction (qPCR). Protein expression levels of NFAT5, NF-κB p65, and α-smooth muscle actin (α-SMA) and the association of NFAT5 with the NF-κB p65 subunit were measured by Western blot analysis and a co-immunoprecipitation assay, respectively. The cellular distribution of NFAT5 and NF-κB p65 was examined by triple immunofluorescence staining. At 24 h after UVB exposure, cell viability significantly decreased in a dose-dependent manner, and UVB light (15 and 20 mJ/cm 2 ) significantly increased the ROS generation. UVB irradiation increased NFAT5 mRNA and protein levels and increased phosphorylation of NF-κB in HLE-B3 cells. α-SMA protein levels were increased in the irradiated cells. In addition, NFAT5 and NF-κB translocated from the cytoplasm to the nucleus, and binding between the p65 subunit and NFAT5 was increased. Exposure to UVB radiation induces nuclear translocation and stimulates binding between NFAT5 and NF-κB proteins in HLE-B3 cells. These interactions may form part of the biochemical mechanism of cataractogenesis in UVB-irradiated HLECs.

34 CFR 5b.10 - Parents and guardians.

Science.gov (United States)

2010-07-01

... 34 Education 1 2010-07-01 2010-07-01 false Parents and guardians. 5b.10 Section 5b.10 Education Office of the Secretary, Department of Education PRIVACY ACT REGULATIONS § 5b.10 Parents and guardians. For the purpose of this part, a parent or guardian of any minor or the legal guardian or any...

Histatin 5 binds to Porphyromonas gingivalis hemagglutinin B (HagB) and alters HagB-induced chemokine responses

Science.gov (United States)

Borgwardt, Derek S.; Martin, Aaron D.; van Hemert, Jonathan R.; Yang, Jianyi; Fischer, Carol L.; Recker, Erica N.; Nair, Prashant R.; Vidva, Robinson; Chandrashekaraiah, Shwetha; Progulske-Fox, Ann; Drake, David; Cavanaugh, Joseph E.; Vali, Shireen; Zhang, Yang; Brogden, Kim A.

2014-01-01

Histatins are human salivary gland peptides with anti-microbial and anti-inflammatory activities. In this study, we hypothesized that histatin 5 binds to Porphyromonas gingivalis hemagglutinin B (HagB) and attenuates HagB-induced chemokine responses in human myeloid dendritic cells. Histatin 5 bound to immobilized HagB in a surface plasmon resonance (SPR) spectroscopy-based biosensor system. SPR spectroscopy kinetic and equilibrium analyses, protein microarray studies, and I-TASSER structural modeling studies all demonstrated two histatin 5 binding sites on HagB. One site had a stronger affinity with a KD1 of 1.9 μM and one site had a weaker affinity with a KD2 of 60.0 μM. Binding has biological implications and predictive modeling studies and exposure of dendritic cells both demonstrated that 20.0 μM histatin 5 attenuated (p < 0.05) 0.02 μM HagB-induced CCL3/MIP-1α, CCL4/MIP-1β, and TNFα responses. Thus histatin 5 is capable of attenuating chemokine responses, which may help control oral inflammation.

Theoretical study of the ionization of B2H5

International Nuclear Information System (INIS)

Curtiss, L.A.; Pople, J.A.

1989-01-01

Ab initio molecular orbital calculations at the G1 level of theory have been carried out on neutral B 2 H 5 radical, doubly bridged B 2 H + 5 cation, and the first triplet excited state of B 2 H + 5 . Singly bridged B 2 H 5 is 4.0 kcal/mol (without zero-point energies) more stable than doubly bridged B 2 H 5 . Based on this work and previous theoretical work on triply bridged B 2 H + 5 , ionization potentials (vertical and adiabatic) are determined for B 2 H 5 . The adiabatic ionization potentials of the two B 2 H 5 structures are 6.94 eV (singly bridged) and 7.53 eV (doubly bridged). A very large difference is found between the vertical and adiabatic ionization potentials (3.37 eV) of the singly bridged B 2 H 5 structure. The first triplet state of B 2 H + 5 is found to be 4.55 eV higher in energy than the lowest energy B 2 H + 5 cation (triply bridged). The results of this theoretical study support the interpretation of Ruscic, Schwarz, and Berkowitz of their recent photoionization measurements on B 2 H 5

Cálculo de la estructura de una nave industrial destinada a la venta y almacenaje de muebles

OpenAIRE

Harana Herrera, Marta

2017-01-01

Dicho proyecto está estructurado en varios documentos, memoria, anexo (cálculo estructural, estudio geotécnico, estudio básico de seguridad y salud), planos, pliego de condiciones, mediciones y presupuesto

B =5 Skyrmion as a two-cluster system

Science.gov (United States)

Gudnason, Sven Bjarke; Halcrow, Chris

2018-06-01

The classical B =5 Skyrmion can be approximated by a two-cluster system in which a B =1 Skyrmion is attached to a core B =4 Skyrmion. We quantize this system, allowing the B =1 to freely orbit the core. The configuration space is 11 dimensional but simplifies significantly after factoring out the overall spin and isospin degrees of freedom. We exactly solve the free quantum problem and then include an interaction potential between the Skyrmions numerically. The resulting energy spectrum is compared to the corresponding nuclei—the helium-5/lithium-5 isodoublet. We find approximate parity doubling not seen in the experimental data. In addition, we fail to obtain the correct ground-state spin. The framework laid out for this two-cluster system can readily be modified for other clusters and in particular for other B =4 n +1 nuclei, of which B =5 is the simplest example.

Malaysian B5 Implementation and Its Quality

International Nuclear Information System (INIS)

Liang, Y.C.; Loh, S.K.; Soon, L.W.; May, C.Y.

2016-01-01

A quality survey of 80 samples of diesel fuels (B5) from 80 retail stations throughout Peninsular Malaysia was performed. The bio diesel contents in these B5 samples were in the range of 4.61 vol. % to 5.33 vol. %. The water contents of the samples were < 200 mg kg -1 , meeting the stringent water requirements recommended by the car manufacturers. In addition, all the samples exhibited superior lubricity as indicated by a much shorter wear scar diameter compared to neat diesel. More importantly, 98 % of the samples passed the oxidation stability test (PetroOXY) with an induction period of > 65 min. Overall, the B5 diesel fuel sold was in full compliance with the Malaysian diesel fuel standard specification. (author)

El cultivo de trigo en Colombia: Su agonía y posible desaparición

Directory of Open Access Journals (Sweden)

David Álvarez Sánchez

2017-12-01

Full Text Available El Trigo (Triticum aestivum L. en Colombia es considerado un alimento básico además de requerir en su cadena productiva un número elevado de mano de obra, sin embargo, a nivel nacional desde el año de 1970 el área y producción del Trigo cultivado ha tenido una disminución constante representada en las estadísticas oficiales, siendo importante conocer las razones de dicho fenómeno y el impacto generado. Por lo anterior, esta revisión buscó identificar los aspectos nocivos que explican la agonía y posible desaparición de este sistema productivo en el país en tres periodos históricos: i desde 1920 hasta 1989, ii desde 1990 hasta 2000 y iii perspectivas a futuro. Para ello, se recopiló información de diferentes fuentes primarias y secundarias, concluyendo que el Trigo a lo largo del tiempo ha soportado coyunturas macroeconómicas y el desamparo gubernamental en el sector, poniendo en duda la sustentabilidad del cultivo en Colombia.

Un posible recinto campamental romano en O Cornado (Negreira, Galicia

Directory of Open Access Journals (Sweden)

Manuel Gago Mariño

2015-02-01

Full Text Available Presentamos en este artículo las evidencias y el contexto geográfico y arqueológico de una fortificación localizada en el municipio de Negreira (A Coruña y que por sus características puede corresponder a un posible campamento romano. El sitio arqueológico está ubicado en una zona de gran interés para comprender la romanización del occidente de Galicia, con actividad minera, asentamientos y vías de comunicación de la época. Las nuevas tecnologías LIDAR, el acceso abierto al «vuelo americano» de 1956 y otras bases de datos de imágenes aéreas, junto con técnicas más convencionales, han propiciado el hallazgo o, más bien, la propuesta de revisión cronológica y funcional de este yacimiento. El posible campamento podría pertenecer a una fase final o inmediatamente posterior de la conquista romana. This article presents the evidence and the geographical and archaeological context of a large fortress located in the municipality of Negreira (A Coruña and whose characteristics may correspond to a possible Roman camp. The archaeological site is located in an area of great interest (with minery, settlements and roads of those times, which help us to understand the Romanization of the western Gallaecia. New LIDAR technologies and open access to the 1956 «American flight» and other aerial imagery databases, combined with more traditional techniques have led to the discovery, or rather, to propose a chronological and functional requalification of this site. This new camp could have been built in the final phase of the Roman conquest or at the beginning of the Romanization process.

18 CFR 3b.5 - Legal guardians.

Science.gov (United States)

2010-04-01

... 18 Conservation of Power and Water Resources 1 2010-04-01 2010-04-01 false Legal guardians. 3b.5... INFORMATION General § 3b.5 Legal guardians. For the purposes of this part, the parent of any minor, or the legal guardian of any individual who has been declared to be incompetent due to physical or mental...

Contribution of Electrostatics to the Kinetics of Electron Transfer from NADH-Cytochrome b5 Reductase to Fe(III)-Cytochrome b5.

Science.gov (United States)

Kollipara, Sireesha; Tatireddy, Shivakishore; Pathirathne, Thusitha; Rathnayake, Lasantha K; Northrup, Scott H

2016-08-25

Brownian dynamics (BD) simulations provide here a theoretical atomic-level treatment of the reduction of human ferric cytochrome b5 (cyt b5) by NADH-cytochrome b5 reductaste (cyt b5r) and several of its mutants. BD is used to calculate the second-order rate constant of electron transfer (ET) between the proteins for direct correlation with experiments. Interestingly, the inclusion of electrostatic forces dramatically increases the reaction rate of the native proteins despite the overall negative charge of both proteins. The role played by electrostatic charge distribution in stabilizing the ET complexes and the role of mutations of several amino acid residues in stabilizing or destabilizing the complexes are analyzed. The complex with the shortest ET reaction distance (d = 6.58 Å) from rigid body BD is further subjected to 1 ns of molecular dynamics (MD) in a periodic box of TIP3P water to produce a more stable complex allowed by flexibility and with a shorter average reaction distance d = 6.02 Å. We predict a docking model in which the following ion-ion interactions are dominant (cyt b5r/cyt b5): Lys162-Heme O1D/Lys163-Asp64/Arg91-Heme O1A/Lys125-Asp70.

Wnt5b-associated exosomes promote cancer cell migration and proliferation.

Science.gov (United States)

Harada, Takeshi; Yamamoto, Hideki; Kishida, Shosei; Kishida, Michiko; Awada, Chihiro; Takao, Toshifumi; Kikuchi, Akira

2017-01-01

Wnt5b is a member of the same family of proteins as Wnt5a, the overexpression of which is associated with cancer aggressiveness. Wnt5b is also suggested to be involved in cancer progression, however, details remain unclarified. We analyzed the biochemical properties of purified Wnt5b and the mode of secretion of Wnt5b by cancer cells. Wnt5b was glycosylated at three asparagine residues and lipidated at one serine residue, and these post-translational modifications of Wnt5b were essential for secretion. Purified Wnt5b showed Dvl2 phosphorylation and Rac activation abilities to a similar extent as Wnt5a. In cultured-cell conditioned medium, Wnt5b was detected in supernatant or precipitation fractions that were separated by centrifugation at 100 000 g. In PANC-1 pancreatic cancer cells, 55% of secreted endogenous Wnt5b was associated with exosomes. Exosomes from wild-type PANC-1 cells, but not those from Wnt5b-knockout PANC-1 cells, activated Wnt5b signaling in CHO cells and stimulated migration and proliferation of A549 lung adenocarcinoma cells, suggesting that endogenous, Wnt5b-associated exosomes are active. The exosomes were taken up by CHO cells and immunoelectron microscopy revealed that Wnt5b is indeed associated with exosomes. In Caco-2 colon cancer cells, most Wnt5b was recovered in precipitation fractions when Wnt5b was ectopically expressed (Caco-2/Wnt5b cells). Knockdown of TSG101, an exosome marker, decreased the secretion of Wnt5b-associated exosomes from Caco-2/Wnt5b cells and inhibited Wnt5b-dependent cell proliferation. Exosomes secreted from Caco-2/Wnt5b cells stimulated migration and proliferation of A549 cells. These results suggest that Wnt5b-associated exosomes promote cancer cell migration and proliferation in a paracrine manner. © 2016 The Authors. Cancer Science published by John Wiley & Sons Australia, Ltd on behalf of Japanese Cancer Association.

B2-B2.5 code benchmarking

Energy Technology Data Exchange (ETDEWEB)

Dekeyser, W.; Baelmans, M; Voskoboynikov, S.; Rozhansky, V.; Reiter, D.; Wiesen, S.; Kotov, V.; Boerner, P.

2011-01-15

ITER-IO currently (and since about 15 years) employs the SOLPS4.xxx code for its divertor design, currently version SOLPS4.3. SOLPS.xxx is a special variant of the B2-EIRENE code, which was originally developed by an European consortium (FZ Juelich, AEA Culham, ERM Belgium/KU Leuven) in the late eighties and early nineties of the last century under NET contracts. Until today even the very similar edge plasma codes within the SOLPS family, if run on a seemingly identical choice of physical parameters, still sometimes disagree significantly with each other. It is obvious that in computational engineering applications, as they are carried out for the various ITER divertor aspects with SOLPS4.3 for more than a decade now, any transition from one to another code must be fully backward compatible, or, at least, the origin of differences in the results must be identified and fully understood quantitatively. In this report we document efforts undertaken in 2010 to ultimately eliminate the third issue. For the kinetic EIRENE part within SOLPS this backward compatibility (back until 1996) was basically achieved (V. Kotov, 2004-2006) and SOLPS4.3 is now essentially up to date with the current EIRENE master maintained at FZ Juelich. In order to achieve a similar level of reproducibility for the plasma fluid (B2, B2.5) part, we follow a similar strategy, which is quite distinct from the previous SOLPS benchmark attempts: the codes are ''disintegrated'' and pieces of it are run on smallest (i.e. simplest) problems. Only after full quantitative understanding is achieved, the code model is enlarged, integrated, piece by piece again, until, hopefully, a fully backward compatible B2 / B2.5 ITER edge plasma simulation will be achieved. The status of this code dis-integration effort and its findings until now (Nov. 2010) are documented in the present technical note. This work was initiated in a small workshop by the three partner teams of KU Leuven, St. Petersburg

Uso de TIC: posibles relaciones con habilidades cognitivas e interpersonales en un grupo de adolescentes

Directory of Open Access Journals (Sweden)

Gabriela Raynaudo

2016-01-01

Full Text Available Grandes cambios han acontecido en la vida cotidiana por la introducción de las tecnologías de la información y la comunicación (tic, aventurándonos en la Sociedad de la Información. En este artículo se describen hábitos de uso de tecnologías y habilidades cognoscitivas e interpersonales en un grupo de adolescentes con la finalidad de encontrar posibles relaciones entre los temas estudiados. De este estudio exploratorio y transversal, participaron 19 jóvenes entre 15 y 17 años. Se administraron cuestionarios sobre uso de tic y habilidades interpersonales y seis subtests de la batería wisc-iii. A nivel descriptivo, encontramos relaciones entre los puntajes obtenidos en las pruebas y la exposición a pantallas. Si bien estas diferencias no fueron estadísticamente significativas, en general los sujetos más expuestos tuvieron un mejor desempeño en las pruebas cognoscitivas y los menos expuestos en habilidades interpersonales. Se discuten posibles estudios posteriores e implicancias educativas.

Theoretical investigation of molecular hydrogen reactions with active centres in B6H5- and AlB6H5- clusters

International Nuclear Information System (INIS)

Mebel', A.M.; Charkin, O.P.

1991-01-01

Nonempirical calculations of sections of potential surface (PS) along the shortest way of reaction of hydrogen interaction with different active centres in AlB 5 H 5 - cluster were conducted. Mechanisms of reactions of valent-saturated hydrides (BH, AlH) and clusters (B 6 H 5 - , AlB 5 H 5 - ) with molecular hydrogen are correlated. Qualitative model enabling to form an opinion about the presence or the absence of barrier on PS of the shortest way of reactions of breaking σ-bond of H-H type on the active centre of cluster, is suggested. The model is based on analysis of the character of canonical MO reagents and products

Remarks on broken chiral SU(5) x SU(5) symmetry and B mesons

International Nuclear Information System (INIS)

Kim, D.Y.; Sinha, S.N.

1985-01-01

In a recent paper, Hatzis has estimated the masses and weak decay constants of b-flavored pseudoscalar mesons in a broken chiral SU(5) x SU(5) symmetry method. The estimated weak decay constant of B meson, f sub(B) f sub(K)(f sub(B)/f sub(K) approximately equal to 1.4) evaluated by Mathur et al. with the quantum chromodynamics (QCD) sum-rule model. We re-examined the problem applying the broken chiral SU(5) x SU(5) symmetry approach using a set of mass formulae. With this method we estimate the symmetry-breaking parameters and decay constants of pseudoscalar mesons. We found a consistent result for the decay constant: f sub(K) < or approximately equal to f sub(D) < or approximately equal to f sub(B). The explicit numerical value of these constants, however, are lower than that of the QCD sum rule. This may be due to the limited validity of the broken chiral symmetry approach for heavy mesons

Biochemical characterization of a haloalkane dehalogenase DadB from Alcanivorax dieselolei B-5.

Directory of Open Access Journals (Sweden)

Anzhang Li

Full Text Available Recently, we found that Alcanivorax bacteria from various marine environments were capable of degrading halogenated alkanes. Genome sequencing of A. dieselolei B-5 revealed two putative haloalkane dehalogenase (HLD genes, which were supposed to be involved in degradation of halogenated compounds. In this report, we confirm for the first time that the Alcanivorax bacterium encodes a truly functional HLD named DadB. An activity assay with 46 halogenated substrates indicated that DadB possesses broad substrate range and has the highest overall activity among the identified HLDs. DadB prefers brominated substrates; chlorinated alkenes; and the C2-C3 substrates, including the persistent pollutants of 1,2-dichloroethane, 1,2-dichloropropane and 1,2,3-trichloropropane. As DadB displays no detectable activity toward long-chain haloalkanes such as 1-chlorohexadecane and 1-chlorooctadecane, the degradation of them in A. dieselolei B-5 might be attributed to other enzymes. Kinetic constants were determined with 6 substrates. DadB has highest affinity and largest k cat/K m value toward 1,3-dibromopropane (K(m = 0.82 mM, k(cat/K(m = 16.43 mM(-1 · s(-1. DadB aggregates fast in the buffers with pH ≤ 7.0, while keeps stable in monomer form when pH ≥ 7.5. According to homology modeling, DadB has an open active cavity with a large access tunnel, which is supposed important for larger molecules as opposed to C2-C3 substrates. Combined with the results for other HLDs, we deduce that residue I247 plays an important role in substrate selection. These results suggest that DadB and its host, A. dieselolei B-5, are of potential use for biocatalysis and bioremediation applications.

Biochemical characterization of a haloalkane dehalogenase DadB from Alcanivorax dieselolei B-5.

Science.gov (United States)

Li, Anzhang; Shao, Zongze

2014-01-01

Recently, we found that Alcanivorax bacteria from various marine environments were capable of degrading halogenated alkanes. Genome sequencing of A. dieselolei B-5 revealed two putative haloalkane dehalogenase (HLD) genes, which were supposed to be involved in degradation of halogenated compounds. In this report, we confirm for the first time that the Alcanivorax bacterium encodes a truly functional HLD named DadB. An activity assay with 46 halogenated substrates indicated that DadB possesses broad substrate range and has the highest overall activity among the identified HLDs. DadB prefers brominated substrates; chlorinated alkenes; and the C2-C3 substrates, including the persistent pollutants of 1,2-dichloroethane, 1,2-dichloropropane and 1,2,3-trichloropropane. As DadB displays no detectable activity toward long-chain haloalkanes such as 1-chlorohexadecane and 1-chlorooctadecane, the degradation of them in A. dieselolei B-5 might be attributed to other enzymes. Kinetic constants were determined with 6 substrates. DadB has highest affinity and largest k cat/K m value toward 1,3-dibromopropane (K(m) = 0.82 mM, k(cat)/K(m) = 16.43 mM(-1) · s(-1)). DadB aggregates fast in the buffers with pH ≤ 7.0, while keeps stable in monomer form when pH ≥ 7.5. According to homology modeling, DadB has an open active cavity with a large access tunnel, which is supposed important for larger molecules as opposed to C2-C3 substrates. Combined with the results for other HLDs, we deduce that residue I247 plays an important role in substrate selection. These results suggest that DadB and its host, A. dieselolei B-5, are of potential use for biocatalysis and bioremediation applications.

Penetration of the renewable sources of energy in Mexico: group of approach on possible guidelines for policies for the renewable energies (Annexe 13 in 'A vision of year 2030 on the use of the renewable energies in Mexico'); Penetracion de las fuentes renovables de energia en Mexico: grupo de enfoque sobre posibles lineamientos de politicas para las energias renovables (Anexo 13 en 'Una vision al 2030 de la utilizacion de las energias renovables en Mexico')

Energy Technology Data Exchange (ETDEWEB)

Pernudi, Montserrat; Alonso C, Antonio [Analitica Consultores S.A. de C.V., Mexico D.F. (Mexico)

2005-08-15

This report corresponds to the results obtained in the group of consultation to experts on the possible policy guidelines that could favor the penetration of the renewable energies in Mexico, conducted on July 26, 2005 in Mexico City with a small group of approach, the specific objectives of the meeting were: to define possible policy guidelines that help the future penetration of the renewable energies in Mexico between years 2005 and 2030; and to explore possible obstacles for the implantation of such policies. [Spanish] Este informe corresponde a los resultados obtenidos en el grupo de consulta a expertos sobre los posibles lineamientos de politicas que podrian favorecer la penetracion de las energias renovables en Mexico, realizado el 26 de julio de 2005 en la ciudad de Mexico con un pequeno grupo de enfoque, los objetivos especificos de la reunion fueron: definir posibles lineamientos de politica que ayuden a la penetracion futura de las energias renovables en Mexico entre los anos 2005 y 2030; y explorar posibles obstaculos para la implantacion de dichas politicas.

Assembly and Regulation of the Membrane Attack Complex Based on Structures of C5b6 and sC5b9

Directory of Open Access Journals (Sweden)

Michael A. Hadders

2012-03-01

Full Text Available Activation of the complement system results in formation of membrane attack complexes (MACs, pores that disrupt lipid bilayers and lyse bacteria and other pathogens. Here, we present the crystal structure of the first assembly intermediate, C5b6, together with a cryo-electron microscopy reconstruction of a soluble, regulated form of the pore, sC5b9. Cleavage of C5 to C5b results in marked conformational changes, distinct from those observed in the homologous C3-to-C3b transition. C6 captures this conformation, which is preserved in the larger sC5b9 assembly. Together with antibody labeling, these structures reveal that complement components associate through sideways alignment of the central MAC-perforin (MACPF domains, resulting in a C5b6-C7-C8β-C8α-C9 arc. Soluble regulatory proteins below the arc indicate a potential dual mechanism in protection from pore formation. These results provide a structural framework for understanding MAC pore formation and regulation, processes important for fighting infections and preventing complement-mediated tissue damage.

Argentina y la bipolaridad Estados Unidos-China: Implicancias de un escenario posible

OpenAIRE

Roberto Miranda

2012-01-01

En el presente siglo Argentina afrontó dos situaciones internacionales bien diferentes. Una fue la ventaja comercial obtenida gracias a la gravitación mundial de Asia y, sobre todo, al vínculo especial con China. Este país representó un punto de apoyo coyuntural. Otra situación fue la marginación de Argentina del poder inversor transnacional por la interposición norteamericana. El escenario posible de una bipolaridad entre Estados Unidos y China no sería una buena noticia para el país sudamer...

ENDF/B-5 modifications 1986

International Nuclear Information System (INIS)

McLaughlin, P.K.

1986-05-01

This document summarizes the modifications made to the ENDF/B-5 evaluated neutron data files in 1986. The new versions of the files are available from the IAEA Nuclear Data Section upon request, costfree, on magnetic tape. (author)

The nature of Z{sub b} states from a combined analysis of Υ(5S) → h{sub b}(mP)π{sup +}π{sup -} and Υ(5S) → B{sup (*)} anti B{sup (*)}π

Energy Technology Data Exchange (ETDEWEB)

Huo, Wen-Sheng [Xinjiang University, Department of Physics, Ueruemqi (China); Chen, Guo-Ying [Xinjiang University, Department of Physics, Ueruemqi (China); Institute of Theoretical Physics, Chinese Academy of Sciences, State Key Laboratory of Theoretical Physics, Beijing (China)

2016-03-15

With a combined analysis of data on Υ(5S) → h{sub b}(1P, 2P)π{sup +}π{sup -} and Υ(5S) → B{sup (*)} anti B{sup (*)}π in an effective field theory approach, we determine resonance parameters of Z{sub b} states in two scenarios. In one scenario we assume that Z{sub b} states are pure molecular states, while in the other one we assume that Z{sub b} states contain compact components. We find that the present data favor that there should be some compact components inside Z{sub b}{sup (')} associated with themolecular components. By fitting the invariant mass spectra of Υ(5S) → h{sub b}(1P, 2P)π{sup +}π{sup -} and Υ(5S) → B{sup (*)} anti B{sup *}π, we determine that the probability of finding the compact components in Z{sub b} states may be as large as about 40 %. (orig.)

Tracing hepatitis B virus (HBV genotype B5 (formerly B6 evolutionary history in the circumpolar Arctic through phylogeographic modelling

Directory of Open Access Journals (Sweden)

Remco Bouckaert

2017-08-01

Full Text Available Background Indigenous populations of the circumpolar Arctic are considered to be endemically infected (>2% prevalence with hepatitis B virus (HBV, with subgenotype B5 (formerly B6 unique to these populations. The distinctive properties of HBV/B5, including high nucleotide diversity yet no significant liver disease, suggest virus adaptation through long-term host-pathogen association. Methods To investigate the origin and evolutionary spread of HBV/B5 into the circumpolar Arctic, fifty-seven partial and full genome sequences from Alaska, Canada and Greenland, having known location and sampling dates spanning 40 years, were phylogeographically investigated by Bayesian analysis (BEAST 2 using a reversible-jump-based substitution model and a clock rate estimated at 4.1 × 10−5 substitutions/site/year. Results Following an initial divergence from an Asian viral ancestor approximately 1954 years before present (YBP; 95% highest probability density interval [1188, 2901], HBV/B5 coalescence occurred almost 1000 years later. Surprisingly, the HBV/B5 ancestor appears to locate first to Greenland in a rapid coastal route progression based on the landscape aware geographic model, with subsequent B5 evolution and spread westward. Bayesian skyline plot analysis demonstrated an HBV/B5 population expansion occurring approximately 400 YBP, coinciding with the disruption of the Neo-Eskimo Thule culture into more heterogeneous and regionally distinct Inuit populations throughout the North American Arctic. Discussion HBV/B5 origin and spread appears to occur coincident with the movement of Neo-Eskimo (Inuit populations within the past 1000 years, further supporting the hypothesis of HBV/host co-expansion, and illustrating the concept of host-pathogen adaptation and balance.

ENDF/B-5. Fission Product Yields File

International Nuclear Information System (INIS)

Schwerer, O.

1985-10-01

The ENDF/B-5 Fission Product Yields File contains a complete set of independent and cumulative fission product yields, representing the final data from ENDF/B-5 as received at the IAEA Nuclear Data Section in June 1985. Yields for 11 fissioning nuclides at one or more neutron incident energies are included. The data are available costfree on magnetic tape from the IAEA Nuclear Data Section. (author). 4 refs

La pedagogía como espacio posible de convergencia de las humanidades y la ingeniería

Directory of Open Access Journals (Sweden)

Patricia Reyes Aparicio

2012-01-01

Full Text Available Más que afirmaciones, el presente texto se pregunta por la eventualidad de hacer converger, en el campo abierto por la pedagogía, el discurso de las humanidades y el de las ingenierías: ¿es acaso esto posible? ¿Qué con- diciones habría que crear para que esa convergencia reportara beneficios en la perspectiva del pensamiento, de la investigación? Mostrar, enseñar, exponer-se: posibilidades que quedan abiertas cuando de pensar de peda- gogía se trata. De modo que, antes que fronteras disciplinares, horizontes de riesgo, planos abiertos de emergencia a impensables modos del ser y de sus relaciones, porque incluso en estos campos los desarrollos de las subjetividades son posibles, y con ellos, las transformaciones del mismo pensamiento disciplinar sobre el que se ha erigido el mundo, hecho que admite y hasta reclama transformaciones.

Substantial photovoltaic response and morphology tuning in benzo[1,2-b:6,5-b']dithiophene (bBDT) molecular donors.

Science.gov (United States)

Harschneck, Tobias; Zhou, Nanjia; Manley, Eric F; Lou, Sylvia J; Yu, Xinge; Butler, Melanie R; Timalsina, Amod; Turrisi, Riccardo; Ratner, Mark A; Chen, Lin X; Chang, Robert P H; Facchetti, Antonio; Marks, Tobin J

2014-04-21

The influence of solubilizing substituents on the photovoltaic performance and thin-film blend morphology of new benzo[1,2-b:6,5-b']dithiophene (bBDT) based small molecule donor semiconductors is investigated. Solar cells based on bBDT(TDPP)2-PC71BM with two different types of side chains exhibit high power conversion efficiencies, up to 5.53%.

Superconducting state in (W, Ta)5SiB2

Science.gov (United States)

Fukuma, M.; Kawashima, K.; Akimitsu, J.

We characterize the superconducting state in a boro-silicide (W, Ta)5SiB2, with Tc of 6.5 K by means of magnetization, electrical resistivity, and specific heat measurements. As x increased, the transition temperature Tc abruptly enhances from 5.8 to 6.5 K. The magnetization versus magnetic field (M-H) curve indicated that (W, Ta)5SiB2 was a conventional type-II superconductor. The estimated lower critical field Hc1(0) and upper critical field Hc2(T) are about 121 Oe and 14.7 kOe, respectively. The penetration depth λ(0) and coherence length ξ(0) are calculated to be approximately 369 and 14.9 nm, respectively, using Ginzburg-Landau (GL) equations. Specific heat data shows the superconductivity in W4.5Ta0.5SiB2 belongs to a week-coupling BCS superconductor. Finally, we discuss the increasing of Tc in of (W, Ta)5SiB2 system.

ENDF/B-5 formats manual 1984

Energy Technology Data Exchange (ETDEWEB)

Kinsey, R; Magurno, B A

1986-09-01

The ENDF-5 Format, originally the format of the US Evaluated Nuclear Data File ENDF/B-5, was internationally recommended for the computer storage, processing and exchange of evaluated neutron nuclear data. The present document contains the original Formats Manual of 1979, updated with revisions of Nov. 1983. (author) Figs, tabs

26 CFR 48.4161(b)-5 - Effective date.

Science.gov (United States)

2010-04-01

...)-5 Internal Revenue INTERNAL REVENUE SERVICE, DEPARTMENT OF THE TREASURY (CONTINUED) MISCELLANEOUS EXCISE TAXES MANUFACTURERS AND RETAILERS EXCISE TAXES Sporting Goods § 48.4161(b)-5 Effective date. The taxes imposed by section 4161(b) are effective with respect to sales made on and after January 1, 1975. ...

STAT5A and STAT5B have opposite correlations with drug response gene expression

International Nuclear Information System (INIS)

Lamba, V.; Jia, B.; Liang, F.

2016-01-01

Introduction: STAT5A and STAT5B are important transcription factors that play a key role in regulation of several important physiological processes including proliferation, survival, mediation of responses to cytokines and in regulating gender differences in drug response genes such as the hepatic cytochrome P450s (CYPs) that are responsible for a large majority of drug metabolism reactions in the human body. STAT5A and STAT5b have a high degree of sequence homology and have been reported to have largely similar functions. Recent studies have, however, indicated that they can also often have distinct and unique roles in regulating gene expression. Objective: In this study, we evaluated the association of STAT5A and STAT5B mRNA expression levels with those of several key hepatic cytochrome P450s (CYPs) and hepatic transcription factors (TFs) and evaluated the potential roles of STAT5A and 5b in mediating gender differences in these CYPs and TFs. Methods: Expression profiling for major hepatic CYP isoforms and transcription factors was performed using RNA sequencing (RNA-seq) in 102 human liver samples (57 female, 45 male). Real time PCR gene expression data for selected CYPs and TFs was available on a subset of 50 human liver samples (25 female, 25 male) and was used to validate the RNA-seq findings. Results: While STAT5A demonstrated significant negative correlation with expression levels of multiple hepatic transcription factors (including NR1I2 and HNF4A) and DMEs such as CYP3A4 and CYP2C19, STAT5B expression was observed to demonstrate positive associations with several CYPs and TFs analyzed. As STAT5A and STAT5B have been shown to be important in regulation of gender differences in CYPs, we also analyzed STAT5A and 5b associations with CYPs and TFs separately in males and females and observed gender dependent differential associations of STATs with several CYPs and TFs. Results from the real time PCR validation largely supported our RNA-seq findings

Propagaçăo vegetativa de pupunheira (Bactris gasipaes H.B.K.) a partir de perfilhos /

OpenAIRE

Tracz, Anderson Luiz Augusto

2005-01-01

Orientador: Marguerite Quoirin Co-orientador: Ivar Wendling Dissertaçăo (mestrado) - Universidade Federal do Paraná, Setor de Cięncias Agrárias, Programa de Pós-Graduaçăo em Agronomia. Defesa: Curitiba, 2005 Inclui bibliografia e anexos Área de concentraçăo: Produçăo vegetal

45 CFR 5b.10 - Parents and guardians.

Science.gov (United States)

2010-10-01

... 45 Public Welfare 1 2010-10-01 2010-10-01 false Parents and guardians. 5b.10 Section 5b.10 Public... Parents and guardians. For the purpose of this part, a parent or guardian of any minor or the legal guardian or any individual who has been declared incompetent due to physical or mental incapacity or age by...

Penetration of the renewable sources of energy in Mexico: group of approach on possible guidelines for policies for the renewable energies (Annexe 13 in 'A vision of year 2030 on the use of the renewable energies in Mexico'); Penetracion de las fuentes renovables de energia en Mexico: grupo de enfoque sobre posibles lineamientos de politicas para las energias renovables (Anexo 13 en 'Una vision al 2030 de la utilizacion de las energias renovables en Mexico')

Energy Technology Data Exchange (ETDEWEB)

Pernudi, Montserrat; Alonso C, Antonio [Analitica Consultores S.A. de C.V., Mexico D.F. (Mexico)

2005-08-15

This report corresponds to the results obtained in the group of consultation to experts on the possible policy guidelines that could favor the penetration of the renewable energies in Mexico, conducted on July 26, 2005 in Mexico City with a small group of approach, the specific objectives of the meeting were: to define possible policy guidelines that help the future penetration of the renewable energies in Mexico between years 2005 and 2030; and to explore possible obstacles for the implantation of such policies. [Spanish] Este informe corresponde a los resultados obtenidos en el grupo de consulta a expertos sobre los posibles lineamientos de politicas que podrian favorecer la penetracion de las energias renovables en Mexico, realizado el 26 de julio de 2005 en la ciudad de Mexico con un pequeno grupo de enfoque, los objetivos especificos de la reunion fueron: definir posibles lineamientos de politica que ayuden a la penetracion futura de las energias renovables en Mexico entre los anos 2005 y 2030; y explorar posibles obstaculos para la implantacion de dichas politicas.

Broken SU(5) x SU(5) chiral symmetry and the classification of B mesons

International Nuclear Information System (INIS)

Hatzis, M.

1984-01-01

We consider broken SU(5) x SU(5) chiral summetry and we assume that the vacuum is SU(5)-symmetric. Using the observed mass spectrum of pseudoscalar mesons, and setting the bu mass in the range 5.2 +- 0.06 GeV, we predict the masses of bs, bc, and etasub(b) states as well as axial current couplings fsub(i)/fsub(π). SU(5) x SU(5) is found to be consistent with SU(4) x SU(4) breaking. The problem of eta - eta' - eta sub(c) - eta sub(b) mixing is also discussed

Structure and physical properties of Cr_5B_3-type Ta_5Si_3 and Ta_5Ge_3

International Nuclear Information System (INIS)

Yuan, Fang; Forbes, Scott; Ramachandran, Krishna Kumar; Mozharivskyj, Yurij

2015-01-01

The Cr_5B_3-type Ta_5Si_3 phase was prepared by arc-melting, while the Cr_5B_3-type Ta_5Ge_3 one was synthesized through sintering at 1000 °C. X-ray single crystal diffraction was employed to elucidate their structure. According to the magnetization measurements, both Ta_5Si_3 and Ta_5Ge_3 are Pauli paramagnets, with Ta_5Ge_3 showing a Curie-Weiss-like paramagnetic behavior at low temperatures likely due to presence of paramagnetic impurity. Both Ta_5Si_3 and Ta_5Ge_3 display a very low electrical resistivity from 2 to 300 K. The resistivity is constant below 20 K, but displays a positive temperature coefficient above 20 K. Electronic structure calculations with the TB-LMTO-ASA method support the metallic character of the two phases and suggest that the bonding is optimized in both phases. - Highlights: • Synthesis of Cr_5B_3-type Ta_5Si_3 and Ta_5Ge_3 phases with high purity by arc-melting and sintering, respectively. • Magnetization data and electrical resistivity of the Cr_5B_3-type Ta_5Si_3 and Ta_5Ge_3 phases. • Crystal and electronic structure analysis for Ta_5Si_3 and Ta_5Ge_3 phase by X-ray diffraction and TB-LMTO-ASA calculations.

In vitro effects of myricetin, morin, apigenin, (+)-taxifolin, (+)-catechin, (−)-epicatechin, naringenin and naringin on cytochrome b5 reduction by purified NADH-cytochrome b5 reductase

International Nuclear Information System (INIS)

Çelik, Haydar; Koşar, Müberra; Arinç, Emel

2013-01-01

Highlights: • We assessed inhibitory effects of 8 dietary flavonoids on cytochrome b5 reduction by purified NADH-cytochrome b5 reductase. • The flavonol myricetin was the most potent in inhibiting cytochrome b5 reduction with an IC 50 value of 0.35 μM. • We investigated kinetics of myricetin-induced inhibition in detail. • We explored the structure–inhibitory activity relationship of compounds. • Modulation of cytochrome b5 reduction indicates a potential for myricetin to lead to some food–drug/xenobiotic interactions. - Abstract: The microsomal NADH-dependent electron transport system consisting of cytochrome b5 reductase and cytochrome b5 participates in a number of physiologically important processes including lipid metabolism as well as is involved in the metabolism of various drug and xenobiotics. In the present study, we assessed the inhibitory effects of eight dietary flavonoids representing five distinct chemical classes on cytochrome b5 reduction by purified cytochrome b5 reductase. From the flavonoids tested, myricetin was the most potent in inhibiting cytochrome b5 reduction with an IC 50 value of 0.35 μM. Myricetin inhibited b5 reductase noncompetitively with a K i of 0.21 μM with respect to cofactor NADH, and exhibited a non-linear relationship indicating non-Michaelis–Menten kinetic binding with respect to cytochrome b5. In contrast to the potent inhibitory activity of myricetin, (+)-taxifolin was found to be a weak inhibitor (IC 50 = 9.8 μM). The remaining flavonoids were inactive within the concentration range tested (1–50 μM). Analysis of structure–activity data suggested that simultaneous presence of three OH groups in ring B is a primary structural determinant for a potent enzyme inhibition. Our results suggest that inhibition of the activity of this system by myricetin or myricetin containing diets may influence the metabolism of therapeutic drugs as well as detoxification of xenobiotics

Prospects and current status of B5 biodiesel implementation in Malaysia

International Nuclear Information System (INIS)

Yusoff, Mohd.Hizami Mohd.; Abdullah, Ahmad Zuhairi; Sultana, Shazia; Ahmad, Mushtaq

2013-01-01

This paper addresses B5 biodiesel programs in Malaysia, global challenges on the production of palm oil. Protective measures for future efficiency as well as continued viability of this renewable energy sector are also discussed. Crude palm oil (CPO) prices are currently suppressed because of high palm oil inventory. Malaysian government has taken a pro-active step in implementing the B5 biodiesel for transportation and industrial sectors through the introduction of B5 biodiesel. The B5 Biodiesel Program which was initially targeted at selected government agencies has been fully implemented for subsidized sectors in the Central Region. The promotion of B5 development is highly attractive due to its potential local feedstock from palm oil industry and the availability of production technologies that offer opportunities for the sustainable development in energy entrepreneurships. Nationally, produced B5 will improve the access to alternative energy services and is expected to help in improving productivity and sustainability. Despite successful local B5 implementation, Malaysia is recently facing global challenges on the biodiesel production which currently remains stagnant due to weak domestic demand and uncompetitive export tax structure. -- Highlights: •Prospects of B5 biodiesel implementation in Malaysia. •National Biofuel Policy thrusts pertinent to B5 program. •Successful application of B5 in government and industrial sectors. •Challenges in CPO production, weak domestic demand and export tax. •Reassessment of national policy according to global issues

Computational investigation of hydrogen storage on B5V3

Science.gov (United States)

Guo, Chen; Wang, Chong

2018-05-01

Based on density functional theory method with 6-311+G(d,p) basis set, the structures, stability and hydrogen storage capacity of B5V3 have been theoretically investigated. It is found that a maximum of seven hydrogen molecules can be adsorbed on B5V3 with gravimetric uptake capacity of 6.39 wt%. The uptake capacity exceeds the target set by the US Department of Energy for vehicular application. Moreover, the average adsorption energy of B5V3 01 (7H2) is 0.60 eV/H2 in the desirable range of reversible hydrogen storage. The kinetic stability of H2 adsorbed on B5V3 01 is confirmed by using gap between highest occupied molecular orbital (HOMO)and the lowest unoccupied molecular orbital (LUMO). The gap value of B5V3 01 (7H2) is 2.81 eV, which indicates the compound with high stability. In addition, the thermochemistry calculation (Gibbs free energy corrected adsorption energy) is used to analyse if the adsorption is favourable or not at different temperatures. It can be found that the Gibbs corrected adsorption energy of B5V3 01 (7H2) is still positive at 400 K at 1 atm. It means that the adsorption of seven hydrogen molecules on B5V3 01 is energetically favourable in a fairly wide temperature range. All the results show that B5V3 01 can be considered as a promising material for hydrogen storage.

26 CFR 301.6226(b)-1 - 5-percent group.

Science.gov (United States)

2010-04-01

... 26 Internal Revenue 18 2010-04-01 2010-04-01 false 5-percent group. 301.6226(b)-1 Section 301.6226... ADMINISTRATION PROCEDURE AND ADMINISTRATION Assessment In General § 301.6226(b)-1 5-percent group. (a) In general. All members of a 5-percent group shall join in filing any petition for judicial review. The...

UNC5B receptor deletion exacerbates tissue injury in response to AKI.

Science.gov (United States)

Ranganathan, Punithavathi; Jayakumar, Calpurnia; Navankasattusas, Sutip; Li, Dean Y; Kim, Il-man; Ramesh, Ganesan

2014-02-01

Netrin-1 regulates cell survival and apoptosis by activation of its receptors, including UNC5B. However, the in vivo role of UNC5B in cell survival during cellular stress and tissue injury is unknown. We investigated the role of UNC5B in cell survival in response to stress using mice heterozygously expressing the UNC5B gene (UNC5B(-/flox)) and mice with targeted homozygous deletion of UNC5B in kidney epithelial cells (UNC5B(-/flox/GGT-cre)). Mice were subjected to two different models of organ injury: ischemia reperfusion injury of the kidney and cisplatin-induced nephrotoxicity. Both mouse models of UNC5B depletion had normal organ function and histology under basal conditions. After AKI, however, UNC5B(-/flox/GGT-cre) mice exhibited significantly worse renal function and damage, increased tubular apoptosis, enhanced p53 activation, and exacerbated inflammation compared with UNC5B(-/flox) and wild-type mice. shRNA-mediated suppression of UNC5B expression in cultured tubular epithelial cells exacerbated cisplatin-induced cell death in a p53-dependent manner and blunted Akt phosphorylation. Inhibition of PI3 kinase similarly exacerbated cisplatin-induced apoptosis; in contrast, overexpression of UNC5B reduced cisplatin-induced apoptosis in these cells. Taken together, these results show that the netrin-1 receptor UNC5B plays a critical role in cell survival and kidney injury through Akt-mediated inactivation of p53 in response to stress.

Posibles efectos en la salud asociados con la metalurgia precolombina.

Directory of Open Access Journals (Sweden)

Alvaro Javier Idrovo

2005-09-01

Full Text Available En el Viejo Mundo algunos investigadores piensan que los efectos adversos en la salud relacionados con la exposición a arsénico influyeron para que se cambiara de usar aleaciones de cobre con arsénico a otras menos tóxicas. En este artículo se evalúa esta hipótesis para las tres grandes tradiciones metalúrgicas precolombinas: Andes centrales, área intermedia y occidente mexicano. Los artefactos metálicos revelan que las concentraciones de arsénico en los Andes centrales fueron similares a las del Viejo Mundo (0,5% a 1%, en el área intermedia los valores eran muy inferiores, mientras en el occidente mexicano fueron muy superiores (7% a 25%. En los Andes centrales se observó inicialmente el uso de bronce arsenical, pero rápidamente se conocieron las aleaciones de cobre-estaño; estas últimas fueron cada vez más preferidas y difundidas por todo el imperio inca. Las evidencias, osteológicas y en objetos artísticos, de amputaciones de los pies entre individuos moches de los Andes centrales apoyan la idea de la presencia de la ?enfermedad del pie negro? entre las poblaciones precolombinas. En conclusión, es posible que los efectos nocivos del arsénico se hayan observado en el Nuevo Mundo, y favorecido el cambio hacia aleaciones menos tóxicas. Se requieren nuevos estudios específicos para verificar esta hipótesis.

On the structure of Lattice code WIMSD-5B

International Nuclear Information System (INIS)

Kim, Won Young; Min, Byung Joo

2004-03-01

The WIMS-D code is a freely available thermal reactor physics lattice code used widely for thermal research and power reactor calculation. Now the code WIMS-AECL, developed on the basis of WIMS-D, has been used as one of lattice codes for the cell calculation in Canada and also, in 1998, the latest version WIMSD-5B is released for OECD/NEA Data Bank. While WIMS-KAERI was developed and has been used, originated from WIMS-D, in Korea, it was adjusted for the cell calculation of research reactor HANARO and so it has no confirmaty to CANDU reactor. Therefore, the code development applicable to cell calculation of CANDU reactor is necessary not only for technological independence and but also for the establishment of CANDU safety analysis system. A lattice code WIMSD-5B was analyzed in order to set the system of reactor physics computer codes, to be used in the assessment of void reactivity effect. In order to improve and validate WIMSD-5B code, the analysis of the structure of WIMSD-5B lattice code was made and so its structure, algorithm and the subroutines of WIMSD-5B were presented for the cluster type and the pij method modelling the CANDU-6 fuel

Implication of 5-HT(2B) receptors in the serotonin syndrome.

Science.gov (United States)

Diaz, Silvina Laura; Maroteaux, Luc

2011-09-01

The serotonin (5-HT) syndrome occurs in humans after antidepressant overdose or combination of drugs inducing a massive increase in extracellular 5-HT. Several 5-HT receptors are known to participate in this syndrome in humans and animal models. The 5-HT(2B) receptor has been proposed as a positive modulator of serotonergic activity, but whether it is involved in 5-HT syndrome has not yet been studied. We analyzed here, a putative role of 5-HT(2B) receptors in this disorder by forced swimming test (FST) and behavioral assessment in the open field. In FST, genetic (5-HT(2B)(-/-) mice) or pharmacological (antagonist RS127445 at 0.5 mg/kg) ablation of 5-HT(2B) receptors facilitated selective 5-HT reuptake inhibitors (SSRI)-induced increase of immobility time as well as expression of other symptoms related to 5-HT syndrome like hind limb abduction and Straub tail. Increase in immobility was also developed in FST by both wild type (WT) and 5-HT(2B)(-/-) mice after the administration of 5-HT(1A), 5-HT(2A) or 5-HT(2C) receptor agonists, 8-OH-DPAT (5 mg/kg), DOI (1 mg/kg), or WAY161503 (5 mg/kg), respectively. In contrast, the 5-HT(2B) receptor agonist BW723C86 (3 mg/kg) or 5-HT(1B) receptor agonist CGS12066A (2 mg/kg) decreased immobility time in both genotypes. The 5-HT syndrome induced by fluoxetine at high doses was blocked in WT and 5-HT(2B)(-/-) mice by administration of 5-HT(1A) and 5-HT(2C) receptor antagonists (WAY100635 0.5 mg/kg and SB242084 0.5 mg/kg) but not by the 5-HT(2A) receptor antagonist MDL100907 (1 mg/kg). By behavioral assessment, we confirmed that 5-HT(2B)(-/-) mice were more prone to develop 5-HT syndrome symptoms after administration of high dose of SSRIs or the 5-HT precursor 5-Hydroxytryptophan, 5-HTP, even if increases in 5-HT plasma levels were similar in both genotypes. This evidence suggests that the presence of 5-HT(2B) receptors hinders acute 5-HT toxicity once high levels of 5-HT are attained. Therefore, differential agonism

Structural aspects of B2O3-substituted (PbO)0.5(SiO2)0.5 glasses

International Nuclear Information System (INIS)

Sudarsan, V.; Kulshreshtha, S.K.; Shrikhande, V.K.; Kothiyal, G.P.

2002-01-01

Lead borosilicate glasses having general formulae (PbO) 0.5-x (SiO 2 ) 0.5 (B 2 O 3 ) x with 0.0≤x≤0.4 and (PbO) 0.5 (SiO 2 ) 0.5-y (B 2 O 3 ) y with 0.0≤y≤0.5 have been prepared by a conventional melt-quench method and characterized by 29 Si, 11 B magic angle spinning (MAS) NMR techniques and infrared spectroscopy, as regards their structural features. From 29 Si NMR results, it has been inferred that with increasing concentration of boron oxide, (PbO) 0.5-x (SiO 2 ) 0.5 (B 2 O 3 )x glasses exhibit a systematic increase in the number of Q 4 structural units of Si at the expense of Q 2 structural units, along with the formation of Si-O-B linkages. On the other hand, for (PbO) 0.5 (SiO 2 ) 0.5-y (B 2 O 3 ) y glasses, there is no direct interaction between SiO 2 and B 2 O 3 in the glass network, as revealed by the 29 Si MAS NMR studies. Boron exists in both trigonal and tetrahedral configurations for these two series of glasses and for the (PbO) 0.5 (SiO 2 ) 0.5-y (B 2 O 3 ) y series of glasses; the relative concentration of these two structural units remains almost constant with increasing B 2 O 3 concentration. In contrast, for (PbO) 0.5-x (SiO 2 ) 0.5 (B 2 O 3 ) x glasses, there is a slight increase in the number of BO 3 structural units above x = 0.2, as there is a competition between SiO 2 and B 2 O 3 for interaction with Pb 2+ , thereby leading to the formation of BO 3 structural units. For both series of glasses, the thermal expansion coefficient is found to decrease with increasing B 2 O 3 concentration, the effect being more pronounced for the (PbO) 0.5-x (SiO 2 ) 0.5 (B 2 O 3 ) x series of glasses due to the increased concentration of Q 4 structural units of silicon and better cross-linking as a result of the formation of Si-O-B-type linkages. (author)

The nature of Zb states from a combined analysis of Υ(5S) → hb(mP)π+π- and Υ(5S) → B(*) anti B(*)π

International Nuclear Information System (INIS)

Huo, Wen-Sheng; Chen, Guo-Ying

2016-01-01

With a combined analysis of data on Υ(5S) → h b (1P, 2P)π + π - and Υ(5S) → B (*) anti B (*) π in an effective field theory approach, we determine resonance parameters of Z b states in two scenarios. In one scenario we assume that Z b states are pure molecular states, while in the other one we assume that Z b states contain compact components. We find that the present data favor that there should be some compact components inside Z b (') associated with themolecular components. By fitting the invariant mass spectra of Υ(5S) → h b (1P, 2P)π + π - and Υ(5S) → B (*) anti B * π, we determine that the probability of finding the compact components in Z b states may be as large as about 40 %. (orig.)

Investigación narrativa con docentes sobre mundos posibles para la educación: la recreación de otros sentidos

Directory of Open Access Journals (Sweden)

Norma Georgina Gutiérrez Serrano

Full Text Available Resumen: Este artículo se desprende de un trabajo más amplio de investigación narrativa con docentes de una escuela rural de educación básica, en México, que tiene por objetivo coproducir, entre docentes e investigadores, un libro sobre la historia de conformación de dicha escuela. Evoca la memoria colectiva por medio de relatos docentes del hacer educativo cotidiano, sobre la construcción del espacio escolar, en escenario rural y en un contexto histórico particular. Como parte de los resultados de esta investigación está la identificación de mundos posibles, que como núcleos temáticos de sentido dentro de los relatos, permiten inspirar y orientar la práctica docente dentro de la escuela. Con entrevistas abiertas a los miembros de la comunidad escolar y la generación de diálogos, se recuperaron los relatos de la labor profesional de siete docentes, quienes expresaron sus sueños, aspiraciones y acciones educativas con sus estudiantes y la comunidad de padres en relación con las acciones desplegadas por ellos para la construcción del espacio escolar al que pertenecen - por ejemplo, el establecimiento de un comedor escolar, la construcción de los espacios físicos necesarios para la labor educativa (aulas suficientes para cada grado, canchas de juegos, plaza cívica, salones de cómputo y logro de condiciones de seguridad (barda perimetral, organización de vigilancia y comisiones de seguridad. Los mundos posibles de los docentes se recrean en las formas autogestivas y comunitarias escolares, en fuerte vínculo con la historia y los modos de existencia de su pueblo originario.

Valence behavior of Eu-ions in intermetallic compound Ce{sub 0.5}Eu{sub 0.5}Pd{sub 3}B{sub 0.5}

Energy Technology Data Exchange (ETDEWEB)

Pandey, Abhishek, E-mail: apandey@ameslab.gov [Experimental Condensed Matter Physics Division, Saha Institute of Nuclear Physics, 1/AF, Bidhannagar, Kolkata 700064 (India); S.N. Bose National Centre for Basic Sciences, Block-JD, Sector-III, Salt Lake, Kolkata 700098 (India); Mazumdar, Chandan, E-mail: chandan.mazumdar@saha.ac.in [S.N. Bose National Centre for Basic Sciences, Block-JD, Sector-III, Salt Lake, Kolkata 700098 (India); Ranganathan, R. [S.N. Bose National Centre for Basic Sciences, Block-JD, Sector-III, Salt Lake, Kolkata 700098 (India); Raghavendra Reddy, V.; Gupta, Ajay [UGC-DAE Consortium for Scientific Research, University Campus, Khandawa Road, Indore (India)

2011-12-15

We have studied the valence behavior of rare-earth ions, in particular Eu-ions, in a cubic intermetallic compound Ce{sub 0.5}Eu{sub 0.5}Pd{sub 3}B{sub 0.5} which is a homogeneous solid solution of two mixed-valent compounds CePd{sub 3} and EuPd{sub 3}B. Results of {sup 151}Eu Moessbauer spectroscopic measurements show that two different valence states, i.e., divalent- and trivalent-like states of Eu-ions exist in the compound. The possible reason for the observed heterogeneous valency vis-a-vis the variation in the chemical environment and the number of nearest-neighbor B atoms surrounding the Eu-ions has been discussed. Our results demonstrate that B incorporation in such Eu-based cubic intermetallic compounds leads to a situation where heterogeneous-valence state of Eu-ions is an energetically favorable ground state. - Highlights: > Intermetallic compound Ce{sub 0.5}Eu{sub 0.5}Pd{sub 3}B{sub 0.5} crystallizes in a single phase. > Eu-ions in Ce{sub 0.5}Eu{sub 0.5}Pd{sub 3}B{sub 0.5} are charge-ordered compared to +2.3 valency in Ce{sub 0.5}Eu{sub 0.5}Pd{sub 3}. > B incorporation makes charge-ordered state of Eu-ions energetically more favorable. > Nearest-neighbor chemical environment affects the Eu valency.

Posibles influencias de la migración en los cambios de fecundidad

Directory of Open Access Journals (Sweden)

GRACIELA SARRIBLE

1987-01-01

Full Text Available Las estadísticas de fertilidad de las mujeres nacidas en Barcelona, España, 1970-1981, se comparan con las de las mujeres migrantes (mujeres nacidas fuera de Cataluña. La relación entre migración, nupcialidad y fertilidad aparece como algo complejo. Se investigan las distintas y posibles explicaciones. La fertilidad de las mujeres migrantes no es necesariamente más alta que la de las catalanas, pero las mayores variaciones son observables entre los grupos migratorios, sugiriendo diferencias intrínsecas entre las comunidades origen. Los resultados sugieren que las mujeres que contemplan la migración tienden a retrasar el matrimonio y el parto hasta después del movimiento migratorio.

Low 5-HT1B receptor binding in the migraine brain

DEFF Research Database (Denmark)

Deen, Marie; Hansen, Hanne D; Hougaard, Anders

2018-01-01

Background The pathophysiology of migraine may involve dysfunction of serotonergic signaling. In particular, the 5-HT1B receptor is considered a key player due to the efficacy of 5-HT1B receptor agonists for treatment of migraine attacks. Aim To examine the cerebral 5-HT1B receptor binding....... Patients who reported migraine brain regions involved in pain modulation as regions of interest and applied a latent variable model (LVM) to assess the group effect on binding across these regions. Results Our data...... support a model wherein group status predicts the latent variable ( p = 0.038), with migraine patients having lower 5-HT1B receptor binding across regions compared to controls. Further, in a whole-brain voxel-based analysis, time since last migraine attack correlated positively with 5-HT1B receptor...

45 CFR 5b.13 - Fees.

Science.gov (United States)

2010-10-01

... DEPARTMENT OF HEALTH AND HUMAN SERVICES GENERAL ADMINISTRATION PRIVACY ACT REGULATIONS § 5b.13 Fees. (a) Policy. Where applicable, fees for copying records will be charged in accordance with the schedule set... whether the search is manual, mechanical, or electronic. Where a copy of the record must be made in order...

296-B-5 Stack monitoring and sampling system annual system assessment report

International Nuclear Information System (INIS)

Ridge, T.M.

1995-02-01

The B Plant Administration Manual requires an annual system assessment to evaluate and report the present condition of the sampling and monitoring system associated with Stack 296-B-5 at B Plant. The sampling and monitoring system associated with stack 296-B-5 is functional and performing satisfactorily. This document is an annual assessment report of the systems associated with the 296-B-5 stack

Influence of 5% dextrose volume on amphotericin B deoxycholate preparation.

Science.gov (United States)

Sun, Pingping; Chen, Jie; Zhang, Zhihao; Gao, Xiang; Chen, Pan; Li, Shuxia

2016-04-01

Preparation of amphotericin B deoxycholate (AmB-d) in different volumes of 5% dextrose (D5W) was studied to investigate a interesting phenomenon that AmB-d was easy to bring pipe blockage when diluted in 500 ml but not in 50 ml. AmB-d (25 mg/vial) in 50 ml, 250 ml or 500 ml D5W was prepared. Fluids were collected before and after infusion, then were assayed by validated high-performance liquid chromatography (HPLC) method. Light obscuration assay was used to detect the particles in transfusions. pH values of different volumes of D5W were all about 3.7, which was lower than the requirement of AmB-d package insert (pH > 4.2). The number of insoluble particles >10 μm/25 μm in 25 mg/500 ml infusions exceeded China Pharmacopoeia limit. Filters in 25 mg/500 ml infusion set were full of AmB-d after dripping slowly for 6 h, and 331.3 ml solution was left in the bottles and only 11.3% of AmB-d could flow out. Whereas the AmB-d infusion consists of 25 mg/50 ml, 25 mg/250 ml and 50 mg/500 ml could meet with China Pharmacopoeia standards, and they flowed out easily and completely. In practice, 25 mg/250 ml and 50 mg/500 ml would be more suitable for clinical use, rather than 25 mg/500 ml. We provided a convenient method for AmB-d preparation. © 2016 Royal Pharmaceutical Society, Journal of Pharmacy and Pharmacology.

5 CFR 870.1205 - Electing portability for Option B.

Science.gov (United States)

2010-01-01

... 5 Administrative Personnel 2 2010-01-01 2010-01-01 false Electing portability for Option B. 870... portability for Option B. (a) The employing agency must notify the employee/assignee(s) of the loss of coverage and the right to elect portability for Option B either before or immediately after the event...

ENDF/B-5 Actinides (Rev. 86)

International Nuclear Information System (INIS)

Lemmel, H.D.

1986-05-01

This document summarizes the contents of the Actinides part of the ENDF/B-5 nuclear data library released by the US National Nuclear Data Center. This library or selective retrievals of it, are available costfree from the IAEA Nuclear Data Section upon request. The present version of the library is the Revision of 1986. (author). Refs, figs and tabs

Memory Enhancement by Targeting Cdk5 Regulation of NR2B

Science.gov (United States)

Plattner, Florian; Hernandéz, Adan; Kistler, Tara M.; Pozo, Karine; Zhong, Ping; Yuen, Eunice Y.; Tan, Chunfeng; Hawasli, Ammar H.; Cooke, Sam F.; Nishi, Akinori; Guo, Ailan; Wiederhold, Thorsten; Yan, Zhen; Bibb, James A.

2014-01-01

SUMMARY Many psychiatric and neurological disorders are characterized by learning and memory deficits, for which cognitive enhancement is considered a valid treatment strategy. The N-methyl-D-aspartate receptor (NMDAR) is a prime target for the development of cognitive enhancers due to its fundamental role in learning and memory. In particular, the NMDAR subunit NR2B improves synaptic plasticity and memory when over-expressed in neurons. However, NR2B regulation is not well understood and no therapies potentiating NMDAR function have been developed. Here, we show that serine 1116 of NR2B is phosphorylated by cyclin-dependent kinase 5 (Cdk5). Cdk5-dependent NR2B phosphorylation is regulated by neuronal activity and controls the receptor’s cell surface expression. Disrupting NR2B-Cdk5 interaction using a small interfering peptide (siP) increases NR2B surface levels, facilitates synaptic transmission, and improves memory formation in vivo. Our results reveal a novel regulatory mechanism critical to NR2B function that can be targeted for the development of cognitive enhancers. PMID:24607229

A Novel Role for C5a in B-1 Cell Homeostasis

Directory of Open Access Journals (Sweden)

Katharina Bröker

2018-02-01

Full Text Available B-1 cells constitute a unique subpopulation of lymphocytes residing mainly in body cavities like the peritoneal cavity (PerC but are also found in spleen and bone marrow (BM. As innate-like B cells, they mediate first line immune defense through low-affinity natural IgM (nIgM antibodies. PerC B-1 cells can egress to the spleen and differentiate into nIgM antibody-secreting plasma cells that recognize conserved exogenous and endogenous cellular structures. Homing to and homeostasis within the PerC are regulated by the chemokine CXCL13 released by PerC macrophages and stroma cells. However, the exact mechanisms underlying the regulation of CXCL13 and B-1 homeostasis are not fully explored. B-1 cells play important roles in the inflammatory response to infection, autoimmunity, ischemia/reperfusion injury, obesity, and atherosclerosis. Remarkably, this list of inflammatory entities has a strong overlap with diseases that are regulated by complement suggesting a link between B-1 cells and the complement system. Interestingly, up to now, no data exist regarding the role of complement in B-1 cell biology. Here, we demonstrate for the first time that C5a regulates B-1 cell steady-state dynamics within the peritoneum, the spleen, and the BM. We found decreased B-1a cell numbers in the peritoneum and the spleen of C5aR1−/− mice associated with increased B1-a and B1-b numbers in the spleen and high serum titers of nIgM antibodies directed against phosphorylcholine and several pneumococcal polysaccharides. Similarly, peritoneal B-1a cells were decreased in the peritoneum and splenic B-1a and B-1b cells were increased in C5aR2−/− mice. The decrease in peritoneal B-1 cell numbers was associated with decreased peritoneal CXCL13 levels in C5aR1−/− and C5aR2−/− mice. In search for mechanisms, we found that combined TLR2 and IL-10 receptor activation in PerC macrophages induced strong CXCL13 production, which was significantly reduced in cells

Posible relación de loratadina con el desenlace fatal en un paciente de riesgo

OpenAIRE

Yanguas, Emilio Pol; Mirch, Rita; Mayoral Borrell, Enrique; Martínez Granados, Paco

2018-01-01

Un varón de 62 años, polimedicado de forma crónica por enfermedad mental grave y persistente, EPOC, diabetes e hipotiroidismo, estabilizado desde hace bastantes meses, inició un tratamiento con loratadina por rinitis. Al día siguiente es encontrado desvanecido sin conocimiento y trasladado de urgencia al hospital general para cuidados intensivos, donde fallece un día después. El análisis del caso revela un posible “efecto mariposa” con desenlace fatal, desencadenado por un fármaco de bajo rie...

POSIBLES SITIOS DE OCUPACIÓN PARA EL TRITIO EN EL TITANATO DE LITIO: UN ESTUDIO DFT PERIÓDICO

Directory of Open Access Journals (Sweden)

Antonio Buljan

2010-01-01

Full Text Available En este trabajo se presenta una investigación teórica sobre los posibles sitios de ocupación de los átomos de tritio en la estructura de titanato de litio. Para esto se utilizó un método de Teoría Funcional de la Densidad (DFT periódico utilizando el paquete computacional VASP. Fueron identificados dos posibles sitios donde un átomo de tritio puede sustituir a un átomo de Li. Uno de estos sitios está en la capa de átomos de titanio y el otro en la capa de litio. Este estudio demuestra que el tritio liberado puede ocupar mas favorablemente el sitio en las capas de litio que de titanio. En efecto, si se comparan los átomos de tritio que ocupan posiciones en las capas de litio con aquellos que ocupan posiciones en las capas de titanio, son estos últimos los que requieren mayor energía para ser liberados. Por último, se encontró una interesante relación entre los resultados reportados en este estudio y los datos experimentales reportados en la literatura.

Aspectos jurídicos y perspectivas políticas de una posible retirada de la Unión Europea por parte del Reino Unido

Directory of Open Access Journals (Sweden)

Werner Miguel Kühn Baca

2016-08-01

Full Text Available El artículo ofrece un análisis de la situación actual de las relaciones entre el Reino Unido y la Unión Europea. El enfoque se encuentra en los aspectos jurídicos y las perspectivas políticas de una posible retirada por parte de este Estado miembro del proceso de integración europeo. Se evalúan los posibles escenarios y consecuencias, tomando en cuenta tanto el marco jurídico cómo el entorno político actual. En base a dicho análisis, se proponen soluciones que podrían satisfacer los intereses del Reino Unido y la Unión Europea.

Microstructural analysis of hot press formed 22MnB5 steel

Science.gov (United States)

Aziz, Nuraini; Aqida, Syarifah Nur; Ismail, Izwan

2017-10-01

This paper presents a microstructural study on hot press formed 22MnB5 steel for enhanced mechanical properties. Hot press forming process consists of simultaneous forming and quenching of heated blank. The 22MnB5 steel was processed at three different parameter settings: quenching time, water temperature and water flow rate. 22MnB5 was processed using 33 full factorial design of experiment (DOE). The full factorial DOE was designed using three factors of quenching time, water temperature and water flow rate at three levels. The factors level were quenching time range of 5 - 11 s, water temperature; 5 - 27°C and water flow rate; 20 - 40 L/min. The as-received and hot press forming processed steel was characterised for metallographic study and martensitic structure area percentage using JEOL Field Emission Scanning Electron Microscopic (FESEM). From the experimental finding, the hot press formed 22MnB5 steel consisted of 50 to 84% martensitic structure area. The minimum quenching time of 8 seconds was required to obtain formed sample with high percentage of martensite. These findings contribute to initial design of processing parameters in hot press forming of 22MnB5 steel blanks for automotive component.

46 CFR 32.63-5 - Barge hull classifications-B/ALL.

Science.gov (United States)

2010-10-01

... 46 Shipping 1 2010-10-01 2010-10-01 false Barge hull classifications-B/ALL. 32.63-5 Section 32.63..., AND HULL REQUIREMENTS Hull and Cargo Tank Requirements for Tank Barges Constructed or Converted On or After July 1, 1964, and Carrying Certain Dangerous Bulk Cargoes § 32.63-5 Barge hull classifications—B...

Crystal structures of (Z-5-[2-(benzo[b]thiophen-2-yl-1-(3,5-dimethoxyphenylethenyl]-1H-tetrazole and (Z-5-[2-(benzo[b]thiophen-3-yl-1-(3,4,5-trimethoxyphenylethenyl]-1H-tetrazole

Directory of Open Access Journals (Sweden)

Narsimha Reddy Penthala

2016-05-01

Full Text Available (Z-5-[2-(Benzo[b]thiophen-2-yl-1-(3,5-dimethoxyphenylethenyl]-1H-tetrazole methanol monosolvate, C19H16N4O2S·CH3OH, (I, was prepared by the reaction of (Z-3-(benzo[b]thiophen-2-yl-2-(3,5-dimethoxyphenylacrylonitrile with tributyltin azide via a [3 + 2]cycloaddition azide condensation reaction. The structurally related compound (Z-5-[2-(benzo[b]thiophen-3-yl-1-(3,4,5-trimethoxyphenylethenyl]-1H-tetrazole, C20H18N4O3S, (II, was prepared by the reaction of (Z-3-(benzo[b]thiophen-3-yl-2-(3,4,5-trimethoxyphenylacrylonitrile with tributyltin azide. Crystals of (I have two molecules in the asymmetric unit (Z′ = 2, whereas crystals of (II have Z′ = 1. The benzothiophene rings in (I and (II are almost planar, with r.m.s deviations from the mean plane of 0.0084 and 0.0037 Å in (I and 0.0084 Å in (II. The tetrazole rings of (I and (II make dihedral angles with the mean planes of the benzothiophene rings of 88.81 (13 and 88.92 (13° in (I, and 60.94 (6° in (II. The dimethoxyphenyl and trimethoxyphenyl rings make dihedral angles with the benzothiophene rings of 23.91 (8 and 24.99 (8° in (I and 84.47 (3° in (II. In both structures, molecules are linked into hydrogen-bonded chains. In (I, these chains involve both tetrazole and methanol, and are parallel to the b axis. In (II, molecules are linked into chains parallel to the a axis by N—H...N hydrogen bonds between adjacent tetrazole rings.

ELECTRON-CAPTURE FROM LI BY B-5+, N-5+ AND BE-4+ IONS

NARCIS (Netherlands)

HOEKSTRA, R; OLSON, RE; FOLKERTS, HO; WOLFRUM, E; PASCALE, J; DEHEER, FJ; MORGENSTERN, R; WINTER, H

1993-01-01

We present state selective experimental and theoretical results for electron capture in B-5+ and N5+-Li collisons at energies in the range of 1-10 keV amu-1. Experimentally we have used photon emission spectroscopy in the VUV and visible spectral range and theoretically we have performed classical

Stable knockdown of Kif5b in MDCK cells leads to epithelial–mesenchymal transition

International Nuclear Information System (INIS)

Cui, Ju; Jin, Guoxiang; Yu, Bin; Wang, Zai; Lin, Raozhou; Huang, Jian-Dong

2015-01-01

Polarization of epithelial cells requires vectorial sorting and transport of polarity proteins to apical or basolateral domains. Kif5b is the mouse homologue of the human ubiquitous Kinesin Heavy Chain (uKHC). To investigate the function of Kif5b in epithelial cells, we examined the phenotypes of Kif5b-deficient MDCK cells. Stable knockdown of Kif5b in MDCK cells resulted in reduced cell proliferation rate, profound changes in cell morphology, loss of epithelial cell marker, and gain of mesenchymal marker, as well as increased cell migration, invasion, and tumorigenesis abilities. E-cadherin and NMMIIA could interact with Kif5b in polarized MDCK cells, and their expression levels were decreased in Kif5b-deficient MDCK cells. Overexpression of E-cadherin and NMMIIA in Kif5b depleted MDCK cells could decrease mesenchymal marker expression and cell migration ability. These results indicate that stable knockdown of Kif5b in MDCK cells can lead to epithelial–mesenchymal transition, which is mediated by defective E-cadherin and NMMIIA expression. - Highlights: • Knockdown of Kif5b in MDCK cells resulted in reduced cell proliferation rate. • Kif5b deficient MDCK cells underwent epithelial–mesenchymal transition. • E-cadherin and NMMIIA could interact with Kif5b in polarized MDCK cells. • Decreased E-cadherin and NMMIIA levels mediate EMT in Kif5b deficient MDCK cells. • Overexpression of E-cadherin and NMMIIA reverse the effects of Kif5b knockdown

Stable knockdown of Kif5b in MDCK cells leads to epithelial–mesenchymal transition

Energy Technology Data Exchange (ETDEWEB)

Cui, Ju, E-mail: juzi.cui@gmail.com [The Key Laboratory of Geriatrics, Beijing Hospital & Beijing Institute of Geriatrics, Ministry of Health, Beijing (China); Department of Biochemistry, LKS Faculty of Medicine, The University of Hong Kong, Hong Kong SAR (China); Jin, Guoxiang; Yu, Bin [Department of Biochemistry, LKS Faculty of Medicine, The University of Hong Kong, Hong Kong SAR (China); Wang, Zai [Department of Biochemistry, LKS Faculty of Medicine, The University of Hong Kong, Hong Kong SAR (China); Institute of Clinical Medical Sciences, China-Japan Friendship Hospital, Beijing (China); Lin, Raozhou [Department of Biochemistry, LKS Faculty of Medicine, The University of Hong Kong, Hong Kong SAR (China); Huang, Jian-Dong, E-mail: jdhuang@hku.hk [Department of Biochemistry, LKS Faculty of Medicine, The University of Hong Kong, Hong Kong SAR (China); The Centre for Synthetic Biology Engineering Research, Shenzhen Institutes of Advanced Technology, Shenzhen (China)

2015-07-17

Polarization of epithelial cells requires vectorial sorting and transport of polarity proteins to apical or basolateral domains. Kif5b is the mouse homologue of the human ubiquitous Kinesin Heavy Chain (uKHC). To investigate the function of Kif5b in epithelial cells, we examined the phenotypes of Kif5b-deficient MDCK cells. Stable knockdown of Kif5b in MDCK cells resulted in reduced cell proliferation rate, profound changes in cell morphology, loss of epithelial cell marker, and gain of mesenchymal marker, as well as increased cell migration, invasion, and tumorigenesis abilities. E-cadherin and NMMIIA could interact with Kif5b in polarized MDCK cells, and their expression levels were decreased in Kif5b-deficient MDCK cells. Overexpression of E-cadherin and NMMIIA in Kif5b depleted MDCK cells could decrease mesenchymal marker expression and cell migration ability. These results indicate that stable knockdown of Kif5b in MDCK cells can lead to epithelial–mesenchymal transition, which is mediated by defective E-cadherin and NMMIIA expression. - Highlights: • Knockdown of Kif5b in MDCK cells resulted in reduced cell proliferation rate. • Kif5b deficient MDCK cells underwent epithelial–mesenchymal transition. • E-cadherin and NMMIIA could interact with Kif5b in polarized MDCK cells. • Decreased E-cadherin and NMMIIA levels mediate EMT in Kif5b deficient MDCK cells. • Overexpression of E-cadherin and NMMIIA reverse the effects of Kif5b knockdown.

Compensatory Role of Inositol 5-Phosphatase INPP5B to OCRL in Primary Cilia Formation in Oculocerebrorenal Syndrome of Lowe.

Directory of Open Access Journals (Sweden)

Na Luo

Full Text Available Inositol phosphatases are important regulators of cell signaling, polarity, and vesicular trafficking. Mutations in OCRL, an inositol polyphosphate 5-phosphatase, result in Oculocerebrorenal syndrome of Lowe, an X-linked recessive disorder that presents with congenital cataracts, glaucoma, renal dysfunction and mental retardation. INPP5B is a paralog of OCRL and shares similar structural domains. The roles of OCRL and INPP5B in the development of cataracts and glaucoma are not understood. Using ocular tissues, this study finds low levels of INPP5B present in human trabecular meshwork but high levels in murine trabecular meshwork. In contrast, OCRL is localized in the trabecular meshwork and Schlemm's canal endothelial cells in both human and murine eyes. In cultured human retinal pigmented epithelial cells, INPP5B was observed in the primary cilia. A functional role for INPP5B is revealed by defects in cilia formation in cells with silenced expression of INPP5B. This is further supported by the defective cilia formation in zebrafish Kupffer's vesicles and in cilia-dependent melanosome transport assays in inpp5b morphants. Taken together, this study indicates that OCRL and INPP5B are differentially expressed in the human and murine eyes, and play compensatory roles in cilia development.

Social isolation stress induces ATF-7 phosphorylation and impairs silencing of the 5-HT 5B receptor gene

Science.gov (United States)

Maekawa, Toshio; Kim, Seungjoon; Nakai, Daisuke; Makino, Chieko; Takagi, Tsuyoshi; Ogura, Hiroo; Yamada, Kazuyuki; Chatton, Bruno; Ishii, Shunsuke

2010-01-01

Many symptoms induced by isolation rearing of rodents may be relevant to neuropsychiatric disorders, including depression. However, identities of transcription factors that regulate gene expression in response to chronic social isolation stress remain elusive. The transcription factor ATF-7 is structurally related to ATF-2, which is activated by various stresses, including inflammatory cytokines. Here, we report that Atf-7-deficient mice exhibit abnormal behaviours and increased 5-HT receptor 5B (Htr5b) mRNA levels in the dorsal raphe nuclei. ATF-7 silences the transcription of Htr5B by directly binding to its 5′-regulatory region, and mediates histone H3-K9 trimethylation via interaction with the ESET histone methyltransferase. Isolation-reared wild-type (WT) mice exhibit abnormal behaviours that resemble those of Atf-7-deficient mice. Upon social isolation stress, ATF-7 in the dorsal raphe nucleus is phosphorylated via p38 and is released from the Htr5b promoter, leading to the upregulation of Htr5b. Thus, ATF-7 may have a critical role in gene expression induced by social isolation stress. PMID:19893493

SrBeB2O5: Growth, crystal structure and optical properties

International Nuclear Information System (INIS)

Yao, Wenjiao; Wang, Xiaoshan; Huang, Hongwei; Xu, Tao; Jiang, Xingxing; Wang, Xiaoyang; Lin, Zheshuai; Chen, Chuangtian

2014-01-01

Graphical abstract: The crystal displays a layered configuration along c axis with the wrinkled infinite (BeB 2 O 5 ) ∞ layers. Display Omitted - Highlights: • A new beryllium borate SrBeB 2 O 5 was synthesized. • A layered structure (BeB 2 O 5 ) ∞ was formed by BO 3 triangles and B/BeO 4 tetrahedrons. • SrBeB 2 O 5 has a very wide transparency range of wavelengths from 200 nm to 1800 nm. • A-site ions impact greatly on the structures of beryllium borates. - Abstract: A novel beryllium borate SrBeB 2 O 5 is discovered for the first time through traditional solid state reaction and high temperature solution method. The framework of the structure is composed by two-dimensional [BeB 2 O 5 ] layers determined from single-crystal X-ray diffraction data. The further structural analysis of beryllium borates reveals that the arrangement of anionic groups attributes to the structural stability. Moreover, the influences of the A-site cations on the structural features of fundamental building blocks in the alkaline or alkaline earth beryllium borates are discussed. The UV–Vis–NIR diffuse-reflectance pattern reveals that this compound has a very wide transparency range of wavelengths down to 200 nm. In addition, the properties of SrBeB 2 O 5 were also characterized by powder X-ray diffraction, differential scanning calorimetry, and IR spectroscopy

Hyperfine splitting of B mesons and Bs production at the Υ(5S)

International Nuclear Information System (INIS)

Lee-Franzini, J.; Heintz, U.; Lovelock, D.M.J.; Narain, M.; Schamberger, R.D.; Willins, J.; Yanagisawa, C.; Franzini, P.; Tuts, P.M.

1990-01-01

Using the Columbia University--Stony Brook (CUSB-II) detector we have studied the inclusive photon spectrum from 2.9x10 4 Υ(5S) decays. We observe a strong signal due to B * →Bγ decays. From this we obtain (i) the average B * -B mass difference, 46.7±0.4 MeV, (ii) the photon yield per Υ(5S) decay, left-angle γ/Υ(5S)right-angle=1.09±0.06, and (iii) the average velocity of the B * 's, left-angle β right-angle=0.156±0.010, for a mix of nonstrange (B) and strange (B s ) B * mesons from Υ(5S) decays. From the shape of the photon line, we find that both B and B s mesons are produced with nearly equal values for the hyperfine splitting of the B and B s meson systems

Fabrication of an Fe80.5Si7.5B6Nb5Cu Amorphous-Nanocrystalline Powder Core with Outstanding Soft Magnetic Properties

Science.gov (United States)

Zhang, Zongyang; Liu, Xiansong; Feng, Shuangjiu; Rehman, Khalid Mehmood Ur

2018-03-01

In this study, the melt spinning method was used to develop Fe80.5Si7.5B6Nb5Cu amorphous ribbons in the first step. Then, the Fe80.5Si7.5B6Nb5Cu amorphous-nanocrystalline core with a compact microstructure was obtained by multiple processes. The main properties of the magnetic powder core, such as micromorphology, thermal behavior, permeability, power loss and quality factor, have been analyzed. The obtained results show that an Fe80.5Si7.5B6Nb5Cu amorphous-nanocrystalline duplex core has high permeability (54.8-57), is relatively stable at different frequencies and magnetic fields, and the maximum power loss is only 313 W/kg; furthermore, it has a good quality factor.

Sobre Comunicología y Comunicometodología: primera guía de apuntes sobre horizontes de lo posible

Directory of Open Access Journals (Sweden)

Jesús Galindo Cáceres

2008-12-01

Full Text Available El texto se compone de cinco partes. En la primera se plantea la situación actual del campo académico de la comunicación como base histórica para la construcción de un nuevo proyecto de configuración científico y tecnológico. La segunda parte propone las coordenadas generales del proyecto. En la tercera se presentan las bases para la emergencia de una Comunicología posible, una ciencia de la comunicación inexistente hasta hoy como disciplina científica. En la cuarta se propone la parte complementaria de la Comunicología, a la Comunicometodología, como la dimensión práctica, aplicada, de la ciencia teórica en una dimensión de ingeniería constructiva de la comunicación. En la última se cierra el argumento de la ciencia y la ingeniería de la comunicación con una propuesta de horizontes de lo posible en la investigación de la comunicación, con la comunicación y en la comunicación.

La reducción de lo posible. René Thom y el determinismo causal

Directory of Open Access Journals (Sweden)

Miguel Espinoza

2009-12-01

Full Text Available La tesis principal de este ensayo estipula que el determinismo causal es una propiedad de la naturaleza y el primer principio de la inteligibilidad natural. El desarrollo de esta tesis utiliza como hilo conductor el pensamiento de René Thom. Esto significa que el determinismo causal se examina en su relación con la estabilidad y la inestabilidad, el desafío de la mecánica cuántica, las raíces aporéticas de la ciencia tal como la dualidad determinismo-indeterminismo, y finalmente, en su relación con el método para ponerlo de manifiesto, es decir la reducción de lo posible.

Measurement of B(Υ(5S)→Bs(*)Bs(*)) using φ mesons

International Nuclear Information System (INIS)

Huang, G. S.; Miller, D. H.; Pavlunin, V.; Sanghi, B.; Shipsey, I. P. J.; Xin, B.; Adams, G. S.; Anderson, M.; Cummings, J. P.; Danko, I.; Napolitano, J.; He, Q.; Insler, J.; Muramatsu, H.; Park, C. S.; Thorndike, E. H.; Yang, F.; Coan, T. E.; Gao, Y. S.; Liu, F.

2007-01-01

Knowledge of the B s decay fraction of the Υ(5S) resonance, f S , is important for B s meson studies at the Υ(5S) energy. Using a data sample collected by the CLEO III detector at CESR consisting of 0.423 fb -1 on the Υ(5S) resonance, 6.34 fb -1 on the Υ(4S) and 2.32 fb -1 in the continuum below the Υ(4S), we measure B(Υ(5S)→φX)=(13.8±0.7 -1.5 +2.3 )% and B(Υ(4S)→φX)=(7.1±0.1±0.6)%; the ratio of the two rates is (1.9±0.1 -0.2 +0.3 ). This is the first measurement of the φ meson yield from the Υ(5S). Using these rates, and a model dependent estimate of B(B s →φX), we determine f S =(24.6±2.9 -5.3 +11.0 )%. We also update our previous independent measurement of f S made using the inclusive D s yields to now be (16.8±2.6 -3.4 +6.7 )%, due to a better estimate of the number of hadronic events. We also report the total Υ(5S) hadronic cross section above continuum to be σ(e + e - →Υ(5S))=(0.301±0.002±0.039) nb. This allows us to extract the fraction of B mesons as (58.9±10.0±9.2)%, equal to 1-f S . Averaging the three methods gives a model dependent result of f S =(21 -3 +6 )%

Draft Genome Sequence of Lactobacillus delbrueckii subsp. bulgaricus LBB.B5

NARCIS (Netherlands)

Urshev, Z.; Hajo, K.; Lenoci, L.; Bron, P.A.; Dijkstra, A.; Alkema, W.; Wels, M.; Siezen, R.J.; Minkova, S.; Hijum, S.A. van

2016-01-01

Lactobacillus delbrueckii subsp. bulgaricus LBB.B5 originates from homemade Bulgarian yogurt and was selected for its ability to form a strong association with Streptococcus thermophilus The genome sequence will facilitate elucidating the genetic background behind the contribution of LBB.B5 to the

Coercivity enhancement of NdFeB sintered magnets by low melting point Dy{sub 32.5}Fe{sub 62}Cu{sub 5.5} alloy modification

Energy Technology Data Exchange (ETDEWEB)

Liang, Liping; Ma, Tianyu, E-mail: maty@zju.edu.cn; Zhang, Pei; Jin, Jiaying; Yan, Mi, E-mail: mse_yanmi@zju.edu.cn

2014-04-15

To improve coercivity without sacrificing other magnetic performance of NdFeB sintered magnets, a low melting point Dy{sub 32.5}Fe{sub 62}Cu{sub 5.5} alloy was introduced as an intergranular additive. Magnetic properties and microstructure of the magnets with different Dy{sub 32.5}Fe{sub 62}Cu{sub 5.5} contents were studied. At the optimum addition of 3 wt%, coercivity H{sub cj} was enhanced from 12.7 to 15.2 kOe, the maximum magnetic energy product (BH){sub max} was simultaneously increased from 46.6 to 47.8 MG Oe, accompanied by a slight reduction in remanence B{sub r}. Further investigation on microstructure and grain boundary composition indicated that the enhanced H{sub cj} and (BH){sub max} could be attributed to the refined and uniform 2:14:1 phase grains, continuous grain boundaries and a (Nd,Dy){sub 2}Fe{sub 14}B hardening shell surrounding the 2:14:1 phase grains. - Highlights: • Low melting-point Dy{sub 32.5}Fe{sub 62}Cu{sub 5.5} alloy was introduced to NdFeB magnets. • The doped magnet exhibits enhanced coercivity and maximum energy product. • (Nd,Dy){sub 2}Fe{sub 14}B shell was expected to form in the surface of Nd{sub 2}Fe{sub 14}B grains. • The continuous grain boundary layer formed between neighboring Nd{sub 2}Fe{sub 14}B grains.

Optimisation of the magnetic properties of mechanically milled R5.5Fe73.5-xCoxCr3B18 nanocomposites

International Nuclear Information System (INIS)

O'Sullivan, J.F.; Smith, P.A.I.; Coey, J.M.D.

1998-01-01

Mechanical milling and subsequent annealing of R 4.5 R'Fe 73.5-x Co x Cr 3 B 18 (R=Nd,Pr and R'=Tb,Dy) ingots has been found to produce hard magnetic nanocomposites of (R,R') 2 (Fe,Co) 14 B, (Fe,Cr) 2 B and α-(Fe,Co) phases. Here we report on the optimisation of the composition of such nanocomposites. Substituting different rare-earth metals has a significant effect on the magnetic properties. The replacement of Nd with Pr produces higher coercivity and remanence, and better loop squareness. However, the replacement of Tb with Dy produced inferior properties when the main rare-earth component was Nd. Improved properties were obtained with the combination of Pr and Dy or Tb. Substitution of Co for Fe was found to lower coercivity but increase the remanence. The best combination of properties measured was for Pr 4.5 Dy 1 Fe 68.5 Co 5 Cr 3 B 1x , where H c =0.41 MA/m, J r =1 T, and (BH) max for the powder was 100 kJ/m 3 . These results will be discussed in terms of the grain size and the intrinsic properties of the hard and soft magnetic phases identified using X-ray diffraction. (orig.)

New 5-deoxyflavonoids and their inhibitory effects on protein tyrosine phosphatase 1B (PTP1B) activity

DEFF Research Database (Denmark)

Nguyen, Phi Hung; Dao, Trong Tuan; Kim, Jayeon

2011-01-01

.9 ± 1.6 to 19.2 ± 1.1 μM), while compounds (3, 5, and 9) with 2,2-dimethylpyrano ring showed less inhibitory effect (IC₅₀ 22.6 ± 2.3 to 72.9 ± 9.7 μM). These results suggest that prenyl and methoxy groups may be responsible for the increase on the activity of 5-deoxyflavonoids against PTP1B......, but the presence of 2,2-dimethylpyrano ring on the B ring may be induced the decrease of PTP1B inhibitory activity....

Enrichment of W2B5 from WO3 and B2O3 by Double SHS Method

Directory of Open Access Journals (Sweden)

Bora DERIN

2018-02-01

Full Text Available A second self-propagating high-temperature synthesis (SHS was carried out to enrich the W2B5 content in the SHS product containing a mixture of various tungsten boride compounds. In the experiment, the process called Double-SHS (D-SHS was conducted in two steps. In the first SHS reaction, an initial molar composition ratio of WO3:B2O3:Mg mixture was selected as 1:3:8. The product was then hot-leached with hydrochloric acid to eliminate MgO and Mg3B2O6 phases. The leached product, consisting of 72.6 wt.% W2B5, 16.1 wt.% WB, 8.4 wt.% W2B, and 2.9 wt.% W, was again reacted with the Mg and B2O3 mixture by second SHS. After another acid leaching step, W2B5 content in the D-SHS product was found to be 98.2 wt.%. The study showed that D-SHS is an effective method for boron enrichment in the tungsten compounds.DOI: http://dx.doi.org/10.5755/j01.ms.24.1.17834

Penetration of the renewable sources of energy in Mexico: group of approach on possible carrying future events for the renewable energies (Annexe 12 in 'A vision of year 2030 on the use of the renewable energies in Mexico'); Penetracion de las fuentes renovables de energia en Mexico: grupo de enfoque sobre posibles eventos portadores de futuro para las energias renovables (Anexo 12 en 'Una vision al 2030 de la utilizacion de las energias renovables en Mexico')

Energy Technology Data Exchange (ETDEWEB)

Pernudi, Montserrat; Alonso C, Antonio [Analitica Consultores SA de CV, Mexico DF (Mexico)

2005-08-15

This report corresponds to the results obtained in the group of consultation to experts on possible events or carrying future events, that is to say, events that in happening could be determinant for the later evolution of the renewable energies in Mexico. Conducted on May 26, 2005 in Mexico City with a small group of approach, the objectives of the meeting were to define possible events or relevant carrying future events for the evolution of the renewable energies in Mexico between years 2005 and 2030 and, to explore the most relevant components of possible scenarios on the future evolution (2005-2030) of the renewable energies in Mexico. [Spanish] Este informe corresponde a los resultados obtenidos en el grupo de consulta a expertos sobre posibles eventos o sucesos portadores de futuro, esto es, eventos que de ocurrir podrian ser determinantes para la evolucion posterior de las energias renovables en Mexico, realizado el 26 de mayo de 2005 en la ciudad de Mexico con un pequeno grupo de enfoque. Los objetivos de la reunion: definir posibles eventos o sucesos portadores de futuro relevantes para la evolucion de las energias renovables en Mexico entre los anos 2005 y 2030 y, explorar los componentes mas relevantes de posibles escenarios sobre la evolucion futura (2005-2030) de las energias renovables en Mexico.

Structural insights into the globular tails of the human type v myosins Myo5a, Myo5b, And Myo5c.

Directory of Open Access Journals (Sweden)

Hana Velvarska

Full Text Available Vertebrate type V myosins (MyoV Myo5a, Myo5b, and Myo5c mediate transport of several different cargoes. All MyoV paralogs bind to cargo complexes mainly by their C-terminal globular domains. In absence of cargo, the globular domain of Myo5a inhibits its motor domain. Here, we report low-resolution SAXS models for the globular domains from human Myo5a, Myo5b, and Myo5c, which suggest very similar overall shapes of all three paralogs. We determined the crystal structures of globular domains from Myo5a and Myo5b, and provide a homology model for human Myo5c. When we docked the Myo5a crystal structure into a previously published electron microscopy density of the autoinhibited full-length Myo5a, only one domain orientation resulted in a good fit. This structural arrangement suggests the participation of additional region of the globular domain in autoinhibition. Quantification of the interaction of the Myo5a globular domain with its motor complex revealed a tight binding with dissociation half-life in the order of minutes, suggesting a rather slow transition between the active and inactive states.

Conventional kinesin KIF5B mediates adiponectin secretion in 3T3-L1 adipocytes

Energy Technology Data Exchange (ETDEWEB)

Cui, Ju, E-mail: juzi.cui@gmail.com [The Key Laboratory of Geriatrics, Beijing Hospital and Beijing Institute of Geriatrics, Beijing (China); Pang, Jing; Lin, Ya-Jun; Jiang, Ping; Gong, Huan [The Key Laboratory of Geriatrics, Beijing Hospital and Beijing Institute of Geriatrics, Beijing (China); Wang, Zai [Institute of Clinical Medical Sciences, China-Japan Friendship Hospital, Beijing (China); Li, Jian; Cai, Jian-Ping [The Key Laboratory of Geriatrics, Beijing Hospital and Beijing Institute of Geriatrics, Beijing (China); Huang, Jian-Dong, E-mail: jdhuang@hku.hk [School of Biomedical Sciences and Shenzhen Institute of Research and Innovation, The University of Hong Kong, Pokfulam (Hong Kong); The Centre for Synthetic Biology Engineering Research, Shenzhen Institutes of Advanced Technology, Shenzhen (China); Zhang, Tie-Mei, E-mail: tmzhang126@126.com [The Key Laboratory of Geriatrics, Beijing Hospital and Beijing Institute of Geriatrics, Beijing (China)

2016-08-05

Insulin stimulates adiponectin secretion and glucose transporter type 4 (GLUT4) translocation in adipocyte to regulate metabolism homeostasis. Similar to GLUT4 translocation, intracellular trafficking and release of adiponectin in adipocytes relies on the trans-Golgi network and endosomal system. Recent studies show that the heavy chain of conventional kinesin (KIF5B) mediates GLUT4 translocation in murine 3T3-L1 adipocytes, however, the motor machinery involved in mediating intracellular trafficking and release of adiponectin is unknown. Here, we examined the role of KIF5B in the regulation of adiponectin secretion. The KIF5B level was up-regulated during 3T3-L1 adipogenesis. This increase in cytosolic KIF5B was synchronized with the induction of adiponectin. Endogenous KIF5B and adiponectin were partially colocalized at the peri-nuclear and cytosolic regions. In addition, adiponectin-containing vesicles were co-immunoprecipitated with KIF5B. Knockdown of KIF5B resulted in a marked inhibition of adiponectin secretion and overexpression of KIF5B enhanced adiponectin release, whereas leptin secretion was not affected by changes in KIF5B expression. These data suggest that the secretion of adiponectin, but not leptin, is dependent on functional KIF5B. - Highlights: • The KIF5B level was up regulated during 3T3-L1 adipogenesis. • Endogenous KIF5B and adiponectin were partially colicalized. • Adiponectin-containing vesicles were co-immunoprecipitated with KIF5B. • The secretion of adiponectin, but not leptin, is dependent on functional KIF5B.

Conventional kinesin KIF5B mediates adiponectin secretion in 3T3-L1 adipocytes

International Nuclear Information System (INIS)

Cui, Ju; Pang, Jing; Lin, Ya-Jun; Jiang, Ping; Gong, Huan; Wang, Zai; Li, Jian; Cai, Jian-Ping; Huang, Jian-Dong; Zhang, Tie-Mei

2016-01-01

Insulin stimulates adiponectin secretion and glucose transporter type 4 (GLUT4) translocation in adipocyte to regulate metabolism homeostasis. Similar to GLUT4 translocation, intracellular trafficking and release of adiponectin in adipocytes relies on the trans-Golgi network and endosomal system. Recent studies show that the heavy chain of conventional kinesin (KIF5B) mediates GLUT4 translocation in murine 3T3-L1 adipocytes, however, the motor machinery involved in mediating intracellular trafficking and release of adiponectin is unknown. Here, we examined the role of KIF5B in the regulation of adiponectin secretion. The KIF5B level was up-regulated during 3T3-L1 adipogenesis. This increase in cytosolic KIF5B was synchronized with the induction of adiponectin. Endogenous KIF5B and adiponectin were partially colocalized at the peri-nuclear and cytosolic regions. In addition, adiponectin-containing vesicles were co-immunoprecipitated with KIF5B. Knockdown of KIF5B resulted in a marked inhibition of adiponectin secretion and overexpression of KIF5B enhanced adiponectin release, whereas leptin secretion was not affected by changes in KIF5B expression. These data suggest that the secretion of adiponectin, but not leptin, is dependent on functional KIF5B. - Highlights: • The KIF5B level was up regulated during 3T3-L1 adipogenesis. • Endogenous KIF5B and adiponectin were partially colicalized. • Adiponectin-containing vesicles were co-immunoprecipitated with KIF5B. • The secretion of adiponectin, but not leptin, is dependent on functional KIF5B.

Half-metallic magnetism in Ti3Co5-xFexB2

Directory of Open Access Journals (Sweden)

Rohit Pathak

2017-05-01

Full Text Available Bulk alloys and thin films of Fe-substituted Ti3Co5B2 have been investigated by first-principle density-functional calculations. The series, which is of interest in the context of alnico magnetism and spin electronics, has been experimentally realized in nanostructures but not in the bulk. Our bulk calculations predict paramagnetism for Ti3Co5B2, Ti3Co4FeB2 and Ti3CoFe4B2, whereas Ti3Fe5B2 is predicted to be ferromagnetic. The thin films are all ferromagnetic, indicating that moment formation may be facilitated at nanostructural grain boundaries. One member of the thin-film series, namely Ti3CoFe4B2, is half-metallic and exhibits perpendicular easy-axis magnetic anisotropy. The half-metallicity reflects the hybridization of the Ti, Fe and Co 3d orbitals, which causes a band gap in minority spin channel, and the limited equilibrium solubility of Fe in bulk Ti3Co5B2 may be linked to the emerging half-metallicity due to Fe substitution.

17 CFR 240.16b-5 - Bona fide gifts and inheritance.

Science.gov (United States)

2010-04-01

... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Bona fide gifts and inheritance. 240.16b-5 Section 240.16b-5 Commodity and Securities Exchanges SECURITIES AND EXCHANGE COMMISSION... gifts and inheritance. Both the acquisition and the disposition of equity securities shall be exempt...

5′ UTR and NS5B-based genotyping of hepatitis C virus in patients from Damietta governorate, Egypt

Directory of Open Access Journals (Sweden)

Radwa R. El-Tahan

2018-03-01

Full Text Available Chronic hepatitis C virus (HCV infection is a main health problem in Egypt causing high rates of mortalities. Egypt has the highest HCV prevalence in the world, with specific HCV subtypes epidemic and circulating extensively in the country. Different antiviral therapy protocols have been implemented for treating Egyptian HCV patients. Due to the limited data about HCV in Egypt, this study aimed to genotype HCV strains circulating in the Nile Delta Damietta governorate and to investigate the variation in the nonstructural 5B (NS5B region targeted by the newly approved antiviral drugs. Thirty HCV samples from treatment-naïve patients were genotyped by restriction fragment length polymorphism. Some samples were genotyped by direct sequencing of their 5′ untranslated region (UTR and NS5B regions. Phylogenetic analysis was also performed on the sequences of their NS5B regions. Fourteen new sequences have been deposited in the GenBank database. Results showed that subtype 4a was prevalent in addition to subtype 1g. None of the previously reported NS5B substitutions were detected in the sequenced isolates from treatment-naïve patients, which may be a good predictor for efficient treatment of HCV Egyptian patients with Sofosbuvir. Further studies on Sofosbuvir treated-HCV Egyptian patients are required to investigate whether any NS5B substitutions can confer resistance to treatment.

Multiple Sclerosis and EIF2B5: A Paradox or a Missing Link.

Science.gov (United States)

Zahoor, Insha; Haq, Ehtishamul; Asimi, Ravouf

2017-01-01

Multiple sclerosis (MS) is an encumbering inflammatory condition of the central nervous system (CNS) caused by axonal demyelination. There is sufficient evidence suggesting role of eukaryotic translation initiation factor 2B (EIF2B) gene family encoding the five subunits of eIF2B complex-α, β, γ, δ and ε respectively, in causing vanishing white matter (VWM) disease of the brain. Incidentally researchers have proposed overlapping between MS and VWM in terms of clinical, biochemical and genetic aspects, which incited us to write this chapter to explore the association between EIF2B5 and MS. eIF2B plays an essential role in translation initiation and its regulation in eukaryotes. Among EIF2B gene family, EIF2B5 gene encodes the catalytic and a crucial epsilon subunit of the eIF2B protein as most of the alterations have been found in this gene. The recent findings on the association between EIF2B5 and MS susceptibility point towards unfathomable and contentious role of EIF2B5 in MS development. This chapter briefly reviews the insights gleaned from recent studies conducted in understanding the association between EIF2B5 and MS risk. The need of hour is to conduct large scale conclusive studies aimed at expounding the mechanisms behind this relationship.

Optimization of the combustion of SOME (soybean oil methyl ester), B5, B10, B20 and petrodiesel in a semi industrial boiler

International Nuclear Information System (INIS)

Ghorbani, Afshin; Bazooyar, Bahamin

2012-01-01

This paper characterizes combustion of petrodiesel and prevalent SOME blends (B100, B5, B10 and B20), which were produced through an alkali-based transesterification in PUT, in a semi industrial boiler by determining its efficiency, exhaust emissions and costs. First, the influence of oxygen content of stock gases (by volume percent) upon regular emissions, thermal efficiency and costs (calculated by a cost function) was studied in order to investigate the performance and feasibility of using biodiesel in the boiler. In the next level, a multi-objective optimization method, named cost-based optimization, was represented and optimized the combustion of the fuels. The overall efficiency of the boiler obtained with the different fuels is comparable for the same operating points. Soy bean methyl ester and the blends emitted lower emissions than petrodiesel. Results demonstrate that the use of pure biodiesel is not economically feasible in the boiler. The total costs of the boiler obtained with the blends and petrodiesel are quite competitive. B5 is introduced to be the best fuel for using in the boiler. Results also reveal an optimum (“compromise”) in total cost of all the fuels in relation to the oxygen concentration of stock gases, which promises a cost saving in the boiler performance. -- Highlights: ► Efficiency, emissions and economy of the boiler fuelled with SOME, B5, B10, B20 and petrodiesel are investigated. ► The use of pure biodiesel was not economically feasible while economy of the blends and petrodiesel is competitive. ► B5 is introduced to be the most appropriate and economic fuel for the boiler. ► Presentation of a cost-based method optimization method. ► Introducing an optimum, “compromise”, O 2 % for the combustion of each fuel which promises a cost saving.

Synthesis of Al-5Ti-1B Refiner by Melt Reaction Method

Directory of Open Access Journals (Sweden)

LI He

2017-02-01

Full Text Available Al-5Ti-1B refiner was successfully prepared by melt reaction method. Through the thermodynamics calculation, the initial reaction temperature was determined. The influence of reaction temperature on microstructure and absorption rate of the alloy was investigated. The phase and microstructure of the alloy were observed by X-ray diffraction, scanning electron microscope and energy dispersive spectrometer. The Al-5Ti-1B refiner was extruded at high temperature to wire with the diameter of 9.5mm, and then the refinement experiment was carried out on pure aluminium. The results indicate that the refiner consists of TiB2, TiAl3 and α-Al, and the microstructure prepared at 850℃ is the optimum and the absorption rate of Ti and B matches the best. The TiAl3 and TiB2 phases distribute homogeneously in the matrix after extrusion. When adding 0.2%(mass fraction of Al-5Ti-1B refiner, the grain size of pure aluminium reduces from 3.99mm to 0.45mm.

Comunicación y Paz Activa: un diálogo posible

Directory of Open Access Journals (Sweden)

Maximiliano Martín Vicente

Full Text Available ResumenEl presente texto tiene como finalidad demostrar que es posible relacionar la Comunicación con la Cultura de la Paz, ambas entendidas como herramientas dinamizadoras y transformadoras de realidades sociales. Para eso se realiza, en un primer momento, una revisión bibliográfica de los estudios de la Comunicación y la Paz identificando sus convergencias y divergencias, tanto metodológicas como de contenido. En segundo lugar, siguiendo el método de procedimiento de la pragmática del Periodismo (Motta, 2007, que permite entender los hechos con profundidad identificando los intereses ocultos, se hace una análisis de la primavera árabe tal como mostrada por Le Monde Diplomatique. Finalmente, en tercer lugar, teniendo como referencia el caso árabe, presentamos lo que entendemos por Comunicación y Paz Activa y cómo deben proceder para actuar conjuntamente para establecer acciones más críticas y transformadoras que lleven a una sociedad más justa e armónica.

Extracellular VirB5 enhances T-DNA transfer from Agrobacterium to the host plant.

Directory of Open Access Journals (Sweden)

Benoît Lacroix

Full Text Available VirB5 is a type 4 secretion system protein of Agrobacterium located on the surface of the bacterial cell. This localization pattern suggests a function for VirB5 which is beyond its known role in biogenesis and/or stabilization of the T-pilus and which may involve early interactions between Agrobacterium and the host cell. Here, we identify VirB5 as the first Agrobacterium virulence protein that can enhance infectivity extracellularly. Specifically, we show that elevating the amounts of the extracellular VirB5--by exogenous addition of the purified protein, its overexpression in the bacterium, or transgenic expression in and secretion out of the host cell--enhances the efficiency the Agrobacterium-mediated T-DNA transfer, as measured by transient expression of genes contained on the transferred T-DNA molecule. Importantly, the exogenous VirB5 enhanced transient T-DNA expression in sugar beet, a major crop recalcitrant to genetic manipulation. Increasing the pool of the extracellular VirB5 did not complement an Agrobacterium virB5 mutant, suggesting a dual function for VirB5: in the bacterium and at the bacterium-host cell interface. Consistent with this idea, VirB5 expressed in the host cell, but not secreted, had no effect on the transformation efficiency. That the increase in T-DNA expression promoted by the exogenous VirB5 was not due to its effects on bacterial growth, virulence gene induction, bacterial attachment to plant tissue, or host cell defense response suggests that VirB5 participates in the early steps of the T-DNA transfer to the plant cell.

Extracellular VirB5 enhances T-DNA transfer from Agrobacterium to the host plant.

Science.gov (United States)

Lacroix, Benoît; Citovsky, Vitaly

2011-01-01

VirB5 is a type 4 secretion system protein of Agrobacterium located on the surface of the bacterial cell. This localization pattern suggests a function for VirB5 which is beyond its known role in biogenesis and/or stabilization of the T-pilus and which may involve early interactions between Agrobacterium and the host cell. Here, we identify VirB5 as the first Agrobacterium virulence protein that can enhance infectivity extracellularly. Specifically, we show that elevating the amounts of the extracellular VirB5--by exogenous addition of the purified protein, its overexpression in the bacterium, or transgenic expression in and secretion out of the host cell--enhances the efficiency the Agrobacterium-mediated T-DNA transfer, as measured by transient expression of genes contained on the transferred T-DNA molecule. Importantly, the exogenous VirB5 enhanced transient T-DNA expression in sugar beet, a major crop recalcitrant to genetic manipulation. Increasing the pool of the extracellular VirB5 did not complement an Agrobacterium virB5 mutant, suggesting a dual function for VirB5: in the bacterium and at the bacterium-host cell interface. Consistent with this idea, VirB5 expressed in the host cell, but not secreted, had no effect on the transformation efficiency. That the increase in T-DNA expression promoted by the exogenous VirB5 was not due to its effects on bacterial growth, virulence gene induction, bacterial attachment to plant tissue, or host cell defense response suggests that VirB5 participates in the early steps of the T-DNA transfer to the plant cell.

Luminosity effects in the ultraviolet spectrum of B5-B6 stars

International Nuclear Information System (INIS)

Underhill, A.B.; Silversmith, E.

1976-01-01

Copernicus U2 spectral tracings of the ultraviolet spectra of eta CMa (B5 Ia) and zeta Dra (B6 III) have been compared, and four regions: 1330 to 1340 A, 1340 to 1350 A, 1390 to 1396 A, and 1398 to 1405 A: are found to contain differences due to luminosity effects. The observed profiles are interpreted using synthetic spectra predicted with LTE theory. These effects are found: (1) the C ii 1335 blend is shortward-displaced in eta CMa, (2) the P iii and Si iv resonance lines strengthen significantly in the supergiant, and (3) lines of multiplet UV7 of Si ii are strengthened by non-LTE effects in the supergiant

DFT study on the isomerization and tautomerism in vitamins B3 (niacin), B5 (pantothenic acid) and B7 (biotin)

Science.gov (United States)

Valadbeigi, Younes; Farrokhpour, Hossein; Tabrizchi, Mahmoud

2014-05-01

Isomerization and tautomerism of the three water soluble vitamins including B3, B5 and B7 were studied applying density functional theory using B3LYP method in gas and aqueous phases. Activation energies (Ea), Gibbs free energies of activation (ΔG#), and imaginary frequencies of the transition state structures were calculated for all the isomerization and tautomerism reactions. Activation energies of the neutral → zwitterion (amine-enamine) tautomerism in vitamin B3 were 310-360 kJ/mol where these values for the keto-enol tautomerism were 100-130 kJ/mol. It was found that water molecule catalyzes the tautomerism and decreases the activation energies about 90-160 kJ/mol.

Formalin-inactivated EV71 vaccine candidate induced cross-neutralizing antibody against subgenotypes B1, B4, B5 and C4A in adult volunteers.

Directory of Open Access Journals (Sweden)

Ai-Hsiang Chou

Full Text Available Enterovirus 71 (EV71 has caused several epidemics of hand, foot and mouth diseases (HFMD in Asia. No effective EV71 vaccine is available. A randomized and open-label phase I clinical study registered with ClinicalTrials.gov #NCT01268787, aims to evaluate the safety, reactogenicity and immunogenicity of a formalin-inactivated EV71 vaccine candidate (EV71vac at 5- and 10-µg doses. In this study we report the cross-neutralizing antibody responses from each volunteer against different subgenotypes of EV71 and CVA16.Sixty eligible healthy adults were recruited and vaccinated. Blood samples were obtained on day 0, 21 and 42 and tested against B1, B4, B5, C2, C4A, C4B and CVA16 for cross-neutralizing antibody responses.The immunogenicity of both 5- and 10- µg doses were found to be very similar. Approximately 45% of the participants had 4-fold increase in Nt, but there was no further increase in Nt after the second dose. EV71vac induced very strong cross-neutralizing antibody responses in >85% of volunteers without pre-existing Nt against subgenotype B1, B5 and C4A. EV71vac elicited weak cross-neutralizing antibody responses (∼20% of participants against a C4B and Coxsackie virus A16. Over 90% of vaccinated volunteers did not develop cross-neutralizing antibody responses (Nt<8 against a C2 strain. EV71vac can boost and significantly enhance the neutralizing antibody responses in volunteers who already had pre-vaccination antibodies against EV71 and/or CVA16.EV71vac is efficient in eliciting cross-neutralizing antibody responses against EV71 subgenotypes B1, B4, B5, and C4A, and provides the rationale for its evaluation in phase II clinical trials.ClinicalTrials.gov NCT01268787.

Posible transmisión oral de la enfermedad de Chagas en trabajadores del sector de los hidrocarburos en Casanare, Colombia, 2014

Directory of Open Access Journals (Sweden)

Liliana Patricia Zuleta-Dueñas

2017-06-01

Conclusiones. Mediante el análisis de las características epidemiológicas, ambientales y sanitarias, se confirmó un brote agudo de enfermedad de Chagas por exposición ocupacional y de posible transmisión oral, que podría ser el de mayor proporción reportado hasta la fecha en Colombia.

Modulación de las vías de señalización de adenosina, glutamato y dopamina en esquizofrenia y alzhaimer. Posibles interacciones.

OpenAIRE

Díaz Sánchez, Sara

2014-01-01

En el presente trabajo se analiza el posible papel jugado en distintos procesos patológicos, como son la Esquizofrenia (SZ) y la enfermedad de Alzheimer (AD), por los Sistemas de Neuromodulación de adenosina y los de Neurotransmisión de dopamina y glutamato y cómo se ven alteradas las vías de señalización mediadas por los receptores de adenosina A2A y A1, de dopamina D2-like y D2, así como el receptor de glutamato mGlu5. Algo en común de estas vías de señalización es que todos los receptores ...

El estrés oxidativo como posible diana terapéutica en la osteoporosis asociada al envejecimiento

OpenAIRE

Portal-Núñez, S.; de la Fuente, M.; Díez, A.; Esbrit, P.

2016-01-01

La osteoporosis senil o involutiva es un problema de primera magnitud en el mundo desarrollado. Estudios recientes apuntan al aumento del estrés oxidativo asociado al envejecimiento -cronológico o biológico- como un factor importante en su desarrollo. En esta revisión nos centraremos en las alteraciones del tejido óseo con la edad, en el origen del estrés oxidativo y su influencia negativa en el tejido óseo. Finalmente, abordaremos las posibles terapias antiestrés oxidativo que actualmente se...

Germinação de sementes e desenvolvimento de brotos de Aechmea nudicaulis (L.) Griseb (Bromeliaceae) : subsídios à produção e extrativismo sustentável /

OpenAIRE

Anacleto, Adilson

2005-01-01

Orientadora: Raquel R. B. Negrelle Co-orientadora: Solange R. Zaniolo Dissertação (mestrado) - Universidade Federal do Paraná, Setor de Ciências Agrárias, Programa de Pós-Graduação em Agronomia - Produção Vegetal. Defesa: Curitiba, 2005 Inclui bibliografia e anexos Área de concentração: Produção vegetal

Synthesis and crystal structures of 2-methyl-4-aryl-5-oxo-5H-indeno [1,2-b] pyridine carboxylate derivatives

DEFF Research Database (Denmark)

Pandian, Ramesh; Naushad, Edayadulla; Vijayakumar, Vinodhkumar

2014-01-01

pyridine derivatives through oxidation. Consequently, the interest in this aromatization reaction, investigation of a wide range of 1, 4-DHPs continues to attract the attention of researchers. Herein, we report the preparation of pyridine derivatives and the crystal structures determined by X......-ray crystallographic methods.Results: The crystal structures and conformational studies of two organic compounds, namely ethyl 2-methyl-4-phenyl-5-oxo-5H-indeno [1,2-b] pyridine-3-carboxylate (I) and ethyl 2-methyl-4-(4 chlorophenyl)-5-oxo-5H-indeno [1,2-b] pyridine-3-carboxylate (II) are reported. The terminal ethyl......) dimer running along 011 direction.Conclusion: The crystal structures ethyl 2-methyl-4-phenyl-5-oxo-5H-indeno [1,2-b] pyridine-3-carboxylate and ethyl 2-methyl-4-(4 chlorophenyl)-5-oxo-5H-indeno [1,2-b] pyridine-3-carboxylate have been investigated in detail. The terminal ethyl group of compound I...

Draft Genome Sequence of Lactobacillus delbrueckii subsp. bulgaricus LBB.B5.

Science.gov (United States)

Urshev, Zoltan; Hajo, Karima; Lenoci, Leonardo; Bron, Peter A; Dijkstra, Annereinou; Alkema, Wynand; Wels, Michiel; Siezen, Roland J; Minkova, Svetlana; van Hijum, Sacha A F T

2016-10-06

Lactobacillus delbrueckii subsp. bulgaricus LBB.B5 originates from homemade Bulgarian yogurt and was selected for its ability to form a strong association with Streptococcus thermophilus The genome sequence will facilitate elucidating the genetic background behind the contribution of LBB.B5 to the taste and aroma of yogurt and its exceptional protocooperation with S. thermophilus. Copyright © 2016 Urshev et al.

CASMO5 JENDL-4.0 and ENDF/B-VII.1beta4 libraries

International Nuclear Information System (INIS)

Rhodes, J.; Gheorghiu, N.; Ferrer, R.

2012-01-01

This paper details the generation of neutron data libraries for the CASMO5 lattice physics code based on the recently released JENDL-4.0 and ENDF/B-VII.1beta4 nuclear data evaluations. This data represents state-of-the-art nuclear data for late-2011. The key features of the new evaluations are briefly described along with the procedure for processing of this data into CASMO5, 586-energy group neutron data libraries. Finally some CASMO5 results for standard UO 2 and MOX critical experiments for the two new libraries and the current ENDF/B-VII.0 CASMO5 library are presented including the B and W 1810 series, DIMPLE S06A, S06B, TCA reflector criticals with iron plates and the PNL-30-35 MOX criticals. The results show that CASMO5 with the new libraries is performing well for these criticals with a very slight edge in results to the JENDL-4.0 nuclear data evaluation over the ENDF/B-VII.1beta4 evaluation. Work is currently underway to generate a CASMO5 library based on the final ENDF/B-VII.R1 evaluation released Dec. 22, 2011. (authors)

Mutational and structural analyses of Caldanaerobius polysaccharolyticus Man5B reveal novel active site residues for family 5 glycoside hydrolases.

Directory of Open Access Journals (Sweden)

Takuji Oyama

Full Text Available CpMan5B is a glycoside hydrolase (GH family 5 enzyme exhibiting both β-1,4-mannosidic and β-1,4-glucosidic cleavage activities. To provide insight into the amino acid residues that contribute to catalysis and substrate specificity, we solved the structure of CpMan5B at 1.6 Å resolution. The structure revealed several active site residues (Y12, N92 and R196 in CpMan5B that are not present in the active sites of other structurally resolved GH5 enzymes. Residue R196 in GH5 enzymes is thought to be strictly conserved as a histidine that participates in an electron relay network with the catalytic glutamates, but we show that an arginine fulfills a functionally equivalent role and is found at this position in every enzyme in subfamily GH5_36, which includes CpMan5B. Residue N92 is required for full enzymatic activity and forms a novel bridge over the active site that is absent in other family 5 structures. Our data also reveal a role of Y12 in establishing the substrate preference for CpMan5B. Using these molecular determinants as a probe allowed us to identify Man5D from Caldicellulosiruptor bescii as a mannanase with minor endo-glucanase activity.

Mutational and structural analyses of Caldanaerobius polysaccharolyticus Man5B reveal novel active site residues for family 5 glycoside hydrolases.

Science.gov (United States)

Oyama, Takuji; Schmitz, George E; Dodd, Dylan; Han, Yejun; Burnett, Alanna; Nagasawa, Naoko; Mackie, Roderick I; Nakamura, Haruki; Morikawa, Kosuke; Cann, Isaac

2013-01-01

CpMan5B is a glycoside hydrolase (GH) family 5 enzyme exhibiting both β-1,4-mannosidic and β-1,4-glucosidic cleavage activities. To provide insight into the amino acid residues that contribute to catalysis and substrate specificity, we solved the structure of CpMan5B at 1.6 Å resolution. The structure revealed several active site residues (Y12, N92 and R196) in CpMan5B that are not present in the active sites of other structurally resolved GH5 enzymes. Residue R196 in GH5 enzymes is thought to be strictly conserved as a histidine that participates in an electron relay network with the catalytic glutamates, but we show that an arginine fulfills a functionally equivalent role and is found at this position in every enzyme in subfamily GH5_36, which includes CpMan5B. Residue N92 is required for full enzymatic activity and forms a novel bridge over the active site that is absent in other family 5 structures. Our data also reveal a role of Y12 in establishing the substrate preference for CpMan5B. Using these molecular determinants as a probe allowed us to identify Man5D from Caldicellulosiruptor bescii as a mannanase with minor endo-glucanase activity.

B2.5-Eunomia simulations of Pilot-PSI plasmas

International Nuclear Information System (INIS)

Wieggers, R.C.; Coster, D.P.; Groen, P.W.C.; Blank, H.J. de; Goedheer, W.J.

2013-01-01

The B2.5-Eunomia code is used to simulate the plasma and neutral species in and around a Pilot-PSI plasma beam. B2.5, part of the SOLPS5.0 code package, is a multi-fluid plasma code for the scrape-off layer. Eunomia is a newly developed non-linear Monte Carlo transport code that solves the neutral equilibrium, given a background plasma. Eunomia is developed to simulate the relevant neutral species in Pilot-PSI and Magnum-PSI, linear devices that study plasma surface interactions in conditions expected in the ITER divertor. Results show the influence of the neutral species on the Pilot-PSI plasma beam. We show that a fluid description for the neutrals is not sufficient and Eunomia is needed to describe Pilot-PSI. The treatment of individual vibrational states of molecular hydrogen as separate species is crucial to match the experiment

MSM enhances GH signaling via the Jak2/STAT5b pathway in osteoblast-like cells and osteoblast differentiation through the activation of STAT5b in MSCs.

Directory of Open Access Journals (Sweden)

Youn Hee Joung

Full Text Available Methylsulfonylmethane (MSM is a naturally occurring sulfur compound with well-known anti-oxidant properties and anti-inflammatory activities. But, its effects on bone are unknown. Growth hormone (GH is regulator of bone growth and bone metabolism. GH activates several signaling pathways such as the Janus kinase (Jak/signal transducers and activators of transcription (STAT pathway, thereby regulating expression of genes including insulin-like growth factor (IGF-1. GH exerts effects both directly and via IGF-1, which signals by activating the IGF-1 receptor (IGF-1R. In this study, we investigated the effects of MSM on the GH signaling via the Jak/STAT pathway in osteoblasts and the differentiation of primary bone marrow mesenchymal stem cells (MSCs. MSM was not toxic to osteoblastic cells and MSCs. MSM increased the expression of GH-related proteins including IGF-1R, p-IGF-1R, STAT5b, p-STAT5b, and Jak2 in osteoblastic cells and MSCs. MSM increased IGF-1R and GHR mRNA expression in osteoblastic cells. The expression of MSM-induced IGF-1R and GHR was inhibited by AG490, a Jak2 kinase inhibitor. MSM induced binding of STAT5 to the IGF-1R and increased IGF-1 and IGF-1R promoter activities. Analysis of cell extracts by immunoprecipitation and Western blot showed that MSM enhanced GH-induced activation of Jak2/STAT5b. We found that MSM and GH, separately or in combination, activated GH signaling via the Jak2/STAT5b pathway in UMR-106 cells. Using siRNA analysis, we found that STAT5b plays an essential role in GH signaling activation in C3H10T1/2 cells. Osteogenic marker genes (ALP, ON, OCN, BSP, OSX, and Runx2 were activated by MSM, and siRNA-mediated STAT5b knockdown inhibited MSM-induced expression of osteogenic markers. Furthermore, MSM increased ALP activity and the mineralization of MSCs. Taken together, these results indicated that MSM can promote osteogenic differentiation of MSCs through activation of STAT5b.

Factores de riesgo asociados a infección aguda por hepatitis B en población militar destacada al departamento de Amazonas, Perú

Directory of Open Access Journals (Sweden)

César Cabezas

2007-10-01

Full Text Available El Perú es considerado un país de endemicidad intermedia-alta para el virus de hepatitis B (VHB, con variaciones entre diferentes regiones. Existen pocos reportes del problema de infección por el VHB en personal militar. Objetivos. Determinar los factores de riesgo asociados con el desarrollo de infección por el VHB en un brote epidémico en personal militar destacado en Ampama, Amazonas, Perú. Material y métodos. Estudio caso-control en personal militar destacado al puesto de Ampama y a la base El Milagro, departamento de Amazonas. Fueron evaluados HBsAg y posibles factores de riesgo asociados a un incremento de riesgo de adquirir el VHB. Resultados. Se estudió a 123 personas, repartidos en 41 sujetos en cada uno de los grupos (casos, control 1 y control 2. 73,2% de los casos tuvo confirmación de infección aguda por el VHB (IgM anti HBc positivo y anti Delta fue positivo en 1/37 (2,7% caso. Ninguno de los factores de riesgo evaluados mostró una asociación significativa con hepatitis B. Algunos factores de riesgo con posible asociación fueron contacto con personal con hepatitis B (OR 2,3; IC95% 0,9 - 5,7 y mordedura de murciélago (OR 1,6; IC95% 0,6 - 4,4. Conclusiones. Los factores de riesgo clásicos asociados con la transmisión del virus de la hepatitis B no fueron significativos. El personal militar es un grupo en riesgo para infectarse con el VHB.

Scintillation characteristics of LiB3O5 and β-BaB2O4 single crystals

International Nuclear Information System (INIS)

Nazarenko, B.P.; Pedash, V.Yu.; Shekhovtsov, A.N.; Tarasov, V.A.; Zelenskaya, O.V.

2006-01-01

LiB 3 O 5 and β-BaB 2 O 4 single crystals have been grown by the top seeded solution growth technique. The optical characteristics and scintillation parameters of the grown single crystals have been tested and discussed

Thermodynamics of interactions between mammalian cytochromes P450 and b5.

Science.gov (United States)

Yablokov, Evgeny; Florinskaya, Anna; Medvedev, Alexei; Sergeev, Gennady; Strushkevich, Natallia; Luschik, Alexander; Shkel, Tatsiana; Haidukevich, Irina; Gilep, Andrei; Usanov, Sergey; Ivanov, Alexis

2017-04-01

Cytochromes P450 (CYPs) play an important role in the metabolism of xenobiotics and various endogenous substrates. Being a crucial component of the microsomal monooxygenase system, CYPs are involved in numerous protein-protein interactions. However, mechanisms underlying molecular interactions between components of the monooxygenase system still need better characterization. In this study thermodynamic parameters of paired interactions between mammalian CYPs and cytochromes b5 (CYB5) have been evaluated using a Surface Plasmon Resonance (SPR) based biosensor Biacore 3000. Analysis of 18 pairs of CYB5-CYP complexes formed by nine different isoforms of mammalian CYPs and two isoforms of human CYB5 has shown that thermodynamically these complexes can be subdivided into enthalpy-driven and entropy-driven groups. Formation of the enthalpy-driven complexes was observed in the case of microsomal CYPs allosterically regulated by CYB5 (CYB5A-CYP3A4, CYB5A-CYP3A5, CYB5A-CYP17A1). The entropy-driven complexes were formed when CYB5 had no effect on the CYP activity (CYB5A-CYP51A1, CYB5A-CYP1B1, CYB5B-CYP11A1). Results of this study suggest that such interactions determining protein clustering are indirectly linked to the monooxygenase functioning. Positive ΔH values typical for such interactions may be associated with displacement of the solvation shells of proteins upon clustering. CYB5-CYP complex formation accompanied by allosteric regulation of CYP activity by CYB5 is enthalpy-dependent. Copyright © 2017 Elsevier Inc. All rights reserved.

Permeability and giant magnetoimpedance in Co69Fe4.5X1.5Si10B15 (X=Cr, Mn, Ni) amorphous ribbons

International Nuclear Information System (INIS)

Byon, Kwang Seok; Yu, Seong-Cho; Kim, Cheol Gi

2001-01-01

The magnetoimpedance (MI) has been measured in the amorphous ribbons of the soft ferromagnetic alloy Co 69 Fe 4.5 X 1.5 Si 10 B 15 (X=Cr, Mn, Ni) as functions of frequency (f). For all of the three samples, at low frequency, f≤5MHz, the MI ratio increases with increasing frequency, but the MI ratio decreases at high frequency, f≥5MHz. The MI profiles are not changed at low frequency regions of f≤1MHz in the amorphous ribbons. The MI ratio at high frequency of f=5MHz becomes 57% in Co 69 Fe 4.5 Cr 1.5 Si 10 B 15 , but the MI ratio becomes 30% in Co 69 Fe 4.5 Mn 1.5 Si 10 B 15 and Co 69 Fe 4.5 Ni 1.5 Si 10 B 15 . The MI ratio at f=10MHz becomes 45% in Co 69 Fe 4.5 Cr 1.5 Si 10 B 15 and the MI ratio becomes 23% in Co 69 Fe 4.5 Mn 1.5 Si 10 B 15 and Co 69 Fe 4.5 Ni 1.5 Si 10 B 15 , respectively. The maximum values of field sensitivity are 2.7(X=Cr), 2.5(X=Mn), 2.2(X=Ni)%/Oe for f=5MHz. [copyright] 2001 American Institute of Physics

Identification and expression analysis of miR-144-5p and miR-130b-5p in dairy cattle

Directory of Open Access Journals (Sweden)

Z. Li

2017-07-01

Full Text Available MicroRNAs (miRNAs can coordinate the main pathways involved in innate and adaptive immune responses by regulating gene expression. To explore the resistance to mastitis in cows, miR-144-5p and miR-130b-5p were identified in bovine mammary gland tissue and 14 potential target genes belonging to the chemokine signaling pathway, the arginine and proline metabolism pathway and the mRNA surveillance pathway were predicted. Subsequently, we estimated the relative expression of miR-144-5p and miR-130b-5p in cow mammary tissues by using stem-loop quantitative real-time polymerase chain reaction. The results showed that the relative expression of miR-144-5p and miR-130b-5p in the mastitis-infected mammary tissues (n = 5 was significantly downregulated 0.14-fold (p < 0. 01 and upregulated 3.34-fold (p < 0. 01, respectively, compared to healthy tissues (n = 5. Our findings reveal that miR-144-5p and miR-130b-5p may have important roles in resistance to mastitis in dairy cattle.

Unprecedentedly mild direct Pd-catalyzed arylation of oxazolo[4,5-b]pyridine

DEFF Research Database (Denmark)

Zhuravlev, Fedor

2006-01-01

Pd-catalyzed C-2 arylation of oxazolo[4,5-b]pyridine proceeds efficiently at 30 degrees C and tolerates a variety of aryl halides, including derivatized amino acids for which no racemization was observed during the reaction. Experimental evidence for facile deprotonation of oxazolo[4,5-b...

Communication received from the Russian Federation Concerning its Policies Regarding the Management of Plutonium; Comunicacion recibida de la Federacion de Rusia en relacion con sus politicas referentes a la gestion del plutonio

Energy Technology Data Exchange (ETDEWEB)

NONE

2010-09-15

The Secretariat has received a letter dated 15 July 2010 from the Permanent Mission of the Russian Federation to the IAEA in the enclosures of which the Government, in keeping with its commitment under the Guidelines for the Management of Plutonium (contained in INFCIRC/549 of 16 March 1998 and hereinafter referred to as the 'Guidelines'), and in accordance with Annexes B and C of the Guidelines, has made available annual figures for holdings of civil unirradiated plutonium and the estimated amounts of plutonium contained in spent civil reactor fuel as of 31 December 2009 [Spanish] La Secretaria ha recibido una carta de fecha 15 de julio de 2010 de la Mision Permanente de la Federacion de Rusia ante el OIEA, en cuyos anexos el Gobierno, en cumplimiento de su compromiso contraido en virtud de las Directrices para la gestion del plutonio (transcritas en el documento INFCIRC/549 de 22 de junio de 1998 y en adelante denominadas 'directrices'), y de conformidad con los anexos B y C de las directrices, ha presentado las cifras anuales de sus existencias de plutonio no irradiado de uso civil y las cantidades estimadas de plutonio.

Communication received from China Concerning Its Policies Regarding the Management of Plutonium; Comunicacion recibida de China en relacion con sus politicas referentes a la gestion del plutonio

Energy Technology Data Exchange (ETDEWEB)

NONE

2008-04-09

The Secretariat has received a Note Verbale dated 3 March 2008 from the Permanent Mission of China to the IAEA in the enclosure of which the Government of China, in keeping with its commitment under the Guidelines for the Management of Plutonium (contained in INFCIRC/549 of 16 March 1998 and hereinafter referred to as the 'Guidelines'), and in accordance with Annexes B and C of the Guidelines, has made available information on its annual figures for holdings of civil unirradiated plutonium as of 31 December 2007 [Spanish] La Secretaria ha recibido una nota verbal, de fecha 3 de marzo de 2008, de la Mision Permanente de China ante el OIEA en cuyo anexo el Gobierno de China, en cumplimiento de su compromiso contraido en virtud de las Directrices para la gestion del plutonio (transcritas en el documento INFCIRC/549 de 22 de junio de 1998 y denominadas en adelante las 'Directrices') y de conformidad con los anexos B y C de las Directrices, ha presentado informacion sobre las cifras anuales de sus existencias de plutonio no irradiado de uso civil al 31 de diciembre de 2007.

Communication received from China Concerning Its Policies Regarding the Management of Plutonium; Comunicacion recibida de China en relacion con sus politicas referentes a la gestion del plutonio

Energy Technology Data Exchange (ETDEWEB)

NONE

2011-07-27

The Secretariat has received a note verbale dated 27 June 2011 from the Permanent Mission of China to the IAEA in the enclosure of which the Government of China, in keeping with its commitment under the Guidelines for the Management of Plutonium (contained in INFCIRC/549 of 16 March 1998 and hereinafter referred to as the 'Guidelines'), and in accordance with Annexes B and C of the Guidelines, has made available information on its annual figures for holdings of civil unirradiated plutonium as of 31 December 2010 [Spanish] La Secretaria ha recibido una nota verbal, de fecha 27 de junio de 2011, de la Mision Permanente de China ante el OIEA, en cuyo anexo el Gobierno de China, en cumplimiento de su compromiso contraido en virtud de las Directrices para la gestion del plutonio (transcritas en el documento INFCIRC/549 de 22 de junio de 1998 y denominadas en adelante las 'Directrices') y de conformidad con los anexos B y C de las Directrices, ha presentado informacion sobre las cifras anuales de sus existencias de plutonio no irradiado de uso civil al 31 de diciembre de 2010.

Communication received from China Concerning Its Policies Regarding the Management of Plutonium; Comunicacion recibida de China en relacion con sus politicas referentes a la gestion del plutonio

Energy Technology Data Exchange (ETDEWEB)

NONE

2007-04-30

The Secretariat has received a Note Verbale dated 26 March 2007 from the Permanent Mission of China to the IAEA in the enclosure of which the Government of China, in keeping with its commitment under the Guidelines for the Management of Plutonium (contained in INFCIRC/549 of 16 March 1998 and hereinafter referred to as the 'Guidelines'), and in accordance with Annexes B and C of the Guidelines, has made available information on its annual figures for holdings of civil unirradiated plutonium as of 31 December 2006 [Spanish] La Secretaria ha recibido una nota verbal, de fecha 26 de marzo de 2007, de la Mision Permanente de China ante el OIEA en cuyo anexo el Gobierno de China, en cumplimiento de su compromiso contraido en virtud de las Directrices para la gestion del plutonio (transcritas en el documento INFCIRC/549 de 22 de junio de 1998 y denominadas en adelante las 'Directrices') y de conformidad con el anexo B de las Directrices, ha presentado informacion sobre las cifras anuales de sus existencias de plutonio no irradiado de uso civil al 31 de diciembre de 2006.

The distinct role of strand-specific miR-514b-3p and miR-514b-5p in colorectal cancer metastasis.

Science.gov (United States)

Ren, Lin-Lin; Yan, Ting-Ting; Shen, Chao-Qin; Tang, Jia-Yin; Kong, Xuan; Wang, Ying-Chao; Chen, Jinxian; Liu, Qiang; He, Jie; Zhong, Ming; Chen, Hao-Yan; Hong, Jie; Fang, Jing-Yuan

2018-06-07

The abnormal expression of microRNAs (miRNAs) in colorectal cancer (CRC) progression has been widely investigated. It was reported that the same hairpin RNA structure could generate mature products from each strand, termed 5p and 3p, which binds different target mRNAs. Here, we explored the expression, functions, and mechanisms of miR-514b-3p and miR-514b-5p in CRC cells and tissues. We found that miR-514b-3p was significantly down-regulated in CRC samples, and the ratio of miR-514b-3p/miR-514b-5p increased from advanced CRC, early CRC to matched normal colorectal tissues. Follow-up functional experiments illustrated that miR-514b-3p and miR-514b-5p had distinct effects through interacting with different target genes: MiR-514b-3p reduced CRC cell migration, invasion and drug resistance through increasing epithelial marker and decreasing mesenchymal marker expressions, conversely, miR-514b-5p exerted its pro-metastatic properties in CRC by promoting EMT progression. MiR-514b-3p overexpressing CRC cells developed tumors more slowly in mice compared with control cells, however, miR-514b-5p accelerated tumor metastasis. Overall, our data indicated that though miR-514b-3p and miR-514b-5p were transcribed from the same RNA hairpin, each microRNA has distinct effect on CRC metastasis.

Conceptual design of the 7 megawatt Mod-5B wind turbine generator

Science.gov (United States)

Douglas, R. R.

1982-01-01

Similar to MOD-2, the MOD-5B wind turbine generator system is designed for the sole purpose of providing electrical power for distribution by a major utility network. The objectives of the MOD-2 and MOD-5B programs are essentially identical with one important exception; the cost-of-electricity (COE) target is reduced from 4 cent/Kwhr on MOD-2 to 3 cent/Kwhr on MOD-5B, based on mid 1977 dollars and large quantity production. The MOD-5B concept studies and eventual concept selection confirmed that the program COE targets could not only be achieved but substantially bettered. Starting from the established MOD-2 technology as a base, this achievement resulted from a combination of concept changes, size changes, and design refinements. The result of this effort is a wind turbine system that can compete with conventional power generation over significant geographical areas, increasing commercial market potential by an order of magnitude.

Isolation and Characterization of Plantaricin Produced by Lactobacillus plantarum Strains (IIA-1A5, IIA-1B1, IIA-2B2

Directory of Open Access Journals (Sweden)

I. I. Arief

2013-08-01

Full Text Available Bacteriocins produced by Indonesian lactic acid bacteria Lactobacillus plantarum IIA-1A5, IIA-1B1, IIA-2B2 were purified and characterized. Plantaricin W gene had been successfully amplified from all strains. This amplicon showed the expected 200 bp size of plantaricin W gene. This bacteriocins purified from L. plantarum IIA-1A5, IIA-1B1, and IIA-2B2 were named plantaricin IIA-1A5, IIA-1B1, and IIA-2B2. Purification by cation exchange chromatography increased the purity (fold and activity of plantaricins. Purity of plantaricin IIA-1A5 was increased by 3.13 fold with specific activity 13.40 AU/mg. Plantaricin IIA-1B1 had 2.98 fold purity with specific activity 5.12 AU/mg, while purity of plantaricin IIA-2B2 was 1.37 fold with specific activity 7.70 AU/mg. All plantaricins could inhibit the growth of pathogenic bacteria, such as Escherichia coli, Salmonella typhimurium, Bacillus cereus, and Staphylococcus aureus. Plantaricins could be digested by trypsin. Stability of plantaricins at 80 oC for 30 min and at 121 oC for 15 min were affected by type of plantaricin and species of pathogenic bacteria. Generally, plantaricin IIA-1A5 was better as antimicrobial agent than plantaricin IIA-1B1 and plantaricin IIA-2B2.

Data of evolutionary structure change: 1CG5B-2QU0C [Confc[Archive

Lifescience Database Archive (English)

Full Text Available 0 C 2QU0C DLHAHKLRVDPence>...0 C 2QU0C FPHFD--LSHGSence...1CG5B-2QU0C 1CG5 2QU0 B C VKLSEDQEHYIKGVWKDVD--HKQITAKALERVFVVYPW... 1CG5 B 1CG5B ence>WKDVD--HKQIT... 384 THR CA 441 2QU0 C 2QU

Data of evolutionary structure change: 1CG5B-2QU0A [Confc[Archive

Lifescience Database Archive (English)

Full Text Available Chain>A 2QU0A ence>AWGKVGGNAGAYence> 2QU0 A 2QU0A ence>DLHAHKLRVDP...0 A 2QU0A ence>YFPHF--DLSHG...1CG5B-2QU0A 1CG5 2QU0 B A VKLSEDQEHYIKGVWKDV--DHKQITAKALERVFVVYPW...dex>0 1CG5 B 1CG5B

¿Es posible provocar la madurez del conflicto? A propósito de la correspondencia entre Medófilo Medina y Timoleón Jiménez

Directory of Open Access Journals (Sweden)

Adolfo León Atehortúa Cruz

2012-08-01

Full Text Available A partir del intercambio epistolar entre Medófilo Medina y Timoleón Jiménez, el presente artículo debate los puntos centrales de la correspondencia aludida: la vigencia de la lucha armada, la concepción de dominación y dependencia y las vías de la democracia en Colombia. Finalmente, explora la madurez del conflicto armado en nuestro país y las posibilidades de una salida negociada con participación de la sociedad. Como conclusión, ofrece respuesta a dos preguntas: ¿Será posible una salida negociada que preserve la dignidad de los combatientes? Más aún, ¿será posible inducir esa salida desde la sociedad?

Structure and physical properties of Cr{sub 5}B{sub 3}-type Ta{sub 5}Si{sub 3} and Ta{sub 5}Ge{sub 3}

Energy Technology Data Exchange (ETDEWEB)

Yuan, Fang; Forbes, Scott [Department of Chemistry and Chemical Biology, McMaster University, 1280 Main Street West, Hamilton, Ontario L8S 4M1 (Canada); Ramachandran, Krishna Kumar [Department of Chemistry, University of Alberta, Edmonton, Alberta T6G 2G2 (Canada); Mozharivskyj, Yurij, E-mail: mozhar@mcmaster.ca [Department of Chemistry and Chemical Biology, McMaster University, 1280 Main Street West, Hamilton, Ontario L8S 4M1 (Canada)

2015-11-25

The Cr{sub 5}B{sub 3}-type Ta{sub 5}Si{sub 3} phase was prepared by arc-melting, while the Cr{sub 5}B{sub 3}-type Ta{sub 5}Ge{sub 3} one was synthesized through sintering at 1000 °C. X-ray single crystal diffraction was employed to elucidate their structure. According to the magnetization measurements, both Ta{sub 5}Si{sub 3} and Ta{sub 5}Ge{sub 3} are Pauli paramagnets, with Ta{sub 5}Ge{sub 3} showing a Curie-Weiss-like paramagnetic behavior at low temperatures likely due to presence of paramagnetic impurity. Both Ta{sub 5}Si{sub 3} and Ta{sub 5}Ge{sub 3} display a very low electrical resistivity from 2 to 300 K. The resistivity is constant below 20 K, but displays a positive temperature coefficient above 20 K. Electronic structure calculations with the TB-LMTO-ASA method support the metallic character of the two phases and suggest that the bonding is optimized in both phases. - Highlights: • Synthesis of Cr{sub 5}B{sub 3}-type Ta{sub 5}Si{sub 3} and Ta{sub 5}Ge{sub 3} phases with high purity by arc-melting and sintering, respectively. • Magnetization data and electrical resistivity of the Cr{sub 5}B{sub 3}-type Ta{sub 5}Si{sub 3} and Ta{sub 5}Ge{sub 3} phases. • Crystal and electronic structure analysis for Ta{sub 5}Si{sub 3} and Ta{sub 5}Ge{sub 3} phase by X-ray diffraction and TB-LMTO-ASA calculations.

Solid-State Synthesis and Structure of the Enigmatic Ammonium Octaborate: (NH4)2[B7O9(OH)5]·3/4B(OH)3·5/4H2O.

Science.gov (United States)

Neiner, Doinita; Sevryugina, Yulia V; Schubert, David M

2016-09-06

The compound known since the 19th century as ammonium octaborate was structurally characterized revealing the ammonium salt of the ribbon isomer of the heptaborate anion, [B7O9(OH)5](2-), with boric acid and water molecules. Of composition (NH4)2B7.75O12.63·4.88H2O, it approximates the classical ammonium octaborate composition (NH4)2B8O13·6H2O and has the structural formula {(NH4)2[B7O9(OH)5]}4·3B(OH)3·5H2O. It spontaneously forms at room temperature in solid-state mixtures of ammonium tetraborate and ammonium pentaborate. It crystallizes in the monoclinic space group P21/c with a = 11.4137(2) Å, b = 11.8877(2) Å, c = 23.4459(3) Å, β = 90.092(1)°, V = 3181.19(8) Å(3), and Z = 2 and contains well-ordered ammonium cations and [B7O9(OH)5](2-) anions and disordered B(OH)3 and H2O molecules linked by extensive H bonding. Expeditious solid-state formation of the heptaborate anion under ambient conditions has important implications for development of practical syntheses of industrially useful borates.

The new silver borate Ag{sub 3}B{sub 5}O{sub 9}

Energy Technology Data Exchange (ETDEWEB)

Sohr, Gerhard; Falkowski, Viktoria; Huppertz, Hubert, E-mail: hubert.huppertz@uibk.ac.at

2015-05-15

Single crystals of Ag{sub 3}B{sub 5}O{sub 9} were obtained via high-pressure synthesis at 3 GPa and 600 °C, using a Walker-type multianvil high-pressure device. Ag{sub 3}B{sub 5}O{sub 9} crystalizes with a=674.7(2), b=943.5(2), c=1103.5(2) pm, V=0.7025(2) nm{sup 3}, and Z=4 in the noncentrosymmetric space group P2{sub 1}2{sub 1}2{sub 1} (no. 19). The orthorhombic structure was refined from 3740 independent reflections with R1=0.0496 and wR2=0.587 (all data). It is built up from infinite corner-sharing chains of BO{sub 4} tetrahedra along the a axis, which are interconnected by BO{sub 3} groups to form a network. In the structure, three crystallographically independent sites are occupied with Ag{sup +} cations exhibiting argentophillic interactions. The synthetic conditions as well as the results of the single crystal structure analysis are presented. - Graphical abstract: Noncentrosymmetric silver borate: During investigations in the system Ag–B–O, a new noncentrosymmetric silver borate Ag{sub 3}B{sub 5}O{sub 9} was discovered. The new structure type is built up from corner-sharing BO{sub 3} and BO{sub 4} groups, forming a network. Argentophillic interactions are clearly indicated by the Ag{sup +}⋯Ag{sup +} distances present in the structure. - Highlights: • A noncentrosymmetric borate Ag{sub 3}B{sub 5}O{sub 9} is accessible via high-pressure synthesis. • Ag{sub 3}B{sub 5}O{sub 9} is the second high-pressure silver borate. • Ag{sup +}⋯Ag{sup +} distances in Ag3B5O9 clearly indicate the presence of argentophillic interactions.

Communication Received from China Concerning its Policies Regarding the Management of Plutonium; Comunicacion recibida de China en relacion con sus politicas referentes a la gestion del plutonio

Energy Technology Data Exchange (ETDEWEB)

NONE

2011-01-13

The Secretariat has received a note verbale dated 21 December 2010 from the Permanent Mission of China to the IAEA in the enclosure of which the Government of China, in keeping with its commitment under the Guidelines for the Management of Plutonium (contained in INFCIRC/5491 of 16 March 1998 and hereinafter referred to as the 'Guidelines'), and in accordance with Annexes B and C of the Guidelines, has made available information on its annual figures for holdings of civil unirradiated plutonium as of 31 December 2008 and as of 31 December 2009. In light of the request expressed by China in its note verbale of 1 December 1997 concerning its policies regarding the management of plutonium (INFCIRC/549 of 16 March 1998), the enclosures of the note verbale of 21 December 2010 are attached for the information of all Member States [Spanish] La Secretaria ha recibido una nota verbal, de fecha 21 de diciembre de 2010, de la Mision Permanente de China ante el OIEA en cuyo anexo el Gobierno de China, en cumplimiento de su compromiso contraido en virtud de las Directrices para la gestion del plutonio (transcritas en el documento INFCIRC/5491 de 22 de junio de 1998 y denominadas en adelante las 'Directrices') y de conformidad con los anexos B y C de las Directrices, ha presentado informacion sobre las cifras anuales de sus existencias de plutonio no irradiado de uso civil a 31 de diciembre de 2008 y a 31 de diciembre de 2009. Atendiendo a la peticion formulada por China en su nota verbal de 1 de diciembre de 1997, sobre sus politicas referentes a la gestion del plutonio (INFCIRC/549 de 22 de junio de 1998), se adjuntan los anexos de la nota verbal de 21 de diciembre de 2010 para informacion de todos los Estados Miembros

Crystal structures of the solid solutions Na3Zn0.912Cd0.088B5O10 and Na3Zn0.845Mg0.155B5O10

Directory of Open Access Journals (Sweden)

Xue-An Chen

2017-11-01

Full Text Available Two new pentaborates, trisodium zinc cadmium pentaborate, Na3Zn0.912Cd0.088B5O10, and trisodium zinc magnesium pentaborate, Na3Zn0.845Mg0.155B5O10, have been synthesized by high-temperature solution reactions at 1023 K. Their crystal structures were determined by single-crystal X-ray diffraction. Both solid solutions crystallize in the orthorhombic form of the parent compound Na3ZnB5O10 (space group type Pbca, Z = 8 and contain the double ring [B5O10]5− anion composed of one BO4 tetrahedron and four BO3 triangles as the basic structural motif. The anions are bridged by tetrahedrally coordinated and occupationally disordered M2+ (M = Zn/Cd, Zn/Mg cations via common O atoms to form [MB5O10]n3n− layers. The intralayer intersecting channels and the interlayer voids are occupied by Na+ cations to balance the charge.

Coatings synthesised by the pulsed laser ablation of a B{sub 4}C/W{sub 2}B{sub 5} ceramic composite

Energy Technology Data Exchange (ETDEWEB)

Tadadjeu Sokeng, I., E-mail: ifriky@tlabs.ac.za [Department of Electrical, Electronics and Computer Engineering, French South African Institute of Technology/Cape Peninsula University of Technology, Bellville campus, PO Box 1906, Bellville, 7530 (South Africa); Nanosciences African Network (NANOAFNET), iThemba LABS-National Research Foundation, 1 Old Faure Road, 7129, PO Box 722, Somerset West, Western Cape Province (South Africa); UNESCO-UNISA Africa Chair in Nanosciences/Nanotechnology, College of Graduate Studies, University of South Africa (UNISA), Muckleneuk Ridge, PO Box 392, Pretoria (South Africa); Ngom, B.D. [Nanosciences African Network (NANOAFNET), iThemba LABS-National Research Foundation, 1 Old Faure Road, 7129, PO Box 722, Somerset West, Western Cape Province (South Africa); UNESCO-UNISA Africa Chair in Nanosciences/Nanotechnology, College of Graduate Studies, University of South Africa (UNISA), Muckleneuk Ridge, PO Box 392, Pretoria (South Africa); Laboratoire de Photonique et de Nanofrabrication, Groupes de physique du Solide et Sciences des Matriaux (GPSSM), Facult des sciences et Techniques Universit Cheikh Anta Diop de Dakar (UCAD), B.P. 25114 Dakar, Fann Dakar (Senegal); Msimanga, M. [iThemba LABS Gauten, Private Bag 11, WITS 2050 Johannesburg (South Africa); Nuru, Z.Y.; Kotsedi, L.; Maaza, M. [Nanosciences African Network (NANOAFNET), iThemba LABS-National Research Foundation, 1 Old Faure Road, 7129, PO Box 722, Somerset West, Western Cape Province (South Africa); UNESCO-UNISA Africa Chair in Nanosciences/Nanotechnology, College of Graduate Studies, University of South Africa (UNISA), Muckleneuk Ridge, PO Box 392, Pretoria (South Africa); Van Zyl, R.R. [Department of Electrical, Electronics and Computer Engineering, French South African Institute of Technology/Cape Peninsula University of Technology, Bellville campus, PO Box 1906, Bellville, 7530 (South Africa)

2015-10-30

A pellet of B{sub 4}C/W{sub 2}B{sub 5} ceramic composite was characterised and subjected to pulsed laser ablation for the deposition of coatings on corning glass substrates. We reports an attempt to produce coatings from B{sub 4}C/W{sub 2}B{sub 5} by pulsed laser deposition (PLD). The thermal, electric and mechanical properties of B{sub 4}C/W{sub 2}B{sub 5} suggest that coatings synthesised from this composite can be used for space applications. The samples were characterised using X-ray Diffraction, Atomic Force Microscopy and Heavy Ion Elastic Recoil Detection Analysis. The characterisation of the samples deposited on soda lime corning glass showed that the laser energy used in this PLD was enough to obtain non amorphous coatings formed by some alteration of the tungsten carbide crystal lattice at room temperature, and that there was no stoichiometry transfer as would be expected from PLD. The coating also showed space applicable features worth investigating. - Highlights: • B{sub 4}C/W{sub 2}B{sub 5} ceramic composite was ablated for deposition on corning glass subtrates. • Non-amorphous coating was obtained at room temperature. • There was no stoichiometry transfer as would be expected from Pulsed Laser Deposition.

5-Methyl-4-oxo-4,6-dihydro-3H-pyridazino[4,5-b]carbazole-1-carbonitrile

Directory of Open Access Journals (Sweden)

Norbert Haider

2010-02-01

Full Text Available The title compound was prepared in excellent yield from 5-methyl-4-oxo-4,6-dihydro-3H-pyridazino[4,5-b]carbazole-1-carbaldehyde by treatment with hydroxylamine hydrochloride in formic acid without isolation of the intermediate oxime.

Data of evolutionary structure change: 1CG5B-2ZLWD [Confc[Archive

Lifescience Database Archive (English)

Full Text Available 1CG5B-2ZLWD 1CG5 2ZLW B D VKLSEDQEHYIKGVWKDVDHKQITAKALERVFVVYPWTT.../seq1> VQLSGEEKAAVLALWDKVNEEEVGGEALGRLLVVYPWTQRFFDSFGDLSNPGAVMGNPKVKAHGKKVLHSFGEGVHHLDNLKGTFAALSELHCDK...224 GLY CA 259 2ZLW D 2ZLWD...W D 2ZLWD ELHCDKLHVDP

17 CFR 240.10b-5 - Employment of manipulative and deceptive devices.

Science.gov (United States)

2010-04-01

... fraud or deceit upon any person, in connection with the purchase or sale of any security. (Sec. 10; 48... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Employment of manipulative and deceptive devices. 240.10b-5 Section 240.10b-5 Commodity and Securities Exchanges SECURITIES AND EXCHANGE...

Sistema cenagoso de ayapel como posible sitio Ramsar en Colombia

Directory of Open Access Journals (Sweden)

Tatiana Puerta Quintana

2016-01-01

Full Text Available Colombia, al ser parte de la Convención internacional de humedales Ramsar, tiene como tarea la gestión de los humedales del país, incluyendo aquellos ecosistemas estratégicos que cumplan con uno o más criterios según los lineamientos dispuestos por la Convención. Este artículo describe el procedimiento a seguir para postular el sistema cenagoso de Ayapel como posible sitio Ramsar en Colombia. Se consolidaron los trabajos de investigación para demostrar que el sistema cenagoso de Ayapel cumple con varios criterios establecidos por la Convención. Como resultado relevante se obtuvo el insumo base para el proceso de postulación en la Convención (Ficha Ramsar. Este es el primer paso de un proyecto marco encaminado a la gestión y conservación de un ecosistema que sufre perturbaciones y transformaciones por actividades antrópicas, del cual depende en gran medida una población humana, de fauna y flora vulnerable, asociada a la dinámica de funcionamiento y servicios ecosistémicos del humedal. Además, se muestra el proceso de socialización de la Ficha Ramsar con la comunidad directamente involucrada, la cual acoge el proyecto de manera positiva.

Recommended data for capture cross sections in B5+ + H collisions

International Nuclear Information System (INIS)

Errea, L F; Guzman, F; Illescas, Clara; Mendez, L; Pons, B; Riera, A; Suarez, J

2006-01-01

Recommended values for state selective capture cross sections are presented for the collision B 5+ + H(1s) in the energy range from 0.05 to 1000 keV amu -1 . Special attention is focused on capture processes to n = 7 states of B 4+ , which play an important role in spectral diagnostics in fusion plasmas. In order to completely cover the intermediate impact energy domain, quantal, semi-classical and classical treatments have been employed for low, low-intermediate and intermediate-high energies, respectively. We also give some guidelines about the domain of accuracy of the methodologies employed. Additionally, preliminary cross sections of the B 5+ + H(2s) collision are also provided

C5 Extract Induces Apoptosis in B16F10 Murine Melanoma Cells ...

African Journals Online (AJOL)

Purpose: To investigate the anti-cancer activities of C5 extract (C5E), a new herbal preparation from Korea, on B16F10 cells. Methods: The anti-proliferative effects of C5E were assessed by culturing B16F10 cells in the presence or absence of C5E. Cell cycle progression was analyzed by PI staining using flow cytometry.

On the Correlation between Morphology of alpha and Its Crystallographic Orientation Relationship with TiB and Beta in Boron Containing Ti-5Al-5Mo-5V-3Cr-0.5Fe Alloy (Preprint)

Science.gov (United States)

2012-01-01

orientation microscopy studies on a boron containing version of the commercial Ti- 5Al-5Mo-5V-3Cr-0.5Fe ( Ti5553 ) alloy. 15. SUBJECT TERMS Ti5553 ...of the commercial Ti-5Al-5Mo-5V-3Cr-0.5Fe ( Ti5553 ) alloy. Keywords: Ti5553 , TiB, EBSD, crystallography, orientation relationship. Paper There has...absence of orientation relationships between the α, β and TiB phases, on the morphology of α nucleating from TiB in the Ti5553 alloy.. The base

Synthesis of Al-5Ti-1B Refiner by Melt Reaction Method

OpenAIRE

LI He; CHAI Li-hua; MA Teng-fei; CHEN Zi-yong

2017-01-01

Al-5Ti-1B refiner was successfully prepared by melt reaction method. Through the thermodynamics calculation, the initial reaction temperature was determined. The influence of reaction temperature on microstructure and absorption rate of the alloy was investigated. The phase and microstructure of the alloy were observed by X-ray diffraction, scanning electron microscope and energy dispersive spectrometer. The Al-5Ti-1B refiner was extruded at high temperature to wire with the diameter of 9.5mm...

Synthesis of Mo5SiB2 based nanocomposites by mechanical alloying and subsequent heat treatment

International Nuclear Information System (INIS)

Abbasi, A.R.; Shamanian, M.

2011-01-01

Research highlights: → α-Mo-Mo 5 SiB 2 nanocomposite was produced after 20 h milling of Mo-Si-B powders. → Heat treatment of 5 h MAed powders led to the formation of boride phases. → Heat treatment of 10 h MAed powders led to the formation of Mo 5 SiB 2 phase. → By increasing heat treatment time, quantity of Mo 5 SiB 2 phase increased. → 5 h heat treatment of 20 h MAed powders led to the formation of Mo 5 SiB 2 -based composite. - Abstract: In this study, systematic investigations were conducted on the synthesis of Mo 5 SiB 2 -based alloy by mechanical alloying and subsequent heat treatment. In this regard, Mo-12.5 mol% Si-25 mol% B powder mixture was milled for different times. Then, the mechanically alloyed powders were heat treated at 1373 K for 1 h. The phase transitions and microstructural evolutions of powder particles during mechanical alloying and heat treatment were studied by X-ray diffractometry and scanning electron microscopy. The results showed that the phase evolutions during mechanical alloying and subsequent heat treatment are strongly dependent on milling time. After 10 h of milling, a Mo solid solution was formed, but, no intermetallic phases were detected at this stage. However, an α-Mo-Mo 5 SiB 2 nanocomposite was formed after 20 h of milling. After heat treatment of 5 h mechanically alloyed powders, small amounts of MoB and Mo 2 B were detected and α-Mo-MoB-Mo 2 B composite was produced. On the other hand, heat treatment of 10 h and 20 h mechanically alloyed powders led to the formation of an α-Mo-Mo 5 SiB 2 -MoSi 2 -Mo 3 Si composite. At this point, there is a critical milling time (10 h) for the formation of Mo 5 SiB 2 phase after heat treatment wherein below that time, boride phase and after that time, Mo 5 SiB 2 phase are formed. In the case of 20 h mechanically alloyed powders, by increasing heat treatment time, not only the quantity of α-Mo was reduced and the quantity of Mo 5 SiB 2 was increased, but also new boride

The RAB2B-GARIL5 Complex Promotes Cytosolic DNA-Induced Innate Immune Responses.

Science.gov (United States)

Takahama, Michihiro; Fukuda, Mitsunori; Ohbayashi, Norihiko; Kozaki, Tatsuya; Misawa, Takuma; Okamoto, Toru; Matsuura, Yoshiharu; Akira, Shizuo; Saitoh, Tatsuya

2017-09-19

Cyclic GMP-AMP synthase (cGAS) is a cytosolic DNA sensor that induces the IFN antiviral response. However, the regulatory mechanisms that mediate cGAS-triggered signaling have not been fully explored. Here, we show the involvement of a small GTPase, RAB2B, and its effector protein, Golgi-associated RAB2B interactor-like 5 (GARIL5), in the cGAS-mediated IFN response. RAB2B-deficiency affects the IFN response induced by cytosolic DNA. Consistent with this, RAB2B deficiency enhances replication of vaccinia virus, a DNA virus. After DNA stimulation, RAB2B colocalizes with stimulator of interferon genes (STING), the downstream signal mediator of cGAS, on the Golgi apparatus. The GTP-binding activity of RAB2B is required for its localization on the Golgi apparatus and for recruitment of GARIL5. GARIL5 deficiency also affects the IFN response induced by cytosolic DNA and enhances replication of vaccinia virus. These findings indicate that the RAB2B-GARIL5 complex promotes IFN responses against DNA viruses by regulating the cGAS-STING signaling axis. Copyright © 2017 The Author(s). Published by Elsevier Inc. All rights reserved.

The RAB2B-GARIL5 Complex Promotes Cytosolic DNA-Induced Innate Immune Responses

Directory of Open Access Journals (Sweden)

Michihiro Takahama

2017-09-01

Full Text Available Cyclic GMP-AMP synthase (cGAS is a cytosolic DNA sensor that induces the IFN antiviral response. However, the regulatory mechanisms that mediate cGAS-triggered signaling have not been fully explored. Here, we show the involvement of a small GTPase, RAB2B, and its effector protein, Golgi-associated RAB2B interactor-like 5 (GARIL5, in the cGAS-mediated IFN response. RAB2B-deficiency affects the IFN response induced by cytosolic DNA. Consistent with this, RAB2B deficiency enhances replication of vaccinia virus, a DNA virus. After DNA stimulation, RAB2B colocalizes with stimulator of interferon genes (STING, the downstream signal mediator of cGAS, on the Golgi apparatus. The GTP-binding activity of RAB2B is required for its localization on the Golgi apparatus and for recruitment of GARIL5. GARIL5 deficiency also affects the IFN response induced by cytosolic DNA and enhances replication of vaccinia virus. These findings indicate that the RAB2B-GARIL5 complex promotes IFN responses against DNA viruses by regulating the cGAS-STING signaling axis.

SrBeB{sub 2}O{sub 5}: Growth, crystal structure and optical properties

Energy Technology Data Exchange (ETDEWEB)

Yao, Wenjiao; Wang, Xiaoshan [Center for Crystal Research and Development, Technical Institute of Physics and Chemistry, Chinese Academy of Sciences, Beijing 100190 (China); University of the Chinese Academy of Sciences, Beijing 100049 (China); Huang, Hongwei [National Laboratory of Mineral Materials, School of Materials Science and Technology, China University of Geosciences, Beijing 100083 (China); Xu, Tao; Jiang, Xingxing [Center for Crystal Research and Development, Technical Institute of Physics and Chemistry, Chinese Academy of Sciences, Beijing 100190 (China); University of the Chinese Academy of Sciences, Beijing 100049 (China); Wang, Xiaoyang [Center for Crystal Research and Development, Technical Institute of Physics and Chemistry, Chinese Academy of Sciences, Beijing 100190 (China); Lin, Zheshuai, E-mail: zslin@mail.ipc.ac.cn [Center for Crystal Research and Development, Technical Institute of Physics and Chemistry, Chinese Academy of Sciences, Beijing 100190 (China); Chen, Chuangtian [Center for Crystal Research and Development, Technical Institute of Physics and Chemistry, Chinese Academy of Sciences, Beijing 100190 (China)

2014-04-01

Graphical abstract: The crystal displays a layered configuration along c axis with the wrinkled infinite (BeB{sub 2}O{sub 5}){sub ∞} layers. Display Omitted - Highlights: • A new beryllium borate SrBeB{sub 2}O{sub 5} was synthesized. • A layered structure (BeB{sub 2}O{sub 5}){sub ∞} was formed by BO{sub 3} triangles and B/BeO{sub 4} tetrahedrons. • SrBeB{sub 2}O{sub 5} has a very wide transparency range of wavelengths from 200 nm to 1800 nm. • A-site ions impact greatly on the structures of beryllium borates. - Abstract: A novel beryllium borate SrBeB{sub 2}O{sub 5} is discovered for the first time through traditional solid state reaction and high temperature solution method. The framework of the structure is composed by two-dimensional [BeB{sub 2}O{sub 5}] layers determined from single-crystal X-ray diffraction data. The further structural analysis of beryllium borates reveals that the arrangement of anionic groups attributes to the structural stability. Moreover, the influences of the A-site cations on the structural features of fundamental building blocks in the alkaline or alkaline earth beryllium borates are discussed. The UV–Vis–NIR diffuse-reflectance pattern reveals that this compound has a very wide transparency range of wavelengths down to 200 nm. In addition, the properties of SrBeB{sub 2}O{sub 5} were also characterized by powder X-ray diffraction, differential scanning calorimetry, and IR spectroscopy.

Mapa de erosión de los suelos de México y posibles implicaciones en el almacenamiento de carbono orgánico del suelo

Directory of Open Access Journals (Sweden)

Martín A. Bolaños González

2016-07-01

Full Text Available Debido a la poca disponibilidad de información a nivel mundial y de manera acentuada en México del fenómeno de erosión de suelos; en este trabajo se presenta el Mapa Nacional de Erosión escala 1:50 000, el cual consolida un esfuerzo realizado por varios años en los que fue necesario conjuntar diversas fuentes de información para que mediante técnicas de fotointerpretación de imágenes de satélite de alta resolución, cartografía especializada e información de campo se concretara este producto, mismo que representa la información básica requerida para que, en el futuro, sea posible estimar de manera general las pérdidas de carbono orgánico del suelo debidas a éste fenómeno, dado que es uno de los componentes menos estudiados y, por consiguiente, menos cuantificados en el balance general de este elemento. Así, este primer resultado muestra que el 76% de la superficie nacional tiene algún grado de afectación por erosión hídrica, que corresponde a 6.79% con un grado de erosión extrema, el 5.79% fuerte, 26.37% moderada y 37.06% leve. Los estados más afectados por erosión apreciable (superficie relativa son: Distrito Federal, Tlaxcala, Estado de México y Michoacán y, por el contrario, los menos afectados: Tabasco, Quintana Roo y Campeche.

CUANDO EL DESARROLLO SOCIAL SE HACE POSIBLE EN UN PAÍS POBRE: EL CASO DE COSTA RICA

Directory of Open Access Journals (Sweden)

Leonardo Garnier Rímolo

2011-09-01

Full Text Available Este artículo es una versión ligeramente modificada de un trabajo escrito a finales de 1994 a solicitud del Fondo de las Naciones Unidas para la Infancia (UNICEF, para ser incluido en una publicación que contendrá los análisis retrospectivos de los procesos de desarrollo social de varios países en desarrollo. Se trata de países que, como Costa Rica, han logrado avances significativos en los niveles de bienestar de sus poblaciones, a pesar de sus históricas limitaciones estructurales.La principal pregunta que se busca contestar en el artículo se podría plantear de la siguiente manera: ¿cómo fue posible que ese pequeño país que es Costa Rica, con una economía típica del capitalismo periférico, pudiera alcanzar niveles de calidad de vida más cercanos a los de los países industrializados que a los de los países en desarrollo, a pesar de que el producto económico que genera no supera el nivel medio-bajo en el contexto internacional?Para abordar esa cuestión, se ofrece una interpretación de los rasgos esenciales del proceso de desarrollo social que ha experimentado el país desde la mitad del siglo veinte hasta principios de la década de los noventa. También se analizan los factores que han hecho posible ese proceso, se resaltan los principales instrumentos institucionales que lo han impulsado, y se discute sobre su sostenibilidad futura.

Effects of serotonin (5-HT)1B receptor ligands on amphetamine-seeking behavior in rats.

Science.gov (United States)

Miszkiel, Joanna; Przegaliński, Edmund

2013-01-01

Numerous studies have indicated that serotonin (5-HT)1B receptor ligands affect the behavioral effects of psychostimulants (cocaine, amphetamine), including the reinforcing activities of these drugs. To substantiate a role for those receptors in incentive motivation for amphetamine, we used the extinction/reinstatement model to examine the effects of the 5-HT1B receptor ligands on the reinstatement of extinguished amphetamine-seeking behavior. Rats trained to self-administer amphetamine (0.06 mg/kg/infusion) subsequently underwent the extinction procedure. These rats were then tested for the amphetamine-primed or amphetamine-associated cue-induced reinstatement of extinguished amphetamine-seeking behavior. The 5-HT1B receptor antagonist SB 216641 (5-7.5 mg/kg) attenuated the amphetamine (1.5 mg/kg)- and the amphetamine-associated cue combined with the threshold dose of amphetamine (0.5 mg/kg)-induced reinstatement of amphetamine-seeking behavior. The 5-HT1B receptor agonist CP 94253 (1.25-5 mg/kg) also inhibited the amphetamine-seeking behavior induced by amphetamine (1.5 mg/kg) but not by the cue combined with the threshold dose of amphetamine. The inhibitory effect of CP94253 on amphetamine-seeking behavior remained unaffected by the 5-HT1B receptor antagonist. Our results indicate that tonic activation of 5-HT1B receptors is involved in amphetamine- and cue-induced reinstatement of amphetamine-seeking behavior and that the inhibitory effects of 5-HT1B receptor antagonists on these phenomena are directly related to the motivational aspects of amphetamine abuse. The inhibitory effect of CP 94253 on amphetamine-seeking behavior seems to be unrelated to 5-HT1B receptor activation and may result from a general reduction of motivation.

Data of evolutionary structure change: 1CF5B-1RTCA [Confc[Archive

Lifescience Database Archive (English)

Full Text Available 1CF5B-1RTCA 1CF5 1RTC B A --------DVNFDLSTATAKTYTKFIEDFRATL-PFSHK...A 211 1RTC A 1RTCA...ain> 1RTC A 1RTCA SALYYYSTGGTQLPT...pdbChain> 1RTCA MRTRIRYNRRSA HHHHHH 1RTCA AYFFH-PDNQE

Robo4 maintains vessel integrity and inhibits angiogenesis by interacting with UNC5B.

Science.gov (United States)

Koch, Alexander W; Mathivet, Thomas; Larrivée, Bruno; Tong, Raymond K; Kowalski, Joe; Pibouin-Fragner, Laurence; Bouvrée, Karine; Stawicki, Scott; Nicholes, Katrina; Rathore, Nisha; Scales, Suzie J; Luis, Elizabeth; del Toro, Raquel; Freitas, Catarina; Bréant, Christiane; Michaud, Annie; Corvol, Pierre; Thomas, Jean-Léon; Wu, Yan; Peale, Franklin; Watts, Ryan J; Tessier-Lavigne, Marc; Bagri, Anil; Eichmann, Anne

2011-01-18

Robo4 is an endothelial cell-specific member of the Roundabout axon guidance receptor family. To identify Robo4 binding partners, we performed a protein-protein interaction screen with the Robo4 extracellular domain. We find that Robo4 specifically binds to UNC5B, a vascular Netrin receptor, revealing unexpected interactions between two endothelial guidance receptors. We show that Robo4 maintains vessel integrity by activating UNC5B, which inhibits signaling downstream of vascular endothelial growth factor (VEGF). Function-blocking monoclonal antibodies against Robo4 and UNC5B increase angiogenesis and disrupt vessel integrity. Soluble Robo4 protein inhibits VEGF-induced vessel permeability and rescues barrier defects in Robo4(-/-) mice, but not in mice treated with anti-UNC5B. Thus, Robo4-UNC5B signaling maintains vascular integrity by counteracting VEGF signaling in endothelial cells, identifying a novel function of guidance receptor interactions in the vasculature. Copyright © 2011 Elsevier Inc. All rights reserved.

ENDF/B-V 7 Standards Data File (EN5-ST Library)

International Nuclear Information System (INIS)

DayDay, N.; Lemmel, H.D.

1980-10-01

This document summarizes the contents and documentation of the ENDF/B-V 7 Standards Data File (EN5-ST Library) released in September 1979. The library contains complete evaluations for all significant neutron reactions in the energy range 10 -5 eV to 20 MeV for H-1, He-3, Li-6, B-10, C-12, Au-197 and U-235 isotopes. The entire library or selective retrievals from it can be obtained free of charge from the IAEA Nuclear Data Section. (author)

Mechanistic and single-dose in vivo therapeutic studies of Cry5B anthelmintic action against hookworms.

Directory of Open Access Journals (Sweden)

Yan Hu

Full Text Available Hookworm infections are one of the most important parasitic infections of humans worldwide, considered by some second only to malaria in associated disease burden. Single-dose mass drug administration for soil-transmitted helminths, including hookworms, relies primarily on albendazole, which has variable efficacy. New and better hookworm therapies are urgently needed. Bacillus thuringiensis crystal protein Cry5B has potential as a novel anthelmintic and has been extensively studied in the roundworm Caenorhabditis elegans. Here, we ask whether single-dose Cry5B can provide therapy against a hookworm infection and whether C. elegans mechanism-of-action studies are relevant to hookworms.To test whether the C. elegans invertebrate-specific glycolipid receptor for Cry5B is relevant in hookworms, we fed Ancylostoma ceylanicum hookworm adults Cry5B with and without galactose, an inhibitor of Cry5B-C. elegans glycolipid interactions. As with C. elegans, galactose inhibits Cry5B toxicity in A. ceylanicum. Furthermore, p38 mitogen-activated protein kinase (MAPK, which controls one of the most important Cry5B signal transduction responses in C. elegans, is functionally operational in hookworms. A. ceylanicum hookworms treated with Cry5B up-regulate p38 MAPK and knock down of p38 MAPK activity in hookworms results in hypersensitivity of A. ceylanicum adults to Cry5B attack. Single-dose Cry5B is able to reduce by >90% A. ceylanicum hookworm burdens from infected hamsters, in the process eliminating hookworm egg shedding in feces and protecting infected hamsters from blood loss. Anthelmintic activity is increased about 3-fold, eliminating >97% of the parasites with a single 3 mg dose (∼30 mg/kg, by incorporating a simple formulation to help prevent digestion in the acidic stomach of the host mammal.These studies advance the development of Cry5B protein as a potent, safe single-dose anthelmintic for hookworm therapy and make available the information of how

Genetic Regulation of Guanylate-Binding Proteins 2b and 5 during Leishmaniasis in Mice

Science.gov (United States)

Sohrabi, Yahya; Volkova, Valeryia; Kobets, Tatyana; Havelková, Helena; Krayem, Imtissal; Slapničková, Martina; Demant, Peter; Lipoldová, Marie

2018-01-01

Interferon-induced GTPases [guanylate-binding proteins (GBPs)] play an important role in inflammasome activation and mediate innate resistance to many intracellular pathogens, but little is known about their role in leishmaniasis. We therefore studied expression of Gbp2b/Gbp1 and Gbp5 mRNA in skin, inguinal lymph nodes, spleen, and liver after Leishmania major infection and in uninfected controls. We used two different groups of related mouse strains: BALB/c, STS, and CcS-5, CcS-16, and CcS-20 that carry different combinations of BALB/c and STS genomes, and strains O20, C57BL/10 (B10) and B10.O20, OcB-9, and OcB-43 carrying different combinations of O20 and B10 genomes. The strains were classified on the basis of size and number of infection-induced skin lesions as highly susceptible (BALB/c, CcS-16), susceptible (B10.O20), intermediate (CcS-20), and resistant (STS, O20, B10, OcB-9, OcB-43). Some uninfected strains differed in expression of Gbp2b/Gbp1 and Gbp5, especially of Gbp2b/Gbp1 in skin. Uninfected BALB/c and STS did not differ in their expression, but in CcS-5, CcS-16, and CcS-20, which all carry BALB/c-derived Gbp gene-cluster, expression of Gbp2b/Gbp1 exceeds that of both parents. These data indicate trans-regulation of Gbps. Infection resulted in approximately 10× upregulation of Gbp2b/Gbp1 and Gbp5 mRNAs in organs of both susceptible and resistant strains, which was most pronounced in skin. CcS-20 expressed higher level of Gbp2b/Gbp1 than both parental strains in skin, whereas CcS-16 expressed higher level of Gbp2b/Gbp1 than both parental strains in skin and liver. This indicates a trans-regulation present in infected mice CcS-16 and CcS-20. Immunostaining of skin of five strains revealed in resistant and intermediate strains STS, CcS-5, O20, and CcS-20 tight co-localization of Gbp2b/Gbp1 protein with most L. major parasites, whereas in the highly susceptible strain, BALB/c most parasites did not associate with Gbp2b/Gbp1. In conclusion, expression of

Analytical relation between the fifth-order vacuum-polarization coefficient b5 and the fifth-order Gell-Mann-Low function Ψ5

International Nuclear Information System (INIS)

Nigam, B.P.

1994-01-01

An expression for the fifth-order vacuum-polarization coefficient b 5 was reported. Recently, Broadhurst et al have indicated that this is in error by the omission of a fifth-order term. In this letter, after including the fifth-order Gell-Mann-Low (GML) function Ψ 5 in the GML equation, a relation between b 5 and Ψ 5 is derived. (author)

Natural Mexican zeolite, potential material for hydrogen storage; Zeolita natural mexicana, material para su posible uso en el almacenamiento de hidrogeno

Energy Technology Data Exchange (ETDEWEB)

Iturbe-Garcia, J. L.; Lopez Munoz, B. E. [Instituto Nacional de Investigaciones Nucleares (Mexico)]. E-mail: joseluis.iturbe@inin.gob.mx

2009-09-15

This work presents a study of the use of natural Mexican zeolite as a possible alternative for hydrogen storage. This zeolite material is from the state of Sonora. Its particle size was decreased using a grinding treatment with a mechanical alloying system for 5 hours. The mechanical alloying equipment was built in our Institute (Instituto Nacional de Investigaciones Nucleares, ININ). Later, zeolite in powder form was characterized with x-ray diffraction and sweep electron microscopy. It was heated in a micro-reactor at 350 degrees Celsius, which was simultaneously emptied over 2 hours to eliminate humidity and possible gases trapped in its structure. Next, the temperature was reduce to 10 degrees Celsius and it was placed in contact with ultra-high pure hydrogen at a pressure of 10 bars for 10 minutes. The analysis of hydrogen trapped in the zeolite was conducted with gas chromatography. The results of the chromatograms indicate that the zeolite absorbed and liberated the hydrogen in completely different conditions than those reported in the literature. That is, with our experimental conditions at low pressure and temperature, the hydrogen was absorbed in this type of material. [Spanish] En este trabajo se presenta un estudio sobre el uso de una zeolita natural de origen mexicano como posible alternativa para almacenar hidrogeno. Este material zeolitico procede del Estado de Sonora, al cual se le disminuyo el tamano de particula mediante un tratamiento de molienda con un sistema de aleado mecanico durante 5 horas. El equipo de aleado mecanico se construyo en nuestro Instituto (Instituto Nacional de Investigaciones Nucleares, ININ). Posteriormente, la zeolita en forma de polvo se caracterizo por medio de difraccion de rayos X y microscopia electronica de barrido. Se sometio a calentamiento en un micro-reactor a 350 grados Celsios y al mismo tiempo haciendo vacio durante 2 horas, para eliminar humedad y posibles gases que estuvieran atrapados en su estructura. En

5HT(1A) and 5HT(1B) receptors of medial prefrontal cortex modulate anxiogenic-like behaviors in rats.

Science.gov (United States)

Solati, Jalal; Salari, Ali-Akbar; Bakhtiari, Amir

2011-10-31

Medial prefrontal cortex (MPFC) is one of the brain regions which play an important role in emotional behaviors. The purpose of the present study was to evaluate the role of 5HT(1A) and 5HT(1B) receptors of the MPFC in modulation of anxiety behaviors in rats. The elevated plus maze (EPM) which is a useful test to investigate the effects of anxiogenic or anxiolytic drugs in rodents, was used. Bilateral intra-MPFC administration of 5HT(1A) receptor agonist, 8-OH-DPAT (5, 10, and 50 ng/rat) decreased the percentages of open arm time (OAT%) and open arm entries (OAE%), indicating an anxiogenic response. Moreover, administration of 5HT(1A) receptor antagonist, NAN-190 (0.25, 0.5, and 1 μg/rat) significantly increased OAT% and OAE%. Pre-treatment administration of NAN-190 (0.5 μg/rat), which was injected into the MPFC, reversed the anxiogenic effects of 8-OH-DPAT (5, 10, and 50 ng/rat). Intra-MPFC microinjection of 5HT(1B) receptor agonist, CGS-12066A (0.25, 0.5, and 1 μg/rat) significantly decreased OAT% and OAE%, without any change in locomotor activity, indicating an anxiogenic effect. However, injection of 5HT(1B) receptor antagonist, SB-224289 (0.5, 1, and 2 μg/rat) into the MPFC showed no significant effect. In conclusion, these findings suggest that 5HT(1A) and 5HT(1B) receptors of the MPFC region modulate anxiogenic-like behaviors in rats. Copyright © 2011 Elsevier Ireland Ltd. All rights reserved.

MicroRNA-148b promotes proliferation of hair follicle cells by targeting NFAT5

Directory of Open Access Journals (Sweden)

Wanbao YANG,Qinqun LI,Bo SU,Mei YU

2016-03-01

Full Text Available MicroRNAs (miRNAs, small non-coding RNAs, are involved in many aspects of biological processes. Previous studies have indicated that miRNAs are important for hair follicle development and growth. In our study, we found by qRT-PCR that miR-148b was significantly upregulated in sheep wool follicle bulbs in anagen phase compared with the telogen phase of the hair follicle cycle. Overexpression of miR-148b promoted proliferation of both HHDPC and HHGMC. By using the TOPFlash system we demonstrated that miR-148b could activate Wnt/β-catenin pathway and b-catenin, cycD, c-jun and PPARD were consistently upregulated accordingly. Furthermore, transcript factor nuclear factor of activated T cells type 5 (NFAT5 and Wnt10b were predicted to be the target of miR-148b and this was substantiated using a Dual-Luciferase reporter system. Subsequently NFAT5 was further identified as the target of miR-148b using western blotting. These results were considered to indicate that miR-148b could activate the Wnt/β-catenin signal pathway by targeting NFAT5 to promote the proliferation of human hair follicle cells.

Prognostic significance of signal transducer and activator of transcription 5 and 5b expression in Epstein-Barr virus-positive patients with chronic lymphocytic leukemia.

Science.gov (United States)

Diamantopoulos, Panagiotis T; Sofotasiou, Maria; Georgoussi, Zafiroula; Giannakopoulou, Nefeli; Papadopoulou, Vasiliki; Galanopoulos, Athanasios; Kontandreopoulou, Elina; Zervakis, Panagiotis; Pallaki, Paschalina; Kalala, Fani; Kyrtsonis, Marie-Christine; Dimitrakopoulou, Aglaia; Vassilakopoulos, Theodoros; Angelopoulou, Maria; Spanakis, Nikolaos; Viniou, Nora-Athina

2016-09-01

Signal transducer and activator of transcription (STAT) proteins have been intensively studied in hematologic malignancies, and the efficacy of agents against STATs in lymphomas is already under research. We investigated the expression of total STAT5 and STAT5b in peripheral blood samples of patients with chronic lymphocytic leukemia (CLL) in correlation with the presence of Epstein-Barr Virus (EBV) and its major oncoprotein (latent membrane protein 1, LMP1). The EBV load was measured in the peripheral blood by real-time PCR for the BXLF1 gene and the levels of LMP1 by PCR and ELISA. Western blotting was performed for total STAT5 and STAT5b in protein extracts. STAT5b was only expressed in patients (not in healthy subjects) and STAT5 but particularly STAT5b expression was correlated with the presence of the virus (77.3% vs. 51.2%, P = 0.006 for STAT5b) and to the expression of LMP1 (58.3% vs. 21.6%, P = 0.011 for STAT5b). Moreover, the expression of STAT5b and the presence of EBV and LMP1 were strongly negatively correlated with the overall survival of the patients (log-rank test P = 0.011, 0.015, 0.006, respectively). Double positive (for EBV and STAT5b) patients had the lowest overall survival (log-rank test P = 0.013). This is the first report of a survival disadvantage of EBV+ patients with CLL, and the first time that STAT5b expression is correlated with survival. The correlation of STAT5 expression with the presence of the virus, along with our survival correlations defines a subgroup of patients with CLL that may benefit from anti-STAT agents. © 2016 The Authors. Cancer Medicine published by John Wiley & Sons Ltd.

Fungal Competitors Affect Production of Antimicrobial Lipopeptides in Bacillus subtilis Strain B9-5.

Science.gov (United States)

DeFilippi, Stefanie; Groulx, Emma; Megalla, Merna; Mohamed, Rowida; Avis, Tyler J

2018-04-01

Bacillus subtilis has shown success in antagonizing plant pathogens where strains of the bacterium produce antimicrobial cyclic lipopeptides (CLPs) in response to microbial competitors in their ecological niche. To gain insight into the inhibitory role of these CLPs, B. subtilis strain B9-5 was co-cultured with three pathogenic fungi. Inhibition of mycelial growth and spore germination was assessed and CLPs produced by B. subtilis B9-5 were quantified over the entire period of microbial interaction. B. subtilis B9-5 significantly inhibited mycelial growth and spore germination of Fusarium sambucinum and Verticillium dahliae, but not Rhizopus stolonifer. LC-MS analysis revealed that B. subtilis differentially produced fengycin and surfactin homologs depending on the competitor. CLP quantification suggested that the presence of Verticillium dahliae, a fungus highly sensitive to the compounds, caused an increase followed by a decrease in CLP production by the bacterium. In co-cultures with Fusarium sambucinum, a moderately sensitive fungus, CLP production increased more gradually, possibly because of its slower rate of spore germination. With co-cultures of the tolerant fungus Rhizopus stolonifer, B. subtilis produced high amounts of CLPs (per bacterial cell) for the duration of the interaction. Variations in CLP production could be explained, in part, by the pathogens' overall sensitivities to the bacterial lipopeptides and/or the relative growth rates between the plant pathogen and B. subtilis. CLP production varied substantially temporally depending on the targeted fungus, which provides valuable insight concerning the effectiveness of B. subtilis B9-5 protecting its ecological niche against the ingress of these pathogens.

27 CFR 5.32b - Petitions for exemption from major food allergen labeling.

Science.gov (United States)

2010-04-01

... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false Petitions for exemption from major food allergen labeling. 5.32b Section 5.32b Alcohol, Tobacco Products and Firearms ALCOHOL AND TOBACCO TAX AND TRADE BUREAU, DEPARTMENT OF THE TREASURY LIQUORS LABELING AND ADVERTISING OF...

ATP5B and ETFB metabolic markers in children with congenital hydronephrosis.

Science.gov (United States)

Zhao, Qi; Yang, Yi; Wang, Changlin; Hou, Ying; Chen, Hui

2016-12-01

Congenital obstructive nephropathy is the primary cause of chronic renal failure in children. Disorders of mitochondrial energy metabolism may be a primary factor underlying tubular cell apoptosis in hydronephrosis. The β-F1-ATPase (ATP5B) and electron transfer flavoprotein β subunit (ETFB) metabolic markers are involved in mitochondrial energy metabolism in other diseases. The aim of the present study was to evaluate whether ATP5B and ETFB are represented in the hydronephrotic kidney, and whether they are associated with the progression of hydronephrosis. The cohort examined consisted of 20 children with hydronephrosis, graded III and IV using the Society for Fetal Urology grading system, and a control group consisting of 20 patients with nephroblastoma. Reverse transcription‑quantitative polymerase chain reaction and immunoblot analyses were used to investigate the differential expression of genes and proteins in the two groups. The gene and protein expression levels of ATP5B and ETFB were upregulated in the hydronephrosis group. Correlation analyses revealed negative correlations between ATP5B, ETFB protein and split renal function (SRF). Receiver‑operator curve analysis found a diagnostic profile of the ETFB protein in identifying children with hydronephrosis with abnormal SRF (hydronephrosis and require further detailed investigation.

17 CFR 240.10b5-2 - Duties of trust or confidence in misappropriation insider trading cases.

Science.gov (United States)

2010-04-01

... in misappropriation insider trading cases. 240.10b5-2 Section 240.10b5-2 Commodity and Securities... Devices and Contrivances § 240.10b5-2 Duties of trust or confidence in misappropriation insider trading... of insider trading under Section 10(b) of the Act and Rule 10b-5. The law of insider trading is...

Microstructure and grain refining performance of melt-spun Al-5Ti-1B master alloy

International Nuclear Information System (INIS)

Zhang Zhonghua; Bian Xiufang; Wang Yan; Liu Xiangfa

2003-01-01

In the present work, the microstructure and grain refining performance of the melt-spun Al-5Ti-1B (wt%) master alloy have been investigated, using X-ray diffraction (XRD), scanning electron microscopy (SEM), transmission electron microscopy (TEM), differential scanning calorimetry (DSC), and grain refining tests. It has been found that the microstructure of the melt-spun Al-5Ti-1B master alloy is mainly composed of two phases: metastable, supersaturated α-Al solid solution and uniformly dispersed TiB 2 particles, quite different from that of the rod-like alloy consisting of three phases: α-Al, blocky TiAl 3 , and clusters of TiB 2 particles. Quenching temperatures and wheel speeds (cooling rates), however, have no obvious effect on the microstructure of the melt-spun Al-5Ti-1B alloy. Grain refining tests show that rapid solidification has a significant effect on the grain refining performance of Al-5Ti-1B alloy and leads to the great increase of nucleation rate of the alloy. Nevertheless, the melt-spun Al-5Ti-1B master alloy prepared at different wheel speeds and quenching temperatures possesses the similar grain refining performance. The reasons for the microstructure formation and the improvement of the grain refining performance of the melt-spun Al-5Ti-1B master alloy have been also discussed

La Ley de Auditoria Española, su Significación y Bases para una Posible Reforma

Directory of Open Access Journals (Sweden)

Alejandro Larriba Díaz-Zorita

1999-12-01

Full Text Available La Ley de Auditoria lleva vigente algo más de una década y numerosas voces reclaman su modifica, por lo que este trabajo aborda las posibles orientaciones que podrían contemplarse en la reforma de algunos de los puntos más controvertidos de la ley actual. Se revisan así los problemas derivados del procedimiento de acceso a la profesión y del régimen transitorio inicial que dispuso la ley, el grado de intervencionismo y su posible reducción, el carácter de profesión de la actividad auditora, el papel de las corporaciones de auditores, la problemática de la formación continuada de los profesionales, los controvertidos temas de la responsabilidad, la independencia prestación de otros servicios paralelos a las empresas auditadas, y el contexto internacional en que desarrollarse la ley y sus consecuencias de cara a la libre circulación de auditores en la Unión Europea.The Spanish Auditory Law is ten years old now and there is now a generalised call for its reform & paper therefore puts forward some possible trends with in this reform, especially in the more controversial sections of the present law. Topics analyzed are the procedure to enter in the auditor career, specially in the transitory way observed by the law, the intervencionisme of the public authorities versus the regulation, the profesional character of the auditor's activity, the role of the auditor's associations problems of permanent training, the highlights themes of responsability, independence and the treatement of other relationships between auditors and companies: consultant and legal services and its implications and the influence in the new law of the international environment, mainly in the free circulation of auditing services in the European Union.

Crystallization behavior and the thermal properties of Zr63Al7.5Cu17.5Ni10B2 bulk amorphous alloy

International Nuclear Information System (INIS)

Jang, J.S.C.; Chang, L.J.; Jiang, Y.T.; Wong, P.W.

2003-01-01

The ribbons of amorphous Zr 63 Al 7.5 Cu 17.5 Ni 10 B 2 alloys with 0.1 mm thickness were prepared by melt spinning method. The thermal properties and micro structural development during the annealing of amorphous alloy have been investigated by a combination of differential thermal analysis, differential scanning calorimetry, high-temperature optical microscope, X-ray diffractometry and TEM. The glass transition temperature for the Zr 63 Al 7.5 Cu 17.5 Ni 10 B 2 alloys are measured about 645 K (372 C). This alloy also obtains a large temperature interval ΔT x about 63 K. Meanwhile, the calculated T rg for Zr 63 Al 7.5 Cu 17.5 Ni 10 B 2 alloy presents the value of 0.57. The activation energy of crystallization for the alloy Zr 63 Al 7.5 Cu 17.5 Ni 10 B 2 was about 370± 10 kJ/mole as determined by the Kissinger and Avrami plot, respectively. These values are about 20% higher than the activation energy of crystallization for the Zr 65 Al 7.5 Cu 17.5 Ni 10 alloy (314 kJ/mol.). This implies that the boron additions exhibit the effect of improving the thermal stability for the Zr-based alloy. The average value of the Avrami exponent n were calculated to be 1.75±0.15 for Zr 63 Al 7.5 Cu 17.5 Ni 10 B 2 alloy. This indicates that this alloy presents a crystallization process with decreasing nucleation rate. (orig.)

MicroRNA-125b-5p suppresses Brucella abortus intracellular survival via control of A20 expression.

Science.gov (United States)

Liu, Ning; Wang, Lin; Sun, Changjiang; Yang, Li; Sun, Wanchun; Peng, Qisheng

2016-07-29

Brucella may establish chronic infection by regulating the expression of miRNAs. However, the role of miRNAs in modulating the intracellular growth of Brucella remains unclear. In this study, we show that Brucella. abortus infection leads to downregulation of miR-125b-5p in macrophages. We establish that miR-125b-5p targets A20, an inhibitor of the NF-kB activation. Additionally, expression of miR-125b-5p decreases A20 expression in B. abortus-infected macrophages and leads to NF-kB activation and increased production of TNFα. Furthermore, B. abortus survival is attenuated in the presence of miR-125b-5p. These results uncover a role for miR-125b-5p in the regulation of B. abortus intracellular survival via the control of A20 expression.

Communication received from Japan Concerning its Policies Regarding the Management of Plutonium; Comunicacion recibida del Japon en relacion con sus politicas referentes a la gestion del plutonio

Energy Technology Data Exchange (ETDEWEB)

NONE

2010-12-14

The Director General has received a note verbale dated 14 September 2010 from the Permanent Mission of Japan to the IAEA in the enclosures of which the Government of Japan, in keeping with its commitment under the Guidelines for the Management of Plutonium (contained in INFCIRC/5491 of 16 March 1998 and hereinafter referred to as the 'Guidelines'), and in accordance with Annexes B and C of the Guidelines, has made available annual figures for holdings of civil unirradiated plutonium and the estimated amount of plutonium contained in spent civil reactor fuel as of 31 December 2009 [Spanish] El Director General ha recibido una nota verbal de fecha 14 de septiembre de 2010 de la Mision Permanente del Japon ante el OIEA, en cuyos anexos el Gobierno del Japon, en cumplimiento de su compromiso contraido en virtud de las Directrices para la gestion del plutonio (transcritas en el documento INFCIRC/5491 de 22 de junio de 1998 y en adelante denominadas las 'directrices') y, de conformidad con los anexos B y C de las directrices, ha presentado las cifras anuales de sus existencias nacionales de plutonio no irradiado de uso civil y la cantidad estimada de plutonio contenido en el combustible gastado de reactores de uso civil, al 31 de diciembre de 2009.

Communication Received from France Concerning its Policies regarding the Management of Plutonium. Statements on the Management of Plutonium and of High Enriched Uranium; Comunicacion recibida de Francia en relacion con sus politicas referentes a la gestion del plutonio. Declaraciones sobre la gestion del plutonio y del uranio muy enriquecido

Energy Technology Data Exchange (ETDEWEB)

NONE

2010-09-17

The Director General has received a note verbale dated 24 August 2010 from the Permanent Mission of France to the IAEA in the enclosures of which the Government of France, in keeping with its commitment under the Guidelines for the Management of Plutonium (contained in INFCIRC/549 of 16 March 1998 and hereinafter referred to as the 'Guidelines'), and in accordance with Annexes B and C of the Guidelines, has made available annual figures for holdings of civil unirradiated plutonium and the estimated amounts of plutonium contained in spent civil reactor fuel as of 31 December 2009 [Spanish] El Director General ha recibido una nota verbal, de fecha 24 de agosto de 20010, de la Mision Permanente de Francia ante el OIEA, en cuyos anexos el Gobierno de Francia, en cumplimiento de su compromiso contraido en virtud de las Directrices para la gestion del plutonio (transcritas en el documento INFCIRC/549 de 22 de junio de 1998 y en adelante denominadas 'directrices') y, de conformidad con los Anexos B y C de las directrices, ha presentado las cifras anuales de sus existencias nacionales de plutonio no irradiado de uso civil y las cantidades estimadas de plutonio contenido en el combustible gastado de reactores de uso civil, al 31 de diciembre de 2009.

Communication Received from France Concerning its Policies regarding the Management of Plutonium. Statements on the Management of Plutonium and of High Enriched Uranium; Comunicacion recibida de Francia en relacion con sus politicas referentes a la gestion del plutonio. Declaraciones sobre la gestion del plutonio y del uranio muy enriquecido

Energy Technology Data Exchange (ETDEWEB)

NONE

2007-09-04

The Director General has received a Note Verbale dated 17 July 2007 from the Permanent Mission of France to the IAEA in the enclosures of which the Government of France, in keeping with its commitment under the Guidelines for the Management of Plutonium (contained in INFCIRC/549 of 16 March 1998 and hereinafter referred to as the 'Guidelines'), and in accordance with Annexes B and C of the Guidelines, has made available annual figures for holdings of civil unirradiated plutonium and the estimated amounts of plutonium contained in spent civil reactor fuel as of 31 December 2006 [Spanish] El Director General ha recibido una nota verbal, de fecha 17 de julio de 2007, de la Mision Permanente de Francia ante el OIEA, en cuyos anexos el Gobierno de Francia, en cumplimiento de su compromiso contraido en virtud de las Directrices para la gestion del plutonio (contenidas en el documento INFCIRC/549 de 16 de marzo de 1998 y en adelante denominadas 'directrices') y, de conformidad con los anexos B y C de las directrices, ha presentado las cifras anuales de sus existencias nacionales de plutonio no irradiado de uso civil y las cantidades estimadas de plutonio contenido en el combustible gastado de reactores de uso civil, al 31de diciembre de 2006.

Communication Received from France Concerning Its Policies regarding the Management of Plutonium. Statements on the Management of Plutonium and of High Enriched Uranium; Comunicacion recibida de Francia en relacion con sus politicas referentes a la gestion del plutonio. Declaraciones sobre la gestion del plutonio y del uranio muy enriquecido

Energy Technology Data Exchange (ETDEWEB)

NONE

2006-12-29

The Secretariat has received a note verbale dated 2 May 2013 from the Permanent Mission of Switzerland to the IAEA in the enclosures of which the Government of Switzerland, in keeping with its commitment under the Guidelines for the Management of Plutonium (contained in INFCIRC/549 of 16 March 1998 and hereinafter referred to as 'Guidelines') and in accordance with Annexes B and C of the Guidelines, has made available annual figures for its holdings of civil unirradiated plutonium and the estimated amounts of plutonium contained in spent civil reactor fuel as of 31 December 2012 [Spanish] El Director General ha recibido una nota verbal, de fecha 13 de noviembre de 2006, de la Mision Permanente de Francia ante el OIEA, en cuyos anexos el Gobierno de Francia, en cumplimiento de su compromiso contraido en virtud de las Directrices para la gestion del plutonio (contenidas en el documento INFCIRC/549 de 22 de junio de 1998 y en adelante denominadas 'directrices') y, de conformidad con los anexos B y C de las directrices, ha presentado las cifras anuales de sus existencias nacionales de plutonio no irradiado de uso civil y las cantidades estimadas de plutonio contenido en el combustible gastado de reactores de uso civil, al 31 de diciembre de 2005.

Communication Received from Switzerland Concerning its Policies Regarding the Management of Plutonium; Comunicacion recibida de Suiza en relacion con sus polIticas referentes a la gestion del plutonio

Energy Technology Data Exchange (ETDEWEB)

NONE

2009-10-10

The Secretariat has received a note verbale dated 4 August 2009 from the Permanent Mission of Switzerland to the IAEA in the enclosures of which the Government of Switzerland, in keeping with its commitment under the Guidelines for the Management of Plutonium (contained in INFCIRC/5491 of 16 March 1998 and hereinafter referred to as 'Guidelines') and in accordance with Annexes B and C of the Guidelines, has made available annual figures for its holdings of civil unirradiated plutonium and the estimated amounts of plutonium contained in spent civil reactor fuel as of 31 December 2008 [Spanish] La Secretaria ha recibido una nota verbal, de fecha 4 de agosto de 2009, de la Mision Permanente de Suiza ante el OIEA, en cuyos anexos el Gobierno de Suiza, en cumplimiento de su compromiso contraido en virtud de las Directrices para la gestion del plutonio (transcritas en el documento INFCIRC/5491 de 16 de marzo de 1998 y a las que en adelante se denominara 'directrices') y de conformidad con los anexos B y C de esas directrices, ha presentado las cifras anuales de sus existencias de plutonio no irradiado de uso civil y las cantidades estimadas de plutonio contenido en el combustible gastado de reactores de uso civil, al 31 de diciembre de 2008.

Communication received from China Concerning Its Policies Regarding the Management of Plutonium; Comunicacion recibida de China en relacion con sus politicas referentes a la gestion del plutonio

Energy Technology Data Exchange (ETDEWEB)

NONE

2011-01-14

The Secretariat has received a note verbale dated 21 December 2010 from the Permanent Mission of China to the IAEA in the enclosure of which the Government of China, in keeping with its commitment under the Guidelines for the Management of Plutonium (contained in INFCIRC/549 of 16 March 1998 and hereinafter referred to as the 'Guidelines'), and in accordance with Annexes B and C of the Guidelines, has made available information on its annual figures for holdings of civil unirradiated plutonium as of 31 December 2008 and as of 31 December 2009 [Spanish] La Secretaria ha recibido una nota verbal, de fecha 21 de diciembre de 2010, de la Mision Permanente de China ante el OIEA en cuyo anexo el Gobierno de China, en cumplimiento de su compromiso contraido en virtud de las Directrices para la gestion del plutonio (transcritas en el documento INFCIRC/5491 de 22 de junio de 1998 y denominadas en adelante las 'Directrices') y de conformidad con los anexos B y C de las Directrices, ha presentado informacion sobre las cifras anuales de sus existencias de plutonio no irradiado de uso civil a 31 de diciembre de 2008 y a 31 de diciembre de 2009.

Communication Received from Switzerland Concerning its Policies Regarding the Management of Plutonium; Comunicacion recibida de Suiza en relacion con sus politicas referentes a la gestion del plutonio

Energy Technology Data Exchange (ETDEWEB)

NONE

2010-06-01

The Secretariat has received a note verbale dated 4 May 2010 from the Permanent Mission of Switzerland to the IAEA in the enclosures of which the Government of Switzerland, in keeping with its commitment under the Guidelines for the Management of Plutonium (contained in INFCIRC/549 of 16 March 1998 and hereinafter referred to as 'Guidelines') and in accordance with Annexes B and C of the Guidelines, has made available annual figures for its holdings of civil unirradiated plutonium and the estimated amounts of plutonium contained in spent civil reactor fuel as of 31 December 2009 [Spanish] La Secretaria ha recibido una nota verbal, de fecha 4 de mayo de 2010, de la Mision Permanente de Suiza ante el OIEA, en cuyos anexos el Gobierno de Suiza, en cumplimiento de su compromiso contraido en virtud de las Directrices para la gestion del plutonio (transcritas en el documento INFCIRC/549 de 16 de marzo de 1998 y a las que en adelante se denominara 'directrices') y de conformidad con los anexos B y C de esas directrices, ha presentado las cifras anuales de sus existencias de plutonio no irradiado de uso civil y las cantidades estimadas de plutonio contenido en el combustible gastado de reactores de uso civil, al 31 de diciembre de 2009.

Communication Received from Switzerland Concerning its Policies Regarding the Management of Plutonium; Comunicacion recibida de Suiza en relacion con sus politicas referentes a la gestion del plutonio

Energy Technology Data Exchange (ETDEWEB)

NONE

2007-12-04

The Secretariat has received a Note Verbale dated 3 September 2007 from the Permanent Mission of Switzerland to the IAEA in the enclosures of which the Government of Switzerland, in keeping with Switzerland's commitment under the Guidelines for the Management of Plutonium (contained in INFCIRC/549 of 16 March 1998 and hereinafter referred to as 'Guidelines') and in accordance with Annexes B and C of the Guidelines, has made available annual figures for its holdings of civil unirradiated plutonium and the estimated amounts of plutonium contained in spent civil reactor fuel as of 31 December 2006 [Spanish] La Secretaria ha recibido una nota verbal, de fecha 3 de septiembre de 2007, de la Mision Permanente de Suiza ante el OIEA, en cuyos anexos el Gobierno de Suiza, en cumplimiento de su compromiso contraido en virtud de las Directrices para la gestion del plutonio (transcritas en el documento INFCIRC/549 de 22 de junio de 1998 y a las que en adelante se denominara 'directrices') y de conformidad con los anexos B y C de esas directrices, ha presentado las cifras anuales de sus existencias de plutonio no irradiado de uso civil y las cantidades estimadas de plutonio contenido en el combustible gastado de reactores de uso civil, al 31 de diciembre de 2006.

Evaluation of the Abbott realtime HCV genotype II RUO (GT II) assay with reference to 5'UTR, core and NS5B sequencing.

Science.gov (United States)

Mallory, Melanie A; Lucic, Danijela X; Sears, Mitchell T; Cloherty, Gavin A; Hillyard, David R

2014-05-01

HCV genotyping is a critical tool for guiding initiation of therapy and selecting the most appropriate treatment regimen. To evaluate the concordance between the Abbott GT II assay and genotyping by sequencing subregions of the HCV 5'UTR, core and NS5B. The Abbott assay was used to genotype 127 routine patient specimens and 35 patient specimens with unusual subtypes and mixed infection. Abbott results were compared to genotyping by 5'UTR, core and NS5B sequencing. Sequences were genotyped using the NCBI non-redundant database and the online genotyping tool COMET. Among routine specimens, core/NS5B sequencing identified 93 genotype 1s, 13 genotype 2s, 15 genotype 3s, three genotype 4s, two genotype 6s and one recombinant specimen. Genotype calls by 5'UTR, core, NS5B sequencing and the Abbott assay were 97.6% concordant. Core/NS5B sequencing identified two discrepant samples as genotype 6 (subtypes 6l and 6u) while Abbott and 5'UTR sequencing identified these samples as genotype 1 with no subtype. The Abbott assay subtyped 91.4% of genotype 1 specimens. Among the 35 rare specimens, the Abbott assay inaccurately genotyped 3k, 6e, 6o, 6q and one genotype 4 variant; gave indeterminate results for 3g, 3h, 4r, 6m, 6n, and 6q specimens; and agreed with core/NS5B sequencing for mixed specimens. The Abbott assay is an automated HCV genotyping method with improved accuracy over 5'UTR sequencing. Samples identified by the Abbott assay as genotype 1 with no subtype may be rare subtypes of other genotypes and thus require confirmation by another method. Copyright © 2014 Elsevier B.V. All rights reserved.

Protein kinase mediated upregulation of endothelin A, endothelin B and 5-hydroxytryptamine 1B/1D receptors during organ culture in rat basilar artery

DEFF Research Database (Denmark)

Hansen-Schwartz, Jacob; Svensson, Carl-Lennart; Xu, Cang-Bao

2002-01-01

with ET-1 (unspecific ET(A) and ET(B) agonist), S6c (specific ET(B) agonist) and 5-CT (5-HT(1) agonist). Levels of mRNA coding for the ET(A), ET(B), 5-HT(1B) and 5-HT(1D) receptors were analysed using real-time RT-PCR. 3. Classical PKC's are critically involved in the appearance of the ET(B) receptor; co....... 2. The effect of inhibiting protein kinases during organ culture with staurosporine (unspecific protein kinase inhibitor), RO 31-7549 (specific inhibitor of classical PKC's) and H 89 (specific inhibitor of PKA) was examined using in vitro pharmacological examination of cultured vessel segments......-culture with RO 31-7549 abolished the contractile response (6.9 +/- 1.8%) and reduced the ET(B) receptor mRNA by 44 +/- 4% as compared to the cultured control. Correlation between decreased ET(B) receptor mRNA and abolished contractile function indicates upstream involvement of PKC. 4. Inhibition of PKA generally...

Rab5 Enhances Classical Swine Fever Virus Proliferation and Interacts with Viral NS4B Protein to Facilitate Formation of NS4B Related Complex

Directory of Open Access Journals (Sweden)

Jihui Lin

2017-08-01

Full Text Available Classical swine fever virus (CSFV is a fatal pig pestivirus and causes serious financial losses to the pig industry. CSFV NS4B protein is one of the most important viral replicase proteins. Rab5, a member of the small Rab GTPase family, is involved in infection and replication of numerous viruses including hepatitis C virus and dengue virus. Until now, the effects of Rab5 on the proliferation of CSFV are poorly defined. In the present study, we showed that Rab5 could enhance CSFV proliferation by utilizing lentivirus-mediated constitutive overexpression and eukaryotic plasmid transient overexpression approaches. On the other hand, lentivirus-mediated short hairpin RNA knockdown of Rab5 dramatically inhibited virus production. Co-immunoprecipitation, glutathione S-transferase pulldown and laser confocal microscopy assays further confirmed the interaction between Rab5 and CSFV NS4B protein. In addition, intracellular distribution of NS4B-Red presented many granular fluorescent signals (GFS in CSFV infected PK-15 cells. Inhibition of basal Rab5 function with Rab5 dominant negative mutant Rab5S34N resulted in disruption of the GFS. These results indicate that Rab5 plays a critical role in facilitating the formation of the NS4B related complexes. Furthermore, it was observed that NS4B co-localized with viral NS3 and NS5A proteins in the cytoplasm, suggesting that NS3 and NS5A might be components of the NS4B related complex. Taken together, these results demonstrate that Rab5 positively modulates CSFV propagation and interacts with NS4B protein to facilitate the NS4B related complexes formation.

ENDF/B-5 Fission Products Library. Rev. 2

International Nuclear Information System (INIS)

Schwerer, O.; Pronyaev, V.G.; Lemmel, H.D.

1984-07-01

This document summarizes contents and documentation of the 1984 version of the Fission Products Nuclear Data File of the ENDF/B-5 Library (Rev. 2) maintained by the National Nuclear Data Center (NNDC) at the Brookhaven National Laboratory, USA. This file contains numerical neutron reaction data and decay data for 877 fission product nuclides. The entire file or selective retrievals from it can be obtained on magnetic tape from the IAEA Nuclear Data Section. (author)

High-pressure synthesis and crystal structure of In{sub 3}B{sub 5}O{sub 12}

Energy Technology Data Exchange (ETDEWEB)

Vitzthum, Daniela; Schauperl, Michael; Liedl, Klaus R.; Huppertz, Hubert [Univ. Innsbruck (Austria). Inst. fuer Allgemeine, Anorganische und Theoretische Chemie

2017-03-01

Orthorhombic In{sub 3}B{sub 5}O{sub 12} was synthesized in a Walker-type multianvil apparatus under high-pressure/high-temperature conditions of 12.2 GPa and 1500 C. Its structure is isotypic to the rare earth analogs RE{sub 3}B{sub 5}O{sub 12} (RE=Sc, Er-Lu). In the field of indium borate chemistry, In{sub 3}B{sub 5}O{sub 12} is the third known ternary indium borate besides InBO{sub 3} and InB{sub 5}O{sub 9}. The crystal structure of In{sub 3}B{sub 5}O{sub 12} has been determined via single-crystal X-ray diffraction data collected at room temperature. It crystallizes in the orthorhombic space group Pmna with the lattice parameters a=12.570(2), b=4.5141(4), c=12.397(2) Aa, and V=703.4(2) Aa{sup 3}. IR and Raman bands of In{sub 3}B{sub 5}O{sub 12} were theoretically determined and assigned to experimentally recorded spectra.

Arid5b facilitates chondrogenesis by recruiting the histone demethylase Phf2 to Sox9-regulated genes

Science.gov (United States)

Hata, Kenji; Takashima, Rikako; Amano, Katsuhiko; Ono, Koichiro; Nakanishi, Masako; Yoshida, Michiko; Wakabayashi, Makoto; Matsuda, Akio; Maeda, Yoshinobu; Suzuki, Yutaka; Sugano, Sumio; Whitson, Robert H.; Nishimura, Riko; Yoneda, Toshiyuki

2013-11-01

Histone modification, a critical step for epigenetic regulation, is an important modulator of biological events. Sox9 is a transcription factor critical for endochondral ossification; however, proof of its epigenetic regulation remains elusive. Here we identify AT-rich interactive domain 5b (Arid5b) as a transcriptional co-regulator of Sox9. Arid5b physically associates with Sox9 and synergistically induces chondrogenesis. Growth of Arid5b-/- mice is retarded with delayed endochondral ossification. Sox9-dependent chondrogenesis is attenuated in Arid5b-deficient cells. Arid5b recruits Phf2, a histone lysine demethylase, to the promoter region of Sox9 target genes and stimulates H3K9me2 demethylation of these genes. In the promoters of chondrogenic marker genes, H3K9me2 levels are increased in Arid5b-/- chondrocytes. Finally, we show that Phf2 knockdown inhibits Sox9-induced chondrocyte differentiation. Our findings establish an epigenomic mechanism of skeletal development, whereby Arid5b promotes chondrogenesis by facilitating Phf2-mediated histone demethylation of Sox9-regulated chondrogenic gene promoters.

Dioxin induces expression of hsa-miR-146b-5p in human neuroblastoma cells.

Science.gov (United States)

Xu, Tuan; Xie, Heidi Q; Li, Yunping; Xia, Yingjie; Sha, Rui; Wang, Lingyun; Chen, Yangsheng; Xu, Li; Zhao, Bin

2018-01-01

Dioxin can cause a series of neural toxicological effects. MicroRNAs (miRs) play important roles in regulating nervous system function and mediating cellular responses to environmental pollutants, such as dioxin. Hsa-miR-146b-5p appears to be involved in neurodegenerative diseases and brain tumors. However, little is known about effects of dioxin on the expression of hsa-miR-146b-5p. We found that the hsa-miR-146b-5p expression and its promoter activity were significantly increased in dioxin treated SK-N-SH cells, a human-derived neuroblastoma cell line. Potential roles of hsa-miR-146b-5p in mediating neural toxicological effects of dioxin may be due to the regulation of certain target genes. We further confirmed that hsa-miR-146b-5p significantly suppressed acetylcholinesterase (AChE) activity and targeted the 3'-untranslated region of the AChE T subunit, which has been down-regulated in dioxin treated SK-N-SH cells. Functional bioinformatic analysis showed that the known and predicted target genes of hsa-miR-146b-5p were involved in some brain functions or cyto-toxicities related to known dioxin effects, including synapse transmission, in which AChE may serve as a responsive gene for mediating the effect. Copyright © 2017. Published by Elsevier B.V.

POSIBLES MECANISMOS DE ACCIÓN BIOLÓGICA DE LA ACTIVIDAD FÍSICA EN EL CÁNCER DE MAMA

OpenAIRE

Jairo Alejandro Fernández Ortega; José Antonio de Paz Fernández

2014-01-01

La evidencia científica ha demostrado la importancia de la actividad física como una estrategia efectiva para disminuir el riesgo y la recidiva del cáncer de mama. Sin embargo, hasta el momento no se conocen con precisión los mecanismos de acción biológicos del ejercicio sobre el cáncer de mama. El propósito de este artículo es realizar una revisión sistemática exhaustiva de la literatura e identificar las posibles hipótesis que se plantean de los mecanismos de acción biológicos del ejercicio...

Análisis de posibles factores determinantes de la proporción sexual secundaria en una población Toba

Directory of Open Access Journals (Sweden)

Lanza, Norberto

2005-01-01

Full Text Available En mamíferos, una de las posibles estrategias para maximizar el éxito reproductivo de las hembras, es ajustar la proporción sexual de sus descendientes. Como Trivers y Willard propusieron en 1973 si la varianza en el éxito reproductivo es mayor en un sexo que en el otro y este éxito está determinado por la condición física de la madre, aquellas que se encuentren en buenas condiciones favorecerían el sexo que mayor varianza tenga en el éxito reproductivo. El objetivo de este trabajo fue evaluar esta hipótesis en una población rural Toba de la provincia de Formosa. Se relevaron 154 historias reproductivas, comprendiendo 635 nacimientos. Se analizó la variación de la proporción sexual secundaria con relación a la edad de madre, el orden de parición y el intervalo intergenésico. Nuestros resultados muestran que la proporción de varones al nacimiento aumenta con la edad de la madre, el orden de parición y el intervalo intergenésico. Sin embargo, es posible que estos factores no sean buenos predictores de la condición física materna. Esto plantea un marco de análisis más complejo y la necesidad de considerar otros parámetros que detallen mejor la historia de vida de los individuos.

Chemical and Hormonal Effects on STAT5b-Dependent Sexual Dimorphism of the Liver Transcriptome.

Directory of Open Access Journals (Sweden)

Keiyu Oshida

Full Text Available The growth hormone (GH-activated transcription factor signal transducer and activator of transcription 5b (STAT5b is a key regulator of sexually dimorphic gene expression in the liver. Suppression of hepatic STAT5b signaling is associated with lipid metabolic dysfunction leading to steatosis and liver cancer. In the companion publication, a STAT5b biomarker gene set was identified and used in a rank-based test to predict both increases and decreases in liver STAT5b activation status/function with high (≥ 97% accuracy. Here, this computational approach was used to identify chemicals and hormones that activate (masculinize or suppress (feminize STAT5b function in a large, annotated mouse liver and primary hepatocyte gene expression compendium. Exposure to dihydrotestosterone and thyroid hormone caused liver masculinization, whereas glucocorticoids, fibroblast growth factor 15, and angiotensin II caused liver feminization. In mouse models of diabetes and obesity, liver feminization was consistently observed and was at least partially reversed by leptin or resveratrol exposure. Chemical-induced feminization of male mouse liver gene expression profiles was a relatively frequent phenomenon: of 156 gene expression biosets from chemically-treated male mice, 29% showed feminization of liver STAT5b function, while <1% showed masculinization. Most (93% of the biosets that exhibited feminization of male liver were also associated with activation of one or more xenobiotic-responsive receptors, most commonly constitutive activated receptor (CAR or peroxisome proliferator-activated receptor alpha (PPARα. Feminization was consistently associated with increased expression of peroxisome proliferator-activated receptor gamma (Pparg but not other lipogenic transcription factors linked to steatosis. GH-activated STAT5b signaling in mouse liver is thus commonly altered by diverse chemicals, and provides a linkage between chemical exposure and dysregulated gene

Reduced sulfation of muc5b is linked to xerostomia in patients with Sjögren syndrome

DEFF Research Database (Denmark)

Alliende, C; Kwon, Y-J; Brito, M

2008-01-01

OBJECTIVES: MUC5B contains sulfated and sialylated oligosaccharides that sequester water required for moisturising the oral mucosa. Xerostomia, in patients with Sjögren syndrome, is generally associated with reduced quantities, rather than altered properties, of saliva. Here, we determined...... the amount of MUC5B (mRNA and protein) as well as sulfation levels in salivary glands of patients with normal or altered unstimulated salivary flow. Localisation of MUC5B and sulfated MUC5B, as well as total levels sulfated groups were determined and compared with acini basal lamina disorganisation. PATIENTS...... AND METHODS: In all, 18 patients with normal or altered unstimulated salivary flow and 16 controls were studied. MUC5B mRNA and protein were evaluated in salivary glands by semiquantitative RT-PCR and Western blot analysis. MUC5B sulfation was determined by Western blotting. MUC5B and sulfo-Lewis(a) antigen...

A structure and second-harmonic generation of crystals Li B3O5

International Nuclear Information System (INIS)

Burak, Ya.V.

1997-01-01

Projections of atoms of nonlinear optical crystals Li B 3 O 5 onto planes perpendicular to directions of the phase matching of type-1 and type-2 for second-harmonic generation (SHG) in a YAG:Nd laser are constructed. Analyses of the interdependence of orientations of (B 3 O 7 ) 5 -complexes and of the effectiveness of SHG are conducted

Effect of Vitamin B5 on Liver Enzyme Levels in Bile Duct Ligation Cholestatic Rat Model

Directory of Open Access Journals (Sweden)

Fatemeh Sadat Emami

2017-01-01

Full Text Available Background and Objectives: Accumulation of toxic bile salts in a bile duct ligation (BDL animal model plays a pivotal role in the induction of liver fibrosis. Vitamin B5 is an essential nutrient, which acts as a cofactor in many detoxification system enzymes. In the present research, the antifibrotic effect of vitamin B5 was investigated on liver cholestasis induced by BDL in rats. Methods: In this experimental study, 72 male Wistar rats were divided into 9 groups: Control, sham-operated, vitamin B5 (5, 50, and 100mg/kg bw, BDL, and BDL+vitamin B5 (5, 50, and 100mg/kg bw. After BDL, rats were given vitamin B5 via intragastric gavage for 28 consecutive days. At the end of the experiment, blood was collected from heart and activity of aspartate aminotransferase (AST, alanine aminotransferase (ALT, and alkaline phosphatase (ALP enzymes, were measured. The data were analyzed using one-way ANOVA test. Results: In the BDL animals, the serum activities of AST, ALT, and ALP significantly increased (p<0.001. Treatment of BDL rats with vitamin B5 significantly attenuated these changes. Conclusion: The results of this study indicated that vitamin B5 has hepatoprotective and antifibrotic effects in the cholestatic liver, which is likely due to the antioxidative and free radical scavenging effects of this vitamin.

The BDNF/TrkB signaling pathway is involved in heat hyperalgesia mediated by Cdk5 in rats.

Directory of Open Access Journals (Sweden)

Hong-Hai Zhang

Full Text Available Cyclin-dependent kinase 5 (Cdk5 has been shown to play an important role in mediating inflammation-induced heat hyperalgesia. However, the underlying mechanism remains unclear. The aim of this study was to determine whether roscovitine, an inhibitor of Cdk5, could reverse the heat hyperalgesia induced by peripheral injection of complete Freund's adjuvant (CFA via the brain-derived neurotrophic factor (BDNF-tyrosine kinase B (TrkB signaling pathway in the dorsal horn of the spinal cord in rats.Heat hyperalgesia induced by peripheral injection of CFA was significantly reversed by roscovitine, TrkB-IgG, and the TrkB inhibitor K252a, respectively. Furthermore, BDNF was significantly increased from 0.5 h to 24 h after CFA injection in the spinal cord dorsal horn. Intrathecal adminstration of the Cdk5 inhibitor roscovitine had no obvious effects on BDNF levels. Increased TrkB protein level was significantly reversed by roscovitine between 0.5 h and 6 h after CFA injection. Cdk5 and TrkB co-immunoprecipitation results suggested Cdk5 mediates the heat hyperalgesia induced by CFA injection by binding with TrkB, and the binding between Cdk5 and TrkB was markedly blocked by intrathecal adminstration of roscovitine.Our data suggested that the BDNF-TrkB signaling pathway was involved in CFA-induced heat hyperalgesia mediated by Cdk5. Roscovitine reversed the heat hyperalgesia induced by peripheral injection of CFA by blocking BDNF/TrkB signaling pathway, suggesting that severing the close crosstalk between Cdk5 and the BDNF/TrkB signaling cascade may present a potential target for anti-inflammatory pain.

THE ATMOSPHERES OF THE HOT-JUPITERS KEPLER-5b AND KEPLER-6b OBSERVED DURING OCCULTATIONS WITH WARM-SPITZER AND KEPLER

Energy Technology Data Exchange (ETDEWEB)

Desert, Jean-Michel; Charbonneau, David; Fressin, Francois; Latham, David W. [Harvard-Smithsonian Center for Astrophysics, 60 Garden Street, Cambridge, MA 02138 (United States); Fortney, Jonathan J. [Department of Astronomy and Astrophysics, University of California, Santa Cruz, CA 95064 (United States); Madhusudhan, Nikku [Department of Astrophysical Sciences, Princeton University, Princeton, NJ 08544 (United States); Knutson, Heather A. [Department of Astronomy, University of California, Berkeley, CA 94720-3411 (United States); Deming, Drake [Solar System Exploration Division, NASA Goddard Space Flight Center, Greenbelt, MD 20771 (United States); Borucki, William J. [NASA Ames Research Center, Moffett Field, CA 94035 (United States); Brown, Timothy M. [Las Cumbres Observatory Global Telescope, Goleta, CA 93117 (United States); Caldwell, Douglas [SETI Institute, Mountain View, CA 94043 (United States); Ford, Eric B. [Department of Astronomy, University of Florida, Gainesville, FL 32611 (United States); Gilliland, Ronald L. [Space Telescope Science Institute, Baltimore, MD 21218 (United States); Marcy, Geoffrey W. [Berkeley Astronomy Department, University of California, Berkeley, CA 94720 (United States); Seager, Sara, E-mail: jdesert@cfa.harvard.edu [Massachusetts Institute of Technology, Cambridge, MA 02159 (United States)

2011-11-01

This paper reports the detection and the measurements of occultations of the two transiting hot giant exoplanets Kepler-5b and Kepler-6b by their parent stars. The observations are obtained in the near-infrared with Warm-Spitzer Space Telescope and at optical wavelengths by combining more than a year of Kepler photometry. The investigation consists of constraining the eccentricities of these systems and of obtaining broadband emergent photometric data for individual planets. For both targets, the occultations are detected at the 3{sigma} level at each wavelength with mid-occultation times consistent with circular orbits. The brightness temperatures of these planets are deduced from the infrared observations and reach T{sub Spitzer} = 1930 {+-} 100 K and T{sub Spitzer} = 1660 {+-} 120 K for Kepler-5b and Kepler-6b, respectively. We measure optical geometric albedos A{sub g} in the Kepler bandpass and find A{sub g} = 0.12 {+-} 0.04 for Kepler-5b and A{sub g} = 0.11 {+-} 0.04 for Kepler-6b, leading to upper an limit for the Bond albedo of A{sub B} {<=} 0.17 in both cases. The observations for both planets are best described by models for which most of the incident energy is redistributed on the dayside, with only less than 10% of the absorbed stellar flux redistributed to the nightside of these planets.

Synthesis and chemistry of the open-cage cobaltaheteroborane cluster [{(η(5)-C5Me5)Co}2B2H2Se2]: a combined experimental and theoretical study.

Science.gov (United States)

Barik, Subrat Kumar; Dorcet, Vincent; Roisnel, Thierry; Halet, Jean-François; Ghosh, Sundargopal

2015-08-28

Reaction of [(η(5)-C5Me5)CoCl]2 with a two-fold excess of [LiBH4·thf] followed by heating with an excess of Se powder produces the dicobaltaselenaborane species [{(η(5)-C5Me5)Co}2B2H2Se2], , in good yield. The geometry of resembles a nido pentagonal [Co2B2Se2] bipyramid with a missing equatorial vertex. It can alternatively be seen as an open cage triple-decker cluster. Isolation of permits its reaction with [Fe2(CO)9] to give heterometallic diselenametallaborane [{(η(5)-C5Me5)Co}Fe(CO)3B2H2Se2], . The geometry of is similar to that of with one of the [(η(5)-C5Me5)Co] groups replaced by the isolobal, two-electron fragment [Fe(CO)3]. Both new compounds have been characterized by mass spectrometry, and by (1)H, (11)B and (13)C NMR spectroscopy. The structural architectures have been unequivocally established by crystallographic analysis. In addition, density functional theory calculations were performed to investigate the bonding and electronic properties. The large HOMO-LUMO gaps computed for both clusters are consistent with their thermodynamic stability. Natural bond order calculations predict the absence of metal-metal bonding interaction.

Desarrollo de aprendizajes significativos con recursos de m-learning integrados en diferentes ambientes de educación a distancia

OpenAIRE

Kardell Sulin, Perea Sarmiento

2012-01-01

Resumen Índice Introducción Capítulo 1 Planteamiento del problema Capítulo 2 Revisión de la literatura Capítulo 3 Metodología general Capítulo 4 Presentación de resultados Capítulo 5 Discusión, conclusiones y recomendaciones Referencias Anexos

Historia y cine: un mapa de posibles líneas de análisis en el eje realidad / representación

Directory of Open Access Journals (Sweden)

Emilce Fabricio

2016-04-01

Full Text Available El artículo rastrea algunas posibles líneas de análisis abiertas para historiadores e historiadoras en el campo de intersecciones de los estudios cinematográficos y de la sociedad. Comienza planteando los orígenes del mismo, para adentrarse en las consideraciones del cine como fuente para la historia y de la historia en el cine. Finalmente se considera el caso particular del cine documental y se problematiza la dualidad realidad/representación.

Structure and superconductivity of double-doped Mg1-x(Al0.5Li0.5)xB2

DEFF Research Database (Denmark)

Xu, G.J.; Grivel, Jean-Claude; Abrahamsen, A.B.

2003-01-01

A series of polycrystalline samples of Mg1-x(Al0.5Li0.5)(x)B-2 (0less than or equal toxless than or equal to0.6) were prepared by a solid state reaction method and their structure, superconducting transition temperature and magneto-transport properties were investigated by means of X-ray diffract......A series of polycrystalline samples of Mg1-x(Al0.5Li0.5)(x)B-2 (0less than or equal toxless than or equal to0.6) were prepared by a solid state reaction method and their structure, superconducting transition temperature and magneto-transport properties were investigated by means of X......-ray diffraction (XRD), ac-susceptibility and resistance in varied magnetic fields. The double doping leads to decreases in both the lattice parameters a and c. The superconducting transition temperature (T-c) decreases with double doping, but the T-c is systematically higher than that of the single Al......-doped samples. It is suggested that the hole band filling has little effect on T-c at high doping level, while the disorder induced by doping plays an important role in suppressing T-c. A systematic comparison with Al-doped MgB2 of the structure, superconducting transition and irreversibility field is made. (C...

C5b-9 Staining Correlates With Clinical and Tumor Stage in Gastric Adenocarcinoma.

Science.gov (United States)

Chen, Jian; Yang, Wei-Jun; Sun, Hai-Jian; Yang, Xia; Wu, Yu-Zhang

2016-08-01

The complement system is a critical part of the immune response, acting in defense against viral infections, clearance of immune complexes, and maintenance of tissue homeostasis. Upregulated expression of the terminal complement complex, C5b-9, has been observed on various tumor cells, such as stomach carcinoma cells, and on cells in the necrotic regions of these tumors as well; however, whether and how C5b-9 is related to gastric cancer progression and severity remains unknown. In this study, human gastric adenocarcinoma (HGAC) tissues (n=47 cases) and patient-matched adjacent nontumoral parenchyma (n=20 cases) were evaluated by tissue microarray and immunohistochemistry. The HGAC tissues showed upregulated C5b-9 expression. Multinomial logistic regression and likelihood ratio testing showed that overexpression of C5b-9 in HGAC tissue was significantly correlated with clinical stage (P=0.007) and tumor stage (P=0.005), but not with tumor distant organ metastasis, lymphoid nodal status, sex, or age. Patients with late-stage gastric adenocarcinoma had a higher amount of tumor cells showing positive staining for C5b-9 than patients with early-stage disease. These results may help in diagnosis and assessment of disease severity of human gastric carcinoma.

CXCR5+ CD8+ T Cells Indirectly Offer B Cell Help and Are Inversely Correlated with Viral Load in Chronic Hepatitis B Infection.

Science.gov (United States)

Jiang, Hang; Li, Linhai; Han, Jiang; Sun, Zhiwei; Rong, Yihui; Jin, Yun

2017-04-01

Treatment options for chronic hepatitis B (CHB) infection are extremely limited. CXCR5 + CD8 + T cell is a novel cell subtype and could possess strong cytotoxic properties in HIV infection. In this study, we investigated the role of CXCR5 + CD8 + T cells in CHB patients. Compared to healthy individuals, both CHB patients and hepatitis B virus (HBV)-infected hepatocellular carcinoma patients presented significant upregulation of CXCR5 + CD8 + T cells in peripheral blood, in which CXCR5 + CD8 + T cells were negatively correlated with the frequency of CXCR5 + CD4 + T cells in CHB patients. After PMA+ionomycin stimulation, CXCR5 + CD8 + T cells from CHB patients presented significantly higher transcription level of interferon gamma (IFN-γ), interleukin 10 (IL-10), and IL-21, as well as higher IL-10 and IL-21 protein secretion, than CXCR5 - CD8 + T cells. Unlike CXCR5 + CD4 + T cells, when incubated with naive CD19 + CD27 - B cells, CXCR5 + CD8 + T cells alone did not upregulate IgM, IgG, and IgA secretion. However, addition of CXCR5 + CD8 + T cells in B cell-CXCR5 + CD4 + T cell coculture significantly increased the levels of secreted IgG and IgA, demonstrating that CXCR5 + CD8 + T cell could indirectly offer B cell help. Furthermore, high frequencies of CXCR5 + CD8 + T cells tended to associate with low HBV DNA load, and the frequency of CXCR5 + CD8 + T cells was negatively correlated with alanine aminotransferase (ALT) level. Together, these results suggested that CXCR5 + CD8 + T cells were involved in the antiviral immune responses in CHB and could potentially serve as a therapeutic candidate.

ENDF/B-5 Dosimetry Files, mod. 2 1979/81

International Nuclear Information System (INIS)

DayDay, N.; Lemmel, H.D.

1981-09-01

This document summarizes the contents and documentation of the ENDF/B-5 Dosimetry Files (Point or Group Data) released in October 1979 and modified in August 1981. The files contain data for 36 neutron reactions of 26 isotopes. The entire libraries or selective retrievals from them can be obtained free of charge from the IAEA Nuclear Data Section. (author)

Xerosis conjuntival y corneal ligera por déficit de vitamina A Mild conjunctival and corneal xerosis due to vitamin A deficiency

Directory of Open Access Journals (Sweden)

Hernán García Álvarez

1999-06-01

Full Text Available Se realizó un estudio descriptivo a un grupo de niños que asistieron a consulta de oftalmología del Hospital Pediátrico Provincial de Cienfuegos, durante un período de dos meses con Xeroftalmía demostrada por la prueba de Citología de Impresión Conjuntival, cuyas edades estaban comprendidas entre 5 y 14 años. Se les realizó un examen oftalmológico detallado de anexos y córnea, incluyendo la tinción con fluoresceína y la prueba del tiempo de desintegración de la película de lágrimas y se relacionó ese grupo con otras posibles afecciones sistémicas causadas por el déficit de vitamina A. Sólo se diagnosticó xerosis conjuntival y corneal ligera asociada en la mayoría de los casos a enfermedad respiratoria aguda y parasitismo intestinalA descriptive study of a group of children aged 5-14 that attended the Ophthalmology Department of the Provincial Pediatric Hospital of Cienfuegos during months with xerophthalmia demostrated by the test of Conjunctival Impression Cytology was carried out. A detailled ophthalmological examination of adnexa and cornea was made, including the staining with fluorescein and the test of the of desintegration of the lacrimal pellicle. This group was related to other possible systemic caused by vitamin A deficiency. Only mild conjunctival and croneal xerosis was diagnosed. It was mostly associated with acute respiratory disease and intestinal parasitism

Crystallisation kinetics of amorphous Fe72.5-xCu1Nb4.5Si10+x+yB12-y alloy

International Nuclear Information System (INIS)

Miglierini, M.; Lipka, J.; Sitek, J.

1994-01-01

Fe 73.5 Cu 1 Nb 3 Si 13.5 B 9 and Fe 72.5-x Cu 1 Nb 4.5 Si 10+x+y B 12-y alloys are compared from the point of view of crystallisation behaviour and changes in the short-range order in the amorphous reminder. The increase in Nb to 4.5 at.% in the latter system slows down the formation of nanocrystals to approximately 40% even after 16 hours of anneal at 550 C for x = 0.5, y = 3. Segregation-induced changes in the short-range order are manifested via hyperfine field distributions corresponding to the amorphous reminder. (orig.)

5 CFR 870.705 - Amount and election of Option B and Option C.

Science.gov (United States)

2010-01-01

... 5 Administrative Personnel 2 2010-01-01 2010-01-01 false Amount and election of Option B and Option C. 870.705 Section 870.705 Administrative Personnel OFFICE OF PERSONNEL MANAGEMENT (CONTINUED... Compensationers § 870.705 Amount and election of Option B and Option C. (a) The number of multiples of Option B...

Lysine acetyltransferase GCN5b interacts with AP2 factors and is required for Toxoplasma gondii proliferation.

Directory of Open Access Journals (Sweden)

Jiachen Wang

2014-01-01

Full Text Available Histone acetylation has been linked to developmental changes in gene expression and is a validated drug target of apicomplexan parasites, but little is known about the roles of individual histone modifying enzymes and how they are recruited to target genes. The protozoan parasite Toxoplasma gondii (phylum Apicomplexa is unusual among invertebrates in possessing two GCN5-family lysine acetyltransferases (KATs. While GCN5a is required for gene expression in response to alkaline stress, this KAT is dispensable for parasite proliferation in normal culture conditions. In contrast, GCN5b cannot be disrupted, suggesting it is essential for Toxoplasma viability. To further explore the function of GCN5b, we generated clonal parasites expressing an inducible HA-tagged dominant-negative form of GCN5b containing a point mutation that ablates enzymatic activity (E703G. Stabilization of this dominant-negative GCN5b was mediated through ligand-binding to a destabilization domain (dd fused to the protein. Induced accumulation of the ddHAGCN5b(E703G protein led to a rapid arrest in parasite replication. Growth arrest was accompanied by a decrease in histone H3 acetylation at specific lysine residues as well as reduced expression of GCN5b target genes in GCN5b(E703G parasites, which were identified using chromatin immunoprecipitation coupled with microarray hybridization (ChIP-chip. Proteomics studies revealed that GCN5b interacts with AP2-domain proteins, apicomplexan plant-like transcription factors, as well as a "core complex" that includes the co-activator ADA2-A, TFIID subunits, LEO1 polymerase-associated factor (Paf1 subunit, and RRM proteins. The dominant-negative phenotype of ddHAGCN5b(E703G parasites, considered with the proteomics and ChIP-chip data, indicate that GCN5b plays a central role in transcriptional and chromatin remodeling complexes. We conclude that GCN5b has a non-redundant and indispensable role in regulating gene expression required

Mossbauer studies of amorphous Fe73.5Cu1Nb3Si13.5B9 alloy

DEFF Research Database (Denmark)

Jiang, Jianzhong

1996-01-01

This paper reports a Mossbauer study of amorphous Fe73.5Cu1Nb3Si13.5B9 alloy between 10 and 673 K. The Curie temperature Tc is found to be 620-+ 1 K. The temperature dependence of the reduced average hyperfine field can be explained on the basis of Handrich's model of amorphous ferromagnetism...

Evidence that cytochrome b5 acts as a redox donor in CYP17A1 mediated androgen synthesis

International Nuclear Information System (INIS)

Duggal, Ruchia; Liu, Yilin; Gregory, Michael C.; Denisov, Ilia G.; Kincaid, James R.; Sligar, Stephen G.

2016-01-01

Cytochrome P450 17A1 (CYP17A1) is an important drug target for castration resistant prostate cancer. It is a bi-functional enzyme, catalyzing production of glucocorticoid precursors by hydroxylation of pregnene-nucleus, and androgen biosynthesis by a second C−C lyase step, at the expense of glucocorticoid production. Cytochrome b 5 (cyt b 5 ) is known to be a key regulator of the androgen synthesis reaction in vivo, by a mechanism that is not well understood. Two hypotheses have been proposed for the mechanism by which cyt b 5 increases androgen biosynthesis. Cyt b 5 could act as an allosteric effector, binding to CYP17A1 and either changing its selective substrate affinity or altering the conformation of the P450 to increase the catalytic rate or decrease unproductive uncoupling channels. Alternatively, cyt b 5 could act as a redox donor for supply of the second electron in the P450 cycle, reducing the oxyferrous complex to form the reactive peroxo-intermediate. To understand the mechanism of lyase enhancement by cyt b 5 , we generated a redox-inactive form of cyt b 5 , in which the heme is replaced with a Manganese-protoporphyrin IX (Mn-b 5 ), and investigated enhancement of androgen producing lyase reaction by CYP17A1. Given the critical significance of a stable membrane anchor for all of the proteins involved and the need for controlled stoichiometric ratios, we employed the Nanodisc system for this study. The redox inactive form was observed to have no effect on the lyase reaction, while reactions with the normal heme-iron containing cyt b 5 were enhanced ∼5 fold as compared to reactions in the absence of cyt b 5 . We also performed resonance Raman measurements on ferric CYP17A1 bound to Mn-b 5 . Upon addition of Mn-b 5 to Nanodisc reconstituted CYP17A1, we observed clear evidence for the formation of a b 5 -CYP17A1 complex, as noted by changes in the porphyrin modes and alteration in the proximal Fe−S vibrational frequency. Thus, although Mn-b 5 binds

Towards engineering increased pantothenate (Vitamin B5) levels in plants

CSIR Research Space (South Africa)

Chakauya, E

2008-11-01

Full Text Available Pantothenate (vitamin B5) is the precursor of the 4'-phosphopantetheine moiety of coenzyme A and acyl-carrier protein. It is made by plants and microorganisms de novo, but is a dietary requirement for animals. The pantothenate biosynthetic pathway...

Granulocyte and monocyte CD11b expression during plasma separation is dependent on complement factor 5 (C5) - an ex vivo study with blood from a C5-deficient individual.

Science.gov (United States)

Hardersen, Randolf; Enebakk, Terje; Christiansen, Dorte; Bergseth, Grethe; Brekke, Ole-Lars; Mollnes, Tom Eirik; Lappegård, Knut Tore; Hovland, Anders

2018-04-01

The aim of the study was to investigate the role of complement factor 5 (C5) in reactions elicited by plasma separation using blood from a C5-deficient (C5D) individual, comparing it to C5-deficient blood reconstituted with C5 (C5DR) and blood from healthy donors. Blood was circulated through an ex vivo plasma separation model. Leukocyte CD11b expression and leukocyte-platelet conjugates were measured by flow cytometry during a 30-min period. Other markers were assessed during a 240-min period. Granulocyte and monocyte CD11b expression did not increase in C5D blood during plasma separation. In C5DR samples granulocytes CD11b expression, measured by mean fluorescence intensity (MFI), increased from 10481 ± 6022 (SD) to 62703 ± 4936, and monocytes CD11b expression changed from 13837 ± 7047 to 40063 ± 713. Granulocyte-platelet conjugates showed a 2.5-fold increase in the C5DR sample compared to the C5D sample. Monocyte-platelet conjugates increased independently of C5. In the C5D samples, platelet count decreased from 210 × 10 9 /L (201-219) (median and range) to 51 × 10 9 /L (50-51), and C3bc increased from 14 CAU/mL (21-7) to 198 CAU/mL (127-269), whereas TCC formation was blocked during plasma separation. In conclusion, up-regulation of granulocyte and monocyte CD11b during plasma separation was C5-dependent. The results also indicate C5 dependency in granulocyte-platelet conjugates formation. © 2018 APMIS. Published by John Wiley & Sons Ltd.

PKC α regulates netrin-1/UNC5B-mediated survival pathway in bladder cancer

International Nuclear Information System (INIS)

Liu, Jiao; Kong, Chui-ze; Gong, Da-xin; Zhang, Zhe; Zhu, Yu-yan

2014-01-01

Netrin-1 and its receptor UNC5B play important roles in angiogenesis, embryonic development, cancer and inflammation. However, their expression patttern and biological roles in bladder cancer have not been well characterized. The present study aims to investigating the clinical significance of PKC α, netrin-1 and UNC5B in bladder cancer as well as their association with malignant biological behavior of cancer cells. Netrin-1 and UNC5B expression was examined in 120 bladder cancer specimens using immunohistochemistry and in 40 fresh cancer tissues by western blot. Immunofluorescence was performed in cancer cell lines. PKC α agonist PMA and PKC siRNA was employed in bladder cancer cells. CCK-8, wound healing assays and flow cytometry analysis were used to examine cell proliferation, migration and cell cycle, respectively. Netrin-1 expression was positively correlated with histological grade, T stage, metastasis and poor prognosis in bladder cancer tissues. Immunofluorescence showed elevated netrin-1 and decreased UNC5B expression in bladder cancer cells compared with normal bladder cell line. Furthermore, cell proliferation, migration and cell cycle progression were promoted with PMA treatment while inhibited by calphostin C. In addition, PMA treatment could induce while calphostin C reduce netrin-1 expression in bladder cancer cells. The present study identified netrin-1/UNC5B, which could be regulated by PKC signaling, was important mediators of bladder cancer progression

A NEW CELL CLONE DERIVED FROM TRICHOPLUSIA NI TN5B1-4 CELLS

Institute of Scientific and Technical Information of China (English)

Jian-xiaoTian; Chang-youLi; Gui-lingZheng; Guo-xunLi; PingWang; Granados

2004-01-01

The characteristics of a cultured cell line do not always remain stable and may change upon continuous passage. Most continuous cell lines, even after cloning, possess several genotypes that are constantly changing. There are numerous selective and adaptive culture processes, in addition to genetic instability, that may improve phenotypic change in cell growth, virus susceptibility, gene expression, and production of virus. Similar detrimental effects of long term passaging of insect cells have also been reported for continuous cell lines, for example, Tn5B 1-4 cells, which are the most widely used for the baculovirus expression vector system (BEVS), provide superior production of recombinant proteins,however, this high productivity may be more evident in low passage cells. In this paper, we describe the isolation of a cell clone, Tn5B-40, from low passage Tn5B 1-4 cells. The growth characteristics,productions of virus, and high level of recombinant protein productions were determined. The results showed the susceptibility of both clone and Tn5B 1-4 cells to wild-type AcNPV was approximately the same rate with over 95% of infection; when the cloned cells were infected with recombinant baculoviruses expressing β-galactosidase and secreted alkaline phosphatase (SEAP), expression of the recombinant proteins from the cloned cells exceeded that from the parental Tn5B 1-4 cells.

Characterization of monoclonal antibodies that specifically recognize the palm subdomain of hepatitis C virus nonstructural protein 5B polymerase.

Science.gov (United States)

Ingravallo, P; Lahser, F; Xia, E; Sodowich, B; Lai, V C; Hong, Z; Zhong, W

2001-06-01

The nonstructural protein 5B (NS5B) of hepatitis C virus (HCV) is an RNA-dependent RNA polymerase (RdRp) which plays an essential role in viral RNA replication. Antibodies that specifically recognize NS5B will have utilities in monitoring NS5B production and subcellular localization, as well as in structure-function studies. In this report, three mouse monoclonal antibodies (mAbs), 16A9C9, 16D9A4 and 20A12C7, against a recombinant NS5B protein (genotype 1a, H-77 strain) were produced. These mAbs specifically recognize HCV NS5B, but not RdRps of polivirus (PV), bovine viral diarrhea virus (BVDV) or GB virus B (GBV-B). The mAbs can readily detect NS5B in cellular lysates of human osteosarcoma Saos2 cells constitutively expressing the nonstructural region of HCV (NS3-NS4A-NS4B-NS5A-NS5B). NS5B proteins of different HCV genotypes/subtypes (1a, 1b, 2a, 2c, 5a) showed varied affinity for these mAbs. Interestingly, the epitopes for the mAbs were mapped to the palm subdomain (amino acid 188-370) of the HCV RdRp as determined by immunoblotting analysis of a panel of HCV/GBV-B chimeric NS5B proteins. The binding site was mapped between amino acid 231 and 267 of NS5B for 16A9C9, and between 282 and 372 for 16D9A4 and 20A12C7. Furthermore, these mAbs showed no inhibitory effect on the NS5B polymerase activity in vitro.

Functional Characterization of 5-HT1B Receptor Drugs in Nonhuman Primates Using Simultaneous PET-MR.

Science.gov (United States)

Hansen, Hanne D; Mandeville, Joseph B; Sander, Christin Y; Hooker, Jacob M; Catana, Ciprian; Rosen, Bruce R; Knudsen, Gitte M

2017-11-01

In the present study, we used a simultaneous PET-MR experimental design to investigate the effects of functionally different compounds (agonist, partial agonist, and antagonist) on 5-HT 1B receptor (5-HT 1B R) occupancy and the associated hemodynamic responses. In anesthetized male nonhuman primates ( n = 3), we used positron emission tomography (PET) imaging with the radioligand [ 11 C]AZ10419369 administered as a bolus followed by constant infusion to measure changes in 5-HT 1B R occupancy. Simultaneously, we measured changes in cerebral blood volume (CBV) as a proxy of drug effects on neuronal activity. The 5-HT 1B R partial agonist AZ10419369 elicited a dose-dependent biphasic hemodynamic response that was related to the 5-HT 1B R occupancy. The magnitude of the response was spatially overlapping with high cerebral 5-HT 1B R densities. High doses of AZ10419369 exerted an extracranial tissue vasoconstriction that was comparable to the less blood-brain barrier-permeable 5-HT 1B R agonist sumatriptan. By contrast, injection of the antagonist GR127935 did not elicit significant hemodynamic responses, even at a 5-HT 1B R cerebral occupancy similar to the one obtained with a high dose of AZ10419369. Given the knowledge we have of the 5-HT 1B R and its function and distribution in the brain, the hemodynamic response informs us about the functionality of the given drug: changes in CBV are only produced when the receptor is stimulated by the partial agonist AZ10419369 and not by the antagonist GR127935, consistent with low basal occupancy by endogenous serotonin. SIGNIFICANCE STATEMENT We here show that combined simultaneous positron emission tomography and magnetic resonance imaging uniquely enables the assessment of CNS active compounds. We conducted a series of pharmacological interventions to interrogate 5-HT 1B receptor binding and function and determined blood-brain barrier passage of drugs and demonstrate target involvement. Importantly, we show how the spatial

Synthesis, properties, crystal structures, and semiconductor characteristics of naphtho[1,2-b:5,6-b']dithiophene and -diselenophene derivatives.

Science.gov (United States)

Shinamura, Shoji; Miyazaki, Eigo; Takimiya, Kazuo

2010-02-19

In this paper we present the synthesis, structures, characterization, and applications to field-effect transistors (FETs) of naphtho[1,2-b:5,6-b']dithiophene (NDT) and -diselenophene (NDS) derivatives. Treatment of 1,5-dichloro-2,6-diethynylnaphthalenes, easily derived from commercially available 2,6-dihydroxynaphthalene, with sodium chalcogenide afforded a straightforward access to NDTs and NDSs including the parent and dioctyl and diphenyl derivatives. Physicochemical evaluations of NDT and NDS derivatives showed that these heteroarenes have a similar electronic structure with isomeric [1]benzothieno[2,3-b][1]benzothiophene (BTBT) and [1]benzoselenopheneno[2,3-b][1]benzoselenophene (BSBS) derivatives, respectively. Although attempts to fabricate solution-processed field-effect transistors (FETs) with soluble dioctyl-NDT (C(8)-NDT) and -NDS (C(8)-NDS) failed, diphenyl derivatives (DPh-NDT and DPh-NDS) afforded vapor-processed FETs showing field-effect mobility as high as 0.7 cm(2) V(-1) s(-1). These results indicated that NDT and NDS are new potential heteroarene core structures for organic semiconducting materials.

Thermal and electrical properties of 60V2O5–5P2O5–(35− x) B2O3 ...

Indian Academy of Sciences (India)

The samples of composition 60V2O5–5P2O5–(35−)B2O3–CeO2, = 1, 2, 3, 4 and 5 mol% were prepared by the melt-quench method. The prepared samples were characterized by X-ray diffraction, thermogravimetric-differential thermal analysis and impedance spectroscopy. The activation energies were evaluated ...

Naphtho[1,2-b:5,6-b']dithiophene-Based Conjugated Polymers for Fullerene-Free Inverted Polymer Solar Cells.

Science.gov (United States)

Jiang, Zhaoyan; Li, Huan; Wang, Zhen; Zhang, Jianqi; Zhang, Yajie; Lu, Kun; Wei, Zhixiang

2018-03-23

Three novel copolymers based on zigzag naphthodithiophene (zNDT) with different aromatic rings as π bridges and different core side substitutions are designed and synthesized (PzNDT-T-1,3-bis(4-(2-ethylhexyl)-thiophen-2-yl)-5,7-bis(2-ethylhexyl)benzo[1,2-c:4,5-c']-dithiophene-4,8-dione (BDD), PzNDT-TT-BDD, and PzNDTP-T-BDD, respectively). The 2D conjugation structure and molecular planarity of the polymers can be effectively altered through the modification of conjugated side chains and π-bridges. These alterations contribute to the variation in energy levels, light absorption capacity, and morphology compatibility of the polymers. When blended with the nonfullerene acceptor (2,2'-[(4,4,9,9-tetrahexyl-4,9-dihydro-sindaceno[1,2-b:5,6-b']dithiophene-2,7-diyl)bis[methylidyne(3-oxo-1H-indene-2,1(3H)-diylidene)

Escenario posible del desempeño profesoral en la enseñanza en una institución de formación docente

Directory of Open Access Journals (Sweden)

Laura Hidalgo M.

2007-01-01

Full Text Available Este artículo tiene como propósito central concebir el escenario posible del desempeño profesoral en la enseñanza en una institución de formación docente. Se toman como referentes las opiniones emitidas por los sujetos informantes de una investigación relacionada con el desempeño profesoral en los ámbitos de enseñanza e investigación que en la actualidad se realiza en el Instituto Pedagógico de Caracas, núcleo de la Universidad Pedagógica Experimental Libertador (UPEL, específicamente, en el Departamento de Pedagogía. Las aseveraciones emitidas por los informantes han permitido abordar los siguientes aspectos: (a ¿cuál es la formación que demanda el profesorado del Departamento de Pedagogía?; (b ¿cómo debería efectuarse el proceso de supervisión y orientación que solicitan los integrantes de este departamento?; (c para lograr la vinculación de las funciones básicas de docencia e investigación ¿cuál debe ser la formación y el incentivo que debe tener el profesorado del departamento de pedagogía en la promoción como investigador?; (d ¿cómo debe ser concebido el proceso de evaluación de manera que contribuya al mejoramiento del desempeño profesoral? y (e en atención a las interrogantes anteriores, ¿cuáles podrían ser las condiciones deseables que deben prevalecer para el desempeño profesoral en la enseñanza?

Educação superior no PNE (2014-2024: apontamentos sobre as relações público-privadas

Directory of Open Access Journals (Sweden)

LALO WATANABE MINTO

2018-01-01

Full Text Available Este artículo aborda algunos aspectos relevantes para una comprensión del Plan Nacional de Educación, en aquello que se refiere a los conflictos entre los sectores público y privado en la enseñanza superior. El procedimiento de análisis lleva en cuenta el texto final de la ley en foco y de su anexo. El público y el privado no son considerados como esferas autónomas y predeterminadas, sino examinadas a la luz de los conflictos sociales, políticos y económicos, que, en el ámbito de la enseñanza superior, expresan disputas en torno a posiciones de clase y visiones de mundo antagónicas. En ese sentido, se señaló que, a pesar de las formas de resistencia y movilizaciones posibles durante las conferencias municipales, estatales y nacionales, en el contexto del nuevo Plan Nacional de Educación se fortalecen a los intereses privados en la enseñanza superior, en conformidad con las tendencias consolidadas sobre todo en las últimas dos décadas.

Association of ARID5B gene variants with acute lymphoblastic leukemia in Yemeni children.

Science.gov (United States)

Al-Absi, Boshra; Noor, Suzita M; Saif-Ali, Riyadh; Salem, Sameer D; Ahmed, Radwan H; Razif, Muhammad Fm; Muniandy, Sekaran

2017-04-01

Studies have shown an association between ARID5B gene polymorphisms and childhood acute lymphoblastic leukemia. However, the association between ARID5B variants and acute lymphoblastic leukemia among the Arab population still needs to be studied. The aim of this study was to investigate the association between ARID5B variants with acute lymphoblastic leukemia in Yemeni children. A total of 14 ARID5B gene single nucleotide polymorphisms (SNPs) were genotyped in 289 Yemeni children, of whom 136 had acute lymphoblastic leukemia and 153 were controls, using the nanofluidic Dynamic Array (Fluidigm 192.24 Dynamic Array). Using logistic regression adjusted for age and gender, the risks of acute lymphoblastic leukemia were presented as odds ratios and 95% confidence intervals. We found that nine SNPs were associated with acute lymphoblastic leukemia under additive genetic models: rs7073837, rs10740055, rs7089424, rs10821936, rs4506592, rs10994982, rs7896246, rs10821938, and rs7923074. Furthermore, the recessive models revealed that six SNPs were risk factors for acute lymphoblastic leukemia: rs10740055, rs7089424, rs10994982, rs7896246, rs10821938, and rs7923074. The gender-specific impact of these SNPs under the recessive genetic model revealed that SNPs rs10740055, rs10994982, and rs6479779 in females, and rs10821938 and rs7923074 in males were significantly associated with acute lymphoblastic leukemia risk. Under the dominant model, SNPs rs7073837, rs10821936, rs7896246, and rs6479778 in males only showed striking association with acute lymphoblastic leukemia. The additive model revealed that SNPs with significant association with acute lymphoblastic leukemia were rs10821936 (both males and females); rs7073837, rs10740055, rs10994982, and rs4948487 (females only); and rs7089424, rs7896246, rs10821938, and rs7923074 (males only). In addition, the ARID5B haplotype block (CGAACACAA) showed a higher risk for acute lymphoblastic leukemia. The haplotype (CCCGACTGC) was

Down-regulation of 5-HT1B and 5-HT1D receptors inhibits proliferation, clonogenicity and invasion of human pancreatic cancer cells.

Directory of Open Access Journals (Sweden)

Nilgun Gurbuz

Full Text Available Pancreatic ductal adenocarcinoma is characterized by extensive local tumor invasion, metastasis and early systemic dissemination. The vast majority of pancreatic cancer (PaCa patients already have metastatic complications at the time of diagnosis, and the death rate of this lethal type of cancer has increased over the past decades. Thus, efforts at identifying novel molecularly targeted therapies are priorities. Recent studies have suggested that serotonin (5-HT contributes to the tumor growth in a variety of cancers including prostate, colon, bladder and liver cancer. However, there is lack of evidence about the impact of 5-HT receptors on promoting pancreatic cancer. Having considered the role of 5-HT-1 receptors, especially 5-HT1B and 5-HT1D subtypes in different types of malignancies, the aim of this study was to investigate the role of 5-HT1B and 5-HT1D receptors in PaCa growth and progression and analyze their potential as cytotoxic targets. We found that knockdown of 5-HT1B and 5-HT1D receptors expression, using specific small interfering RNA (siRNA, induced significant inhibition of proliferation and clonogenicity of PaCa cells. Also, it significantly suppressed PaCa cells invasion and reduced the activity of uPAR/MMP-2 signaling and Integrin/Src/Fak-mediated signaling, as integral tumor cell pathways associated with invasion, migration, adhesion, and proliferation. Moreover, targeting 5-HT1B and 5-HT1D receptors down-regulates zinc finger ZEB1 and Snail proteins, the hallmarks transcription factors regulating epithelial-mesenchymal transition (EMT, concomitantly with up-regulating of claudin-1 and E-Cadherin. In conclusion, our data suggests that 5-HT1B- and 5-HT1D-mediated signaling play an important role in the regulation of the proliferative and invasive phenotype of PaCa. It also highlights the therapeutic potential of targeting of 5-HT1B/1D receptors in the treatment of PaCa, and opens a new avenue for biomarkers identification

Down-regulation of 5-HT1B and 5-HT1D receptors inhibits proliferation, clonogenicity and invasion of human pancreatic cancer cells.

Directory of Open Access Journals (Sweden)

Nilgun Gurbuz

Full Text Available Pancreatic ductal adenocarcinoma is characterized by extensive local tumor invasion, metastasis and early systemic dissemination. The vast majority of pancreatic cancer (PaCa patients already have metastatic complications at the time of diagnosis, and the death rate of this lethal type of cancer has increased over the past decades. Thus, efforts at identifying novel molecularly targeted therapies are priorities. Recent studies have suggested that serotonin (5-HT contributes to the tumor growth in a variety of cancers including prostate, colon, bladder and liver cancer. However, there is lack of evidence about the impact of 5-HT receptors on promoting pancreatic cancer. Having considered the role of 5-HT-1 receptors, especially 5-HT1B and 5-HT1D subtypes in different types of malignancies, the aim of this study was to investigate the role of 5-HT1B and 5-HT1D receptors in PaCa growth and progression and analyze their potential as cytotoxic targets. We found that knockdown of 5-HT1B and 5-HT1D receptors expression, using specific small interfering RNA (siRNA, induced significant inhibition of proliferation and clonogenicity of PaCa cells. Also, it significantly suppressed PaCa cells invasion and reduced the activity of uPAR/MMP-2 signaling and Integrin/Src/Fak-mediated signaling, as integral tumor cell pathways associated with invasion, migration, adhesion, and proliferation. Moreover, targeting 5-HT1B and 5-HT1D receptors down-regulates zinc finger ZEB1 and Snail proteins, the hallmarks transcription factors regulating epithelial-mesenchymal transition (EMT, concomitantly with up-regulating of claudin-1 and E-Cadherin. In conclusion, our data suggests that 5-HT1B- and 5-HT1D- mediated signaling play an important role in the regulation of the proliferative and invasive phenotype of PaCa. It also highlights the therapeutic potential of targeting of 5-HT1B/1D receptors in the treatment of PaCa, and opens a new avenue for biomarkers identification

N-acetyltransferase-dependent activation of 2-hydroxyamino-1-methyl-6-phenylimidazo[4,5-b]pyridine: formation of 2-amino-1-methyl-6-(5-hydroxy)phenylimidazo [4,5-b]pyridine, a possible biomarker for the reactive dose of 2-amino-1-methyl-6-phenylimidazo[4,5-b]pyridine

DEFF Research Database (Denmark)

Frandsen, Henrik Lauritz; Alexander, J.

2000-01-01

2-Amino-1-methyl-6-phenylimidazo[4,5-b]pyridine (PhIP) is a mutagenic and carcinogenic heterocyclic amine formed during ordinary cooking. PhIP is metabolically activated to the ultimate mutagenic metabolite by CYP P450-mediated N-hydroxylation followed by phase II esterification, Incubation of N...

Impact of Haemophilus influenzae type b conjugate vaccine on bacterial meningitis in the Dominican Republic Impacto de la vacuna conjugada contra Haemophilus influenzae tipo b sobre la meningitis bacteriana en la República Dominicana

Directory of Open Access Journals (Sweden)

Ellen H. Lee

2008-09-01

Full Text Available OBJECTIVES: Widespread use of Haemophilus influenzae type b (Hib vaccines has dramatically reduced the burden of Hib disease throughout the Americas. Few studies have evaluated the impact of Hib vaccination on non-culture-confirmed disease. This study analyzed trends in probable bacterial meningitis before and after the introduction of Hib vaccine in the Dominican Republic and estimated vaccine effectiveness against Hib meningitis. METHODS: Meningitis cases among children OBJETIVOS: El uso generalizado de la vacuna contra Haemophilus influenzae tipo b (Hib ha permitido reducir radicalmente la carga de enfermedad por Hib en las Américas. Pocos estudios han evaluado el impacto de la vacunación contra Hib sobre los casos no confirmados mediante cultivo. En este estudio se analizaron las tendencias en el número de casos probables de meningitis bacteriana antes y después de la introducción de la vacuna contra Hib en la República Dominicana y se estimó la eficacia de la vacuna contra la meningitis. MÉTODOS: Se identificaron los casos de meningitis en niños menores de 5 años a partir de los registros de ingreso del principal hospital pediátrico de Santo Domingo entre 1998 y 2004. Los casos de meningitis con probable etiología bacteriana se clasificaron según criterios de laboratorio; los casos confirmados contaban con cultivo bacteriano positivo o detección de antígenos específicos en el líquido cefalorraquídeo. Se calcularon las tasas de incidencia acumulada de casos confirmados y probables de meningitis en los niños que vivían en el Distrito Nacional. Los casos confirmados de meningitis por Hib se incorporaron a un estudio de casos y controles -pareados según la edad y el barrio de residencia- para calcular la eficacia de la vacuna. RESULTADOS: Antes de la introducción de la vacuna, la tasa anual de meningitis de posible etiología bacteriana era de 49 casos por 100 000 niños menores de 5 años; de los casos confirmados de

Increased numbers of CD5+ B lymphocytes with a regulatory phenotype in spondylarthritis

NARCIS (Netherlands)

Cantaert, Tineke; Doorenspleet, Marieke E.; Francosalinas, Gabriela; Paramarta, Jaqueline E.; Klarenbeek, Paul L.; Tiersma, Yvonne; van der Loos, Chris M.; de Vries, Niek; Tak, Paul Peter; Baeten, Dominique L.

2012-01-01

Objective Whether and how B lymphocytes contribute to the pathogenesis of spondylarthritis (SpA), a seronegative arthritis associated with gut inflammation, remains unknown. Because innate-like CD5+ B lymphocytes with regulatory functions have been identified in colitis models, we undertook the

Overexpressed KDM5B is associated with the progression of glioma and promotes glioma cell growth via downregulating p21

Energy Technology Data Exchange (ETDEWEB)

Dai, Bin [Department of Neurosurgery, Beijing Shijitan Hospital, Capital Medical University, Beijing 100038 (China); Hu, Zhiqiang, E-mail: zhiqhutg@126.com [Department of Neurosurgery, Beijing Shijitan Hospital, Capital Medical University, Beijing 100038 (China); Huang, Hui; Zhu, Guangtong; Xiao, Zhiyong [Department of Neurosurgery, Beijing Shijitan Hospital, Capital Medical University, Beijing 100038 (China); Wan, Weiqing; Zhang, Peng; Jia, Wang; Zhang, Liwei [Department of Neurosurgery, Beijing Tian Tan Hospital, Capital Medical University, Beijing 100050 (China)

2014-11-07

Highlights: • KDM5B is overexpressed in glioma samples. • KDM5B stimulated proliferation of glioma cells. • Inhibition of p21contributes to KDM5B-induced proliferation. - Abstract: Epigenetic alterations such as aberrant expression of histone-modifying enzymes have been implicated in tumorigenesis. Upregulation of lysine (K)-specific demethylase 5B (KDM5B) has been reported in a variety of malignant tumors. However, the impact of KDM5B in glioma remains unclear. The objective of this study was to investigate the expression and prognostic value of KDM5B in glioma. In clinical glioma samples, we found that KDM5B expression was significantly upregulated in cancer lesions compared with normal brain tissues. Kaplan–Meier analysis showed that patients with glioma and higher KDM5B expression tend to have shorter overall survival time. By silencing or overexpressing KDM5B in glioma cells, we found that KDM5B could promote cell growth both in vitro and in vivo. Moreover, we demonstrated that KDM5B promoted glioma proliferation partly via regulation of the expression of p21. Our study provided evidence that KDM5B functions as a novel tumor oncogene in glioma and may be a potential therapeutic target for glioma management.

Regulation of UGT2B Expression and Activity by miR-216b-5p in Liver Cancer Cell Lines

OpenAIRE

Dluzen, Douglas F.; Sutliff, Aimee K.; Chen, Gang; Watson, Christy J. W.; Ishmael, Faoud T.; Lazarus, Philip

2016-01-01

The UDP-glucuronosyltransferase (UGT) 2B enzymes are important in the detoxification of a variety of endogenous and exogenous compounds, including many hormones, drugs, and carcinogens. Identifying novel mechanisms governing their expression is important in understanding patient-specific response to drugs and cancer risk factors. In silico prediction algorithm programs were used to screen for microRNAs (miRNAs) as potential regulators of UGT2B enzymes, with miR-216b-5p identified as a potenti...

Evidence that cytochrome b{sub 5} acts as a redox donor in CYP17A1 mediated androgen synthesis

Energy Technology Data Exchange (ETDEWEB)

Duggal, Ruchia [Department of Biochemistry, University of Illinois Urbana-Champaign, Urbana, IL (United States); Liu, Yilin [Department of Chemistry, Marquette University, Milwaukee, WI (United States); Gregory, Michael C.; Denisov, Ilia G. [Department of Biochemistry, University of Illinois Urbana-Champaign, Urbana, IL (United States); Kincaid, James R. [Department of Chemistry, Marquette University, Milwaukee, WI (United States); Sligar, Stephen G., E-mail: s-sligar@illinois.edu [Department of Biochemistry, University of Illinois Urbana-Champaign, Urbana, IL (United States); Department of Chemistry, University of Illinois Urbana-Champaign, Urbana, IL (United States)

2016-08-19

Cytochrome P450 17A1 (CYP17A1) is an important drug target for castration resistant prostate cancer. It is a bi-functional enzyme, catalyzing production of glucocorticoid precursors by hydroxylation of pregnene-nucleus, and androgen biosynthesis by a second C−C lyase step, at the expense of glucocorticoid production. Cytochrome b{sub 5} (cyt b{sub 5}) is known to be a key regulator of the androgen synthesis reaction in vivo, by a mechanism that is not well understood. Two hypotheses have been proposed for the mechanism by which cyt b{sub 5} increases androgen biosynthesis. Cyt b{sub 5} could act as an allosteric effector, binding to CYP17A1 and either changing its selective substrate affinity or altering the conformation of the P450 to increase the catalytic rate or decrease unproductive uncoupling channels. Alternatively, cyt b{sub 5} could act as a redox donor for supply of the second electron in the P450 cycle, reducing the oxyferrous complex to form the reactive peroxo-intermediate. To understand the mechanism of lyase enhancement by cyt b{sub 5}, we generated a redox-inactive form of cyt b{sub 5}, in which the heme is replaced with a Manganese-protoporphyrin IX (Mn-b{sub 5}), and investigated enhancement of androgen producing lyase reaction by CYP17A1. Given the critical significance of a stable membrane anchor for all of the proteins involved and the need for controlled stoichiometric ratios, we employed the Nanodisc system for this study. The redox inactive form was observed to have no effect on the lyase reaction, while reactions with the normal heme-iron containing cyt b{sub 5} were enhanced ∼5 fold as compared to reactions in the absence of cyt b{sub 5}. We also performed resonance Raman measurements on ferric CYP17A1 bound to Mn-b{sub 5}. Upon addition of Mn-b{sub 5} to Nanodisc reconstituted CYP17A1, we observed clear evidence for the formation of a b{sub 5}-CYP17A1 complex, as noted by changes in the porphyrin modes and alteration in the proximal

MDMA self-administration fails to alter the behavioral response to 5-HT(1A) and 5-HT(1B) agonists.

Science.gov (United States)

Aronsen, Dane; Schenk, Susan

2016-04-01

Regular use of the street drug, ecstasy, produces a number of cognitive and behavioral deficits. One possible mechanism for these deficits is functional changes in serotonin (5-HT) receptors as a consequence of prolonged 3,4 methylenedioxymethamphetamine (MDMA)-produced 5-HT release. Of particular interest are the 5-HT(1A) and 5-HT(1B) receptor subtypes since they have been implicated in several of the behaviors that have been shown to be impacted in ecstasy users and in animals exposed to MDMA. This study aimed to determine the effect of extensive MDMA self-administration on behavioral responses to the 5-HT(1A) agonist, 8-hydroxy-2-(n-dipropylamino)tetralin (8-OH-DPAT), and the 5-HT(1B/1A) agonist, RU 24969. Male Sprague-Dawley rats self-administered a total of 350 mg/kg MDMA, or vehicle, over 20-58 daily self-administration sessions. Two days after the last self-administration session, the hyperactive response to 8-OH-DPAT (0.03-1.0 mg/kg) or the adipsic response to RU 24969 (0.3-3.0 mg/kg) were assessed. 8-OH-DPAT dose dependently increased horizontal activity, but this response was not altered by MDMA self-administration. The dose-response curve for RU 24969-produced adipsia was also not altered by MDMA self-administration. Cognitive and behavioral deficits produced by repeated exposure to MDMA self-administration are not likely due to alterations in 5-HT(1A) or 5-HT(1B) receptor mechanisms.

Medicamentos como posible factor asociado a la infertilidad masculina

Directory of Open Access Journals (Sweden)

Campos Martínez B.

2015-09-01

Full Text Available Revisión sistemática de las fichas técnicas (apartados 4.6 y 5.3 de los medicamentos más consumidos en España, según el Sistema Nacional de Salud, y revisión bibliográfica a través de PubMed, según un patrón de búsqueda estándar, con respecto a la influencia de éstos sobre la fertilidad masculina. Como resultado a esto nos encontramos con que de 29 principios activos estudiados, 15 no presentan datos referentes a la fertilidad masculina en su ficha técnica, para 18 no se recuperó información al respecto en la búsqueda en PubMed y 9 no disponen de material de información que provenga de ninguna de las dos fuentes de las que utilizamos. En 3 medicamentos los resultados de las dos fuentes coinciden y en 2 encontramos discrepancias. En 13 de los 29 fármacos estudiados se ha encontrado información de efectos adversos sobre la fertilidad masculina en alguna de las 2 fuentes de información revisadas. Se demuestra con esto una falta de información clara, concisa y contrastada.

LOS VIEJOS ANTECEDENTES ANDALUSÍES DE LA INTERTEXTUALIDAD Y SU POSIBLE INFLUENCIA EN EL OCCIDENTE CRISTIANO

Directory of Open Access Journals (Sweden)

Kevin Perromat Agustín

2014-10-01

Full Text Available La literatura arábiga medieval posee la singularidad de haber elaborado una teoría considerable sobre la intertextualidad y los límites de la apropiación e imitación poéticas. En este contexto, los tratadistas árabes consideraron simultánea y paradojicamente el plagio (sariqa como infracción de las normas literarias y como uno más de los recursos literarios legítimos del poeta. Por el momento se desconoce su posible ascendiente en las poéticas medievales del Occidente cristiano, aunque, a la luz de determinadas evidencias, no es descartable una influencia tangencial o implícita. Por este motivo, el estudio de los autores de al-Ándalus, así como de otros territorios fronterizos, reviste un gran interés en tanto escenarios privilegiados de estos intercambios textuales.

Coproantígenos de Fasciola hepatica de posible utilidad en el diagnóstico de la fascioliasis

Directory of Open Access Journals (Sweden)

Ana M. Espino

2000-04-01

Full Text Available En el presente estudio se describen cuáles son los antígenos de Fasciola hepatica que están presentes en las heces de pacientes con fascioliasis crónica y de ratas infectadas experimentalmente con metacercarias de F. hepatica. Mediante el empleo de la técnica de inmunoelectrotransferencia (Western blot con un suero hiperinmune obtenido frente a antígenos de excreción/secreción de adultos de F. hepatica, se pudo demostrar que en las heces de los pacientes se encuentran antígenos de posible interés para el diagnóstico con masas moleculares de 14, 19, 20, 23, 25, 32, 46, 51 y 62 kilodaltons (kDa. Además, se comprobó que algunos de estos péptidos (los de 14, 20, 23 y 51 kDa son reconocidos también por la mayoría de los sueros de pacientes crónicos. Después de purificar por cromatografía de afinidad los antígenos presentes en heces de ratas con 6 a 12 semanas de infección, empleando para ello el anticuerpo monoclonal ES78 acoplado a Sepharosa 4B-CNBr, se identificaron seis polipéptidos de 11, 14, 26, 32, 47 y 51 kDa; otros tres polipéptidos, de 17, 24 y 66 kDa, solo se pudieron identificar en heces de ratas con 10 a 12 semanas de infección. Nuestros resultados sugieren que estos polipéptidos pueden ser antígenos comunes a ambos estadios parasitarios y constituir importantes marcadores de la fascioliasis aguda y crónica, en particular los de 14, 24, 26 y 51 kDa, puesto que reaccionaron con el inmunosuero, los sueros humanos y el anticuerpo monoclonal ES78.

Dm5-HT2B: Pharmacological Characterization of the Fifth Serotonin Receptor Subtype of Drosophila melanogaster.

Science.gov (United States)

Blenau, Wolfgang; Daniel, Stöppler; Balfanz, Sabine; Thamm, Markus; Baumann, Arnd

2017-01-01

Serotonin (5-hydroxytryptamine, 5-HT) is an important regulator of physiological and behavioral processes in both protostomes (e.g., insects) and deuterostomes (e.g., mammals). In insects, serotonin has been found to modulate the heart rate and to control secretory processes, development, circadian rhythms, aggressive behavior, as well as to contribute to learning and memory. Serotonin exerts its activity by binding to and activating specific membrane receptors. The clear majority of these receptors belong to the superfamily of G-protein-coupled receptors. In Drosophila melanogaster , a total of five genes have been identified coding for 5-HT receptors. From this family of proteins, four have been pharmacologically examined in greater detail, so far. While Dm5-HT 1A , Dm5-HT 1B , and Dm5-HT 7 couple to cAMP signaling cascades, the Dm5-HT 2A receptor leads to Ca 2+ signaling in an inositol-1,4,5-trisphosphate-dependent manner. Based on sequence similarity to homologous genes in other insects, a fifth D. melanogaster gene was uncovered coding for a Dm5-HT 2B receptor. Knowledge about this receptor's pharmacological properties is very limited. This is quite surprising because Dm5-HT 2B has been attributed to distinct physiological functions based on genetic interference with its gene expression. Mutations were described reducing the response of the larval heart to 5-HT, and specific knockdown of Dm5-HT 2B mRNA in hemocytes resulted in a higher susceptibility of the flies to bacterial infection. To gain deeper understanding of Dm5-HT 2B 's pharmacology, we evaluated the receptor's response to a series of established 5-HT receptor agonists and antagonists in a functional cell-based assay. Metoclopramide and mianserin were identified as two potent antagonists that may allow pharmacological interference with Dm5-HT 2B signaling in vitro and in vivo .

Communication received from the Russian Federation Concerning Its Policies Regarding the Management of Plutonium; Comunicacion recibida de la Federacion de Rusia en relacion con sus politicas referentes a la gestion del plutonio

Energy Technology Data Exchange (ETDEWEB)

NONE

2007-04-27

The Director General has received a letter dated 9 March 2007 from the Permanent Mission of the Russian Federation to the IAEA in the enclosures of which the Government of Russian Federation, in keeping with its commitment under the Guidelines for the Management of Plutonium (contained in INFCIRC/549 of 16 March 1998 and hereinafter referred to as the 'Guidelines'), and in accordance with Annexes B and C of the Guidelines, has made available annual figures for holdings of civil unirradiated plutonium and the estimated amounts of plutonium contained in spent civil reactor fuel as of 31 December 2006 [Spanish] El Director General ha recibido una carta, de fecha 9 de marzo de 2007, de la Mision Permanente de la Federacion de Rusia ante el OIEA, en cuyos anexos el Gobierno de la Federacion de Rusia, en cumplimiento de su compromiso contraido en virtud de las Directrices para la gestion del plutonio (transcritas en el documento INFCIRC/549 de 16 de marzo de 1998 y en adelante denominadas 'Directrices'), y de conformidad con los Anexos B y C de las Directrices, ha presentado las cifras anuales de sus existencias de plutonio no irradiado de uso civil y las cantidades estimadas de plutonio contenido en el combustible gastado de reactores de uso civil, al 31 de diciembre de 2006.

Communication Received from the United Kingdom of Great Britain and Northern Ireland Concerning its Policies Regarding the Management of Plutonium. Statements on the Management of Plutonium and of High Enriched Uranium; Comunicacion recibida del Reino Unido de Gran Bretana e Irlanda del Norte en relacion con sus politicas referentes a la gestion del plutonio. Declaraciones sobre la gestion del plutonio y del uranio muy enriquecido

Energy Technology Data Exchange (ETDEWEB)

NONE

2011-07-19

The Secretariat has received a note verbale dated 6 June 2011 from the Permanent Mission of the United Kingdom of Great Britain and Northern Ireland to the IAEA in the enclosures of which the Government, in keeping with its commitment under the Guidelines for the Management of Plutonium (contained in INFCIRC/549 of 16 March 1998 and hereinafter referred to as the 'Guidelines') and in accordance with Annexes B and C of the Guidelines, has made available annual figures for its holdings of civil unirradiated plutonium and the estimated amounts of plutonium contained in spent civil reactor fuel as of 31 December 2010 [Spanish] La Secretaria ha recibido una nota verbal, de fecha 6 de junio de 2011, de la Mision Permanente del Reino Unido de Gran Bretana e Irlanda del Norte ante el OIEA, en cuyos anexos el Gobierno, en cumplimiento de su compromiso contraido en virtud de las Directrices para la gestion del plutonio (transcritas en el documento INFCIRC/549 de 22 de junio de 1998 y denominadas en adelante las 'directrices') y de conformidad con los anexos B y C de las directrices, presenta las cifras anuales de sus existencias de plutonio no irradiado de uso civil y las cantidades estimadas de plutonio contenido en el combustible gastado de reactores de uso civil, a 31 de diciembre de 2010.

Communication Received from the United Kingdom of Great Britain and Northern Ireland Concerning its Policies Regarding the Management of Plutonium. Statements on the Management of Plutonium and of High Enriched Uranium; Comunicacion recibida del Reino Unido de Gran Bretana e Irlanda del Norte en relacion con sus politicas referentes a la gestion del plutonio. Declaraciones sobre la gestion del plutonio y del uranio muy enriquecido

Energy Technology Data Exchange (ETDEWEB)

NONE

2010-09-13

The Secretariat has received a note verbale dated 28 July 2010 from the Permanent Mission of the United Kingdom of Great Britain and Northern Ireland to the IAEA in the enclosures of which the Government, in keeping with its commitment under the Guidelines for the Management of Plutonium (contained in INFCIRC/549 of 16 March 1998 and hereinafter referred to as the 'Guidelines'), and in accordance with Annexes B and C of the Guidelines, has made available annual figures for its holdings of civil unirradiated plutonium and the estimated amounts of plutonium contained in spent civil reactor fuel as of 31 December 2009 [Spanish] La Secretaria ha recibido una nota verbal, de fecha 28 de julio de 2010, de la Mision Permanente del Reino Unido de Gran Bretana e Irlanda del Norte ante el OIEA, en cuyos anexos el Gobierno, en cumplimiento de su compromiso contraido en virtud de las Directrices para la gestion del plutonio (transcritas en el documento INFCIRC/549 de 16 de marzo de 1998 y denominadas en adelante las 'directrices') y de conformidad con los anexos B y C de las directrices, presenta las cifras anuales de sus existencias de plutonio no irradiado de uso civil y las cantidades estimadas de plutonio contenido en el combustible gastado de reactores de uso civil, a 31 de diciembre de 2009.

Communication Received from the United Kingdom of Great Britain and Northern Ireland Concerning its Policies Regarding the Management of Plutonium. Statements on the Management of Plutonium and of High Enriched Uranium; Comunicacion recibida del Reino Unido de Gran Bretana e Irlanda del Norte en relacion con sus politicas referentes a la gestion del plutonio. Declaraciones sobre la gestion del plutonio y del uranio muy enriquecido

Energy Technology Data Exchange (ETDEWEB)

NONE

2009-10-30

The Secretariat has received a note verbale dated 26 June 2009 from the Permanent Mission of the United Kingdom of Great Britain and Northern Ireland to the IAEA in the enclosures of which the Government, in keeping with its commitment under the Guidelines for the Management of Plutonium (contained in INFCIRC/549 of 16 March 1998 and hereinafter referred to as the 'Guidelines') and in accordance with Annexes B and C of the Guidelines, has made available annual figures for its holdings of civil unirradiated plutonium and the estimated amounts of plutonium contained in spent civil reactor fuel as of 31 December 2008 [Spanish] La Secretaria ha recibido una nota verbal, de fecha 26 de junio de 2009, de la Mision Permanente del Reino Unido de Gran Bretana e Irlanda del Norte ante el OIEA, en cuyos anexos el Gobierno, en cumplimiento de su compromiso contraido en virtud de las Directrices para la gestion del plutonio (transcritas en el documento INFCIRC/549 de 22 de junio de 1998 y denominadas en adelante las 'directrices') y de conformidad con los anexos B y C de las directrices, presenta las cifras anuales de sus existencias de plutonio no irradiado de uso civil y las cantidades estimadas de plutonio contenido en el combustible gastado de reactores de uso civil, a 31 de diciembre de 2008.

Communication Received from the United States of America Concerning Its Policies Regarding the Management of Plutonium; Comunicacion recibida de los Estados Unidos de America en relacion con sus politicas referentes a la gestion del plutonio

Energy Technology Data Exchange (ETDEWEB)

NONE

2010-05-05

The Secretariat has received a letter dated 24 February 2010 from the Permanent Mission of the United States of America to the IAEA in the enclosures of which the Government of the United States of America, in keeping with its commitment under the Guidelines for the Management of Plutonium (contained in INFCIRC/549 of 16 March 1998 and hereinafter referred to as the 'Guidelines'), and in accordance with Annexes B and C of the Guidelines, has made available annual figures for holdings of civil unirradiated plutonium and the estimated amounts of plutonium contained in spent civil reactor fuel as of 31 December 2008 [Spanish] La Secretaria ha recibido una carta, de fecha 24 de febrero de 2010 de la Mision Permanente de los Estados Unidos de America ante el OIEA, en cuyos anexos el Gobierno de los Estados Unidos de America, en cumplimiento del compromiso contraido en virtud de las Directrices para la gestion del plutonio (transcritas en el documento INFCIRC/549 de 22 de junio de 1998 y denominadas en adelante las 'Directrices'), y de conformidad con los anexos B y C de las Directrices, presenta las cifras anuales de sus existencias de plutonio no irradiado de uso civil y las cantidades estimadas de plutonio contenido en el combustible gastado de reactores de uso civil a 31 de diciembre de 2008.

Quantum mechanically guided design of Co43Fe20Ta5.5X31.5 (X=B, Si, P, S) metallic glasses

International Nuclear Information System (INIS)

Hostert, C; Music, D; Schneider, J M; Bednarcik, J; Keckes, J

2012-01-01

A systematic ab initio molecular dynamics study was carried out to identify valence electron concentration and size induced changes on structure, elastic and magnetic properties for Co 43 Fe 20 Ta 5.5 X 31.5 (X=B, Si, P, S). Short range order, charge transfer and the bonding nature are analyzed by means of density of states, Bader decomposition and pair distribution function analysis. A clear trend of a decrease in density and bulk modulus as well as a weaker cohesion was observed as the valence electron concentration is increased by replacing B with Si and further with P and S. These changes may be understood based on increased interatomic distances, variations in coordination numbers and the electronic structure changes; as the valence electron concentration of X is increased the X bonding becomes more ionic, which disrupts the overall metallic interactions, leading to lower cohesion and stiffness. The highest magnetic moments for the transition metals are identified for X=S, despite the fact that the presence of X generally reduces the magnetic moment of Co. Furthermore, this study reveals an extended diagonal relationship between B and P within these amorphous alloys. Based on quantum mechanical data we identify composition induced changes in short range order, charge transfer and bonding nature and link them to density, elasticity and magnetism. The interplay between transition metal d band filling and s-d hybridization was identified to be a key materials design criterion. (paper)

A recurrent germline PAX5 mutation confers susceptibility to pre-B cell acute lymphoblastic leukemia

NARCIS (Netherlands)

Shah, S.; Schrader, K.A.; Waanders, E.; Timms, A.E.; Vijai, J.; Miething, C.; Wechsler, J.; Yang, J.; Hayes, J.; Klein, R.J.; Zhang, J.; Wei, L.; Wu, G.; Rusch, M.; Nagahawatte, P.; Ma, J; Chen, S.C.; Song, G.; Cheng, J.; Meyers, P.; Bhojwani, D.; Jhanwar, S.; Maslak, P.; Fleisher, M.; Littman, J.; Offit, L.; Rau-Murthy, R.; Fleischut, M.H.; Corines, M.; Murali, R.; Gao, X.; Manschreck, C.; Kitzing, T.; Murty, V.V.; Raimondi, S.C.; Kuiper, R.P.; Simons, A.; Schiffman, J.D.; Onel, K.; Plon, S.E.; Wheeler, D.A.; Ritter, D.; Ziegler, D.S.; Tucker, K.; Sutton, R.; Chenevix-Trench, G.; Li, J.; Huntsman, D.G.; Hansford, S.; Senz, J.; Walsh, T.; Lee (Helen Dowling Instituut), M. van der; Hahn, C.N.; Roberts, K.G.; King, M.C.; Lo, S.M.; Levine, R.L.; Viale, A.; Socci, N.D.; Nathanson, K.L.; Scott, H.S.; Daly, M.; Lipkin, S.M.; Lowe, S.W.; Downing, J.R.; Altshuler, D.; Sandlund, J.T.; Horwitz, M.S.; Mullighan, C.G.; Offit, K.

2013-01-01

Somatic alterations of the lymphoid transcription factor gene PAX5 (also known as BSAP) are a hallmark of B cell precursor acute lymphoblastic leukemia (B-ALL), but inherited mutations of PAX5 have not previously been described. Here we report a new heterozygous germline variant, c.547G>A

miR-339-5p inhibits alcohol-induced brain inflammation through regulating NF-κB pathway

International Nuclear Information System (INIS)

Zhang, Yu; Wei, Guangkuan; Di, Zhiyong; Zhao, Qingjie

2014-01-01

Graphical abstract: - Highlights: • Alcohol upregulates miR-339-5p expression. • miR-339-5p inhibits the NF-kB pathway. • miR-339-5p interacts with and blocks activity of IKK-beat and IKK-epsilon. • miR-339-5p modulates IL-1β, IL-6 and TNF-α. - Abstract: Alcohol-induced neuroinflammation is mediated by the innate immunesystem. Pro-inflammatory responses to alcohol are modulated by miRNAs. The miRNA miR-339-5p has previously been found to be upregulated in alcohol-induced neuroinflammation. However, little has been elucidated on the regulatory functions of this miRNA in alcohol-induced neuroinflammation. We investigated the function of miR-339-5p in alcohol exposed brain tissue and isolated microglial cells using ex vivo and in vitro techniques. Our results show that alcohol induces transcription of miR 339-5p, IL-6, IL-1β and TNF-α in mouse brain tissue and isolated microglial cells by activating NF-κB. Alcohol activation of NF-κB allows for nuclear translocation of the NF-κB subunit p65 and expression of pro-inflammatory mediators. miR-339-5p inhibited expression of these pro-inflammatory factors through the NF-κB pathway by abolishing IKK-β and IKK-ε activity

miR-339-5p inhibits alcohol-induced brain inflammation through regulating NF-κB pathway

Energy Technology Data Exchange (ETDEWEB)

Zhang, Yu [Department of Neurology, The First Affiliated School of Harbin Medical University, Harbin 150001 (China); Wei, Guangkuan [Department of Neurology, Heilongjiang Provincial Hospital, Harbin 150036 (China); Di, Zhiyong [Department of Laboratory, Heilongjiang Provincial Hospital, Harbin 150036 (China); Zhao, Qingjie, E-mail: zhaoqingjie2013@163.com [Department of Neurology, The First Affiliated School of Harbin Medical University, Harbin 150001 (China)

2014-09-26

Graphical abstract: - Highlights: • Alcohol upregulates miR-339-5p expression. • miR-339-5p inhibits the NF-kB pathway. • miR-339-5p interacts with and blocks activity of IKK-beat and IKK-epsilon. • miR-339-5p modulates IL-1β, IL-6 and TNF-α. - Abstract: Alcohol-induced neuroinflammation is mediated by the innate immunesystem. Pro-inflammatory responses to alcohol are modulated by miRNAs. The miRNA miR-339-5p has previously been found to be upregulated in alcohol-induced neuroinflammation. However, little has been elucidated on the regulatory functions of this miRNA in alcohol-induced neuroinflammation. We investigated the function of miR-339-5p in alcohol exposed brain tissue and isolated microglial cells using ex vivo and in vitro techniques. Our results show that alcohol induces transcription of miR 339-5p, IL-6, IL-1β and TNF-α in mouse brain tissue and isolated microglial cells by activating NF-κB. Alcohol activation of NF-κB allows for nuclear translocation of the NF-κB subunit p65 and expression of pro-inflammatory mediators. miR-339-5p inhibited expression of these pro-inflammatory factors through the NF-κB pathway by abolishing IKK-β and IKK-ε activity.

5-fluorocitosina e anfotericina-B no tratamento da criptococose do sistema nervoso central Amphotericin-B and 5-fluorocytosine in the treatment of cryptococcosis of the central nervous system: report of two cases

Directory of Open Access Journals (Sweden)

J. P. S. Nobrega

1975-09-01

Full Text Available Registro de dois casos de criptococose do sistema nervoso central, em um deles associada a candidíase. Em ambos foram utilizados no tratamento anfotericina-B e 5-fluorocitosina. Em função dos resultados obtidos são feitas considerações quanto à utilidade de cada uma das drogas no tratamento da criptococose, bem como quanto ao uso associado de ambas.Two cases of cryptococcosis of the central nervous system are reported. The treatment was based on the association of amphotericin-B with 5-fluorocytosine. Details on the therapeutic proprieties of these drugs are discussed considering the results obtained. Amphotericin-B was administered intravenously and intrathecally in the two cases. The total amount of amphotericin administered intravenously in the first case was 5.375 mgm, and the oral doses of 5-fluorocytosine were not superior to 100 mgm/kg/of body weight. This patient died 130 days after the first symptoms of the disease. The second patient had been submitted previously to kidney transplantation after bilateral nephrectomy, and inmunossupressive drugs were administered to him since then. Candidiasis and cryptococcosis of the central nervous system developped two years later. 5-fluorocytosine was administered orally (200 mgm/kg of body weight and amphotericin-B. The total amount of this drug administered intravenously was 2.00 mgm. There was complete clinical and laboratory remission of the mycoses in this case.

Clinical significance of miR-140-5p and miR-193b expression in patients with breast cancer and relationship to IGFBP5

Directory of Open Access Journals (Sweden)

Gökçe Güllü

2015-03-01

Full Text Available The functional role of IGFBP5 in breast cancer is complicated. Experimental and bioinformatics studies have shown that IGFBP5 is targeted by miR-140-5p and miR-193b, although this has not yet been proven in clinical samples. The aim of this study was to evaluate the expression of miR-140-5p and miR-193b in breast cancer and adjacent normal tissue and assess its correlation with IGFBP5 and the clinicopathological characteristics of the tumors. IGFBP5 protein expression was analyzed immunohistochemically and IGFBP5, miR-140 and miR-193b mRNA expression levels were analyzed with real-time RT-PCR. Tumor tissue had higher miR-140-5p expression than adjacent normal tissue (p = 0.015. Samples with no immunohistochemical staining for IGFBP5 showed increased miR-140-5p expression (p = 0.009. miR-140-5p expression was elevated in invasive ductal carcinomas (p = 0.002, whereas basal-like tumors had decreased expression of miR-140-5p compared to other tumors (p = 0.008. Lymph node-positive samples showed an approximately 13-fold increase in miR-140-5p expression compared to lymph node-negative tissue (p = 0.049. These findings suggest that miR-140-5p, but not miR-193b, could be an important determinant of IGFBP5 expression and clinical phenotype in breast cancer patients. Further studies are needed to clarify the expressional regulation of IGFBP5 by miR-140-5p.

Cyclisation versus 1,1-Carboboration: Reactions of B(C6F5)3 with Propargyl Amides.

Science.gov (United States)

Melen, Rebecca L; Hansmann, Max M; Lough, Alan J; Hashmi, A Stephen K; Stephan, Douglas W

2013-09-02

A series of propargyl amides were prepared and their reactions with the Lewis acidic compound B(C6F5)3 were investigated. These reactions were shown to afford novel heterocycles under mild conditions. The reaction of a variety of N-substituted propargyl amides with B(C6F5)3 led to an intramolecular oxo-boration cyclisation reaction, which afforded the 5-alkylidene-4,5-dihydrooxazolium borate species. Secondary propargyl amides gave oxazoles in B(C6F5)3 mediated (catalytic) cyclisation reactions. In the special case of disubstitution adjacent to the nitrogen atom, 1,1-carboboration is favoured as a result of the increased steric hindrance (1,3-allylic strain) in the 5-alkylidene-4,5-dihydrooxazolium borate species. Copyright © 2013 WILEY‐VCH Verlag GmbH & Co. KGaA, Weinheim.

2-Amino-1-methyl-6-(5-hydroxy-)phenylimidazo[4,5-b]pyridine (5-OH-PhIP), a biomarker for the genotoxic dose of the heterocyclic amine, 2-amino-1-methyl-6-phenylimidazo[4,5-b]pyridine (PhIP)

DEFF Research Database (Denmark)

Frandsen, H; Frederiksen, H; Alexander, J

2002-01-01

2-Amino-1-methyl-6-phenylimidazo[4,5-b]pyridine (PhIP) is a mutagenic and carcinogenic heterocyclic amine formed during ordinary cooking. PhIP is metabolically activated by CYP P450 mediated N-hydroxylation followed by phase II esterification. The ultimate mutagenic metabolite reacts with DNA...

5-(sulfonyl)oxy-tryptamines and ethylamino side chain restricted derivatives. Structure-affinity relationships for h5-HT1B and h5-HT1D receptors

NARCIS (Netherlands)

Barf, T; Wikstrom, H; Pauwels, PJ; Palmier, C; Tardif, S; Lundmark, M; Sundell, S

A number of sulfonic acid ester derivatives of serotonin (5-hydroxytryptamine; 5-HT; 1) were prepared and their affinities are compared to that of the reference compound 5-[[(trifluoromethyl)sulfonyl]oxy]-tryptamine (8b). The structure-affinity relationship (SAFIR) is discussed in terms of in vitro

Magnetic and structural properties of ferromagnetic Fe{sub 5}PB{sub 2} and Fe{sub 5}SiB{sub 2} and effects of Co and Mn substitutions

Energy Technology Data Exchange (ETDEWEB)

McGuire, Michael A., E-mail: McGuireMA@ornl.gov; Parker, David S. [Oak Ridge National Laboratory, Oak Ridge, Tennessee 37831 (United States)

2015-10-28

Crystallographic and magnetic properties of Fe{sub 5}PB{sub 2}, Fe{sub 4}CoPB{sub 2}, Fe{sub 4}MnPB{sub 2}, Fe{sub 5}SiB{sub 2}, Fe{sub 4}CoSiB{sub 2}, and Fe{sub 4}MnSiB{sub 2} are reported. All adopt the tetragonal Cr{sub 5}B{sub 3} structure-type and are ferromagnetic at room temperature with easy axis of magnetization along the c-axis. The spin reorientation in Fe{sub 5}SiB{sub 2} is observed as an anomaly in the magnetization near 170 K and is suppressed by substitution of Co or Mn for Fe. The silicides are found to generally have larger magnetic moments than the phosphides, but the data suggest smaller magnetic anisotropy in the silicides. Cobalt substitution reduces the Curie temperatures by more than 100 K and ordered magnetic moments by 16%–20%, while manganese substitution has a much smaller effect. This suggests Mn moments align ferromagnetically with the Fe and that Co does not have an ordered moment in these structures. Anisotropic thermal expansion is observed in Fe{sub 5}PB{sub 2} and Fe{sub 5}SiB{sub 2}, with negative thermal expansion seen along the c-axis of Fe{sub 5}SiB{sub 2}. First principles calculations of the magnetic properties of Fe{sub 5}SiB{sub 2} and Fe{sub 4}MnSiB{sub 2} are reported. The results, including the magnetic moment and anisotropy, are in good agreement with experiment.

Posible participación del sistema complemento en el desarrollo de manifestaciones autoinmunes en la leucemia linfocítica crónica Possible role of the complement system in the development of autoimmune manifestations in chronic lymphocytic leukemias

Directory of Open Access Journals (Sweden)

Rinaldo Villaescusa Blanco

2002-04-01

Full Text Available Se efectuó la medición de la actividad de la vía clásica, alternativa, factor B, factor D, así como la cuantificación de C1q, C3 y C4 del sistema complemento en 27 pacientes con leucemia linfocítica crónica de tipo B (LLC-B CD5+ estadificados en 2 grupos: 12 pacientes en fase poco avanzada de la enfermedad (estadios 0, I, II y 15 en fase avanzada (estadios III, IV. Se demostró una disminución de la actividad de la vía clásica y de la concentración de C1q y C4 en 10 pacientes en fase avanzada, 7 de los cuales tenían asociada una anemia hemolítica autoinmune (AHAI; en el grupo en fase poco avanzada de la enfermedad no se demostraron deficiencias de complemento ni manifestaciones autoinmunes. Los datos obtenidos sugieren la posible participación del sistema complemento en el mantenimiento de la tolerancia inmunológica, cuya ruptura pudiera provocar la síntesis de anticuerpos antieritrocitarios, y por lo tanto, la anemia hemolítica que se asocia en determinados pacientes en fase avanzada de la enfermedadThe measurement of the activity of the classical pathway, the alternative pathway, factor B, factor D, as well as the quantification of Clq, C3 and C4 of the complement system were made in 27 patients with type B chronic lymphocytic leukemia (CLL-B CD5+, classified into 2 groups: 12 patients at little advanced stage of the disease (stages 0, I, II and 15 patients at advanced stage (stages III, IV. It was proved that the activity of the classical pathway and the concentration of Clq and C4 lowered in 10 patients at advanced stage, 7 of them also had autoimmune hemolytic anemia. Neither complement deficiencies nor autoimmune manifestations were shown in the group of patients at little advanced stage of the disease. Collected data indicates the possible involvement of the complement system in keeping the immune tolerance, the rupture of which may cause the synthesis of anti-erythrocyte antibodies and thus, the hemolytic anemia that

Core y sistema de control neuro-motor: mecanismos básicos para la estabilidad del raquis lumbar

Directory of Open Access Journals (Sweden)

Víctor SEGARRA

2014-09-01

Full Text Available El "CORE" es un concepto funcional que engloba la integración de tres sistemas cuyo óptimo funcionamiento garantiza la realización de tareas con una mayor eficacia y seguridad a nivel raquídeo, permitiendo adecuados niveles de estabilidad y control del movimiento. En este sentido, a fin de afrontar con éxito retos que demanden un control dinámico de la columna y la pelvis, el SNC debe aplicar estrategias diferentes, sopesando as fuerzas internas y externas con el fin de proporcionar una respuesta muscular que permita un movimiento óptimo y resista cualquier posible perturbación. En el presente manuscrito se revisa de forma aplicada, las bases, atendiendo a la información disponible actualmente, de los mecanismos básicos de control motor y las posibles alteraciones en los mismos a ser considerados por los especialistas en ejercicio respecto a su intervención mediante programas de ejercicio para la mejora de la capacidad de estabilización raquídea.

HPLC analysis of water-soluble vitamins (B1, B2, B3, B5, B6) in in ...

African Journals Online (AJOL)

... B6 (pyridoxine HCl) were higher in in vitro germinated seedlings. Thus, vitamin production was age and culture conditions dependent, which is discussed in detail. The study revealed that the germinated chickpea grains can be used for human consumption with value addition of vitamin B-group in the diet of vegetarians.

Assessment of BETHSY Test 9.1.b using RELAP5/MOD3

International Nuclear Information System (INIS)

Lee, S.; Chung, B.D.; Kim, H.J.

1993-06-01

The 2'' cold leg break test 9.l.b, conducted at the BETHSY facility was analyzed using the RELAP5/MOD3 Version 5m5 code. The test 9.l.b was conducted with the main objective being the investigation of the thermal-hydraulic mechanisms responsible for the large core uncovery and fuel heat-up, requiring the implementation of an ultimate procedure. The present analysis demonstrates the code's capability to predict, with sufficient accuracy, the main phenomena occurring in the depressurization transient, both from a qualitative and quantitative point of view. Nevertheless, several differences regarding the evolution of phenomena and affecting the timing order have to be pointed out in the base calculation. Three calculations were carried out to study the sensitivity to change of the nodalization in the components of the loop seal cross-over legs, and of the auxiliary feedwater control logics, and of the break discharge coefficient

¿ Es posible la Intervención Dietética dentro del tratamiento del Síndrome de Ovario Poliquístico?

OpenAIRE

Vicente Ferreras, Sonia

2014-01-01

En este trabajo se ha intentado hacer una puesta al día del Síndrome de Ovario Poliquístico para entender, posteriormente, el abordaje dietético-nutricional que se ha estudiado en las mujeres con esta patología. Para ello, en primer lugar se explica lo que es el Síndrome de Ovario Poliquístico y las posibles causas que podrían producir esta patología. A continuación, se explicará cómo se diagnostica este trastorno por los diferentes criterios que existen. A continuación, se comentará tanto...

Functional diversification of grapevine MYB5a and MYB5b in the control of flavonoid biosynthesis in a petunia anthocyanin regulatory mutant.

Science.gov (United States)

Cavallini, Erika; Zenoni, Sara; Finezzo, Laura; Guzzo, Flavia; Zamboni, Anita; Avesani, Linda; Tornielli, Giovanni Battista

2014-03-01

Flavonoids play a key role in grapevine physiology and also contribute substantially to the quality of berries and wines. VvMYB5a and VvMYB5b are R2R3-MYB transcription factors previously proposed to control the spatiotemporal expression of flavonoid structural genes during berry development. We investigated the functions of these two proteins in detail by heterologous expression in a petunia an2 mutant, which has negligible anthocyanin levels in the petals because it lacks the MYB protein PhAN2. We also expressed VvMYBA1, the grapevine ortholog of petunia PhAN2, in the same genetic background. The anthocyanin profiles induced by expressing these transgenes in the petals revealed that VvMYBA1 is the functional ortholog of PhAN2 and that, unlike VvMYB5a, VvMYB5b can partially complement the an2 mutation. Transcriptomic analysis of petals by microarray hybridization and quantitative PCR confirmed that VvMYB5b up-regulates a subset of anthocyanin structural genes, whereas VvMYB5a has a more limited impact on the expression of genes related to anthocyanin biosynthesis. Furthermore, we identified additional specific and common targets of these two regulators, related to vacuolar acidification and membrane remodeling. Taken together, these data provide insight into the role of VvMYB5a and VvMYB5b in flavonoid biosynthesis and provide evidence for additional regulatory roles in distinct pathways.

Naturally occurring resistance mutations within the core and NS5B regions in hepatitis C genotypes, particularly genotype 5a, in South Africa.

Science.gov (United States)

Prabdial-Sing, N; Blackard, J T; Puren, A J; Mahomed, A; Abuelhassan, W; Mahlangu, J; Vermeulen, M; Bowyer, S M

2016-03-01

Approximately 1 million South Africans are infected with Hepatitis C virus (HCV). The standard of care (SOC) in South Africa is combination therapy (pegylated interferon and ribavirin). HCV genotypes and/or mutations in the core/non-structural regions have been associated with response to therapy and/or disease progression. This study examines mutations in the core (29-280 amino acids, including ∼ 90 E1 amino acids) and NS5B (241-306 amino acids) regions on pre-treatment isolates from patients attending Johannesburg hospitals or asymptomatic South African blood donors. Diversity within known CD4+ and CD8+ T-cell epitopes was also explored. Samples grouped into subtypes 1a(N = 10) 1b(N = 12), 3a(N = 5), 4a(N = 3) and 5a(N = 61). Two mutations, associated with interferon resistance-R70Q and T110N-were present in 29 genotype 5a core sequences. No resistance mutation to NS5B nucleotide inhibitors, sofosbuvir was found. Six putative CD8+ and one CD4+ T-cell epitope sequence in the core region showed binding scores of <300 IC50nM to HLA alleles frequently observed in the South African population. No known CD8+ and CD4+ T-cell epitopes were mapped in the NS5B region. The analysis begs the question whether those infected with genotype 5a will benefit better on interferon-free combination therapies. This study provides new insight into one of the lesser studied HCV genotypes and compares the diversity seen in a large pre-treatment cohort with other subtypes. Copyright © 2015 Elsevier B.V. All rights reserved.

Thermal expansion behaviour in the oxygen deficient perovskites Sr2BSbO5.5 (B=Ca, Sr, Ba). Competing effects of water and oxygen ordering

International Nuclear Information System (INIS)

Zhou Qingdi; Kennedy, Brendan J.; Avdeev, Maxim

2011-01-01

Neutron diffractions studies reveal the presence of oxygen disorder in the oxygen deficient perovskites Sr 2 BSbO 5.5 (B=Ca, Sr, Ba). Synchrotron X-ray studies demonstrate that these oxides have a double perovskite-type structure with the cell size increasing as the size of the B cation increases from 8.2114(2) A for B=Ca to 8.4408(1) A for B=Ba. It is postulated that a combination of local clustering of the anions and vacancies together with water-water and water-host hydrogen bonds plays a role in defining the volume of the encapsulated water clusters and that changes in the local structure upon heating result in anomalous thermal expansion observed in variable temperature diffraction measurements. - Graphical abstract: The oxides Sr 2 BSbO 5.5 (B=Ca, Sr, Ba) have unusual anion disorder. There is a lag in the contraction in the cell size of Sr 2 CaSbO 5.5 nH 2 O established from X-ray diffraction measurements following the loss of water suggesting changes on the local structure are important. Highlights: → The average structures of the defect perovskites Sr 2 MSbO 5.5 established. → Anion and cation disorder quantified by neutron and synchrotron X-ray diffraction. → Anomalous thermal expansion due to local clustering of anions and vacancies observed.

Intracellular and Extracellular Expression of Bacillus thuringiensis Crystal Protein Cry5B in Lactococcus lactis for Use as an Anthelminthic

Science.gov (United States)

Durmaz, Evelyn; Hu, Yan; Aroian, Raffi V.

2015-01-01

The Bacillus thuringiensis crystal (Cry) protein Cry5B (140 kDa) and a truncated version of the protein, tCry5B (79 kDa), are lethal to nematodes. Genes encoding the two proteins were separately cloned into a high-copy-number vector with a strong constitutive promoter (pTRK593) in Lactococcus lactis for potential oral delivery against parasitic nematode infections. Western blots using a Cry5B-specific antibody revealed that constitutively expressed Cry5B and tCry5B were present in both cells and supernatants. To increase production, cry5B was cloned into the high-copy-number plasmid pMSP3535H3, carrying a nisin-inducible promoter. Immunoblotting revealed that 3 h after nisin induction, intracellular Cry5B was strongly induced at 200 ng/ml nisin, without adversely affecting cell viability or cell membrane integrity. Both Cry5B genes were also cloned into plasmid pTRK1061, carrying a promoter and encoding a transcriptional activator that invoke low-level expression of prophage holin and lysin genes in Lactococcus lysogens, resulting in a leaky phenotype. Cry5B and tCry5B were actively expressed in the lysogenic strain L. lactis KP1 and released into cell supernatants without affecting culture growth. Lactate dehydrogenase (LDH) assays indicated that Cry5B, but not LDH, leaked from the bacteria. Lastly, using intracellular lysates from L. lactis cultures expressing both Cry5B and tCry5B, in vivo challenges of Caenorhabditis elegans worms demonstrated that the Cry proteins were biologically active. Taken together, these results indicate that active Cry5B proteins can be expressed intracellularly in and released extracellularly from L. lactis, showing potential for future use as an anthelminthic that could be delivered orally in a food-grade microbe. PMID:26682852

Synthesis of Amino Acid Analogues of 5H-Dibenz[b,f]azepine and Evaluation of their Radical Scavenging Activity

Directory of Open Access Journals (Sweden)

H. Vijay Kumar

2009-01-01

Full Text Available A method for the synthesis of tyrosine, phenyl alanine, hydroxy proline and threonine free amino acid analogues of 5H-dibenz[b,f]azepine is proposed. 5H-dibenz[b,f]azepine was prepared by known method. The key intermediate 3-chloro-1-(5H-dibenz[b,f]azepine-5-ylpropan-1-one was obtained by N-acylation of 5H-dibenz[b,f]azepine with 3-chloro propionyl chloride. Further coupling of respective free amino acid to produce 2-(3-(5H-dibenz[b,f]azepine-5-yl-3-oxopropylamino3-(4 hydroxyphenyl propanoic acid, 2-(3-(5H-dibenz[b,f]azepine-5-yl-3-oxopropylamino-3-phenyl propanoicacid,1-(3-(5H-dibenz[b,f]azepine-5-yl-3-oxopropyl-3-hydroxypyrolidine-2-carboxylic acid and 2-(3-(5H-dibenz[b,f] azepine-yl-3-oxopropyl amino-3-hydroxy butanoic acid. The synthesized compounds were evaluated for their potential over 1,1-diphenyl-2-picryl hydrazyl (DPPH free radical scavenging activity. Butylated hydroxy anisole (BHA and ascorbic acid (AA were used as the reference antioxidant compounds and also the comparative study with synthesized compounds was done. Under our experimental conditions tyrosine, hydroxy proline and threonine analogues possess a direct scavenging effect on trapping the stable free radical DPPH. Hydroxy proline analogues showed a significant radical scavenging activity among the synthesized analogues

Superconducting properties of Zn and Al double-doped Mg1-x(Zn0.5Al0.5)xB2

DEFF Research Database (Denmark)

Xu, G.J.; Grivel, Jean-Claude; Abrahamsen, A.B.

2004-01-01

(XRD), ac susceptibility, magnetization and resistivity. The double doping leads to decreases in both the lattice parameters a and c, and the T-c decreases with increasing dopant content. A systematical comparison with Al doped- and Li, Al double doped MgB2 of structure, superconducting transition......A series of polycrystalline samples of Mg1-x(Zn0.5Al0.5)(x)B-2 (0less than or equal toxless than or equal to0.8) were prepared by solid state reaction method and their structure, superconducting transition temperature (T-c) and transport properties were investigated by means of X-ray diffraction...

Funcionamiento del ascensor social en España y posibles mejoras. Informe SESPAS 2014

Directory of Open Access Journals (Sweden)

Anna García-Altés

2014-06-01

Full Text Available En este artículo nos preocuparemos por el grado en que la situación socioeconómica de un individuo se hereda y cómo puede aumentarse la igualdad de oportunidades para mejorar la movilidad social. La pobreza y la deprivación pueden dejar de ser dinásticas si el ascensor social funciona. En España, la desigualdad de renta, medida por el coeficiente de Gini, ha pasado de 0,31 en 2006 a 0,35 en 2012 (nos alejamos de los países escandinavos y centroeuropeos para asemejarnos más en desigualdades de renta al Reino Unido o Estados Unidos, y el grado de movilidad intergeneracional se sitúa entre el de Italia y el de Estados Unidos. Para cambiar esta situación y hacer que el ascensor social funcione es necesario mejorar la educación primaria y orientar el sistema sanitario hacia la atención primaria, lo cual no será posible sin una mejor calidad de la política y de las instituciones que la están condicionando.

Verificación de la contaminación del maíz por flatoxina B1

Directory of Open Access Journals (Sweden)

Lisa Vallone

2010-10-01

Full Text Available “Aflaflesh” es un instrumento computarizado, diseñado para combinar un metodo de adquisición de datos visuales, con sofisticados sistemas operativosde software y análisis de imágenes. Esto, mediante la exposicion de la fluorescencia de maíz sometido a la radiación UV, ya que si hay contaminación con aflatoxinas B1, es posible transformar directamente el número de pixeles de la fluorescencia, en la concentración de AFB1 correspondiente.

Los EE.UU. y las cláusulas de jurisdicción obligatoria ante la corte internacional de justicia

OpenAIRE

Trillo, José María

2006-01-01

Se trata de un análisis de las modificaciones que se advierten en la posición del los EE.UU. frente a las cláusulas o protocolos de jurisdicción obligatoria, incluidas o anexos a Tratados Internacionales desde la finalización de la Segunda Guerra Mundial hasta la fecha. En particular, el trabajo se centra en la reciente denuncia formulada por el Departamento de Estado, del Protocolo de Jurisdicción Obligatoria anexo a la Convención de Viena sobre ...

NuSTAR DETECTION OF THE BLAZAR B2 1023+25 AT REDSHIFT 5.3

Energy Technology Data Exchange (ETDEWEB)

Sbarrato, T. [Dipartimento di Scienza e Alta Tecnologia, Università dell' Insubria, Via Valleggio 11, I-22100 Como (Italy); Tagliaferri, G.; Ghisellini, G. [INAF-Osservatorio Astronomico di Brera, via E. Bianchi 46, I-23807 Merate (Italy); Perri, M.; Puccetti, S.; Giommi, P. [ASI-Science Data Center, via Galileo Galilei, I-00044 Frascati (Italy); Baloković, M.; Harrison, F. A.; Hovatta, T. [Cahill Center for Astronomy and Astrophysics, California Institute of Technology, Pasadena, CA 91125 (United States); Nardini, M. [Dipartimento di Fisica G. Occhialini, Università di Milano Bicocca, Piazza della Scienza 3, I-20126 Milano (Italy); Stern, D. [Jet Propulsion Laboratory, California Institute of Technology, Pasadena, CA 91109 (United States); Boggs, S. E. [Space Sciences Laboratory, University of California, Berkeley, CA 94720 (United States); Brandt, W. N. [Department of Astronomy and Astrophysics, The Pennsylvania State University, 525 Davey Lab, University Park, PA 16802 (United States); Christensen, F. E. [DTU Space-National Space Institute, Technical University of Denmark, Elektrovej 327, DK-2800 Lyngby (Denmark); Greiner, J.; Rau, A.; Schady, P.; Sudilovsky, V. [Max-Planck-Institut für extraterrestrische Physik, Giessenbachstrasse 1, D-85748 Garching (Germany); Hailey, C. J. [Columbia Astrophysics Laboratory, Columbia University, New York, NY 10027 (United States); Madejski, G. M., E-mail: tullia.sbarrato@brera.inaf.it [Kavli Institute for Particle Astrophysics and Cosmology, SLAC National Accelerator Laboratory, Menlo Park, CA 94025 (United States); and others

2013-11-10

B2 1023+25 is an extremely radio-loud quasar at z = 5.3 that was first identified as a likely high-redshift blazar candidate in the SDSS+FIRST quasar catalog. Here, we use the Nuclear Spectroscopic Telescope Array (NuSTAR) to investigate its non-thermal jet emission, whose high-energy component we detected in the hard X-ray energy band. The X-ray flux is ∼ 5.5 x 10{sup -14} erg cm{sup -2} s{sup -1} (5-10 keV) and the photon spectral index is Γ{sub X} ≅ 1.3-1.6. Modeling the full spectral energy distribution, we find that the jet is oriented close to the line of sight, with a viewing angle of ∼3°, and has significant Doppler boosting, with a large bulk Lorentz factor ∼13, which confirms the identification of B2 1023+25 as a blazar. B2 1023+25 is the first object at redshift larger than 5 detected by NuSTAR, demonstrating the ability of NuSTAR to investigate the early X-ray universe and to study extremely active supermassive black holes located at very high redshift.

Observaciones en el Ornithodoros Forcosus sobre su posible rol como vector de la Fiebre Recurrente

Directory of Open Access Journals (Sweden)

Arístides Herrer

1957-12-01

Full Text Available Tratando de verificar la posible infección por borrelias en el Ornithodoros Forcosus Neumann, 1908, se realizaron observaciones experimentales en las que se utilizó un total de 1,655 especímenes de esta garrapata. En tales estudios se emplearon pericotes blancos y cobayos. Con triturado de garrapatas fueron inoculados 68 animales (64 pericotes y 4 cobayos y 37 (16 pericotes y 21 cobayos fueron empleados para alimentar sobre ellos varios lotes de garrapatas. Los resultados de todas estas observaciones fueron negativas. Las garrapatas con las que se han efectuado estos estudios procedían de las localidades de Limabamba, Mariscal Benavides, Camporredondo, Ocalli y Luya, todas en el departamento de Amazonas, y a altitudes que varían entre 1,400 y 2,300 metros sobre el nivel del mar. Desde que la fiebre recurrente parece ser endémica en el Perú, especialmente en localidades de considerable altitud, es de suponer que en este país sea trasmitida principalmente por piojos.

Hit discovery of Mycobacterium tuberculosis inosine 5'-monophosphate dehydrogenase, GuaB2, inhibitors.

Science.gov (United States)

Sahu, Niteshkumar U; Singh, Vinayak; Ferraris, Davide M; Rizzi, Menico; Kharkar, Prashant S

2018-04-18

Tuberculosis remains a global concern. There is an urgent need of newer antitubercular drugs due to the development of resistant forms of Mycobacterium tuberculosis (Mtb). Inosine 5'-monophosphate dehydrogenase (IMPDH), guaB2, of Mtb, required for guanine nucleotide biosynthesis, is an attractive target for drug development. In this study, we screened a focused library of 73 drug-like molecules with desirable calculated/predicted physicochemical properties, for growth inhibitory activity against drug-sensitive MtbH37Rv. The eight hits and mycophenolic acid, a prototype IMPDH inhibitor, were further evaluated for activity on purified Mtb-GuaB2 enzyme, target selectivity using a conditional knockdown mutant of guaB2 in Mtb, followed by cross-resistance to IMPDH inhibitor-resistant SRMV2.6 strain of Mtb, and activity on human IMPDH2 isoform. One of the hits, 13, a 5-amidophthalide derivative, has shown growth inhibitory potential and target specificity against the Mtb-GuaB2 enzyme. The hit, 13, is a promising molecule with potential for further development as an antitubercular agent. Copyright © 2018 Elsevier Ltd. All rights reserved.

Design and alaysis of the PEP-II B-Factory HER QF5 quadrupole magnet

International Nuclear Information System (INIS)

Kendall, C.M.; Harvey, A.; Swan, J.; Yamamoto, R.; Yokota, T.; Tanabe, J.; Sullivan, M.; Wienands, U.

1997-01-01

The High Energy Ring (HER) in Stanford Linear Accelerator Center's PEP-II B-Factory employs two high field quality quadrupole magnets, labeled QF5, located in the Interaction Region (IR) symmetrically about the Interaction Point (IP), for final horizontal beam focusing. An asymmetric, septum, Collins quadrupole design is required for QF5 as a result of space constraints within the IR. Water cooled square hollow copper conductor is used in a two coil per pole configuration to develop the 61.7 kG/m and 82.2 kG/m gradients required for the HER 9 GeV and 12 GeV energy levels respectively. A 1.45 m long laminated iron core constructed in two halves with a 160 mm diameter aperture and pole tip shims shape the quadruple field. The QF5 field quality requirements include a multipole content of b n /b 2 ≤1 x 10 -4 for n = 3-15 at a radius of 78.1 mm. The QF5 quadrupole mechanical and magnetic design and analysis are presented

Macrophages are related to goblet cell hyperplasia and induce MUC5B but not MUC5AC in human bronchus epithelial cells.

Science.gov (United States)

Silva, Manuel A; Bercik, Premysl

2012-06-01

Airway goblet cell hyperplasia (GCH)--detectable by mucin staining--and abnormal macrophage infiltrate are pathological features present in many chronic respiratory disorders. However, it is unknown if both factors are associated. Using in-vivo and in-vitro models, we investigated whether macrophages are related with GCH and changes in mucin immunophenotypes. Lung sections from Sprague-Dawley rats treated for 48 h with one intra-tracheal dose of PBS or LPS (n=4-6 per group) were immunophenotyped for rat-goblet cells, immune, and proliferation markers. Human monocyte-derived macrophages (MDM) were pre-treated with or without LPS, immunophenotyped, and their supernatant, as well as cytokines at levels equivalent to supernatant were used to challenge primary culture of normal human bronchus epithelial cells (HBEC) in air-liquid interface, followed by MUC5B and MUC5AC mucin immunostaining. An association between increased bronchiolar goblet cells and terminal-bronchiolar proliferative epithelial cells confirmed the presence of GCH in our LPS rat model, which was related with augmented bronchiolar CD68 macrophage infiltration. The in-vitro experiments have shown that MUC5AC phenotype was inhibited when HBEC were challenged with supernatant from MDM pre-treated with or without LPS. In contrast, TNF-α and interleukin-1β at levels equivalent to supernatant from LPS-treated MDM increased MUC5AC. MUC5B was induced by LPS, supernatant from LPS-treated MDM, a mix of cytokines including TNF-α and TNF-α alone at levels present in supernatant from LPS-treated MDM. We demonstrated that macrophages are related with bronchiolar GCH, and that they induced MUC5B and inhibited MUC5AC in HBEC, suggesting a role for them in the pathogenesis of airway MUC5B-related GCH.

Comparative fate of an organochlorine, chlordecone, and a related compound, chlordecone-5b-hydro, in soils and plants.

Science.gov (United States)

Clostre, Florence; Cattan, Philippe; Gaude, Jean-Marie; Carles, Céline; Letourmy, Philippe; Lesueur-Jannoyer, Magalie

2015-11-01

We address the problem of the comparative environmental fate of a pesticide, chlordecone (CLD), and a related compound, chlordecone-5b-hydro (CLD-5b-hydro). We used a large database including data from two types of contaminated volcanic soils, andosol and nitisol, and thirteen crops grown in the French West Indies in historically polluted soils. We performed in-depth statistical analysis of the effect of different parameters (soil type, crop, organ, etc.) on the ratio of CLD-5b-hydro to CLD in both soils and plants. The environmental fate of the two compounds differed depending on the type of soil. Proportionally, more CLD-5b-hydro than CLD was measured in nitisols than in andosols. Compared to CLD, we also found a preferential transfer of CLD-5b-hydro from the soil to the plant. Finally, mobilization of the two compounds differed according to the species of crop but also within the plant, with increasing ratios from the roots to the top of the plant. The properties of the compound played a key role in the underlying processes. Because CLD-5b-hydro is more soluble in water and has a lower K(ow) than CLD, CLD-5b-hydro (1) was more easily absorbed from soils by plants, (2) was less adsorbed onto plant tissues and (3) was transported in greater quantities through the transpiration stream. Due to the amounts of CLD-5b-hydro we measured in some plant parts such as cucurbit fruits, an assessment of the toxicity of this CLD monodechlorinated product is recommended. Copyright © 2015 Elsevier B.V. All rights reserved.

Dm5-HT2B: Pharmacological Characterization of the Fifth Serotonin Receptor Subtype of Drosophila melanogaster

Directory of Open Access Journals (Sweden)

Wolfgang Blenau

2017-05-01

Full Text Available Serotonin (5-hydroxytryptamine, 5-HT is an important regulator of physiological and behavioral processes in both protostomes (e.g., insects and deuterostomes (e.g., mammals. In insects, serotonin has been found to modulate the heart rate and to control secretory processes, development, circadian rhythms, aggressive behavior, as well as to contribute to learning and memory. Serotonin exerts its activity by binding to and activating specific membrane receptors. The clear majority of these receptors belong to the superfamily of G-protein-coupled receptors. In Drosophila melanogaster, a total of five genes have been identified coding for 5-HT receptors. From this family of proteins, four have been pharmacologically examined in greater detail, so far. While Dm5-HT1A, Dm5-HT1B, and Dm5-HT7 couple to cAMP signaling cascades, the Dm5-HT2A receptor leads to Ca2+ signaling in an inositol-1,4,5-trisphosphate-dependent manner. Based on sequence similarity to homologous genes in other insects, a fifth D. melanogaster gene was uncovered coding for a Dm5-HT2B receptor. Knowledge about this receptor’s pharmacological properties is very limited. This is quite surprising because Dm5-HT2B has been attributed to distinct physiological functions based on genetic interference with its gene expression. Mutations were described reducing the response of the larval heart to 5-HT, and specific knockdown of Dm5-HT2B mRNA in hemocytes resulted in a higher susceptibility of the flies to bacterial infection. To gain deeper understanding of Dm5-HT2B’s pharmacology, we evaluated the receptor’s response to a series of established 5-HT receptor agonists and antagonists in a functional cell-based assay. Metoclopramide and mianserin were identified as two potent antagonists that may allow pharmacological interference with Dm5-HT2B signaling in vitro and in vivo.

Efficient hepatitis c virus genotype 1b core-NS5A recombinants permit efficacy testing of protease and NS5A inhibitors

DEFF Research Database (Denmark)

Pham, Long V.; Ramirez Almeida, Santseharay; Carlsen, Thomas H R

2017-01-01

Hepatitis C virus (HCV) strains belong to seven genotypes with numerous subtypes that respond differently to antiviral therapies. Genotype 1, and primarily subtype 1b, is the most prevalent genotype worldwide. The development of recombinant HCV infectious cell culture systems for different variants......, permitted by the high replication capacity of strain JFH1 (genotype 2a), has advanced efficacy and resistance testing of antivirals. However, efficient infectious JFH1-based cell cultures of subtype 1b are limited and comprise only the 5= untranslated region (5=UTR)-NS2, NS4A, or NS5A regions. Importantly...

NFAT5 participates in seawater inhalation-induced acute lung injury via modulation of NF-κB activity

Science.gov (United States)

Li, Congcong; Liu, Manling; Bo, Liyan; Liu, Wei; Liu, Qingqing; Chen, Xiangjun; Xu, Dunquan; Li, Zhichao; Jin, Faguang

2016-01-01

Nuclear factor of activated T cells 5 (NFAT5) is a transcription factor that can be activated by extracellular tonicity. It has been reported that NFAT5 may increase the transcription of certain osmoprotective genes in the renal system, and the aim of the current study was to explore the role of NFAT5 in seawater inhalation-induced acute lung injury. Though establishing the model of seawater inhalation-induced acute lung injury, it was demonstrated that seawater inhalation enhanced the transcription and protein expression of NFAT5 (evaluated by reverse transcription-polymerase chain reaction, immunohistochemistry stain and western blotting) and activation of nuclear factor (NF)-κB (evaluated by western blotting and mRNA expression levels of three NF-κB-dependent genes) both in lung tissue and rat alveolar macrophage cells (NR8383 cells). When expression of NFAT5 was reduced in NR8383 cells using an siRNA targeted to NFAT5, the phosphorylation of NF-κB and transcription of NF-κB-dependent genes were significantly reduced. In addition, the elevated content of certain inflammatory cytokines [tumor necrosis factor α, interleukin (IL)-1 and IL-8] were markedly reduced. In conclusion, NFAT5 serves an important pathophysiological role in seawater inhalation-induced acute lung injury by modulating NF-κB activity, and these data suggest that NFAT5 may be a promising therapeutic target. PMID:27779669

Protein kinase C inhibition prevents upregulation of vascular ET(B) and 5-HT(1B) receptors and reverses cerebral blood flow reduction after subarachnoid haemorrhage in rats

DEFF Research Database (Denmark)

Beg, Saema S; Hansen-Schwartz, Jacob A; Vikman, Petter J

2007-01-01

with Western blot; only PKCdelta and PKCalpha subtypes were increased after SAH RO-31-7549 treatment abolished this. At 2 days after the SAH basilar and middle cerebral arteries were harvested and the contractile response to endothelin-1 (ET-1; ET(A) and ET(B) receptor agonist) and 5-carboxamidotryptamine (5......-CT; 5-HT(1) receptor agonist) were investigated with a myograph. The contractile responses to ET-1 and 5-CT were increased (Poperated rats. In parallel, the ET(B) and 5-HT(1B) receptor mRNA and protein expression were significantly elevated after SAH, as analysed...

CD1d(hi)CD5+ B cells expanded by GM-CSF in vivo suppress experimental autoimmune myasthenia gravis.

Science.gov (United States)

Sheng, Jian Rong; Quan, Songhua; Soliven, Betty

2014-09-15

IL-10-competent subset within CD1d(hi)CD5(+) B cells, also known as B10 cells, has been shown to regulate autoimmune diseases. Whether B10 cells can prevent or suppress the development of experimental autoimmune myasthenia gravis (EAMG) has not been studied. In this study, we investigated whether low-dose GM-CSF, which suppresses EAMG, can expand B10 cells in vivo, and whether adoptive transfer of CD1d(hi)CD5(+) B cells would prevent or suppress EAMG. We found that treatment of EAMG mice with low-dose GM-CSF increased the proportion of CD1d(hi)CD5(+) B cells and B10 cells. In vitro coculture studies revealed that CD1d(hi)CD5(+) B cells altered T cell cytokine profile but did not directly inhibit T cell proliferation. In contrast, CD1d(hi)CD5(+) B cells inhibited B cell proliferation and its autoantibody production in an IL-10-dependent manner. Adoptive transfer of CD1d(hi)CD5(+) B cells to mice could prevent disease, as well as suppress EAMG after disease onset. This was associated with downregulation of mature dendritic cell markers and expansion of regulatory T cells resulting in the suppression of acetylcholine receptor-specific T cell and B cell responses. Thus, our data have provided significant insight into the mechanisms underlying the tolerogenic effects of B10 cells in EAMG. These observations suggest that in vivo or in vitro expansion of CD1d(hi)CD5(+) B cells or B10 cells may represent an effective strategy in the treatment of human myasthenia gravis. Copyright © 2014 by The American Association of Immunologists, Inc.

Pim-2 activates API-5 to inhibit the apoptosis of hepatocellular carcinoma cells through NF-kappaB pathway.

Science.gov (United States)

Ren, Ke; Zhang, Wei; Shi, Yujun; Gong, Jianping

2010-06-01

Pim-2 is proved to be relevant to the tumorigenesis of hepatocellular carcinoma (HCC), but the mechanism is unclear. We studied the relationship among Pim-2, NF-kappaB and API-5. In our experiment, expression level of the three factors and phosphorylation level of API-5, as well as NF-kappaB activity, were detected in HCC tissues and the nontumorous controls. Then Pim-2 gene was transfected into nontumorous liver cells L02, and Pim-2 SiRNA was transfected into hepatoblastoma cell line HepG2. Parthenolide was added as NF-kappaB inhibitor. The same detections as above were repeated in the cells, along with the apoptosis analysis. We found the levels of Pim-2, NF-kappaB and API-5, as well as NF-kappaB activity, were significantly higher in HCC tissues. Pim-2 level was increased in L02 cells after the transfection of Pim-2 gene, but decreased in HepG2 cells after the transfection of Pim-2 SiRNA. The levels of NF-kappaB and API-5, as well as NF-kappaB activity and API-5 phosphorylation level, were in accordance with Pim-2 level, but could be reversed by Parthenolide. Cell apoptosis rates were negatively correlated with API-5 phosphorylation level. Therefore, we infer that Pim-2 could activate API-5 to inhibit the apoptosis of liver cells, and NF-kappaB is the key regulator.

Molecular and crystal structure of nido-9-C5H5N-11-I-7,8-C2B9H10: supramolecular architecture via hydrogen bonding X-H...I (X = B, C)

International Nuclear Information System (INIS)

Polyanskaya, T.M.

2006-01-01

A monocrystal X-ray diffraction study of a new iodine-containing cluster compound 9-(pyridine)-11-iodo-decahydro-7,8-dicarba-nido-undecaborane [9-C 5 H 5 N-11-I-7,8-C 2 B 9 H 10 ] has been performed. Crystal data: C 7 H 15 B 9 NI, M = 337.39, monoclinic, space group P2 1 /c, unit cell parameters: a=9.348(1) A, b=11.159(1) A, c=13.442(2) A, β=98.13(1) deg, V=1388.1(5) A 3 , Z=4, d calc = 1.614 g/cm 3 , T = 295 K, F(000)=648, μ=2.276 mm -1 . The structure was solved by a direct method and refined in the full-matrix anisotropic approximation (isotropic for hydrogen atoms) to final agreement factors R 1 = 0.0254, wR 2 = 0.0454 for 2437 I hkl >2σ I from 3590 measured I hkl (an Enraf-Nonius CAD-4 diffractometer, λMoK α , graphite monochromator, θ/2θ-scanning). The molecules are joined into a supramolecular assembly by hydrogen bonds X-H...I (X = B, C) [ru

Muc5b Is the Major Polymeric Mucin in Mucus from Thoroughbred Horses With and Without Airway Mucus Accumulation

Science.gov (United States)

Rousseau, Karine; Cardwell, Jacqueline M.; Humphrey, Emma; Newton, Richard; Knight, David; Clegg, Peter; Thornton, David J.

2011-01-01

Mucus accumulation is a feature of inflammatory airway disease in the horse and has been associated with reduced performance in racehorses. In this study, we have analysed the two major airways gel-forming mucins Muc5b and Muc5ac in respect of their site of synthesis, their biochemical properties, and their amounts in mucus from healthy horses and from horses with signs of airway mucus accumulation. Polyclonal antisera directed against equine Muc5b and Muc5ac were raised and characterised. Immunohistochemical staining of normal equine trachea showed that Muc5ac and Muc5b are produced by cells in the submucosal glands, as well as surface epithelial goblet cells. Western blotting after agarose gel electrophoresis of airway mucus from healthy horses, and horses with mucus accumulation, was used to determine the amounts of these two mucins in tracheal wash samples. The results showed that in healthy horses Muc5b was the predominant mucin with small amounts of Muc5ac. The amounts of Muc5b and Muc5ac were both dramatically increased in samples collected from horses with high mucus scores as determined visually at the time of endoscopy and that this increase also correlated with increase number of bacteria present in the sample. The change in amount of Muc5b and Muc5ac indicates that Muc5b remains the most abundant mucin in mucus. In summary, we have developed mucin specific polyclonal antibodies, which have allowed us to show that there is a significant increase in Muc5b and Muc5ac in mucus accumulated in equine airways and these increases correlated with the numbers of bacteria. PMID:21602926

Muc5b is the major polymeric mucin in mucus from thoroughbred horses with and without airway mucus accumulation.

Directory of Open Access Journals (Sweden)

Karine Rousseau

Full Text Available Mucus accumulation is a feature of inflammatory airway disease in the horse and has been associated with reduced performance in racehorses. In this study, we have analysed the two major airways gel-forming mucins Muc5b and Muc5ac in respect of their site of synthesis, their biochemical properties, and their amounts in mucus from healthy horses and from horses with signs of airway mucus accumulation. Polyclonal antisera directed against equine Muc5b and Muc5ac were raised and characterised. Immunohistochemical staining of normal equine trachea showed that Muc5ac and Muc5b are produced by cells in the submucosal glands, as well as surface epithelial goblet cells. Western blotting after agarose gel electrophoresis of airway mucus from healthy horses, and horses with mucus accumulation, was used to determine the amounts of these two mucins in tracheal wash samples. The results showed that in healthy horses Muc5b was the predominant mucin with small amounts of Muc5ac. The amounts of Muc5b and Muc5ac were both dramatically increased in samples collected from horses with high mucus scores as determined visually at the time of endoscopy and that this increase also correlated with increase number of bacteria present in the sample. The change in amount of Muc5b and Muc5ac indicates that Muc5b remains the most abundant mucin in mucus. In summary, we have developed mucin specific polyclonal antibodies, which have allowed us to show that there is a significant increase in Muc5b and Muc5ac in mucus accumulated in equine airways and these increases correlated with the numbers of bacteria.

Key role of CXCL13/CXCR5 axis for cerebrospinal fluid B cell recruitment in pediatric OMS.

Science.gov (United States)

Pranzatelli, Michael R; Tate, Elizabeth D; McGee, Nathan R; Travelstead, Anna L; Ransohoff, Richard M; Ness, Jayne M; Colliver, Jerry A

2012-02-29

To study aberrant B cell trafficking into the CSF in opsoclonus-myoclonus syndrome (OMS), chemoattractants CXCL13 and CXCL12, and B cell frequency and CXCR5 expression, were evaluated. CSF CXCL13 concentration and the CSF/serum ratio were higher in untreated OMS than controls, related directly to OMS severity and inversely to OMS duration, and correlated with CSF B cell frequency and oligoclonal bands. CXCL12 showed the opposite pattern. Selective accumulation of CXCR5+ memory B cells in CSF was found. In ACTH-treated OMS, CXCL13, but not CXCL12, was lower. These data implicate the chemokine/chemoreceptor pair CXCL13/CXR5 in B cell recruitment to the CNS in OMS. CXCL13 and CXCL12 may serve as reciprocal biomarkers of disease activity, but CXCL13 also had utility as a treatment biomarker. Copyright © 2011 Elsevier B.V. All rights reserved.

NS5B RNA dependent RNA polymerase inhibitors: the promising approach to treat hepatitis C virus infections.

Science.gov (United States)

Deore, R R; Chern, J-W

2010-01-01

Hepatitis C virus (HCV), a causative agent for non-A and non-B hepatitis, has infected approximately 3% of world's population. The current treatment option of ribavirin in combination with pegylated interferon possesses lower sustained virological response rates, and has serious disadvantages. Unfortunately, no prophylactic vaccine has been approved yet. Therefore, there is an unmet clinical need for more effective and safe anti-HCV drugs. HCV NS5B RNA dependent RNA polymerase is currently pursued as the most popular target to develop safe anti-HCV agents, as it is not expressed in uninfected cells. More than 25 pharmaceutical companies and some research groups have developed ≈50 structurally diverse scaffolds to inhibit NS5B. Here we provide comprehensive account of the drug development process of these scaffolds. NS5B polymerase inhibitors have been broadly classified in nucleoside and non nucleoside inhibitors and are sub classified according to their mechanism of action and structural diversities. With some additional considerations about the inhibitor bound NS5B enzyme X-ray crystal structure information and pharmacological aspects of the inhibitors, this review summarizes the lead identification, structure activity relationship (SAR) studies leading to the most potent NS5B inhibitors with subgenomic replicon activity.

Disruption of STAT5b-Regulated Sexual Dimorphism of the Liver Transcriptome by Diverse Factors Is a Common Event

Science.gov (United States)

Signal transducer and activator of transcription 5b (STAT5b) is a growth hormone (GH)-activated transcription factor and a master regulator of sexually dimorphic gene expression in the liver. Disruption ofthe GH hypothalamo-pituitary-liver axis controlling STAT5b activation can ...

Magnetic properties improvement of melt spun Co{sub 86.5}Hf{sub 11.5}B{sub 2} nanocomposites by refractory elements substitution

Energy Technology Data Exchange (ETDEWEB)

Chang, H.W. [Department of Applied Physics, Tunghai University, Taichung 407, Taiwan (China); Lin, Y.H.; Shih, C.W.; Liao, M.C.; Lee, Y.I. [Department of Physics, National Chung Cheng University, Chia-Yi 621, Taiwan (China); Chang, W.C., E-mail: phywcc@ccu.edu.tw [Department of Physics, National Chung Cheng University, Chia-Yi 621, Taiwan (China); Yang, C.C. [Department of Physics, Chung-Yuan Christian University, Chungli 320, Taiwan (China); Shaw, C.C. [Superrite Electronics Co. Ltd., Taipei 111, Taiwan (China)

2016-03-01

Magnetic properties of melt spun Co{sub 86.5}Hf{sub 10.5}MB{sub 2} ribbons with refractory elements substitution (M=Cr, Nb, Ti, Zr) have been studied. For ternary Co{sub 86.5}Hf{sub 11.5}B{sub 2} ribbon, permanent magnetic properties of B{sub r}=0.71 T, {sub i}H{sub c}=192 kA/m, and (BH){sub max}=34.4 kJ/m{sup 3} are obtained, and they are significantly improved to B{sub r}=0.73–0.76 T, {sub i}H{sub c}=136–216 kA/m and (BH){sub max}=38.4–52.8 kJ/m{sup 3} with M substitution. Summarized with the results of x-ray diffraction refinement, thermal magnetic analysis, and transmission electron microscopy, the Co{sub 86.5}Hf{sub 10.5}MB{sub 2} nanocomposites following the optimal crystallization treatment mainly consist of orthorhombic 7:1 and face-center-cubic Co phases. Fine microstructure with average grain size in the range of 12.5−19.6 nm promotes exchange coupling effect between magnetic grains, thus improving permanent magnetic properties. The magnetic field dependence of coercivity reveals that coercivity of the studied Co{sub 86.5}Hf{sub 10.5}MB{sub 2} nonocomposites is mainly governed by the reverse domain nucleation mechanism. - Highlights: • M substitution refines the grain size. • M substitution strengthens the exchange coupling effect between grains. • M substitution improves hard magnetic properties of Co{sub 86.5}Hf{sub 10.5}MB{sub 2} ribbons. • The coercivity is mainly governed by the reverse domain nucleation mechanism. • Co{sub 86.5}Hf{sub 10.5}MB{sub 2} ribbons are relevant candidate for RE free permanent magnets.

The Properties of XO-5b and WASP-82b Redetermined Using New High-Precision Transit Photometry and Global Data Analyses

Science.gov (United States)

Smith, A. M. S.

2015-03-01

This paper presents new transit photometry from the Isaac Newton Telescope of two transiting exoplanetary systems, XO-5 and WASP-82. In each case the new transit light curve is more precise than any other of that system previously published. The new data are analyzed alongside previously-published photometry and radial velocities, resulting in an improved orbital ephemeris and a refined set of system parameters in each case. The observational baseline of XO-5 is extended by very nearly four years, resulting in a determination of the orbital period of XO-5b to a precision of just 50 ms. The mass and radius of XO-5b are 1.19±0.03 and 1.14±0.03 times those of Jupiter, respectively. The light curve of WASP-82 is only the second published for this system. The planetary mass is 1.25±0.05 MJup, and the radius is 1.71±0.08 RJup.

Calculation of the Dielectric Constant as a Function of Temperature Close to the Smectic A-Smectic B Transition in B5 Using the Mean Field Model

Directory of Open Access Journals (Sweden)

Hamit Yurtseven

2012-01-01

Full Text Available The temperature dependence of the static dielectric constant ( is calculated close to the smectic A-smectic B ( transition ( = 71.3°C for the liquid crystal compound B5. By expanding the free energy in terms of the order parameter in the mean field theory, the expression for the dielectric susceptibility (dielectric constant is derived and is fitted to the experimental data for which was obtained at the field strengths of 0 and 67 kV/cm from literature. Coefficients in the free energy expansion are determined from our fit for the transition of B5. Our results show that the observed behaviour of the dielectric constant close to the transition in B5 can be described satisfactorily by our mean field model.

Selective up-regulation of 5-HT(1B/1D) receptors during organ culture of cerebral arteries

DEFF Research Database (Denmark)

Hoel, N L; Hansen-Schwartz, J; Edvinsson, L

2001-01-01

5-Hydroxytryptamine (5-HT) is thought to be involved in migraine headache and the pathophysiology of cerebrovascular diseases. Previous data show that organ culture induces a phenotypic change in cerebral vessels. Therefore we investigated if these changes also applied for the vasoconstrictive 5-HT......(cultured) 6.8+/-0.4). The response was inhibited by the 5-HT(1B/1D) selective antagonist GR55562 (pEC50(fresh) 5.1+/-0.2 and pEC50(cultured) 6.0+/-0.3). The organ model might mimic the phenotypic changes during cerebrovascular diseases....... receptors. Rat cerebral arteries express 5-HT2 receptors. Using organ culture we observed a phenotypic change with a selective up-regulation of 5-HT(1B/1D) receptors. This was revealed by an increased sensitivity to the selective 5-HT(1B/1D) agonist 5-CT after organ culture (pEC50(fresh) 5.6+/-0.2 and pEC50...

Site investigation SFR. Reprocessing of reflection seismic profiles 5b and 8, Forsmark

Energy Technology Data Exchange (ETDEWEB)

Juhlin, Christopher; Zhang, Fengjiao (Uppsala Univ., Dept. of Earth Sciences (Sweden))

2010-12-15

Reflection seismic profiles 5b and 8 in the northern Forsmark area have been reprocessed with the aim of improving the images in the uppermost 500 metres in the SFR area. The main conclusion is that a new reflection (B10) has been identified that may extend below the SFR site. This reflection was not clearly observed in the previous processing. The reflection strikes approximately N25E and dips at about 35 degrees to the southeast. This orientation is similar to the set B group identified earlier /Juhlin and Palm 2005/. Note that the dip of the reflection is uncertain. On shot gathers it appears to dip at a slightly shallower angle while on the stacked sections it appears to dip at a greater angle. This discrepancy is probably due to the crooked nature of the profiles. However, reflections are clearly observed in shot gathers and its presence below SFR is highly probable. Two new reflections were also identified further north along profile 5b (A11 and A12). These dip to the south-southeast, but would be found at a depth of 1-2 km below SFR if they extend to below the site. There are also signs of a 3rd reflection with similar orientation to the set A group identified earlier, A13, but its existence is very speculative. This reflector would intersect the surface within the SFR area. South of the Singoe deformation zone on profile 5b, another new reflection has been found, N1. The orientation of this reflection is speculative since it is not clearly seen on profile 8. It has been modelled as dipping to the north at about 35 degrees and projects to the surface south of the main SFR area. In addition, the orientation of reflection B7 has been revised as has the lateral extent of A1. Most importantly, A1 is now interpreted not to extend to the surface and not cross the Singoe deformation zone

MicroRNA-200b Suppresses Arsenic-transformed Cell Migration by Targeting Protein Kinase Cα and Wnt5b-Protein Kinase Cα Positive Feedback Loop and Inhibiting Rac1 Activation*

Science.gov (United States)

Wang, Zhishan; Humphries, Brock; Xiao, Hua; Jiang, Yiguo; Yang, Chengfeng

2014-01-01

MicroRNA-200b (miR-200b) is a member of miR-200 family that has been found to inhibit cell migration and cancer metastasis; however, the underlying mechanism is not well understood. We previously reported that miR-200 expression is depleted in arsenic-transformed human bronchial epithelial cells with highly migratory and invasive characteristics, whereas stably re-expressing miR-200b strongly suppresses arsenic-transformed cell migration. This study was performed to investigate how miR-200b inhibits arsenic-transformed cell migration. We found that protein kinase Cα (PKCα) is significantly up-regulated in arsenic-transformed cells. Combining bioinformatics analysis with PKCα 3′-untranslated region vector luciferase reporter assays, we showed that PKCα is a direct target of miR-200b. Inhibiting PKCα activity or knocking down PKCα expression drastically reduced cell migration, phenocoping the inhibitory effect of overexpressing miR-200b. In contrast, forced expression of PKCα in miR-200b overexpressing cells impaired the inhibitory effect of miR-200b on cell migration. In addition, we also found a positive feedback loop between Wnt5b and PKCα in arsenic-transformed cells. Knocking down Wnt5b expression reduced phospho-PKC levels and cell migration; and knocking down PKCα expression decreased Wnt5b level and cell migration. Moreover, forced expression of PKCα increased Wnt5b and phospho-PKC levels and cell migration. Further mechanistic studies revealed that Rac1 is highly activated in arsenic-transformed cells and stably expressing miR-200b abolishes Rac1 activation changing actin cytoskeleton organization. Manipulating PKCα or Wnt5b expression levels significantly altered the level of active Rac1. Together, these findings indicate that miR-200b suppresses arsenic-transformed cell migration by targeting PKCα and Wnt5b-PKCα positive feedback loop and subsequently inhibiting Rac1 activation. PMID:24841200

MicroRNA-200b suppresses arsenic-transformed cell migration by targeting protein kinase Cα and Wnt5b-protein kinase Cα positive feedback loop and inhibiting Rac1 activation.

Science.gov (United States)

Wang, Zhishan; Humphries, Brock; Xiao, Hua; Jiang, Yiguo; Yang, Chengfeng

2014-06-27

MicroRNA-200b (miR-200b) is a member of miR-200 family that has been found to inhibit cell migration and cancer metastasis; however, the underlying mechanism is not well understood. We previously reported that miR-200 expression is depleted in arsenic-transformed human bronchial epithelial cells with highly migratory and invasive characteristics, whereas stably re-expressing miR-200b strongly suppresses arsenic-transformed cell migration. This study was performed to investigate how miR-200b inhibits arsenic-transformed cell migration. We found that protein kinase Cα (PKCα) is significantly up-regulated in arsenic-transformed cells. Combining bioinformatics analysis with PKCα 3'-untranslated region vector luciferase reporter assays, we showed that PKCα is a direct target of miR-200b. Inhibiting PKCα activity or knocking down PKCα expression drastically reduced cell migration, phenocoping the inhibitory effect of overexpressing miR-200b. In contrast, forced expression of PKCα in miR-200b overexpressing cells impaired the inhibitory effect of miR-200b on cell migration. In addition, we also found a positive feedback loop between Wnt5b and PKCα in arsenic-transformed cells. Knocking down Wnt5b expression reduced phospho-PKC levels and cell migration; and knocking down PKCα expression decreased Wnt5b level and cell migration. Moreover, forced expression of PKCα increased Wnt5b and phospho-PKC levels and cell migration. Further mechanistic studies revealed that Rac1 is highly activated in arsenic-transformed cells and stably expressing miR-200b abolishes Rac1 activation changing actin cytoskeleton organization. Manipulating PKCα or Wnt5b expression levels significantly altered the level of active Rac1. Together, these findings indicate that miR-200b suppresses arsenic-transformed cell migration by targeting PKCα and Wnt5b-PKCα positive feedback loop and subsequently inhibiting Rac1 activation. © 2014 by The American Society for Biochemistry and Molecular

Somatic drivers of B-ALL in a model of ETV6-RUNX1; Pax5+/− leukemia

International Nuclear Information System (INIS)

Weyden, Louise van der; Giotopoulos, George; Wong, Kim; Rust, Alistair G.; Robles-Espinoza, Carla Daniela; Osaki, Hikari; Huntly, Brian J.; Adams, David J.

2015-01-01

B-cell precursor acute lymphoblastic leukemia (B-ALL) is amongst the leading causes of childhood cancer-related mortality. Its most common chromosomal aberration is the ETV6-RUNX1 fusion gene, with ~25 % of ETV6-RUNX1 patients also carrying PAX5 alterations. We have recreated this mutation background by inter-crossing Etv6-RUNX1 (Etv6 RUNX1-SB ) and Pax5 +/− mice and performed an in vivo analysis to find driver genes using Sleeping Beauty transposon-mediated mutagenesis and also exome sequencing. Combination of Etv6-RUNX1 and Pax5 +/− alleles generated a transplantable B220 + CD19+ B-ALL with a significant disease incidence. RNA-seq analysis showed a gene expression pattern consistent with arrest at the pre-B stage. Analysis of the transposon common insertion sites identified genes involved in B-cell development (Zfp423) and the JAK/STAT signaling pathway (Jak1, Stat5 and Il2rb), while exome sequencing revealed somatic hotspot mutations in Jak1 and Jak3 at residues analogous to those mutated in human leukemias, and also mutation of Trp53. Powerful synergies exists in our model suggesting STAT pathway activation and mutation of Trp53 are potent drivers of B-ALL in the context of Etv6-RUNX1;Pax5 +/− . The online version of this article (doi:10.1186/s12885-015-1586-1) contains supplementary material, which is available to authorized users

Myo5b knockout mice as a model of microvillus inclusion disease

NARCIS (Netherlands)

Carton-Garcia, Fernando; Overeem, Arend W.; Nieto, Rocio; Bazzocco, Sarah; Dopeso, Higinio; Macaya, Irati; Bilic, Josipa; Landolfi, Stefania; Hernandez-Losa, Javier; Schwartz, Simo; Ramon y Cajal, Santiago; van Ijzendoorn, Sven C. D.; Arango, Diego

2015-01-01

Inherited MYO5B mutations have recently been associated with microvillus inclusion disease (MVID), an autosomal recessive syndrome characterized by intractable, life-threatening, watery diarrhea appearing shortly after birth. Characterization of the molecular mechanisms underlying this disease and

B production in pPb at 5.02 TeV from CMS

CERN Document Server

Lee, Kisoo

2016-01-01

Hadrons with heavy quarks are promising probes to investigate the detailed properties of hot and dense medium generated by heavy-ion collisions at collider energies. Since heavy quarks are sensitive to the transport properties of the medium, the energy-loss pattern of them is expected to be quite different from that of light quarks in a strongly-interacting matter. On the other hand, in order to elicit the actual effects caused by the hot and dense medium, it is necessary to understand the cold nuclear mattereffect in pA collisions. For example, the pPb data is expected to provide a baseline for the study of the b-quark energy loss in medium produced by PbPb collisions. Therefore, the CMS Collaboration at the Large Hadron Collider (LHC) has analyzed the production cross sections of $B^{+}$, $B^{0}$, $B^{0}_{s}$ mesons in pPb collisions as a function of rapidity and the transverse momentum at the nucleon-nucleon center-of-mass energy of 5.02 TeV. In addition, the nuclear modification factors of the B mesons ha...

Spinal NF-κB and chemokine ligand 5 expression during spinal glial cell activation in a neuropathic pain model.

Directory of Open Access Journals (Sweden)

Qin Yin

Full Text Available BACKGROUND: The NF-κB pathway and chemokine (C-C motif ligand 5 (CCL5 are involved in pain modulation; however, the precise mechanisms of their interactions in chronic neuropathic pain have yet to be established. METHODS: The present study examined the roles of spinal NF-κB and CCL5 in a neuropathic pain model after chronic constriction injury (CCI surgery. CCI-induced pain facilitation was evaluated using the Plantar and von Frey tests. The changes in NF-κB and CCL5 expression were analyzed by immunohistochemistry and Western blot analyses. RESULTS: Spinal NF-κB and CCL5 expression increased after CCI surgery. Repeated intrathecal infusions of pyrrolidine dithiocarbamate (PDTC, a NF-κB inhibitor decreased CCL5 expression, inhibited the activation of microglia and astrocytes, and attenuated CCI-induced allodynia and hyperalgesia. Intrathecal injection of a CCL5-neutralizing antibody attenuated CCI-induced pain facilitation and also suppressed spinal glial cell activation after CCI surgery. However, the CCL5-neutralizing antibody did not affect NF-κB expression. Furthermore, selective glial inhibitors, minocycline and fluorocitrate, attenuated the hyperalgesia induced by intrathecal CCL5. CONCLUSIONS: The inhibition of spinal CCL5 expression may provide a new method to prevent and treat nerve injury-induced neuropathic pain.

Genotype and allelic frequencies of CYP2E1*5B polymorphism in the southwest population of Iran

Directory of Open Access Journals (Sweden)

Fatemeh Zanganeh

2014-10-01

Full Text Available Background: Cytochrome P450 2E1 (CYP2E1 is a main enzyme which plays a major role in activating and detoxifying many xenobiotics, carcinogens and drugs. Available studies suggest that CYP2E1 single nucleotide polymorphisms (SNPs are involved in the risk of developing certain cancers after exposure to carcinogens. The purpose of the present study was to assess genotype and allele frequencies of polymorphic CYP2E1*5B in the Iranian population. Material and Methods: This study was performed on 200 healthy individuals (female: 100, male: 100 in medical laboratories of Ahvaz during 2011. The CYP2E1 *5B (rs3813867 G-1293C assessment was carried out using PCR-RFLP method. The data were analyzed with ĸ2 and hardy-Weinberg Equation statistically methods. Results: The frequency of *1A/*1A (c1/c1, *1A/*5B (c1/c2 and *5B/*5B (c2/c2 genotypes was computed 97, 3 and 0 percent, respectively. The frequency of *1A (c1 and *5B (c2 alleles was computed 98.5 and 1.5 percent, respectively. No statistically significant difference was between two genders (p>0.05. Conclusion: The genotype distribution and allele frequencies of CYP2E1*5B polymorphism were similar to Turkish and some of the European populations. However, there are significant interethnic differences when the Iranian population is compared with the Eastern Asian, American and some of the European populations. The allelic distribution of this polymorphism did not vary with gender.

A Study on the Development of Playback Control Software for Mark5B VSI System

Directory of Open Access Journals (Sweden)

S. J. Oh

2010-06-01

Full Text Available We developed the playback control software for a high-speed playback system which is a component of the Korea-Japan Joint VLBI Correlator (KJJVC. The Mark5B system, which is a recorder and playback system used in the Korean VLBI Network (KVN, has two kinds of operation mode. That is to say, the station unit (SU mode, which is for the present Mark4 system, and the VSI mode, which is for the new VLBI standard interface (VSI system. The software for SU is already developed and widely used in the Mark4 type VLBI system, but the software for VSI has only been developed for recording. The new VLBI system is designed with a VSI interface for compatibility between different systems. Therefore, the playback control software development of the VSI mode is needed for KVN. In this work, we developed the playback control software of the Mark5B VSI mode. The developed playback control software consists of an application part for data playing back, a data input/output part for the VSI board, a module for the StreamStor RAID board, and a user interface part, including an observation time control part. To verify the performance of developed playback control software, the playback and correlation experiments were performed using the real observation data in Mark5B system and KJJVC. To check the observation time control, the data playback experiment was performed between the Mark5B and Raw VLBI Data Buffer (RVDB systems. Through the experimental results, we confirmed the performance of developed playback control software in the Mark5B VSI mode.

ASPECTOS SOCIO-ECONÓMICOS DE LAS MIGRACIONES RECIENTES EN ESPAÑA EN EL CONTEXTO DE LA EUROPA MERIDIONAL. ELEMENTOS PARA UNA POSIBLE TEORÍA

Directory of Open Access Journals (Sweden)

Gaetano Ferrieri

1996-01-01

Full Text Available Se analizan la s características geográficas y la s implicaciones socio-económicas de los recientes flujos inmigratorios que re cibe España, relacionando las tendencias econó- micas y las tendencias migratorias; el ejempl o español se estudia en el contexto de la Europa meridional, como nueva meta de las migraciones internacionales. El estudio concluye con la propuesta de una posible te oría sobre el ciclo migratorio-económico.

Secondhand cigarette smoke exposure causes upregulation of cerebrovascular 5-HT(1) (B) receptors via the Raf/ERK/MAPK pathway in rats

DEFF Research Database (Denmark)

Cao, L; Xu, C B; Zhang, Y

2013-01-01

Cigarette smoke exposure increases the risk of stroke. Upregulation of 5-hydroxytryptamine 1B (5-HT(1) (B) ) receptors is associated with the pathogenesis of cerebral ischaemia. This study examined the hypothesis that the expression of 5-HT(1) (B) receptors is altered in brain vessels after secon...... secondhand smoke (SHS) exposure.......Cigarette smoke exposure increases the risk of stroke. Upregulation of 5-hydroxytryptamine 1B (5-HT(1) (B) ) receptors is associated with the pathogenesis of cerebral ischaemia. This study examined the hypothesis that the expression of 5-HT(1) (B) receptors is altered in brain vessels after...

Measurements of the Exclusive Decays of the Υ(5S) to B Meson Final States and Improved Bs* Mass Measurement

International Nuclear Information System (INIS)

Aquines, O.; Li, Z.; Lopez, A.; Mendez, H.; Ramirez, J.; Huang, G.S.; Miller, D.H.; Pavlunin, V.; Sanghi, B.; Shipsey, I.P.J.; Xin, B.; Adams, G.S.; Anderson, M.; Cummings, J.P.; Danko, I.; Napolitano, J.; He, Q.; Insler, J.; Muramatsu, H.; Park, C.S.

2006-01-01

Using 420 pb -1 of data collected on the Υ(5S) resonance with the CLEO III detector, we reconstruct B mesons in 25 exclusive decay channels to measure or set upper limits on the decay rate of Υ(5S) into B meson final states. We measure the inclusive B cross section to be σ(Υ(5S)→BB(X))=(0.177±0.030±0.016) nb and make the first measurements of the production rates of σ(Υ(5S)→B*B*)=(0.131±0.025±0.014) nb and σ(Υ(5S)→BB*)=(0.043±0.016±0.006) nb, respectively. We set 90% confidence level limits of σ(Υ(5S)→BB) ( * ) B ( * ) π) s * mass to date, M(B s *)=(5411.7±1.6±0.6) MeV/c 2

Polymorphisms of CCL3L1/CCR5 genes and recurrence of hepatitis B in liver transplant recipients.

Science.gov (United States)

Li, Hong; Xie, Hai-Yang; Zhou, Lin; Wang, Wei-Lin; Liang, Ting-Bo; Zhang, Min; Zheng, Shu-Sen

2011-12-01

The genetic diversity of chemokines and chemokine receptors has been associated with the outcome of hepatitis B virus infection. The aim of this study was to evaluate whether the copy number variation in the CCL3L1 gene and the polymorphisms of CCR5Δ32 and CCR5-2459A→G (rs1799987) are associated with recurrent hepatitis B in liver transplantation for hepatitis B virus infection-related end-stage liver disease. A total of 185 transplant recipients were enrolled in this study. The genomic DNA was extracted from whole blood, the copy number of the CCL3L1 gene was determined by a quantitative real-time PCR based assay, CCR5Δ32 was detected by a sizing PCR method, and a single-nucleotide polymorphism in CCR5-2459 was detected by restriction fragment length polymorphism PCR. No CCR5Δ32 mutation was detected in any of the individuals from China. Neither copy number variation nor polymorphism in CCR5-2459 was associated with post-transplant re-infection with hepatitis B virus. However, patients with fewer copies (CCR5 genes might be more likely to have recurrence of hepatitis B after transplantation.

El compromiso de la investigación social en la construcción de otra escuela posible

Directory of Open Access Journals (Sweden)

Matías DE STÉFANO BARBERO

2015-01-01

Full Text Available Este artículo recoge una serie de experiencias y reflexiones entorno a la investigaciónDiversidad y convivencia en los cen-tros educativosllevada a cabo desde la Universidad Complu-tense de Madrid en 2013 y centrada en el análisis de bue-nas prácticas educativas en atención a la diversidad. Nosinterrogamos acerca de cómo la elección de la metodología,el formato en el que se elaboran los resultados y su posteriordifusión son decisiones fundamentales para que una investi-gación académica desarrolle todo su potencial de cambiosocial. En nuestro caso, la vertiente aplicada de la investiga-ción ha estado orientada a analizar y visibilizar en el contex-to escolar la diversidad sexual y familiar, así como diferentesidentidades de género, haciendo de ellas una oportunidadeducativa para el cambio hacia otra escuela posible.

Quorum-sensing-directed protein expression in Serratia proteamaculans B5a

DEFF Research Database (Denmark)

Christensen, Allan Beck; Riedel, Kathrin; Eberl, Leo

2003-01-01

N-Acyl-L-homoserine-lactone-producing Serratia species are frequently encountered in spoiling foods of vegetable and protein origin. The role of quorum sensing in the food spoiling properties of these bacteria is currently being investigated. A set of luxR luxI homologous genes encoding a putative...... quorum sensor was identified in the N-(3-oxo-hexanoyl)-L-homoserine lactone (3-oxo-C6-HSL)-producing Serratia proteamaculans strain B5a. The 3-oxo-C6-HSL synthase SprI showed 79% similarity with Esal from Pantoea stewartii and the putative regulatory protein SprR was 86% similar to the SpnR of Serratia...... marcescens. Proteome analysis suggested that the presence of at least 39 intracellular proteins was affected by the 3-oxo-C6-HSL-based quorum sensing system. The lipB-encoded secretion system was identified as one target gene of the quorum sensing system. LipB was required for the production of extracellular...

Subaru XV: una estrategia de comunicación y mercadeo para la generación Y

Directory of Open Access Journals (Sweden)

Guillermo Armelini

2013-03-01

Full Text Available En el año 2009 las ventas en la industria automotriz disminuyeron. El año 2010 había comenzado mucho mejor. En este contexto, Subaru Chile, un actor del mercado con una cuota relativamente pequeña (anexo 1, decidió introducir un nuevo modelo: Subaru XV, un crossover que se presentaba como la gran apuesta para el creciente mercado de los SUV (anexos 6 y 7 El desafío de lanzar este modelo presentaba varias aristas. En primer lugar, el mercado de este tipo de vehículos ya estaba muy desarrollado por actores importantes como Toyota, Nissan y Renault (anexo 7. En segundo lugar, Subaru tenía que dirigir su acción comercial a un nuevo segmento de mercado (jóvenes entre 20 y 35 años que desconocía y, consecuentemente, debía estudiar sus hábitos y necesidades, y definir el sistema de comunicación más acorde para este target.

Communication Received from the United Kingdom of Great Britain and Northern Ireland Concerning Its Policies Regarding the Management of Plutonium. Statements on the Management of Plutonium and of High Enriched Uranium; Comunicacion recibida del Reino Unido de Gran Bretana e Irlanda del Norte en relacion con sus politicas referentes a la gestion del plutonio. Declaraciones sobre la gestion del plutonio y del uranio muy enriquecido

Energy Technology Data Exchange (ETDEWEB)

NONE

2007-09-25

The Secretariat has received a Note Verbale dated 23 August 2007 from the Permanent Mission of the United Kingdom of Great Britain and Northern Ireland to the United Nations and the International Organizations in Vienna in the enclosures of which the Government, in keeping with its commitment under the Guidelines for the Management of Plutonium (contained in INFCIRC/549 of 16 March 1998 and hereinafter referred to as the 'Guidelines') and in accordance with Annexes B and C of the Guidelines, has made available annual figures for its holdings of civil unirradiated plutonium and the estimated amounts of plutonium contained in spent civil reactor fuel as of 31 December 2006 [Spanish] La Secretaria ha recibido una nota verbal, de fecha 23 de agosto de 2007, de la Mision Permanente del Reino Unido de Gran Bretana e Irlanda del Norte ante las Naciones Unidas y las Organizaciones Internacionales con sede en Viena, en cuyos anexos el Gobierno, en cumplimiento de su compromiso contraido en virtud de las Directrices para la gestion del plutonio (transcritas en el documento INFCIRC/549 de 16 de marzo de 1998 y denominadas en adelante las 'Directrices') y de conformidad con los anexos B y C de las Directrices, presenta las cifras anuales de sus existencias de plutonio no irradiado de uso civil y las cantidades estimadas de plutonio contenido en el combustible gastado de reactores de uso civil, a 31 de diciembre de 2006.

Experimental observations of surface electrostatic wave on KT-5B tokamak

International Nuclear Information System (INIS)

Zhu Shiyao; Han Shensheng

1991-01-01

Shear Alfven waves have been successfully excited in KT-5B small tokamak by means of the one turn longitudinal loop antenna located in the shadow area. The measured antenna loadings show their rich structure, and the loadings are also found to be sensitive to the plasma current. Preliminary evidence of surface electrostatic wave was observed

Identification, Characterization, and Three-Dimensional Structure of the Novel Circular Bacteriocin, Enterocin NKR-5-3B, from Enterococcus faecium.

Science.gov (United States)

Himeno, Kohei; Rosengren, K Johan; Inoue, Tomoko; Perez, Rodney H; Colgrave, Michelle L; Lee, Han Siean; Chan, Lai Y; Henriques, Sónia Troeira; Fujita, Koji; Ishibashi, Naoki; Zendo, Takeshi; Wilaipun, Pongtep; Nakayama, Jiro; Leelawatcharamas, Vichien; Jikuya, Hiroyuki; Craik, David J; Sonomoto, Kenji

2015-08-11

Enterocin NKR-5-3B, one of the multiple bacteriocins produced by Enterococcus faecium NKR-5-3, is a 64-amino acid novel circular bacteriocin that displays broad-spectrum antimicrobial activity. Here we report the identification, characterization, and three-dimensional nuclear magnetic resonance solution structure determination of enterocin NKR-5-3B. Enterocin NKR-5-3B is characterized by four helical segments that enclose a compact hydrophobic core, which together with its circular backbone impart high stability and structural integrity. We also report the corresponding structural gene, enkB, that encodes an 87-amino acid precursor peptide that undergoes a yet to be described enzymatic processing that involves adjacent cleavage and ligation of Leu(24) and Trp(87) to yield the mature (circular) enterocin NKR-5-3B.

La virtualidad: un escenario posible para la construcción de conocimientos matemáticos

Directory of Open Access Journals (Sweden)

Guillermo Arraiz

2012-04-01

Full Text Available Es un hecho innegable que el fenómeno de la virtualidad ha impregnado todas las esferas sociales, culturales, económicas y educativas a escala global. En este contexto, el empleo de entornos virtuales de aprendizaje, específicamente en los procesos de enseñanza y aprendizaje de la matemática, plantea a docentes y estudiantes estrategias alternativas que resultan potencialmente valiosas en la construcción de conocimientos matemáticos. El propósito de este artículo es hacer un seguimiento exploratorio sobre algunos avances de la comunidad científica en el campo de la educación en línea para aproximar algunas reflexiones de índole tecnológica y didáctica que expongan la virtualidad como un escenario posible para la construcción de los conocimientos matemáticos. Aunque se identificaron patrones de resistencia y desconfianza manifiesta hacia la virtualización de la enseñanza matemática por parte de docentes y alumnos, se hace evidente el potencial de los medios virtuales, dada la curiosidad y disposición de docentes y estudiantes por estas experiencias de aprendizaje.

Li2Sr4B12O23: A new alkali and alkaline-earth metal mixed borate with [B10O18]6− network and isolated [B2O5]4− unit

International Nuclear Information System (INIS)

Zhang Min; Pan Shilie; Han Jian; Yang Zhihua; Su Xin; Zhao Wenwu

2012-01-01

A novel ternary lithium strontium borate Li 2 Sr 4 B 12 O 23 crystal with size up to 20 mm×10 mm×4 mm has been grown via the top-seeded solution growth method below 730 °C. Single-crystal XRD analyses showed that Li 2 Sr 4 B 12 O 23 crystallizes in the monoclinic space group P2 1 /c with a=6.4664(4) Å, b=8.4878(4) Å, c=15.3337(8) Å, β=102.02(3)°, Z=2. The crystal structure is composed of [B 10 O 18 ] 6− network and isolated [B 2 O 5 ] 4− unit. The IR spectrum further confirmed the presence of both BO 3 and BO 4 groups. TG-DSC and Transmission spectrum were reported. Band structures and density of states were calculated. - Graphical abstract: A new phase, Li 2 Sr 4 B 12 O 23 , has been discovered in the ternary M 2 O–M′O–B 2 O 3 (M=alkali-metal, M′=alkalineearth metal) system. The crystal structure consists of [B 10 O 18 ] 6− network and isolated [B 2 O 5 ] 4− unit. Highlights: ► Li 2 Sr 4 B 12 O 23 is a a novel borate discovered in the M 2 O–M′O–B 2 O 3 (M=alkali-metal, M′=alkaline-earth metal) system. ► Li 2 Sr 4 B 12 O 23 crystal structure has a three-dimensional crystal structure with [B 10 O 18 ] 6− network and isolated [B 2 O 5 ] 4− unit. ► Sr 1 and Sr 2 are located in two different channels constructed by 3 ∞ [B 10 O 18 ] network.

Resistance Analyses of HCV NS3/4A Protease and NS5B Polymerase from Clinical Studies of Deleobuvir and Faldaprevir.

Directory of Open Access Journals (Sweden)

Kristi L Berger

Full Text Available The resistance profile of anti-hepatitis C virus (HCV agents used in combination is important to guide optimal treatment regimens. We evaluated baseline and treatment-emergent NS3/4A and NS5B amino-acid variants among HCV genotype (GT-1a and -1b-infected patients treated with faldaprevir (HCV protease inhibitor, deleobuvir (HCV polymerase non-nucleoside inhibitor, and ribavirin in multiple clinical studies.HCV NS3/4A and NS5B population sequencing (Sanger method was performed on all baseline plasma samples (n = 1425 NS3; n = 1556 NS5B and on post-baseline plasma samples from patients with virologic failure (n = 113 GT-1a; n = 221 GT-1b. Persistence and time to loss of resistance-associated variants (RAVs was estimated using Kaplan-Meier analysis.Faldaprevir RAVs (NS3 R155 and D168 and deleobuvir RAVs (NS5B 495 and 496 were rare (90%. Virologic relapse was associated with RAVs in both NS3 and NS5B (53% GT-1b; 52% GT-1b; some virologic relapses had NS3 RAVs only (47% GT-1a; 17% GT-1b. Median time to loss of GT-1b NS5B P495 RAVs post-treatment (5 months was less than that of GT-1b NS3 D168 (8.5 months and GT-1a R155 RAVs (11.5 months.Faldaprevir and deleobuvir RAVs are more prevalent among virologic failures than at baseline. Treatment response was not compromised by common NS3 polymorphisms; however, alanine at NS5B amino acid 499 at baseline (wild-type in GT-1a, polymorphism in GT-1b may reduce response to this deleobuvir-based regimen.

BCR-crosslinking induces a transcription of protein phosphatase component G5PR that is required for mature B-cell survival

International Nuclear Information System (INIS)

Huq Ronny, Faisal Mahmudul; Igarashi, Hideya; Sakaguchi, Nobuo

2006-01-01

BCR-crosslinking triggers activation-induced cell death (AICD) selectively in the restricted stage of B-cell differentiation. We examined the transcription of a protein phosphatase subunit G5PR in immature and mature B-cells, because absence of this factor augmented cell sensitivity to AICD, associated with increased activation of JNK and Bim. BCR-crosslinking-induced G5pr transcription in AICD-resistant mature splenic IgM lo IgD hi B-cells but not in AICD susceptible immature IgM hi IgD lo B-cells. Thus, G5pr induction correlated with the prevention of AICD; High in mature splenic CD23 hi B-cells but low in immature B-cells of neonatal mice, sub-lethally irradiated mice, or xid mice. Lack of G5pr upregulation was associated with the prolonged activation of JNK. The G5pr cDNA transfection protected an immature B-cell line WEHI-231 from BCR-mediated AICD. The differential expression of G5PR might be responsible for the antigen-dependent selection of B-cells

2-tert-Butyl-5,6,7,8,9,10-hexahydrocyclohepta[b]indole

Directory of Open Access Journals (Sweden)

Janina Wobbe

2011-09-01

Full Text Available 2-tert-Butyl-5,6,7,8,9,10-hexahydrocyclohepta[b]indole was synthesized by reaction of cycloheptanone and (4-tert-butylphenylhydrazine hydrochloride in the presence of sodium acetate and sulfuric acid in glacial acetic acid via Fischer indole synthesis.

PD-L2 Regulates B-1 Cell Antibody Production against Phosphorylcholine through an IL-5-Dependent Mechanism.

Science.gov (United States)

McKay, Jerome T; Haro, Marcela A; Daly, Christina A; Yammani, Rama D; Pang, Bing; Swords, W Edward; Haas, Karen M

2017-09-15

B-1 cells produce natural Abs which provide an integral first line of defense against pathogens while also performing important homeostatic housekeeping functions. In this study, we demonstrate that programmed cell death 1 ligand 2 (PD-L2) regulates the production of natural Abs against phosphorylcholine (PC). Naive PD-L2-deficient (PD-L2 -/- ) mice produced significantly more PC-reactive IgM and IgA. This afforded PD-L2 -/- mice with selectively enhanced protection against PC-expressing nontypeable Haemophilus influenzae , but not PC-negative nontypeable Haemophilus influenzae , relative to wild-type mice. PD-L2 -/- mice had significantly increased PC-specific CD138 + splenic plasmablasts bearing a B-1a phenotype, and produced PC-reactive Abs largely of the T15 Id. Importantly, PC-reactive B-1 cells expressed PD-L2 and irradiated chimeras demonstrated that B cell-intrinsic PD-L2 expression regulated PC-specific Ab production. In addition to increased PC-specific IgM, naive PD-L2 -/- mice and irradiated chimeras reconstituted with PD-L2 -/- B cells had significantly higher levels of IL-5, a potent stimulator of B-1 cell Ab production. PD-L2 mAb blockade of wild-type B-1 cells in culture significantly increased CD138 and Blimp1 expression and PC-specific IgM, but did not affect proliferation. PD-L2 mAb blockade significantly increased IL-5 + T cells in culture. Both IL-5 neutralization and STAT5 inhibition blunted the effects of PD-L2 mAb blockade on B-1 cells. Thus, B-1 cell-intrinsic PD-L2 expression inhibits IL-5 production by T cells and thereby limits natural Ab production by B-1 cells. These findings have broad implications for the development of therapeutic strategies aimed at altering natural Ab levels critical for protection against infectious disease, autoimmunity, allergy, cancer, and atherosclerosis. Copyright © 2017 by The American Association of Immunologists, Inc.

Casa de campo en la playa de Jávea, Valencia – España

Directory of Open Access Journals (Sweden)

De Jorge, M.

1971-03-01

Full Text Available This house is adapted to a gentle pine covered slope, extending down to the beach. There is a number of stepped down bedrooms, following the ground contour. The main bedroom is at the top, and it is on the same level as the dining and living room, the kitchen and other services, and two terraces facing north and south. At the lower part of the building there is a music and study room, with an independent entrance and a covered porch, for winter use. There is also a basement, firewood store room and other secondary rooms, which can allow for future extensions.El acoplamiento a una suave ladera cubierta de pinos, que desciende hacia la playa, determina una serie de dormitorios escalonados, según la pendiente del terreno, que culminan en la parte superior de la vivienda con el dormitorio principal, situado ya en el mismo plano que el salón-comedor, las terrazas principales N. y S. y la cocina y servicios anexos. En la parte inferior se sitúa un estudio-sala de música, con entrada independiente y un porche cubierto para invierno, junto con la bodega, leñera y otros servicios y espacios previstos para una posible ampliación.

Manipulating multiple order parameters via oxygen vacancies: The case of E u0.5B a0.5Ti O3 -δ

Science.gov (United States)

Li, Weiwei; He, Qian; Wang, Le; Zeng, Huizhong; Bowlan, John; Ling, Langsheng; Yarotski, Dmitry A.; Zhang, Wenrui; Zhao, Run; Dai, Jiahong; Gu, Junxing; Shen, Shipeng; Guo, Haizhong; Pi, Li; Wang, Haiyan; Wang, Yongqiang; Velasco-Davalos, Ivan A.; Wu, Yangjiang; Hu, Zhijun; Chen, Bin; Li, Run-Wei; Sun, Young; Jin, Kuijuan; Zhang, Yuheng; Chen, Hou-Tong; Ju, Sheng; Ruediger, Andreas; Shi, Daning; Borisevich, Albina Y.; Yang, Hao

2017-09-01

Controlling functionalities, such as magnetism or ferroelectricity, by means of oxygen vacancies (VO) is a key issue for the future development of transition-metal oxides. Progress in this field is currently addressed through VO variations and their impact on mainly one order parameter. Here we reveal a mechanism for tuning both magnetism and ferroelectricity simultaneously by using VO. Combining experimental and density-functional theory studies of E u0.5B a0.5Ti O3 -δ , we demonstrate that oxygen vacancies create T i3 +3 d1 defect states, mediating the ferromagnetic coupling between the localized Eu 4 f7 spins, and increase an off-center displacement of Ti ions, enhancing the ferroelectric Curie temperature. The dual function of Ti sites also promises a magnetoelectric coupling in the E u0.5B a0.5Ti O3 -δ .

Real-world comparison of probe vehicle emissions and fuel consumption using diesel and 5% biodiesel (B5) blend

Energy Technology Data Exchange (ETDEWEB)

Ropkins, Karl; Quinn, Robert; Tate, James; Bell, Margaret [Institute for Transport Studies, University of Leeds, Leeds, LS2 9JT (United Kingdom); Beebe, Joe [National Center for Vehicle Emissions Control and Safety, Colorado State University, Colorado 80523-1584 (United States); Li, Hu; Daham, Basil; Andrews, Gordon [Energy and Resources Research Institute, University of Leeds, Leeds, LS2 9JT (United Kingdom)

2007-04-15

An instrumented EURO I Ford Mondeo was used to perform a real-world comparison of vehicle exhaust (carbon dioxide, carbon monoxide, hydrocarbons and oxides of nitrogen) emissions and fuel consumption for diesel and 5% biodiesel in diesel blend (B5) fuels. Data were collected on multiple replicates of three standardised on-road journeys: (1) a simple urban route; (2) a combined urban/inter-urban route; and, (3) an urban route subject to significant traffic management. At the total journey measurement level, data collected here indicate that replacing diesel with a B5 substitute could result in significant increases in both NO{sub x} emissions (8-13%) and fuel consumption (7-8%). However, statistical analysis of probe vehicle data demonstrated the limitations of comparisons based on such total journey measurements, i.e., methods analogous to those used in conventional dynamometer/drive cycle fuel comparison studies. Here, methods based on the comparison of speed/acceleration emissions and fuel consumption maps are presented. Significant variations across the speed/acceleration surface indicated that direct emission and fuel consumption impacts were highly dependent on the journey/drive cycle employed. The emission and fuel consumption maps were used both as descriptive tools to characterise impacts and predictive tools to estimate journey-specific emission and fuel consumption effects. (author)

Real-world comparison of probe vehicle emissions and fuel consumption using diesel and 5% biodiesel (B5) blend

International Nuclear Information System (INIS)

Ropkins, Karl; Quinn, Robert; Tate, James; Bell, Margaret; Beebe, Joe; Li, Hu; Daham, Basil; Andrews, Gordon

2007-01-01

An instrumented EURO I Ford Mondeo was used to perform a real-world comparison of vehicle exhaust (carbon dioxide, carbon monoxide, hydrocarbons and oxides of nitrogen) emissions and fuel consumption for diesel and 5% biodiesel in diesel blend (B5) fuels. Data were collected on multiple replicates of three standardised on-road journeys: (1) a simple urban route; (2) a combined urban/inter-urban route; and, (3) an urban route subject to significant traffic management. At the total journey measurement level, data collected here indicate that replacing diesel with a B5 substitute could result in significant increases in both NO x emissions (8-13%) and fuel consumption (7-8%). However, statistical analysis of probe vehicle data demonstrated the limitations of comparisons based on such total journey measurements, i.e., methods analogous to those used in conventional dynamometer/drive cycle fuel comparison studies. Here, methods based on the comparison of speed/acceleration emissions and fuel consumption maps are presented. Significant variations across the speed/acceleration surface indicated that direct emission and fuel consumption impacts were highly dependent on the journey/drive cycle employed. The emission and fuel consumption maps were used both as descriptive tools to characterise impacts and predictive tools to estimate journey-specific emission and fuel consumption effects. (author)

Indicações para o emprego da madeira de espécies tropicais do Brasil

OpenAIRE

Marcela Paula Grobério

2000-01-01

Realizou-se, no contexto deste trabalho, o estudo de espécies tropicais de madeira e a qualificação destas a partir de suas características físicas, de resistência e rigidez. Os ensaios para a determinação das propriedades foram realizados no Laboratório de Madeiras e de Estruturas de Madeira, do Departamento de Engenharia de Estruturas, Escola de Engenharia de São Carlos, seguindo as recomendações do anexo B da NBR 7190/1997 - Projeto de Estruturas de Madeira. O objetivo fundamental é gerar ...

POSIBLES MECANISMOS DE ACCIÓN BIOLÓGICA DE LA ACTIVIDAD FÍSICA EN EL CÁNCER DE MAMA

Directory of Open Access Journals (Sweden)

Jairo Alejandro Fernández Ortega

2014-11-01

Full Text Available La evidencia científica ha demostrado la importancia de la actividad física como una estrategia efectiva para disminuir el riesgo y la recidiva del cáncer de mama. Sin embargo, hasta el momento no se conocen con precisión los mecanismos de acción biológicos del ejercicio sobre el cáncer de mama. El propósito de este artículo es realizar una revisión sistemática exhaustiva de la literatura e identificar las posibles hipótesis que se plantean de los mecanismos de acción biológicos del ejercicio sobre el cáncer de mama. Se realizó una revisión sistemática de la literatura publicada desde 1990 hasta 2011 sobre los efectos del ejercicio en el cáncer de mama.

Dissect Kif5b in nuclear positioning during myogenesis: The light chain binding domain and the autoinhibitory peptide are both indispensable

Energy Technology Data Exchange (ETDEWEB)

Wang, Zai, E-mail: wangzai81@hotmail.com [Department of Biochemistry, Li Ka Shing Faculty of Medicine, The University of Hong Kong, Pokfulam (Hong Kong); Institute of Clinical Medical Sciences, China–Japan Friendship Hospital, Beijing (China); Xue, Wenqian; Li, Xiuling; Lin, Raozhou [Department of Biochemistry, Li Ka Shing Faculty of Medicine, The University of Hong Kong, Pokfulam (Hong Kong); Cui, Ju [Department of Biochemistry, Li Ka Shing Faculty of Medicine, The University of Hong Kong, Pokfulam (Hong Kong); Beijing Institute of Geriatrics, Beijing Hospital, Ministry of Health (China); Huang, Jian-Dong, E-mail: jdhuang@hku.hk [Department of Biochemistry, Li Ka Shing Faculty of Medicine, The University of Hong Kong, Pokfulam (Hong Kong)

2013-03-08

Highlights: ► Kif5b localizes at myonuclear membrane and is responsible for nuclear dispersion. ► Kif5b stalk/tail domain contains signal for nuclear membrane targeting. ► Kif5b stalk/tail domain directly binds to a nesprin 4 in vitro. ► KLC binding domain and autoinhibitory peptide are both functionally indispensable. -- Abstract: The microtubule motor kinesin-1 is responsible for the nuclear positioning during myogenesis. Here we show that the coiled-coil stalk/tail domain containing the kinesin light chain (KLC) binding sites targets to the perinuclear region like endogenous Kif5b, while the globular tail domain cannot. To investigate which fragments of kinesin heavy chain (Kif5b) is responsible for the myonuclear positioning, we transfect Kif5b expression constructs into Kif5b deficient myoblasts and test their ability to rescue the myonuclear phenotype. We find that the KLC binding domain and the autoinhibitory peptide in the globular tail region are both indispensable for the nuclear membrane localization of Kif5b and the kinesin-1-mediated myonuclear positioning. These results suggest that while the KLC binding domain may directly targets Kif5b to the myonuclear membrane, the autoinhibitory peptide may play an indirect role in regulating the kinesin-1-mediated myonuclear positioning.

The 10B(p,α)7Be S(E)-factor from 5 keV to 1.5 MeV using the Trojan Horse Method

Science.gov (United States)

Puglia, Sebastiana Maria Regina; Spitaleri, Claudio; La Cognata, Marco; Lamia, Livio; Broggini, Carlo; Caciolli, Antonio; Carlin, Nelson; Cherubini, Silvio; Cvetinovic, Alexandra; D'Agata, Giuseppe; Dell'aquila, Daniele; Depalo, Rosanna; Gulino, Marisa; Guardo, Giovanni Luca; Indelicato, Iolanda; Lombardo, Ivano; Menegazzo, Roberto; Munhoz, Marcelo Gimenez; Pizzone, Rosario Gianluca; Rapisarda, Giuseppe Gabriele; Rigato, Valentino; Romano, Stefano; Sergi, Maria Letizia; Souza, Francisco; Sparta, Roberta; Tudisco, Salvo; Tumino, Aurora

2018-01-01

The 10B(p,α)7Be reaction is the main responsible for the 10B destruction in stellar interior [1]. In such environments this p-capture process occurs at a Gamow energy of 10 keV and takes places mainly through a resonant state (Ex = 8.701 MeV) of the compound 11C nucleus. Thus a resonance right in the region of the Gamow peak is expected to significantly influence the behavior of the astrophysical S(E)-factor. The 10B(p,α)7Be reaction was studied via the Trojan Horse Method (THM) applied to the 2H(10B,α7Be)n in order to extract the astrophysical S(E)-factor in a wide energy range from 5 keV to 1.5 MeV.

ENDF/B-5 fission product cross section evaluations

International Nuclear Information System (INIS)

Schenter, R.E.; England, T.R.

1979-12-01

Cross section evaluations were made for the 196 fission product nuclides on the ENDF/B-5 data files. Most of the evaluations involve updating the capture cross sections of the important absorbers for fast and thermal reactor systems. This included updating thermal values, resonance integrals, resonance parameter sets, and fast capture cross sections. For the fast capture results generalized least-squares calculations were made with the computer code FERRET. Input for these cross section adjustments included nuclear models calculations and both integral and differential experimental data results. The differential cross sections and their uncertainties were obtained from the CSIRS library. Integral measurement results came from CFRMF and STEK Assemblies 500, 1000, 2000, 3000, 4000. Comparisons of these evaluations with recent capture measurements are shown. 15 figures, 10 tables

Penetration of the renewable sources of energy in Mexico: group of approach on the possible present and future obstacles for the renewable energies (Annexe 11 in 'A vision of year 2030 on the use of the renewable energies in Mexico'); Penetracion de las fuentes renovables de energia en Mexico: grupo de enfoque sobre los posibles obstaculos actuales y futuros para las energias renovables (Anexo 11 en 'Una vision al 2030 de la utilizacion de las energias renovables en Mexico')

Energy Technology Data Exchange (ETDEWEB)

Pernudi, Montserrat; Alonso C, Antonio [Analitica Consultores S.A. de C.V., Mexico D.F. (Mexico)

2005-08-15

In this study it is analyzed the possible penetration of the renewable sources of energy in Mexico between today and year 2030. In this project are included as small renewable sources the hydroelectric ones (mini, smaller micro and less than of 20 MW), the geothermal, the solar energy, the wind energy and the biomass. This report corresponds to the results obtained in the group of consultation of experts on the present obstacles and future of the renewable energies in Mexico, made o May 24, 2005 in the Mexico City with a small group of approach that presented the objectives of the project, defined the main present obstacles and the possible future evolution for the penetration of the renewable sources of energy in Mexico. [Spanish] En este estudio se analiza la posible penetracion de las fuentes renovables de energia en Mexico entre hoy y el ano 2030. En dicho proyecto se incluyen como fuentes renovables a las pequenas hidroelectricas (micro y mini, menores de 20 MW), la geotermia, la energia solar, la energia eolica y la biomasa. Este informe corresponde a los resultados obtenidos en el grupo de consulta a expertos sobre los obstaculos presentes y futuros de las energias renovables en Mexico, realizado el 24 de mayo de 2005 en la ciudad de Mexico con un pequeno grupo de enfoque que presento los objetivos del proyecto, definio los principales obstaculos actuales y la posible evolucion futura para la penetracion de las fuentes renovables de energia en Mexico.

IL-1β upregulates Muc5ac expression via NF-κB-induced HIF-1α in asthma.

Science.gov (United States)

Wu, Shouzhen; Li, Hailong; Yu, Lijuan; Wang, Ning; Li, Xu; Chen, Wei

2017-12-01

The manifest and important feature in respiratory diseases, including asthma and COPD (chronic obstructive pulmonary disease), is the increased numbers and hypersecretion of goblet cells and overexpression of mucins, especially Muc5ac. Many proinflammatory cytokines play important roles in goblet cell metaplasia and overproduction of Muc5ac. However, the effect of IL-1β on Muc5ac expression in asthma remains unknown. Here, we detected the correlation between IL-1β and Muc5ac in asthma patients and further explored the mechanism of IL-1β-induced Muc5ac overexpression. Our results showed that Muc5ac and IL-1β were up-regulated in 41 patients with asthma and that Muc5ac overexpression was related with IL-1β in asthma (R 2 =0.668, p≪0.001). Furthermore, the correlation between IL-1β and Muc5ac is higher in severe group than that in moderate group. In vitro experiments with normal human bronchial epithelial cells (NHBECs) showed that IL-1β up-regulated Muc5ac expression in NHBEC in a time- and dosage-dependent manner. Hypoxia-induced HIF-1α was responsible for Muc5ac expression mediated by IL-1β. Knocking down HIF-1α by siRNA decreased Muc5ac expression under hypoxia even in IL-1β-treated NHBEC cells. Luciferase reporter assay showed that HIF-1α enhanced Muc5ac promoter activity in HEK293T cells. HIF-1α could specifically bind to the promoter of Muc5ac by EMSA. The correlation among IL-1β, HIF-1α and Muc5ac was observed in patients with asthma. Mechanically, NF-κB activation was essential to IL-1β-induced HIF-1α upregulation via the canonical pathway of NF-κB. The level of nuclear p65, a subunit of NF-κB, was obviously increased in NHBEC cells under IL-1β treatment. IL-1β did not change either HIF-1α or Muc5ac expression when inhibiting NF-κB signaling with Bay11-7082, an inhibitor of NF-κB. Collectively, we concluded that IL-1β up-regulated Muc5ac expression via NF-κB-induced HIF-1α in asthma and provided a potential therapeutic target for

Prevalence of NS5B resistance-associated variants in treatment-naïve Asian patients with chronic hepatitis C.

Science.gov (United States)

Yang, Song; Xing, Huichun; Feng, Shenghu; Ju, Wei; Liu, Shunai; Wang, Xiaomei; Ou, Weini; Cheng, Jun; Pan, Calvin Q

2018-02-01

There is little information on the association between baseline non-structural protein (NS) 5b resistance-associated variants (RAVs) and treatment failure in hepatitis C patients. This study examined the frequencies of natural hepatitis C virus (HCV) NS5B resistance-associated variants (RAVs) in an Asian cohort. Samples from Asian HCV patients enrolled between October 2009 and September 2014 were analyzed for NS5B RAVs within the region from amino acid 230 to 371. Serum samples were tested by PCR genotyping, with sequence alignment performed using the neighbor-joining method. NS5B was detected by Sanger sequencing followed by Geno2pheno analysis. NS5B RAVs were detected in 80.52% (1199/1489) of patients; 68.4% (1019/1489) and 79.7% (1186/1489) were associated with resistance to sofosbuvir (SOF) and dasabuvir (DSV), respectively. These RAVs were present in 95% (1004/1058) of genotype 1b patients. When genotypes 1b and 2a were compared, SOF-associated RAVs were detected at a higher frequency in genotype 1b (94.8% [1004/1058] vs. 2.9% [9/309]; χ 2 = 1054.433, P C316H/N was more common in genotype 1b (94.7% [1002/1058] vs. 0% [0/309]; χ 2 = 1096.014, P C316Y/H/N/W was higher in genotype 1b (94.7% [1002/1058] vs. 0% [0/309]; χ 2 = 1096.014, P < 0.001). In conclusion, baseline SOF and DSV RAVs are common in Asian HCV patients and predominantly occur in genotype 1b.

Decline of hepatitis B antibody level in vaccinated 5-7 year-old children

Directory of Open Access Journals (Sweden)

Mitra Safari

2010-06-01

Full Text Available Background: Vaccination is the best way to prevent hepatitis B infection. The efficacy of hepatitis B vaccine and duration of protection after vaccination in infants is unknown. The aim of this study was to evaluate the immunity level of school age children against HBV in order to determine the decline of hepatitis B antibody level during the childhood period.Materials and Methods: This cross-sectional research was performed on 729, 5-7 year-old children in Kohgiloyeh& Boyerahmad Province who had been vaccinated at birth. Patients selected by multiple stage sampling method. While interviewing parents the questionnaire were completed. The laboratory rep[ort was attached to the questionnaire. After confirming the correct date of vaccination time, parents were asked for an informed consent. From each patient 3ml blood sample were taken and hepatitis B surface antibody (HBs-Ab and hepatitis B surface antigen (HBs-Ag were determined by ELISA method. Chi-squared and t-tests were used to analyze obtained data by using SPSS-15 software.Results: HBs-Ag was negative in all patients. 84.4% of subjects were immune against HBV (had protective antibody titer. The mean antibody titer was 308.9±230.5 IU/ml with range of 10.6–1175 IU/ml. 15.6% of samples had non protective antibody titer and mean antibody titer was 4.97 ±3. 5 IU/ml. Anti-HBsAb titers were related to the age and residency of children. The immunity level decreased with increasing age. No statistically significant differences could be found between two sexes. Conclusion: Based on this stud, the immunity persistency rate in this age group was suitable compared to other studies. Unfortunately, there is about 20% of non-immune children to HBV infection in this susceptible age with a high risk of contamination and affliction. Because of seriousness of HBV infection proper immunization strategy should be considered in this era by health care authorities

Genetic Screening of WNT4 and WNT5B in Two Populations with Deviating Bone Mineral Densities

DEFF Research Database (Denmark)

Hendrickx, Gretl; Boudin, Eveline; Steenackers, Ellen

2017-01-01

A role for WNT4 and WNT5B in bone metabolism was indicated by genome-wide association studies (GWAS) and a Wnt4 knockout mouse model. The aim of this study was therefore to replicate and further investigate the causality between genetic variation in WNT4 and WNT5B and deviating bone mineral density...... (BMD) values. A WNT4 and WNT5B mutation screening was performed in patients with craniotubular hyperostosis using Sanger sequencing. Here, no putative causal mutations were detected. Moreover, a high and low BMD cohort was selected from the Odense Androgen Study population for re-sequencing. In WNT4 we...

Nuclear Magnetic Resonance (NMR) study of the nanocrystalline alloy Fe73.5 Cu1 Nb3 Si13.5 B9

International Nuclear Information System (INIS)

Aliaga-Guerra, D.; Iannarella, L.; Fontes, M.B.; Guimaraes, A.P.; Skorvanek, I.

1994-05-01

Nanocrystalline Fe 73.5 Cu 1 Nb 3 Si 13.5 B 9 alloys were studied with spin echo NMR at 4.2 K, from 15 to 100 MHz. Several lines are observed, with signals from domains and domain walls. Signals at 50-90 MHz appear to arise from 93 Nb nuclei in the amorphous matrix and in the interface of the crystallites. (author). 5 refs, 3 figs

Visual detection of STAT5B gene expression in living cell using the hairpin DNA modified gold nanoparticle beacon.

Science.gov (United States)

Xue, Jianpeng; Shan, Lingling; Chen, Haiyan; Li, Yang; Zhu, Hongyan; Deng, Dawei; Qian, Zhiyu; Achilefu, Samuel; Gu, Yueqing

2013-03-15

Signal transducer and activator of transcription 5B (STAT5B) is an important protein in JAK-STAT signaling pathway that is responsible for the metastasis and proliferation of tumor cells. Determination of the STAT5B messenger Ribonucleic Acid (mRNA) relating to the STAT5B expression provides insight into the mechanism of tumor progression. In this study, we designed and used a special hairpin deoxyribonucleic acid (DNA) for human STAT5B mRNA to functionalize gold nanoparticles, which served as a beacon for detecting human STAT5B expression. Up to 90% quenching efficiency was achieved. Upon hybridizing with the target mRNA, the hairpin DNA modified gold nanoparticle beacons (hDAuNP beacons) release the fluorophores attached at 5' end of the oligonucleotide sequence. The fluorescence properties of the beacon before and after the hybridization with the complementary DNA were confirmed in vitro. The stability of hDAuNP beacons against degradation by DNase I and GSH indicated that the prepared beacon is stable inside cells. The detected fluorescence in MCF-7 cancer cells correlates with the specific STAT5B mRNA expression, which is consistent with the result from PCR measurement. Fluorescence microscopy showed that the hDAuNP beacons internalized in cells without using transfection agents, with intracellular distribution in the cytoplasm rather than the nucleus. The results demonstrated that this beacon could directly provide quantitative measurement of the intracellular STAT5B mRNA in living cells. Compared to the previous approaches, this beacon has advantages of higher target to background ratio of detection and an increased resistance to nuclease degradation. The strategy reported in this study is a promising approach for the intracellular measurement of RNA or protein expression in living cells, and has great potential in the study of drug screening and discovery. Copyright © 2012 Elsevier B.V. All rights reserved.

Paulus als Schriftuitlegger Paulus’ vertolking van Genesis 15:5b-6 in Romeinen 4:3

Directory of Open Access Journals (Sweden)

Pieter K. Baaij

2005-07-01

  In this article the author illustrates that Paul in Romans 4:3 accurately renders what is written in Genesis 15:5b and 6. Paul teaches us to understand the Hebrew text better by indicating where the emphasis lies in the Hebrew text and how we must interpret the Hebrew terms used. For this reason Paul’s interpretation of Genesis 15:5b and 6 in Romans 4:3 is of great importance in the continually more topical debate on how we must translate the Bible.

Percepción de las estrategias de crianza y la ansiedad en estudiantes de 5to de primaria a 5to de secundaria en una institución privada de Lima

OpenAIRE

Carbajal León, Carlos Alberto

2016-01-01

Investigación, de tipo correlacional, que analiza las posibles relaciones entre la percepción de las estrategias de crianza y la ansiedad en estudiantes de 5to de primaria a 5to de secundaria en una institución privada de Lima. Utiliza una muestra de 422 estudiantes cuyas edades oscilan entre los 10 a 16 años, conformada por 143 hombres (33.9%) y 279 mujeres (66.1%). Los instrumentos empleados son la fichas sociodemográficas, la escala de la calidad de la interacción familiar adaptada por Dom...

DNA (cytosine-5-methyltransferase 3B (DNMT 3B polymorphism and risk of Down syndrome offspring

Directory of Open Access Journals (Sweden)

Cláudia Melo de Moura

2018-01-01

Full Text Available Down syndrome (DS is the most common form of human genetic mental retardation. Several polymorphisms in genes coding folic acid cycle enzymes have been associated to the risk of bearing a DS child; however, the results are controversial. S-adenosyl-l-methionine (SAM is an important intermediate of folic acid pathway and acts as methyl donor and substrate for DNA (cytosine-5-methyltransferase 3B (DNMT3B – EC 2.1.1.37 de novo methylation processes during embryogenesis. Recent studies suggest that a functional polymorphism of DNMT 3B in maternal genotype may be associated with a decreased risk of having a DS child. We herein investigate the association of this polymorphism with the occurrence of DS in a Brazilian population. We have genotyped 111 mothers of DS infants (MDS and 212 control mothers (CM through PCR-RFLP. The observed genotypic frequencies were CC = 0.22; CT = 0.49 and TT = 0.29 in CM, and CC = 0.30; CT = 0.52 and TT = 0.18 in MDS. Allelic frequencies were C = 0.47 and T = 0.53 in CM and C = 0.56 and T = 0.44 in MDS. No deviation of HWE was observed, and both DNMT 3B rs2424913 genotype (χ2 = 4.53; DF = 1; P = 0.03 and allelic (χ2 = 4.90; DF = 1; P = 0.03 frequencies show significant differences between MDS and CM. The presence of the mutant DNMT 3B T allele decreases 30% the risk of bearing a DS child (OR = 0.69; 95% CI: 0.50–0.96; P = 0.03, and the risk is diminished up to 45% in association with the homozygous genotype (OR = 0.54; 95% CI: 0.31–0.96; P = 0.04. Our results suggest that women harboring the single nucleotide polymorphism DNMT 3B rs2424913 have a decreased risk of a DS pregnancy, and further studies are necessary to confirm this protective effect.

Dynamics of optical degradation on LiB{sub 3}O{sub 5}-crystal surfaces during SFG

Energy Technology Data Exchange (ETDEWEB)

Moeller, Stefan; Andresen, Aenne; Imlau, Mirco [Department of Physics, University of Osnabrueck (Germany)

2008-07-01

We have investigated the phenomenon of optical degradation of LiB{sub 3}O{sub 5} single crystal surfaces during sum-frequency generation (SFG) of UV-light ({lambda}=355 nm) by a focused Q-switched Nd:YAG laser (f=20 kHz, {tau}{sub 1064}=10 ns, anti P{sub 1064}=1.5 W). The investigations were performed on timescales >100 h and UV-intensities below the light induced damage threshold of the crystals. The degradations were studied with optical and analytical methods. As a result we found a steady deposition of foreign material on the output crystal surface in the illuminated area. Here, XPS uncovered several foreign elements as Na,S,Si,Ca, C beside B and O depending on the composition of the ambient atmosphere during SFG. The temporal development of the degradation could be observed by measuring the beam profile behind the crystal. The beam divergence increased as a function of the deposition height, which led to a complex intensity profile in the far-field. Further illuminating lead to a catastrophic break-down of the surface and the beam profile. This is due to thermal damage originating from the UV-absorption of the deposited material. Three models for the deposition process are discussed: a) diffusion out of the LiB{sub 3}O{sub 5}-subsurface, b) deposition of atoms of the ambient atmosphere, c) chemical reactions of LiB{sub 3}O{sub 5}, water, and boric acid.

La actividad carbonífera y su incidencia en las necesidades básicas humanas. Una aproximación al fenómeno de violencia estructural en el municipio de Albania, Guajira.