WorldWideScience

Sample records for anemone nematostella vectensis

  1. Continuous drug release by sea anemone Nematostella vectensis stinging microcapsules.

    Science.gov (United States)

    Tal, Yossi; Ayalon, Ari; Sharaev, Agnesa; Kazir, Zoya; Brekhman, Vera; Lotan, Tamar

    2014-02-01

    Transdermal delivery is an attractive option for drug delivery. Nevertheless, the skin is a tough barrier and only a limited number of drugs can be delivered through it. The most difficult to deliver are hydrophilic drugs. The stinging mechanism of the cnidarians is a sophisticated injection system consisting of microcapsular nematocysts, which utilize built-in high osmotic pressures to inject a submicron tubule that penetrates and delivers their contents to the prey. Here we show, for the first time, that the nematocysts of the starlet sea anemone Nematostella vectensis can be isolated and incorporated into a topical formulation for continuous drug delivery. We demonstrate quantitative delivery of nicotinamide and lidocaine hydrochloride as a function of microcapsular dose or drug exposure. We also show how the released submicron tubules can be exploited as a skin penetration enhancer prior to and independently of drug application. The microcapsules are non-irritant and may offer an attractive alternative for hydrophilic transdermal drug delivery. PMID:24473172

  2. Continuous Drug Release by Sea Anemone Nematostella vectensis Stinging Microcapsules

    Directory of Open Access Journals (Sweden)

    Yossi Tal

    2014-01-01

    Full Text Available Transdermal delivery is an attractive option for drug delivery. Nevertheless, the skin is a tough barrier and only a limited number of drugs can be delivered through it. The most difficult to deliver are hydrophilic drugs. The stinging mechanism of the cnidarians is a sophisticated injection system consisting of microcapsular nematocysts, which utilize built-in high osmotic pressures to inject a submicron tubule that penetrates and delivers their contents to the prey. Here we show, for the first time, that the nematocysts of the starlet sea anemone Nematostella vectensis can be isolated and incorporated into a topical formulation for continuous drug delivery. We demonstrate quantitative delivery of nicotinamide and lidocaine hydrochloride as a function of microcapsular dose or drug exposure. We also show how the released submicron tubules can be exploited as a skin penetration enhancer prior to and independently of drug application. The microcapsules are non-irritant and may offer an attractive alternative for hydrophilic transdermal drug delivery.

  3. Profiling molecular and behavioral circadian rhythms in the non-symbiotic sea anemone Nematostella vectensis

    OpenAIRE

    Oren, Matan; Tarrant, Ann M.; Alon, Shahar; Simon-Blecher, Noa; Elbaz, Idan; Appelbaum, Lior; Levy, Oren

    2015-01-01

    Endogenous circadian clocks are poorly understood within early-diverging animal lineages. We have characterized circadian behavioral patterns and identified potential components of the circadian clock in the starlet sea anemone, Nematostella vectensis: a model cnidarian which lacks algal symbionts. Using automatic video tracking we showed that Nematostella exhibits rhythmic circadian locomotor activity, which is persistent in constant dark, shifted or disrupted by external dark/light cues and...

  4. Characterizing the spatiotemporal expression of RNAs and proteins in the starlet sea anemone, Nematostella vectensis

    OpenAIRE

    Wolenski, Francis S.; Layden, Michael J; Martindale, Mark Q; Gilmore, Thomas D.; Finnerty, John R.

    2013-01-01

    In an effort to reconstruct the early evolution of animal genes and proteins, there is an increasing focus on basal animal lineages such as sponges, cnidarians, ctenophores and placozoans. Among the basal animals, the starlet sea anemone Nematostella vectensis (phylum Cnidaria) has emerged as a leading laboratory model organism partly because it is well suited to experimental techniques for monitoring and manipulating gene expression. Here we describe protocols adapted for use in Nematostella...

  5. Profiling molecular and behavioral circadian rhythms in the non-symbiotic sea anemone Nematostella vectensis.

    Science.gov (United States)

    Oren, Matan; Tarrant, Ann M; Alon, Shahar; Simon-Blecher, Noa; Elbaz, Idan; Appelbaum, Lior; Levy, Oren

    2015-01-01

    Endogenous circadian clocks are poorly understood within early-diverging animal lineages. We have characterized circadian behavioral patterns and identified potential components of the circadian clock in the starlet sea anemone, Nematostella vectensis: a model cnidarian which lacks algal symbionts. Using automatic video tracking we showed that Nematostella exhibits rhythmic circadian locomotor activity, which is persistent in constant dark, shifted or disrupted by external dark/light cues and maintained the same rate at two different temperatures. This activity was inhibited by a casein kinase 1δ/ε inhibitor, suggesting a role for CK1 homologue(s) in Nematostella clock. Using high-throughput sequencing we profiled Nematostella transcriptomes over 48 hours under a light-dark cycle. We identified 180 Nematostella diurnally-oscillated transcripts and compared them with previously established databases of adult and larvae of the symbiotic coral Acropora millepora, revealing both shared homologues and unique rhythmic genes. Taken together, this study further establishes Nematostella as a non-symbiotic model organism to study circadian rhythms and increases our understanding about the fundamental elements of circadian regulation and their evolution within the Metazoa. PMID:26081482

  6. The rise of the starlet sea anemone Nematostella vectensis as a model system to investigate development and regeneration.

    Science.gov (United States)

    Layden, Michael J; Rentzsch, Fabian; Röttinger, Eric

    2016-07-01

    Reverse genetics and next-generation sequencing unlocked a new era in biology. It is now possible to identify an animal(s) with the unique biology most relevant to a particular question and rapidly generate tools to functionally dissect that biology. This review highlights the rise of one such novel model system, the starlet sea anemone Nematostella vectensis. Nematostella is a cnidarian (corals, jellyfish, hydras, sea anemones, etc.) animal that was originally targeted by EvoDevo researchers looking to identify a cnidarian animal to which the development of bilaterians (insects, worms, echinoderms, vertebrates, mollusks, etc.) could be compared. Studies in Nematostella have accomplished this goal and informed our understanding of the evolution of key bilaterian features. However, Nematostella is now going beyond its intended utility with potential as a model to better understand other areas such as regenerative biology, EcoDevo, or stress response. This review intends to highlight key EvoDevo insights from Nematostella that guide our understanding about the evolution of axial patterning mechanisms, mesoderm, and nervous systems in bilaterians, as well as to discuss briefly the potential of Nematostella as a model to better understand the relationship between development and regeneration. Lastly, the sum of research to date in Nematostella has generated a variety of tools that aided the rise of Nematostella to a viable model system. We provide a catalogue of current resources and techniques available to facilitate investigators interested in incorporating Nematostella into their research. WIREs Dev Biol 2016, 5:408-428. doi: 10.1002/wdev.222 For further resources related to this article, please visit the WIREs website. PMID:26894563

  7. Spatial gene expression quantification: a tool for analysis of in situ hybridizations in sea anemone Nematostella vectensis

    Directory of Open Access Journals (Sweden)

    Botman Daniel

    2012-10-01

    Full Text Available Abstract Background Spatial gene expression quantification is required for modeling gene regulation in developing organisms. The fruit fly Drosophila melanogaster is the model system most widely applied for spatial gene expression analysis due to its unique embryonic properties: the shape does not change significantly during its early cleavage cycles and most genes are differentially expressed along a straight axis. This system of development is quite exceptional in the animal kingdom. In the sea anemone Nematostella vectensis the embryo changes its shape during early development; there are cell divisions and cell movement, like in most other metazoans. Nematostella is an attractive case study for spatial gene expression since its transparent body wall makes it accessible to various imaging techniques. Findings Our new quantification method produces standardized gene expression profiles from raw or annotated Nematostella in situ hybridizations by measuring the expression intensity along its cell layer. The procedure is based on digital morphologies derived from high-resolution fluorescence pictures. Additionally, complete descriptions of nonsymmetric expression patterns have been constructed by transforming the gene expression images into a three-dimensional representation. Conclusions We created a standard format for gene expression data, which enables quantitative analysis of in situ hybridizations from embryos with various shapes in different developmental stages. The obtained expression profiles are suitable as input for optimization of gene regulatory network models, and for correlation analysis of genes from dissimilar Nematostella morphologies. This approach is potentially applicable to many other metazoan model organisms and may also be suitable for processing data from three-dimensional imaging techniques.

  8. Characterization of the Cadherin-Catenin Complex of the Sea Anemone Nematostella vectensis and Implications for the Evolution of Metazoan Cell-Cell Adhesion.

    Science.gov (United States)

    Clarke, Donald Nathaniel; Miller, Phillip W; Lowe, Christopher J; Weis, William I; Nelson, William James

    2016-08-01

    The cadherin-catenin complex (CCC) mediates cell-cell adhesion in bilaterian animals by linking extracellular cadherin-based adhesions to the actin cytoskeleton. However, it is unknown whether the basic organization of the complex is conserved across all metazoans. We tested whether protein interactions and actin-binding properties of the CCC are conserved in a nonbilaterian animal, the sea anemone Nematostella vectensis We demonstrated that N. vectensis has a complete repertoire of cadherin-catenin proteins, including two classical cadherins, one α-catenin, and one β-catenin. Using size-exclusion chromatography and multi-angle light scattering, we showed that α-catenin and β-catenin formed a heterodimer that bound N. vectensis Cadherin-1 and -2. Nematostella vectensis α-catenin bound F-actin with equivalent affinity as either a monomer or an α/β-catenin heterodimer, and its affinity for F-actin was, in part, regulated by a novel insert between the N- and C-terminal domains. Nematostella vectensis α-catenin inhibited Arp2/3 complex-mediated nucleation of actin filaments, a regulatory property previously thought to be unique to mammalian αE-catenin. Thus, despite significant differences in sequence, the key interactions of the CCC are conserved between bilaterians and cnidarians, indicating that the core function of the CCC as a link between cell adhesions and the actin cytoskeleton is ancestral in the eumetazoans. PMID:27189570

  9. Characterization of the Cadherin–Catenin Complex of the Sea Anemone Nematostella vectensis and Implications for the Evolution of Metazoan Cell–Cell Adhesion

    Science.gov (United States)

    Clarke, Donald Nathaniel; Miller, Phillip W.; Lowe, Christopher J.; Weis, William I.; Nelson, William James

    2016-01-01

    The cadherin–catenin complex (CCC) mediates cell–cell adhesion in bilaterian animals by linking extracellular cadherin-based adhesions to the actin cytoskeleton. However, it is unknown whether the basic organization of the complex is conserved across all metazoans. We tested whether protein interactions and actin-binding properties of the CCC are conserved in a nonbilaterian animal, the sea anemone Nematostella vectensis. We demonstrated that N. vectensis has a complete repertoire of cadherin–catenin proteins, including two classical cadherins, one α-catenin, and one β-catenin. Using size-exclusion chromatography and multi-angle light scattering, we showed that α-catenin and β-catenin formed a heterodimer that bound N. vectensis Cadherin-1 and -2. Nematostella vectensis α-catenin bound F-actin with equivalent affinity as either a monomer or an α/β-catenin heterodimer, and its affinity for F-actin was, in part, regulated by a novel insert between the N- and C-terminal domains. Nematostella vectensis α-catenin inhibited Arp2/3 complex-mediated nucleation of actin filaments, a regulatory property previously thought to be unique to mammalian αE-catenin. Thus, despite significant differences in sequence, the key interactions of the CCC are conserved between bilaterians and cnidarians, indicating that the core function of the CCC as a link between cell adhesions and the actin cytoskeleton is ancestral in the eumetazoans. PMID:27189570

  10. Pre-bilaterian origins of the Hox cluster and the Hox code: evidence from the sea anemone, Nematostella vectensis.

    Directory of Open Access Journals (Sweden)

    Joseph F Ryan

    Full Text Available BACKGROUND: Hox genes were critical to many morphological innovations of bilaterian animals. However, early Hox evolution remains obscure. Phylogenetic, developmental, and genomic analyses on the cnidarian sea anemone Nematostella vectensis challenge recent claims that the Hox code is a bilaterian invention and that no "true" Hox genes exist in the phylum Cnidaria. METHODOLOGY/PRINCIPAL FINDINGS: Phylogenetic analyses of 18 Hox-related genes from Nematostella identify putative Hox1, Hox2, and Hox9+ genes. Statistical comparisons among competing hypotheses bolster these findings, including an explicit consideration of the gene losses implied by alternate topologies. In situ hybridization studies of 20 Hox-related genes reveal that multiple Hox genes are expressed in distinct regions along the primary body axis, supporting the existence of a pre-bilaterian Hox code. Additionally, several Hox genes are expressed in nested domains along the secondary body axis, suggesting a role in "dorsoventral" patterning. CONCLUSIONS/SIGNIFICANCE: A cluster of anterior and posterior Hox genes, as well as ParaHox cluster of genes evolved prior to the cnidarian-bilaterian split. There is evidence to suggest that these clusters were formed from a series of tandem gene duplication events and played a role in patterning both the primary and secondary body axes in a bilaterally symmetrical common ancestor. Cnidarians and bilaterians shared a common ancestor some 570 to 700 million years ago, and as such, are derived from a common body plan. Our work reveals several conserved genetic components that are found in both of these diverse lineages. This finding is consistent with the hypothesis that a set of developmental rules established in the common ancestor of cnidarians and bilaterians is still at work today.

  11. Cadherin-23 May Be Dynamic in Hair Bundles of the Model Sea Anemone Nematostella vectensis

    OpenAIRE

    Pei-Ciao Tang; Watson, Glen M.

    2014-01-01

    Cadherin 23 (CDH23), a component of tip links in hair cells of vertebrate animals, is essential to mechanotransduction by hair cells in the inner ear. A homolog of CDH23 occurs in hair bundles of sea anemones. Anemone hair bundles are located on the tentacles where they detect the swimming movements of nearby prey. The anemone CDH23 is predicted to be a large polypeptide featuring a short exoplasmic C-terminal domain that is unique to sea anemones. Experimentally masking this domain with anti...

  12. Cadherin-23 may be dynamic in hair bundles of the model sea anemone Nematostella vectensis.

    Directory of Open Access Journals (Sweden)

    Pei-Ciao Tang

    Full Text Available Cadherin 23 (CDH23, a component of tip links in hair cells of vertebrate animals, is essential to mechanotransduction by hair cells in the inner ear. A homolog of CDH23 occurs in hair bundles of sea anemones. Anemone hair bundles are located on the tentacles where they detect the swimming movements of nearby prey. The anemone CDH23 is predicted to be a large polypeptide featuring a short exoplasmic C-terminal domain that is unique to sea anemones. Experimentally masking this domain with antibodies or mimicking this domain with free peptide rapidly disrupts mechanotransduction and morphology of anemone hair bundles. The loss of normal morphology is accompanied, or followed by a decrease in F-actin in stereocilia of the hair bundles. These effects were observed at very low concentrations of the reagents, 0.1-10 nM, and within minutes of exposure. The results presented herein suggest that: (1 the interaction between CDH23 and molecular partners on stereocilia of hair bundles is dynamic and; (2 the interaction is crucial for normal mechanotransduction and morphology of hair bundles.

  13. Evidence for participation of GCS1 in fertilization of the starlet sea anemone Nematostella vectensis: Implication of a common mechanism of sperm–egg fusion in plants and animals

    International Nuclear Information System (INIS)

    Highlights: • GCS1 is a sperm transmembrane protein that is essential for gamete fusion in flowering plants. • The GCS1 gene is present not only in angiosperms but also in unicellular organisms and animals. • NvGCS1 gene is expressed in the testis and GCS1 protein exists in sperm of a sea anemone. • Anti-GCS1 antibodies inhibited the fertilization, showing the participation in fertilization. - Abstract: It has been reported that GCS1 (Generative Cell Specific 1) is a transmembrane protein that is exclusively expressed in sperm cells and is essential for gamete fusion in flowering plants. The GCS1 gene is present not only in angiosperms but also in unicellular organisms and animals, implying the occurrence of a common or ancestral mechanism of GCS1-mediated gamete fusion. In order to elucidate the common mechanism, we investigated the role of GCS1 in animal fertilization using a sea anemone (Cnidaria), Nematostella vectensis. Although the existence of the GCS1 gene in N. vectensis has been reported, the expression of GCS1 in sperm and the role of GCS1 in fertilization are not known. In this study, we showed that the GCS1 gene is expressed in the testis and that GCS1 protein exists in sperm by in situ hybridization and proteomic analysis, respectively. Then we made four peptide antibodies against the N-terminal extracellular region of NvGCS1. These antibodies specifically reacted to NvGCS1 among sperm proteins on the basis of Western analysis and potently inhibited fertilization in a concentration-dependent manner. These results indicate that sperm GCS1 plays a pivotal role in fertilization, most probably in sperm–egg fusion, in a starlet sea anemone, suggesting a common gamete-fusion mechanism shared by eukaryotic organisms

  14. Enzymes of the shikimic acid pathway encoded in the genome of a basal metazoan, Nematostella vectensis, have microbial origins

    OpenAIRE

    Starcevic, Antonio; Akthar, Shamima; Dunlap, Walter C.; Shick, J. Malcolm; Hranueli, Daslav; Cullum, John; Long, Paul F.

    2008-01-01

    The shikimic acid pathway is responsible for the biosynthesis of many aromatic compounds by a broad range of organisms, including bacteria, fungi, plants, and some protozoans. Animals are considered to lack this pathway, as evinced by their dietary requirement for shikimate-derived aromatic amino acids. We challenge the universality of this traditional view in this report of genes encoding enzymes for the shikimate pathway in an animal, the starlet sea anemone Nematostella vectensis. Molecula...

  15. Nme gene family evolutionary history reveals pre-metazoan origins and high conservation between humans and the sea anemone, Nematostella vectensis.

    Directory of Open Access Journals (Sweden)

    Thomas Desvignes

    Full Text Available BACKGROUND: The Nme gene family is involved in multiple physiological and pathological processes such as cellular differentiation, development, metastatic dissemination, and cilia functions. Despite the known importance of Nme genes and their use as clinical markers of tumor aggressiveness, the associated cellular mechanisms remain poorly understood. Over the last 20 years, several non-vertebrate model species have been used to investigate Nme functions. However, the evolutionary history of the family remains poorly understood outside the vertebrate lineage. The aim of the study was thus to elucidate the evolutionary history of the Nme gene family in Metazoans. METHODOLOGY/PRINCIPAL FINDINGS: Using a total of 21 eukaryote species including 14 metazoans, the evolutionary history of Nme genes was reconstructed in the metazoan lineage. We demonstrated that the complexity of the Nme gene family, initially thought to be restricted to chordates, was also shared by the metazoan ancestor. We also provide evidence suggesting that the complexity of the family is mainly a eukaryotic innovation, with the exception of Nme8 that is likely to be a choanoflagellate/metazoan innovation. Highly conserved gene structure, genomic linkage, and protein domains were identified among metazoans, some features being also conserved in eukaryotes. When considering the entire Nme family, the starlet sea anemone is the studied metazoan species exhibiting the most conserved gene and protein sequence features with humans. In addition, we were able to show that most of the proteins known to interact with human NME proteins were also found in starlet sea anemone. CONCLUSION/SIGNIFICANCE: Together, our observations further support the association of Nme genes with key cellular functions that have been conserved throughout metazoan evolution. Future investigations of evolutionarily conserved Nme gene functions using the starlet sea anemone could shed new light on a wide variety of

  16. A thrombospondin in the anthozoan Nematostella vectensis is associated with the nervous system and upregulated during regeneration

    Directory of Open Access Journals (Sweden)

    Richard P. Tucker

    2012-12-01

    Thrombospondins are multimeric extracellular matrix glycoproteins that play important roles in development, synaptogenesis and wound healing in mammals. We previously identified four putative thrombospondins in the genome of the starlet sea anemone Nematostella vectensis. This study presents the first analysis of these thrombospondins, with the goals of understanding fundamental roles of thrombospondins in the Eumetazoa. Reverse transcriptase PCR showed that each of the N. vectensis thrombospondins (Nv85341, Nv22035, Nv168100 and Nv30790 is transcribed. Three of the four thrombospondins include an RGD or KGD motif in their thrombospondin type 3 repeats at sites equivalent to mammalian thrombospondins, suggesting ancient roles as RGD integrin ligands. Phylogenetic analysis based on the C-terminal regions demonstrated a high level of sequence diversity between N. vectensis thrombospondins. A full-length cDNA sequence was obtained for Nv168100 (NvTSP168100, which has an unusual domain organization. Immunohistochemistry with an antibody to NvTSP168100 revealed labeling of neuron-like cells in the mesoglea of the retractor muscles and the pharynx. In situ hybridization and quantitative PCR showed that NvTSP168100 is upregulated during regeneration. Immunohistochemistry of the area of regeneration identified strong immunostaining of the glycocalyx, the carbohydrate-rich matrix coating the epidermis, and electron microscopy identified changes in glycocalyx organization during regeneration. Thus, N. vectensis thrombospondins share structural features with thrombospondins from mammals and may have roles in the nervous system and in matrix reorganization during regeneration.

  17. Enzymes of the shikimic acid pathway encoded in the genome of a basal metazoan, Nematostella vectensis, have microbial origins.

    Science.gov (United States)

    Starcevic, Antonio; Akthar, Shamima; Dunlap, Walter C; Shick, J Malcolm; Hranueli, Daslav; Cullum, John; Long, Paul F

    2008-02-19

    The shikimic acid pathway is responsible for the biosynthesis of many aromatic compounds by a broad range of organisms, including bacteria, fungi, plants, and some protozoans. Animals are considered to lack this pathway, as evinced by their dietary requirement for shikimate-derived aromatic amino acids. We challenge the universality of this traditional view in this report of genes encoding enzymes for the shikimate pathway in an animal, the starlet sea anemone Nematostella vectensis. Molecular evidence establishes horizontal transfer of ancestral genes of the shikimic acid pathway into the N. vectensis genome from both bacterial and eukaryotic (dinoflagellate) donors. Bioinformatic analysis also reveals four genes that are closely related to those of Tenacibaculum sp. MED152, raising speculation for the existence of a previously unsuspected bacterial symbiont. Indeed, the genome of the holobiont (i.e., the entity consisting of the host and its symbionts) comprises a high content of Tenacibaculum-like gene orthologs, including a 16S rRNA sequence that establishes the phylogenetic position of this associate to be within the family Flavobacteriaceae. These results provide a complementary view for the biogenesis of shikimate-related metabolites in marine Cnidaria as a "shared metabolic adaptation" between the partners. PMID:18268342

  18. Continuous Drug Release by Sea Anemone Nematostella vectensis Stinging Microcapsules

    OpenAIRE

    Yossi Tal; Ari Ayalon; Agnesa Sharaev; Zoya Kazir; Vera Brekhman; Tamar Lotan

    2014-01-01

    Transdermal delivery is an attractive option for drug delivery. Nevertheless, the skin is a tough barrier and only a limited number of drugs can be delivered through it. The most difficult to deliver are hydrophilic drugs. The stinging mechanism of the cnidarians is a sophisticated injection system consisting of microcapsular nematocysts, which utilize built-in high osmotic pressures to inject a submicron tubule that penetrates and delivers their contents to the prey. Here we show, for the fi...

  19. Glypican1/2/4/6 and sulfated glycosaminoglycans regulate the patterning of the primary body axis in the cnidarian Nematostella vectensis.

    Science.gov (United States)

    Bause, Markus; van der Horst, Roddy; Rentzsch, Fabian

    2016-06-01

    Glypicans are members of the heparan sulfate (HS) subfamily of proteoglycans that can function in cell adhesion, cell crosstalk and as modulators of the major developmental signalling pathways in bilaterians. The evolutionary origin of these multiple functions is not well understood. In this study we investigate the role of glypicans in the embryonic and larval development of the sea anemone Nematostella vectensis, a member of the non-bilaterian clade Cnidaria. Nematostella has two glypican (gpc) genes that are expressed in mutually exclusive ectodermal domains, NvGpc1/2/4/6 in a broad aboral domain, and NvGpc3/5 in narrow oral territory. The endosulfatase NvSulf (an extracellular modifier of HS chains) is expressed in a broad oral domain, partially overlapping with both glypicans. Morpholino-mediated knockdown of NvGpc1/2/4/6 leads to an expansion of the expression domains of aboral marker genes and a reduction of oral markers at gastrula stage, strikingly similar to knockdown of the Wnt receptor NvFrizzled5/8. We further show that treatment with sodium chlorate, an inhibitor of glycosaminoglycan (GAG) sulfation, phenocopies knockdown of NvGpc1/2/4/6 at gastrula stage. At planula stage, knockdown of NvGpc1/2/4/6 and sodium chlorate treatment result in alterations in aboral marker gene expression that suggest additional roles in the fine-tuning of patterning within the aboral domain. These results reveal a role for NvGpc1/2/4/6 and sulfated GAGs in the patterning of the primary body axis in Nematostella and suggest an ancient function in regulating Frizzled-mediated Wnt signalling. PMID:27090806

  20. Strabismus-mediated primary archenteron invagination is uncoupled from Wnt/β-catenin-dependent endoderm cell fate specification in Nematostella vectensis (Anthozoa, Cnidaria: Implications for the evolution of gastrulation

    Directory of Open Access Journals (Sweden)

    Kumburegama Shalika

    2011-01-01

    Full Text Available Abstract Background Gastrulation is a uniquely metazoan character, and its genesis was arguably the key step that enabled the remarkable diversification within this clade. The process of gastrulation involves two tightly coupled events during embryogenesis of most metazoans. Morphogenesis produces a distinct internal epithelial layer in the embryo, and this epithelium becomes segregated as an endoderm/endomesodermal germ layer through the activation of a specific gene regulatory program. The developmental mechanisms that induced archenteron formation and led to the segregation of germ layers during metazoan evolution are unknown. But an increased understanding of development in early diverging taxa at the base of the metazoan tree may provide insights into the origins of these developmental mechanisms. Results In the anthozoan cnidarian Nematostella vectensis, initial archenteron formation begins with bottle cell-induced buckling of the blastula epithelium at the animal pole. Here, we show that bottle cell formation and initial gut invagination in Nematostella requires NvStrabismus (NvStbm, a maternally-expressed core component of the Wnt/Planar Cell Polarity (PCP pathway. The NvStbm protein is localized to the animal pole of the zygote, remains asymmetrically expressed through the cleavage stages, and becomes restricted to the apical side of invaginating bottle cells at the blastopore. Antisense morpholino-mediated NvStbm-knockdown blocks bottle cell formation and initial archenteron invagination, but it has no effect on Wnt/ß-catenin signaling-mediated endoderm cell fate specification. Conversely, selectively blocking Wnt/ß-catenin signaling inhibits endoderm cell fate specification but does not affect bottle cell formation and initial archenteron invagination. Conclusions Our results demonstrate that Wnt/PCP-mediated initial archenteron invagination can be uncoupled from Wnt/ß-catenin-mediated endoderm cell fate specification in

  1. Comprehensive EST analysis of the symbiotic sea anemone, Anemonia viridis

    Directory of Open Access Journals (Sweden)

    Deleury Emeline

    2009-07-01

    Full Text Available Abstract Background Coral reef ecosystems are renowned for their diversity and beauty. Their immense ecological success is due to a symbiotic association between cnidarian hosts and unicellular dinoflagellate algae, known as zooxanthellae. These algae are photosynthetic and the cnidarian-zooxanthellae association is based on nutritional exchanges. Maintenance of such an intimate cellular partnership involves many crosstalks between the partners. To better characterize symbiotic relationships between a cnidarian host and its dinoflagellate symbionts, we conducted a large-scale EST study on a symbiotic sea anemone, Anemonia viridis, in which the two tissue layers (epiderm and gastroderm can be easily separated. Results A single cDNA library was constructed from symbiotic tissue of sea anemones A. viridis in various environmental conditions (both normal and stressed. We generated 39,939 high quality ESTs, which were assembled into 14,504 unique sequences (UniSeqs. Sequences were analysed and sorted according to their putative origin (animal, algal or bacterial. We identified many new repeated elements in the 3'UTR of most animal genes, suggesting that these elements potentially have a biological role, especially with respect to gene expression regulation. We identified genes of animal origin that have no homolog in the non-symbiotic starlet sea anemone Nematostella vectensis genome, but in other symbiotic cnidarians, and may therefore be involved in the symbiosis relationship in A. viridis. Comparison of protein domain occurrence in A. viridis with that in N. vectensis demonstrated an increase in abundance of some molecular functions, such as protein binding or antioxidant activity, suggesting that these functions are essential for the symbiotic state and may be specific adaptations. Conclusion This large dataset of sequences provides a valuable resource for future studies on symbiotic interactions in Cnidaria. The comparison with the closest

  2. Development of the aboral domain in Nematostella requires β-catenin and the opposing activities of Six3/6 and Frizzled5/8

    Science.gov (United States)

    Leclère, Lucas; Bause, Markus; Sinigaglia, Chiara; Steger, Julia; Rentzsch, Fabian

    2016-01-01

    ABSTRACT The development of the oral pole in cnidarians and the posterior pole in bilaterians is regulated by canonical Wnt signaling, whereas a set of transcription factors, including Six3/6 and FoxQ2, controls aboral development in cnidarians and anterior identity in bilaterians. However, it is poorly understood how these two patterning systems are initially set up in order to generate correct patterning along the primary body axis. Investigating the early steps of aboral pole formation in the sea anemone Nematostella vectensis, we found that, at blastula stage, oral genes are expressed before aboral genes and that Nvβ-catenin regulates both oral and aboral development. In the oral hemisphere, Nvβ-catenin specifies all subdomains except the oral-most, NvSnailA-expressing domain, which is expanded upon Nvβ-catenin knockdown. In addition, Nvβ-catenin establishes the aboral patterning system by promoting the expression of NvSix3/6 at the aboral pole and suppressing the Wnt receptor NvFrizzled5/8 at the oral pole. NvFrizzled5/8 expression thereby gets restricted to the aboral domain. At gastrula stage, NvSix3/6 and NvFrizzled5/8 are both expressed in the aboral domain, but they have opposing activities, with NvSix3/6 maintaining and NvFrizzled5/8 restricting the size of the aboral domain. At planula stage, NvFrizzled5/8 is required for patterning within the aboral domain and for regulating the size of the apical organ by modulation of a previously characterized FGF feedback loop. Our findings suggest conserved roles for Six3/6 and Frizzled5/8 in aboral/anterior development and reveal key functions for Nvβ-catenin in the patterning of the entire oral-aboral axis of Nematostella. PMID:26989171

  3. Distribution of CpG Motifs in Upstream Gene Domains in a Reef Coral and Sea Anemone: Implications for Epigenetics in Cnidarians

    Science.gov (United States)

    Marsh, Adam G.; Hoadley, Kenneth D.; Warner, Mark E.

    2016-01-01

    Coral reefs are under assault from stressors including global warming, ocean acidification, and urbanization. Knowing how these factors impact the future fate of reefs requires delineating stress responses across ecological, organismal and cellular scales. Recent advances in coral reef biology have integrated molecular processes with ecological fitness and have identified putative suites of temperature acclimation genes in a Scleractinian coral Acropora hyacinthus. We wondered what unique characteristics of these genes determined their coordinate expression in response to temperature acclimation, and whether or not other corals and cnidarians would likewise possess these features. Here, we focus on cytosine methylation as an epigenetic DNA modification that is responsive to environmental stressors. We identify common conserved patterns of cytosine-guanosine dinucleotide (CpG) motif frequencies in upstream promoter domains of different functional gene groups in two cnidarian genomes: a coral (Acropora digitifera) and an anemone (Nematostella vectensis). Our analyses show that CpG motif frequencies are prominent in the promoter domains of functional genes associated with environmental adaptation, particularly those identified in A. hyacinthus. Densities of CpG sites in upstream promoter domains near the transcriptional start site (TSS) are 1.38x higher than genomic background levels upstream of -2000 bp from the TSS. The increase in CpG usage suggests selection to allow for DNA methylation events to occur more frequently within 1 kb of the TSS. In addition, observed shifts in CpG densities among functional groups of genes suggests a potential role for epigenetic DNA methylation within promoter domains to impact functional gene expression responses in A. digitifera and N. vectensis. Identifying promoter epigenetic sequence motifs among genes within specific functional groups establishes an approach to describe integrated cellular responses to environmental stress in

  4. Distribution of CpG Motifs in Upstream Gene Domains in a Reef Coral and Sea Anemone: Implications for Epigenetics in Cnidarians.

    Directory of Open Access Journals (Sweden)

    Adam G Marsh

    Full Text Available Coral reefs are under assault from stressors including global warming, ocean acidification, and urbanization. Knowing how these factors impact the future fate of reefs requires delineating stress responses across ecological, organismal and cellular scales. Recent advances in coral reef biology have integrated molecular processes with ecological fitness and have identified putative suites of temperature acclimation genes in a Scleractinian coral Acropora hyacinthus. We wondered what unique characteristics of these genes determined their coordinate expression in response to temperature acclimation, and whether or not other corals and cnidarians would likewise possess these features. Here, we focus on cytosine methylation as an epigenetic DNA modification that is responsive to environmental stressors. We identify common conserved patterns of cytosine-guanosine dinucleotide (CpG motif frequencies in upstream promoter domains of different functional gene groups in two cnidarian genomes: a coral (Acropora digitifera and an anemone (Nematostella vectensis. Our analyses show that CpG motif frequencies are prominent in the promoter domains of functional genes associated with environmental adaptation, particularly those identified in A. hyacinthus. Densities of CpG sites in upstream promoter domains near the transcriptional start site (TSS are 1.38x higher than genomic background levels upstream of -2000 bp from the TSS. The increase in CpG usage suggests selection to allow for DNA methylation events to occur more frequently within 1 kb of the TSS. In addition, observed shifts in CpG densities among functional groups of genes suggests a potential role for epigenetic DNA methylation within promoter domains to impact functional gene expression responses in A. digitifera and N. vectensis. Identifying promoter epigenetic sequence motifs among genes within specific functional groups establishes an approach to describe integrated cellular responses to

  5. FGF signaling in gastrulation and neural development in Nematostella vectensis, an anthozoan cnidarian

    OpenAIRE

    Matus, David Q.; Thomsen, Gerald H.; Martindale, Mark Q.

    2007-01-01

    The fibroblast growth factor (FGF) signal transduction pathway serves as one of the key regulators of early metazoan development, displaying conserved roles in the specification of endodermal, mesodermal, and neural fates during vertebrate development. FGF signals also regulate gastrulation, in part, by triggering epithelial to mesenchymal transitions in embryos of both vertebrates and invertebrates. Thus, FGF signals coordinate gastrulation movements across many different phyla. To help unde...

  6. Gene : CBRC-CBRE-01-0818 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available SACLFVCLSVCLSVCLSACLPACLSVCLSVCLSVCLSACLSACLPVCLPACLSVCLPVCLPVCLSVCLSVRLSVCLPVCLSVCLSVCLSVCLSVCLSVRLPACLSVCL...PVCLSVCLSACLSACLPACLSVCLSVCLSVCLSACLSVCLSVCLSICLSIYPDVHRP...icted protein [Nematostella vectensis] gb|EDO46452.1| predicted protein [Nematostella vectensis] 3e-61 71% MSGCPDTWASRCPDVCLSVCLYVCL

  7. Gene : CBRC-PABE-26-0183 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available cted protein [Nematostella vectensis] gb|EDO35054.1| predicted protein [Nematostella vectensis] 4e-19 34% MLLCA...TTTLLCVITALRCAITLLYARTTLLCAITLLCVITVLRCAITLLYARTTLLCAITLLCATTTLLCATTTLLCAVTLLCATTTLLCATTTLLCAMTTLLCAITLLCAITTLLCA...ATTLLGAITTRLCDIATLLCAITMLLCATTPLLCAITLLCAITLLCAITTLLCHNNAAVCHNTAVWLASCPALPHLPGTGLSLQCWRWPGSHRCPCCSHASCFLG ...

  8. Gene : CBRC-TSYR-01-0464 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available cted protein [Nematostella vectensis] gb|EDO31021.1| predicted protein [Nematostella vectensis] 9e-33 29% MP...FHLFKFLSIPYLWIPFHSIALLFIPLLSTPLHSIPFHAFPFHFIPLHPIPLYFFLFHSSPFHSIPFLSIHFLSIPLLSIPFLCITFISILLHCPLIYSILLISISLHPIPLHAIPL...HSVALYSIPCVTITLPLIPLHSFPLHASFLHSSPSQSISLHSIPFQSIRFHCTPLLSTPFHWAALHFVPRHSIPL...LSIPIHILCFLFLSLPFNIFTLNDIPFLPFLSIPLITFHSSSFPSIPFLCNPFHYIALHSIPFPLIPLHSISAHSIPFHFTAFHSSSLHSILFHSILLYSLPLHSIPLLSIPSNPFLSI ...

  9. Gene : CBRC-TSYR-01-0383 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available icted protein [Nematostella vectensis] gb|EDO31021.1| predicted protein [Nematostella vectensis] 3e-30 28% MDSSLFITIPFHSSSFQSSHSIPL...HITPLPSITLHSSDSISFHSILLLLIPFLCIPFHTSPFHSFPLHSIPLHSIPLFSIPFHFSPFHSISHHSIPFHSILFLSILLLSILLLSIPFHSISYLSIPL...HFSPFHCFPFLLIPFLLIPLYSIAFHYFFLIPLHSIPLYSTPFHYIPFHSIPFHPIQFHSCTLVFIPFHSSLFLSIPL...LSIPVLSIPVHSKTYLSISCHSVEFPSIPFLSSPFHSIPFHDTVSIPFASIPLDSIPSHSSPLHFFPFLSSLSIPFLSITLHSSPFNSISIHSIPLHFSPFHFIPFRSFLF ...

  10. Gene : CBRC-OPRI-01-1408 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available ted protein [Nematostella vectensis] gb|EDO40287.1| predicted protein [Nematostella vectensis] 1e-30 30% MRRVSMGAWGMRLVSMGAWGMRLVSMGA...WGMRLVSMGAWGMRLVSMGAWGMRLVSMGAWGMRLVSMGAWGMRLVSMGAWGMRLVSMGAWGMRLVSMGAWGMRLVSMGAWGMRLVSMGAWGMRLVSMGA...WGMRLVSMGAWGMRLVSMGAWGMRLVSMGAWGMRLVSMGCMGNEACLHGCMGNEACLHGCMGNE...ACLHGCMGNEACLHGCMGNEACLHGCTGNEACLHGCTGNEACLHASWGLRRVSMGAWGMRLVSMGAWGMRLVSMGAWGMRLVSMGAWGMRRVSMGAWGMRLVSMGAWGMRRVSMGAWGMRLVSMGAWGMRLVSMGAWGMRLVSMGAWGMRRVSMGAWGMRQPQLQREGGKWPQGS ...

  11. Gene : CBRC-PTRO-27-0197 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available cted protein [Nematostella vectensis] gb|EDO40259.1| predicted protein [Nematostella vectensis] 5e-11 18% MKIPRQRPSASRVRVMMVSPQRPSAS...RVWVMMVSPQWSSASRVWVMMVSPQRPSASWVWVMMVSPHRPSASWVWVMMVSPQRPSASWVQGIKIPRQRSSASWVQVMMVSRQRPSSSWVRVMKIPRQGPSAS...WVWVMMVSPQPPSASWVWVMMVSPLRSSASWVWVMMVSPQWPLVWVMMVSPQWPSASWVRVMMVSPQRPSA...CSVWVMMVSPQRPSASWVWVMMVSPQWPLVWVMMVSPQWPSASWVRLMKIPRQRPFASWVQVMMVSPPRPSASWVRVMMVSPQRPSASWVRVMMVSPQRPSASWVWVVLLTSAS ...

  12. Gene : CBRC-CREM-01-1038 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available cted protein [Nematostella vectensis] gb|EDO39667.1| predicted protein [Nematostella vectensis] 1e-04 23% MGLQFLYLLKLIRIFIILRILRIF...RKRHVRRTRVQSSLMGLQFLYLLKLIRIFIISRILRIFRKRHVRRTRVQSSLMGLQFLYLLKLIRIFIILRILRIFRKRHVRRTRV...QSSLMGLQFLYLIKLIKIFIILRILRIFRKRHVRRTRVQSSLMGLQFLYLIKLIRIFGTLRILRILRKRHVRRTRVQSSLMGLQFLYLIKLIRIFGTLRILRILRKRHVRRTRVQSSLMGLQFLYLIKLIRIFIILRIV ...

  13. Multi-scale modeling of gene regulation of morphogenesis

    NARCIS (Netherlands)

    J.A. Kaandorp; D. Botman; C. Tamulonis; R Dries

    2012-01-01

    In this paper we demonstrate a spatio-temporal gene regulatory network for early gastrulation in the sea anemone Nematostella vectensis. We measure gene expression during early gastrulation using a gene expression quantification tool. We measure gene expression during early gastrulation when the emb

  14. Gene : CBRC-CJAC-01-0867 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available [Nematostella vectensis] 7e-26 33% MMSLCPGWMMTSPCPGWMMTSPCPGWMMMSPCPGWMMTSPCPGWMMMSPCPGWMMTSPCPGWMMRS...PCPGWMMRSPCPGWMMRSLCPGWMMTSLCPGWMMRSTCPGWMMTSPCPGWMMRSPCPGWMMRSLCPGWMMTSLCPGWMMRSTCPGWMMTSPCPGWMMRSPCPGWMMRS...PCPGWMMRSLCPGWMMTSLCPGWMMRSPCPGWMMTSPCPGWMMRSPCPGWMMRSLCPGWMMRSPCPGWMMRSLCPGWMMTSPCPGWMMMSPCPGWMMTSPCPEWMMTSPCPG ...

  15. Gene : CBRC-PHAM-01-1715 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available etical protein NEMVEDRAFT_v1g4917 [Nematostella vectensis] gb|EDO26657.1| predicted protein [Nematostella vectensis] 2e-34 41% MPLC...SCAPVPHASVLLCSCAPVPRAPVLLCSCAPVPAPVPLCSCAPVTLCSCAPVLLCPCAPVPLFLRASVLLCPCAPVPPCPCAPLLLCPFAPVPLCPVPPCSCAPVPLC...PFAPVLLCPFAPVPRDPLLLCPCAPVPRDPVPRAPVLLCSCAPVPLCPVPLCSYAPVPLCPVPLCSCAPVPAPVPLC...SCAPVTLCSCAPVLLCPCGPVSLFPRAPVLLCPCAPVPLCPFAPVPLCPVPPCSCATVPLCPFAPVLLCPFAPVPCAPLLLCPCDPVPL ...

  16. Gene : CBRC-LAFR-01-0730 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available tical protein NEMVEDRAFT_v1g157548 [Nematostella vectensis] gb|EDO25349.1| predicted protein [Nematostella vectensis] 1e-10 37% MSVII...LLLGTYGAIIILLLCTHGPVIILLLGTRGPVIILHLCTHGPVIILLLDTHGSVIILLLGTHESVIILLLLTHEPVIILLLCTNWPVIILLLDTQVPVII...LLLDINSPVIILLLGTHEPVITLPLGTHGPVIILVLCTHKPIIILLLCTHWPVIILLLGTHELVIILLGTPEPVIILLLGTHGPVIILLCTHKPIIILLLGTPEPVIILLLCTHAPVIILLRLPVSCC ...

  17. Gene : CBRC-ACAR-01-0435 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available hetical protein NEMVEDRAFT_v1g221917 [Nematostella vectensis] gb|EDO29398.1| predicted protein [Nematostella... vectensis] 2e-14 20% MYFLISVYIYETYELHMTYDFKTKICTFLIGTKYIYFLISVYIYETYELHMTYDFKTKICTFLICTKYMYFLISVYIYETYELHMTYDFKTKICT...FLIGTKYIYFLISVYIYETYELHMTYDFKTKICTFLIGTKYIYFLISVYIYKTYKLHPTYDFKTKICTFLIG...TKYIYFLISVYIYKTYKLHPTYNFKTKICTFLIGTKYMYFLISVYIYETYELHMTYDFKTKICTFLICTKYMYFLISVYIYETYELHTTYDFKTKNCISQISIRCVCVCVYIYIYIYIYGF ...

  18. Gene : CBRC-HSAP-02-0042 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available ed protein [Nematostella vectensis] gb|EDO31021.1| predicted protein [Nematostella vectensis] 3e-62 39% gnl|...SKERQNSNSVSLRLLWGLNQEGVNFCDIYMRLCFRQQLSSLSYAILSYAILSYATLCYATLCYAMLCYPIPSCPFPSLPFPSHLIPFYPIPSHPIPSHPFISYPTLTY...PMLSYSILSYSILSIHMLSHIPSYPILCCPIPSCPILPFPMLSHPTPPHPISSYLIPSHPIPSHPIPSHPILSYPILSYPIPSHPILSHPIPSHPIPSYPLLSQPTPCHPMLSYPI...LPHAILSSPLLSCTIPSYPILFFLFLSYPILSYPILSYPILSYPILSYSIPSHPIPSHPIPSYPIPSPLILSYPILSYPILSYPI...LSYLIPSHPLSSHPIPSYPILSYPIPSHPIPSHPILSYPIPSHPLSSYPILSYPILSYPILSYPSPSHPIPSHPIPFHPILSYPILSHPIPSRPVPSRLIPSHSILFYSILSYPILSYPI

  19. Gene : CBRC-PTRO-01-0006 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available cted protein [Nematostella vectensis] gb|EDO37921.1| predicted protein [Nematostella vectensis] 2e-44 46% MDPLLWAVG...CGLCAVCCVLWAVCCGLWAVCCVLCAVGCGLCPVCCVLCAVSSVLWAVSCGLWAVCCGLCPVCCGLCAVGCGLCAVGCGLWAVCCGLCPVCCVLCPVCCVLCPVCCVLWAVG...CVLCAVCCVLCPVCCVLCAVGCVLCALCCVLCAVGCVLWAVSCVLCAVGCGLCTVCCGLCAMGCGLCAVGCVLCPVCRGLWAVCCGLWAVG...CVLCAVSCVLCAVGCGLCAVGCVLCPVCCVLWAVCCGLCPVSCVLCAVGCVLWVVCCGLCAVGXXXXXXXXXXXXXXXXXXXXXXXX...XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVCCVLWACVLWVVCCGLCAVGCVL

  20. Gene : CBRC-MEUG-01-2708 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available cted protein [Nematostella vectensis] gb|EDO44059.1| predicted protein [Nematostella vectensis] 1e-12 24% MEAFLFPPGVLACGVISFGIS...RAMEAFLFSPGVLVCGVISFGVARAMEALLFLPGVLACGVISFGISRAMEAFLFSPGVLACDVISFGISRAMEALLFLPGVLACGVISFGIS...RAMEAFLFSPGVLVCGXXXXLESPEPWRHPLSPGVLVVVYLFRSCQSHGGLLFLPGVLACGVISFGISRAMEAFLFSPGVLACDVISFGIS...RAMEALLFLPGVLACGVISFGISRAMEAFLFSPGVLVCGVISFGVARAMEALLFLPGVLACGVISFGISRAMEAFLFSPGVLACDVISFGVARAMEALLFLPGVLACGVISFGIS...RAMEAFFFSPGVLACDVISFGISRAMETFLFSPGVLACGVVSFGVARAMKAFFFSPGVLACGVISFGVIRAKEDFLFSPGVLACGVVSFGVPRAMEAFLFLPGALACGVSALRLSSAGSFVRPAF ...

  1. Gene : CBRC-OGAR-01-0677 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available cted protein [Nematostella vectensis] gb|EDO43974.1| predicted protein [Nematostella vectensis] 1e-15 28% MGKHKPMCAAADAQTGPAF...GTFLRKTAQLFSDRARFLTASQLSTHVWNQRLGKIPLFLQLNILQTLSYADKFTFFFQQRNGIISTHCLLLYSNCESQPILRSVHAPLWPSQGRASPLWPSQGQSCSSVAFS...GQSCSSVAFSRRCMLLCGLLRAEHAPLWPSQGGASSSVAFSGRCMLLCGLLRAVMLLCGLLRVVHPPLWPSQVGACSSVAFS...GQSCSSVAFSGQSCSSVAFSGQSCSSVAFSGQSCSSVAFSGQSCSSVAFSGQSCSSVAFSGQSCSSVAFSGQSCSSVVFSGQSCSSVAFS...GRCMLLCGLLRAVMLLCGLLRAVMFLCGLLRAVMLLFGLLRAVHAPLWPSQGSHAPLWPSQGSHAPLWPSQGGACSSVAFSGQSCSSVAFSGRCMLLCGLLRAVMFLCGLYSAVHAPLWPSQGSHAPLWPSQGSHAPLWPFQGSACSSVV ...

  2. Chemical constituents from rhizome of Anemone amurensis.

    Science.gov (United States)

    Lv, Chong-Ning; Li, Yan-Jiao; Wang, Jing; Qin, Ru-Lan; Lei, Tian-Li; Lu, Jin-Cai

    2016-07-01

    Phytochemical investigation of the 70% EtOH extract of the rhizome of Anemone amurensis led to the isolation of two new oleanane-type triterpenoid saponins 1 and 2. Their structures were elucidated on the basis of chemical and spectral analysis, including 1D, 2D NMR data, and HR-ESI-MS. Compounds 1 and 2 were tested for cytotoxicities against two human cancer cell lines (A549 and Hep-G2). Compound 2 showed potent cytotoxicity with IC50 values of 38.53 and 66.17 μM, respectively, while compound 1 with IC50 > 100 μM. PMID:26978669

  3. Searching for a toxic key to unlock the mystery of anemonefish and anemone symbiosis.

    Directory of Open Access Journals (Sweden)

    Anita M Nedosyko

    Full Text Available Twenty-six species of anemonefish of the genera Amphiprion and monospecific Premnas, use only 10 species of anemones as hosts in the wild (Families: Actiniidae, Stichodactylidae and Thalassianthidae. Of these 10 anemone species some are used by multiple species of anemonefish while others have only a single anemonefish symbiont. Past studies have explored the different patterns of usage between anemonefish species and anemone species; however the evolution of this relationship remains unknown and has been little studied over the past decade. Here we reopen the case, comparing the toxicity of crude venoms obtained from anemones that host anemonefish as a way to investigate why some anemone species are used as a host more than others. Specifically, for each anemone species we investigated acute toxicity using Artemia francisca (LC50, haemolytic toxicity using ovine erythrocytes (EC50 and neurotoxicity using shore crabs (Ozius truncatus. We found that haemolytic and neurotoxic activity varied among host anemone species. Generally anemone species that displayed greater haemolytic activity also displayed high neurotoxic activity and tend to be more toxic on average as indicated by acute lethality analysis. An overall venom toxicity ranking for each anemone species was compared with the number of anemonefish species that are known to associate with each anemone species in the wild. Interestingly, anemones with intermediate toxicity had the highest number of anemonefish associates, whereas anemones with either very low or very high toxicity had the fewest anemonefish associates. These data demonstrate that variation in toxicity among host anemone species may be important in the establishment and maintenance of anemonefish anemone symbiosis.

  4. Two new triterpenoid saponins from rhizome of Anemone raddeana Regel

    DEFF Research Database (Denmark)

    Fan, Li; Lu, Jincai; Wang, Jing;

    2009-01-01

    Two new 27-hydroxyoleanolic acid-type triterpenoid saponins, raddeanoside Ra (1) and raddeanoside Rb (2), were isolated from the rhizome of Anemone raddeana Regel. The structures of the two compounds were elucidated to be 27-hydroxyoleanolic acid 3-O-beta-D: -glucopyranosyl-(1 --> 4)-alpha...

  5. First observations of attempted nudibranch predation by sea anemones

    NARCIS (Netherlands)

    Meij, van der S.E.T.; Reijnen, B.T.

    2011-01-01

    On two separate occasions during fieldwork in Semporna (eastern Sabah, Malaysia), sea anemones of the family Edwardsiidae were observed attempting to feed on the nudibranch species Nembrotha lineolata and Phyllidia ocellata. These are the first in situ observations of nudibranch predation by sea ane

  6. Expanded functional diversity of shaker K(+ channels in cnidarians is driven by gene expansion.

    Directory of Open Access Journals (Sweden)

    Timothy Jegla

    Full Text Available The genome of the cnidarian Nematostella vectensis (starlet sea anemone provides a molecular genetic view into the first nervous systems, which appeared in a late common ancestor of cnidarians and bilaterians. Nematostella has a surprisingly large and diverse set of neuronal signaling genes including paralogs of most neuronal signaling molecules found in higher metazoans. Several ion channel gene families are highly expanded in the sea anemone, including three subfamilies of the Shaker K(+ channel gene family: Shaker (Kv1, Shaw (Kv3 and Shal (Kv4. In order to better understand the physiological significance of these voltage-gated K(+ channel expansions, we analyzed the function of 18 members of the 20 gene Shaker subfamily in Nematostella. Six of the Nematostella Shaker genes express functional homotetrameric K(+ channels in vitro. These include functional orthologs of bilaterian Shakers and channels with an unusually high threshold for voltage activation. We identified 11 Nematostella Shaker genes with a distinct "silent" or "regulatory" phenotype; these encode subunits that function only in heteromeric channels and serve to further diversify Nematostella Shaker channel gating properties. Subunits with the regulatory phenotype have not previously been found in the Shaker subfamily, but have evolved independently in the Shab (Kv2 family in vertebrates and the Shal family in a cnidarian. Phylogenetic analysis indicates that regulatory subunits were present in ancestral cnidarians, but have continued to diversity at a high rate after the split between anthozoans and hydrozoans. Comparison of Shaker family gene complements from diverse metazoan species reveals frequent, large scale duplication has produced highly unique sets of Shaker channels in the major metazoan lineages.

  7. Dicty_cDB: Contig-U15590-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 2 ( DV084509 ) 327-384-12_L06_KS Nematostella vectensis normaliz... 56 0.011 1 ( FC237518 ) CAGH11793.fwd CAGH Nema...tostella vectensis Nemve L... 56 0.011 1 ( FC225732 ) CAGF8767.fwd CAGF Nematostella vectensi...s Nemve Ea... 56 0.011 1 ( FC223486 ) CAGF7497.fwd CAGF Nematostella vectensis Nemve Ea...... 56 0.011 1 ( FC217602 ) CAGF4462.rev CAGF Nematostella vectensis Nemve Ea... 56 0.011 1 ( FC216624 ) CAGF3956.rev CAGF Nema...A000031 |pid:none) Vibrio parahaemolyticus RIMD 2210... 152 1e-68 CP000964_241( CP000964 |pid:none) Klebsiel

  8. DNA extraction from sea anemone (Cnidaria: Actiniaria) tissues for molecular analyses

    OpenAIRE

    Pinto S.M.; Fernandes-Matioli F.M.C.; Schlenz E.

    2000-01-01

    A specific DNA extraction method for sea anemones is described in which extraction of total DNA from eight species of sea anemones and one species of corallimorpharian was achieved by changing the standard extraction protocols. DNA extraction from sea anemone tissue is made more difficult both by the tissue consistency and the presence of symbiotic zooxanthellae. The technique described here is an efficient way to avoid problems of DNA contamination and obtain large amounts of purified and in...

  9. Sea Anemone (Cnidaria, Anthozoa, Actiniaria Toxins: An Overview

    Directory of Open Access Journals (Sweden)

    Agostinho Antunes

    2012-08-01

    Full Text Available The Cnidaria phylum includes organisms that are among the most venomous animals. The Anthozoa class includes sea anemones, hard corals, soft corals and sea pens. The composition of cnidarian venoms is not known in detail, but they appear to contain a variety of compounds. Currently around 250 of those compounds have been identified (peptides, proteins, enzymes and proteinase inhibitors and non-proteinaceous substances (purines, quaternary ammonium compounds, biogenic amines and betaines, but very few genes encoding toxins were described and only a few related protein three-dimensional structures are available. Toxins are used for prey acquisition, but also to deter potential predators (with neurotoxicity and cardiotoxicity effects and even to fight territorial disputes. Cnidaria toxins have been identified on the nematocysts located on the tentacles, acrorhagi and acontia, and in the mucous coat that covers the animal body. Sea anemone toxins comprise mainly proteins and peptides that are cytolytic or neurotoxic with its potency varying with the structure and site of action and are efficient in targeting different animals, such as insects, crustaceans and vertebrates. Sea anemones toxins include voltage-gated Na+ and K+ channels toxins, acid-sensing ion channel toxins, Cytolysins, toxins with Kunitz-type protease inhibitors activity and toxins with Phospholipase A2 activity. In this review we assessed the phylogentic relationships of sea anemone toxins, characterized such toxins, the genes encoding them and the toxins three-dimensional structures, further providing a state-of-the-art description of the procedures involved in the isolation and purification of bioactive toxins.

  10. The reproduction of the anemone Sagartia troglodytes (PRICE): no influence of tidal manipulation

    NARCIS (Netherlands)

    Hummel, H.; Bogaards, R.H.

    1991-01-01

    The reproductive cycle and the glycogen content were monitored in the subtidal anemone Sagartia troglodytes (PRICE). Moreover, these parameters were followed for periods of 3 to 30 days over the course of 1 year in anemones previously submerged in stagnant water and thus subjected to a reduced food

  11. Parasitic anemone infects the invasive ctenophore Mnemiopsis leidyi in the North East Atlantic

    DEFF Research Database (Denmark)

    Selander, Erik; Møller, Lene Friis; Sundberg, Per;

    2010-01-01

    We report of the first finding of parasitic sea anemone larvae infecting the invasive ctenophore Mnemiopsis leidyi in the North East Atlantic. Parasitic anemone larvae are common in the native habitat of Mnemiopsis, but have not previously been reported from any of the locations where Mnemiopsis...

  12. Gene : CBRC-XTRO-01-3575 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-XTRO-01-3575 Novel UN D UNKNOWN KRA45_HUMAN 1e-06 26% ref|XP_001636178.1| predict...ed protein [Nematostella vectensis] gb|EDO44115.1| predicted protein [Nematostella vectensis] 1e-20 22% g...65 /len=874 3e-11 26% MVHSAFCICTVCHSPYMVYSAFCICTVCYSPGMVYSAFCICTVCHSPYMVYSAFCICTVCYSPGMVYSAFCICTVCYSPGMVYSAFCICTVCYSPGMVYSAFCICT...VCYSPGMVYSAFCICTVCYSPGMVYSAFCICTVCYSPGMVYSAFCICTVCYSPGMVYSAFCICTVCYSPGMVYSAFCICTVCYSPGMVYSAFCICTVCYSPGMVYSAFCICT...VCYSPGMVYSAFCICTVCYSPGMGYGVFRIRGLAVIWISLLYSVLKNNLHFN ...

  13. Gene : CBRC-XTRO-01-0421 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available IFCLPYAACMCHILPALCCLRVPYFACPMLPACAIFCLPYAACVCHTLPYAACVCHTLPALCCLRVPYSALPYAACVCHTLPALCCLHVPYSACPMLPACAILCPMLPVCA.../len=769 2e-58 64% MQYCLCVPYCMSYAACVYHTLPALCCLCVPYSAYPMLPVCAIICLPYPMLPACAYCLPYPACVCHTLPALCCPCVPYCLPYAACMCHTLPALCCLCVPYSACPMLPACA...XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXISNVTLLFVNSIGEPYQTAKRHIVDNIFYFSNSVFQLLRRSVPRCYCQSTVTMSHSHIKPSGTNLPLKAGGWKNSDVVFAHYSDCASLFPPMLHLKLNNLSKGLHSNTPYQGQN ... ...icted protein [Nematostella vectensis] gb|EDO46251.1| predicted protein [Nematostella vectensis] 2e-26 33% gnl|UG|Str#S38792658 CCA...ILCPMLPVGREPGGGLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX

  14. Anemonefish depletion reduces survival, growth, reproduction and fishery productivity of mutualistic anemone-anemonefish colonies

    Science.gov (United States)

    Frisch, Ashley J.; Rizzari, Justin R.; Munkres, Katherine P.; Hobbs, Jean-Paul A.

    2016-06-01

    Intimate knowledge of both partners in a mutualism is necessary to understand the ecology and evolution of each partner, and to manage human impacts that asymmetrically affect one of the partners. Although anemonefishes and their host anemones are iconic mutualists and widely sought by ornamental fisheries, the degree to which anemones depend on anemonefishes, and thus the colony-level effects of collecting anemonefishes, is not well understood. We tracked the size and abundance of anemone Entacmaea quadricolor and anemonefish Amphiprion melanopus colonies for 3 yr after none, some, or all of the resident anemonefish were experimentally removed. Total and partial removal of anemonefish had rapid and sustained negative effects on growth, reproduction and survival of anemones, as well as cascading effects on recruitment and productivity of anemonefish in the remaining colony. As predicted, total removal of anemonefish caused acute declines in size and abundance of anemones, although most anemone colonies (76 %) slowly resumed growth and reproduction after the arrival of anemonefish recruits, which subsequently grew and defended the hosts. Partial removal of anemonefish had similar but typically less severe effects on anemones. Remarkably, the colony-level effects on anemones and anemonefish were proportional to the size and number of anemonefish that were experimentally removed. In particular, anemone survival and anemonefish productivity were highest when one or more adult anemonefish remained in the colony, suggesting that adult fish not only enhanced the protection of anemones, but also increased the recruitment and/or survival of conspecifics. We conclude that the relationship between E. quadricolor and A. melanopus is not only obligate, but also demographically rigid and easily perturbed by anemonefish fisheries. Clearly, these two species must be managed together as a unit and with utmost precaution. To this end, we propose several tangible management actions

  15. Taxonomic, Spatial and Temporal Patterns of Bleaching in Anemones Inhabited by Anemonefishes

    KAUST Repository

    Hobbs, Jean-Paul A.

    2013-08-08

    Background:Rising sea temperatures are causing significant destruction to coral reef ecosystems due to coral mortality from thermally-induced bleaching (loss of symbiotic algae and/or their photosynthetic pigments). Although bleaching has been intensively studied in corals, little is known about the causes and consequences of bleaching in other tropical symbiotic organisms.Methodology/Principal Findings:This study used underwater visual surveys to investigate bleaching in the 10 species of anemones that host anemonefishes. Bleaching was confirmed in seven anemone species (with anecdotal reports of bleaching in the other three species) at 10 of 19 survey locations spanning the Indo-Pacific and Red Sea, indicating that anemone bleaching is taxonomically and geographically widespread. In total, bleaching was observed in 490 of the 13,896 surveyed anemones (3.5%); however, this percentage was much higher (19-100%) during five major bleaching events that were associated with periods of elevated water temperatures and coral bleaching. There was considerable spatial variation in anemone bleaching during most of these events, suggesting that certain sites and deeper waters might act as refuges. Susceptibility to bleaching varied between species, and in some species, bleaching caused reductions in size and abundance.Conclusions/Significance:Anemones are long-lived with low natural mortality, which makes them particularly vulnerable to predicted increases in severity and frequency of bleaching events. Population viability will be severely compromised if anemones and their symbionts cannot acclimate or adapt to rising sea temperatures. Anemone bleaching also has negative effects to other species, particularly those that have an obligate relationship with anemones. These effects include reductions in abundance and reproductive output of anemonefishes. Therefore, the future of these iconic and commercially valuable coral reef fishes is inextricably linked to the ability of host

  16. Taxonomic, spatial and temporal patterns of bleaching in anemones inhabited by anemonefishes.

    Directory of Open Access Journals (Sweden)

    Jean-Paul A Hobbs

    Full Text Available BACKGROUND: Rising sea temperatures are causing significant destruction to coral reef ecosystems due to coral mortality from thermally-induced bleaching (loss of symbiotic algae and/or their photosynthetic pigments. Although bleaching has been intensively studied in corals, little is known about the causes and consequences of bleaching in other tropical symbiotic organisms. METHODOLOGY/PRINCIPAL FINDINGS: This study used underwater visual surveys to investigate bleaching in the 10 species of anemones that host anemonefishes. Bleaching was confirmed in seven anemone species (with anecdotal reports of bleaching in the other three species at 10 of 19 survey locations spanning the Indo-Pacific and Red Sea, indicating that anemone bleaching is taxonomically and geographically widespread. In total, bleaching was observed in 490 of the 13,896 surveyed anemones (3.5%; however, this percentage was much higher (19-100% during five major bleaching events that were associated with periods of elevated water temperatures and coral bleaching. There was considerable spatial variation in anemone bleaching during most of these events, suggesting that certain sites and deeper waters might act as refuges. Susceptibility to bleaching varied between species, and in some species, bleaching caused reductions in size and abundance. CONCLUSIONS/SIGNIFICANCE: Anemones are long-lived with low natural mortality, which makes them particularly vulnerable to predicted increases in severity and frequency of bleaching events. Population viability will be severely compromised if anemones and their symbionts cannot acclimate or adapt to rising sea temperatures. Anemone bleaching also has negative effects to other species, particularly those that have an obligate relationship with anemones. These effects include reductions in abundance and reproductive output of anemonefishes. Therefore, the future of these iconic and commercially valuable coral reef fishes is inextricably linked

  17. DNA extraction from sea anemone (Cnidaria: Actiniaria tissues for molecular analyses

    Directory of Open Access Journals (Sweden)

    Pinto S.M.

    2000-01-01

    Full Text Available A specific DNA extraction method for sea anemones is described in which extraction of total DNA from eight species of sea anemones and one species of corallimorpharian was achieved by changing the standard extraction protocols. DNA extraction from sea anemone tissue is made more difficult both by the tissue consistency and the presence of symbiotic zooxanthellae. The technique described here is an efficient way to avoid problems of DNA contamination and obtain large amounts of purified and integral DNA which can be used in different kinds of molecular analyses.

  18. Molecular cloning of a peptidylglycine alpha-hydroxylating monooxygenase from sea anemones

    DEFF Research Database (Denmark)

    Hauser, F; Williamson, M; Grimmelikhuijzen, C J

    1997-01-01

    activity. No cDNA coding for PAL could be identified, suggesting that sea anemone PAL is coded for by a gene that is different from the sea anemone PHM gene, a situation similar to the one found in insects. This is the first report on the molecular cloning of a cnidarian PHM. Udgivelsesdato: 1997-Dec-18...... conserved regions of PHM, we have now cloned a PHM from the sea anemone Calliactis parasitica showing 42% amino acid sequence identity with rat PHM. Among the conserved (identical) amino acid residues are five histidine and one methionine residue, which bind two Cu2+ atoms that are essential for PHM...

  19. The Antitumor Effects of Triterpenoid Saponins from the Anemone flaccida and the Underlying Mechanism

    OpenAIRE

    Lin-Tao Han; Ying Fang; Ming-Ming Li; Hong-Bing Yang; Fang Huang

    2013-01-01

    Anemone flaccida Fr. Schmidt, a family of ancient hopanoids, have been used as traditional Asian herbs for the treatments of inflammation and convulsant diseases. Previous study on HeLa cells suggested that triterpenoid saponins from Anemone flaccida Fr. Schmidt may have potential antitumor effect due to their apoptotic activities. Here, we confirmed the apoptotic activities of the following five triterpenoid saponins: glycoside St-I4a (1), glycoside St-J (2), anhuienoside E (3), hedera sapon...

  20. Analgesic Compound from Sea Anemone Heteractis crispa Is the First Polypeptide Inhibitor of Vanilloid Receptor 1 (TRPV1)*

    OpenAIRE

    Yaroslav A. Andreev; Kozlov, Sergey A.; Koshelev, Sergey G.; Ekaterina A. Ivanova; Monastyrnaya, Margarita M.; Kozlovskaya, Emma P.; Grishin, Eugene V.

    2008-01-01

    Venomous animals from distinct phyla such as spiders, scorpions, snakes, cone snails, or sea anemones produce small toxic proteins interacting with a variety of cell targets. Their bites often cause pain. One of the ways of pain generation is the activation of TRPV1 channels. Screening of 30 different venoms from spiders and sea anemones for modulation of TRPV1 activity revealed inhibitors in tropical sea anemone Heteractis crispa venom. Several separation steps result...

  1. Characterization of small HSPs from Anemonia viridis reveals insights into molecular evolution of alpha crystallin genes among cnidarians.

    Directory of Open Access Journals (Sweden)

    Aldo Nicosia

    Full Text Available Gene family encoding small Heat-Shock Proteins (sHSPs containing α-crystallin domain are found both in prokaryotic and eukaryotic organisms; however, there is limited knowledge of their evolution. In this study, two small HSP genes termed AvHSP28.6 and AvHSP27, both organized in one intron and two exons, were characterised in the Mediterranean snakelocks anemone Anemonia viridis. The release of the genome sequence of Hydra magnipapillata and Nematostella vectensis enabled a comprehensive study of the molecular evolution of α-crystallin gene family among cnidarians. Most of the H. magnipapillata sHSP genes share the same gene organization described for AvHSP28.6 and AvHSP27, differing from the sHSP genes of N. vectensis which mainly show an intronless architecture. The different genomic organization of sHSPs, the phylogenetic analyses based on protein sequences, and the relationships among Cnidarians, suggest that the A.viridis sHSPs represent the common ancestor from which H. magnipapillata genes directly evolved through segmental genome duplication. Additionally retroposition events may be considered responsible for the divergence of sHSP genes of N. vectensis from A. viridis. Analyses of transcriptional expression profile showed that AvHSP28.6 was constitutively expressed among different tissues from both ectodermal and endodermal layers of the adult sea anemones, under normal physiological conditions and also under different stress condition. Specifically, we profiled the transcriptional activation of AvHSP28.6 after challenges with different abiotic/biotic stresses showing induction by extreme temperatures, heavy metals exposure and immune stimulation. Conversely, no AvHSP27 transcript was detected in such dissected tissues, in adult whole body cDNA library or under stress conditions. Hence, the involvement of AvHSP28.6 gene in the sea anemone defensome is strongly suggested.

  2. The expansion behaviour of sea anemones may be coordinated by two inhibitory neuropeptides, Antho-KAamide and Antho-RIamide

    DEFF Research Database (Denmark)

    McFarlane, I D; Hudman, D; Nothacker, H P;

    1993-01-01

    Antho-KAamide (L-3-phenyllactyl-Phe-Lys-Ala-NH2) and Antho-RIamide (L-3-phenyllactyl-Tyr-Arg-Ile-NH2) are novel neuropeptides isolated from the sea anemone Anthopleura elegantissima. They both inhibited spontaneous contractions of isolated muscle preparations from a wide variety of anemone species...

  3. Masquerade, mimicry and crypsis of the polymorphic sea anemone Phyllodiscus semoni and its aggregations in South Sulawesi

    NARCIS (Netherlands)

    Hoeksema, B.; Crowther, A.L.

    2011-01-01

    Phyllodiscus semoni is a morphologically variable sea anemone species from the Indo-Pacific with morphotypes ranging from upright and branched to low-lying and rounded. The apparent camouflage strategies of this sea anemone allow it to resemble other species or objects in its environment, such as st

  4. Dicty_cDB: Contig-U08124-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available lium discoideum cDNA clone:dds23l24, 5' ... 46 3.3 1 ( FC295437 ) CAGN8167.rev CAGN Nematostella vectensis Nem...ve mi... 46 3.3 1 ( FC272732 ) CAGN20119.rev CAGN Nematostella vectensis Nemve m... 4...6 3.3 1 ( FC255689 ) CAGN10067.rev CAGN Nematostella vectensis Nemve m... 46 3.3 ...ne:dda8d04, 5' e... 914 0.0 3 ( AU264620 ) Dictyostelium discoideum vegetative cD...lium discoideum vegetative cDNA clone:VS... 111 7e-20 1 ( C91299 ) Dictyostelium discoideu

  5. Antimicrobial properties of sea anemone Stichodactyla mertensii and Stichodactyla gigantea from Mandapam coast of India

    Institute of Scientific and Technical Information of China (English)

    S Thangaraj; S Bragadeeswaran; K Suganthi; N Sri Kumaran

    2011-01-01

    Objective: To investigate the antimicrobial activities of the methanol and aqueous extract of sea anemone Stichodactyla mertensii (S. mertensii) and Stichodactyla gigantea (S. gigantea).Methods:The sea anemone S. mertensii and S. gigantea were subjected to extraction by using methanol and distilled water. They were evaluated for antimicrobial activity against bacterial and fungal pathogens. Results: In antibacterial activity, S. gigantea exhibited significantly inhibitory activity against Pseudomonas aeruginosa than the S. mertensii of butanolic extract. In antifungal activity, the S. mertensii extract showed good activity against Aspergillus niger (A. niger)compared with other strains. Whereas S. gigantea recorded maximum and minimum zone of inhibition against Botrytis cinerea, A. niger and Cladosporium cucumerinum respectively. Conclusions: The results support that the sea anemones S. mertensii and S. gigantea extracts for treatment of some bacterial and fungal diseases as an ethanomedicinal source.

  6. Juvenile Thalassoma amblycephalum Bleeker (Labridae, Teleostei) dwelling among the tentacles of sea anemones

    DEFF Research Database (Denmark)

    Arvedlund, Michael; Iwao, Kenji; Brolund, Thea Marie;

    2006-01-01

    each) of the juvenile wrasse Thalassoma amblycephalum dwelling among the tentacles of the two sea anemones Entacmaea quadricolor (clonal type), and Heteractis magnifica at a coral reef in southern Japan during 16 months in daylight hours. There are only two past records of this facultative association......, one from east Africa and one from Indonesia. The wrasse remained close to and was occasionally in physical contact with the host when foraging amongst the tentacles. When frightened, they took shelter among corals, away from the host anemone. The wrasse co-existed with the anemonefishes Amphiprion...

  7. Characteristics of Anemone Active Regions Appearing in Coronal Holes Observed with {\\it Yohkoh} Soft X-ray Telescope

    CERN Document Server

    Asai, Ayumi; Hara, Hirohisa; Nitta, Nariaki V

    2008-01-01

    Coronal structure of active regions appearing in coronal holes is studied by using the data obtained with the Soft X-Ray Telescope (SXT) aboard {\\it Yohkoh} from 1991 November to 1993 March. The following characteristics are found; Many of active regions appearing in coronal holes show a structure that looks like a ``sea-anemone''. Such active regions are called {\\it anemone ARs}. About one-forth of all active regions that were observed with SXT from their births showed the anemone structure. For almost all the anemone ARs, the order of magnetic polarities is consistent with the Hale-Nicholson's polarity law. These anemone ARs also showed more or less east-west asymmetry in X-ray intensity distribution, such that the following (eastern) part of the ARs is brighter than its preceding (western) part. This, as well as the anemone shape itself, is consistent with the magnetic polarity distribution around the anemone ARs. These observations also suggest that an active region appearing in coronal holes has simpler ...

  8. Anemone altaica Induces Apoptosis in Human Osteosarcoma Cells.

    Science.gov (United States)

    Chang, I-Chang; Chiang, Tsay-I; Lo, Chun; Lai, Yi-Hua; Yue, Chia-Herng; Liu, Jer-Yuh; Hsu, Li-Sung; Lee, Chia-Jen

    2015-01-01

    In the past decade, no significant improvement has been made in chemotherapy for osteosarcoma (OS). To develop improved agents against OS, we screened 70 species of medicinal plants and treated two human OS cell lines with different agent concentrations. We then examined cell viability using the MTT assay. Results showed that a candidate plant, particularly the rhizomes of Anemone altaica Fisch. ex C. A. Mey aqueous extract (AAE), suppressed the viability of HOS and U2OS cells in a concentration-dependent manner. Flow cytometry analysis revealed that AAE significantly increased the amount of cell shrinkage (Sub-G1 fragments) in HOS and U2OS cells. Moreover, AAE increased cytosolic cytochrome c and Bax, but decreased Bcl-2. The amount of cleaved caspase-3 and poly-(ADP-ribose) polymerase-1 (PARP-1) were significantly increased. AAE suppressed the growth of HOS and U2OS through the intrinsic apoptotic pathway. Data suggest that AAE is cytotoxic to HOS and U2OS cells and has no significant influence on human osteoblast hFOB cells. The high mRNA levels of apoptosis-related factors (PPP1R15A, SQSTM1, HSPA1B, and DDIT4) and cellular proliferation markers (SKA2 and BUB1B) were significantly altered by the AAE treatment of HOS and U2OS cells. Results show that the anticancer activity of AAE could up-regulate the expression of a cluster of genes, especially those in the apoptosis-related factor family and caspase family. Thus, AAE has great potential as a useful therapeutic drug for human OS. PMID:26224029

  9. Characteristics of Gas Exchange in Three Domesticated Anemone Species

    Directory of Open Access Journals (Sweden)

    Feihu Liu

    2010-09-01

    Full Text Available Seeds of three Anemone species were collected from the suburban areas of Kunming and planted in a nursery for three and a half years at Kunming, Yunnan Province, China. Leaf gas exchange measurement indicated that these species had similar one-peak diurnal trends of net photosynthetic rate (PN, although A. rivularis had lower transpiration rate (TR, stomatal conductance (gs and intercellular CO2 concentration (Ci, and higher stomatal limit in the afternoon. Species differences in response of PN to photosynthetically active radiation (PAR were observed, especially under strong light. A. rivularis had the highest PN and Ci under strong light which corresponded with its highest gs and TR. A. rivularis had the highest light saturation point (LSP (1000 mol m-2 s-1 and light compensation point (LCP (69 mol m-2 s-1, while A. hupehensis var. japonica had the lowest LSP (800 ?mol m-2 s-1 and a lower LCP (53 mol m-2 s-1. But the three species responded similarly to the change of CO2 concentration in the air from 0 to 350 ?mol (CO2 mol-1, and their observed CO2 compensation point showed little difference (47, 53 and 56 ?mol (CO2 mol-1. Moreover, A. rivularis had the highest apparent quantum yield (0.032, carboxylation efficiency (0.049, PN (11.68 ?mol (CO2 m-2 s-1 and TR (5.36 mmol (H2O m-2 s-1 based on the PN -PAR response. The results implied that A. rivularis is able to grow well under higher radiation, while A. hupehensis var. japonica is the best one to grow under partial shade.

  10. Characteristics of Anemone Active Regions Appearing in Coronal Holes Observed with {\\it Yohkoh} Soft X-ray Telescope

    OpenAIRE

    Asai, Ayumi; Shibata, Kazunari; Hara, Hirohisa; Nitta, Nariaki V.

    2008-01-01

    Coronal structure of active regions appearing in coronal holes is studied by using the data obtained with the Soft X-Ray Telescope (SXT) aboard {\\it Yohkoh} from 1991 November to 1993 March. The following characteristics are found; Many of active regions appearing in coronal holes show a structure that looks like a ``sea-anemone''. Such active regions are called {\\it anemone ARs}. About one-forth of all active regions that were observed with SXT from their births showed the anemone structure....

  11. NUMERICAL SIMULATIONS OF CHROMOSPHERIC ANEMONE JETS ASSOCIATED WITH MOVING MAGNETIC FEATURES

    Energy Technology Data Exchange (ETDEWEB)

    Yang, Liping; He, Jiansen; Tu, Chuanyi; Zhang, Lei [School of Earth and Space Sciences, Peking University, 100871 Beijing (China); Peter, Hardi [Max Planck Institute for Solar System Research, D-37191 Katlenburg-Lindau (Germany); Feng, Xueshang [SIGMA Weather Group, State Key Laboratory for Space Weather, Center for Space Science and Applied Research, Chinese Academy of Sciences, 100871 Beijing (China); Zhang, Shaohua, E-mail: jshept@gmail.com [Institute of Geology and Geophysics, Chinese Academy of Sciences, 100871 Beijing (China)

    2013-11-01

    Observations with the space-based solar observatory Hinode show that small-scale magnetic structures in the photosphere are found to be associated with a particular class of jets of plasma in the chromosphere called anemone jets. The goal of our study is to conduct a numerical experiment of such chromospheric anemone jets related to the moving magnetic features (MMFs). We construct a 2.5 dimensional numerical MHD model to describe the process of magnetic reconnection between the MMFs and the pre-existing ambient magnetic field, which is driven by the horizontal motion of the magnetic structure in the photosphere. We include thermal conduction parallel to the magnetic field and optically thin radiative losses in the corona to account for a self-consistent description of the evaporation process during the heating of the plasma due to the reconnection process. The motion of the MMFs leads to the expected jet and our numerical results can reproduce many observed characteristics of chromospheric anemone jets, topologically and quantitatively. As a result of the tearing instability, plasmoids are generated in the reconnection process that are consistent with the observed bright moving blobs in the anemone jets. An increase in the thermal pressure at the base of the jet is also driven by the reconnection, which induces a train of slow-mode shocks propagating upward. These shocks are a secondary effect, and only modulate the outflow of the anemone jet. The jet itself is driven by the energy input due to the reconnection of the MMFs and the ambient magnetic field.

  12. Gene : CBRC-TSYR-01-0156 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-TSYR-01-0156 Novel UN B UNKNOWN ALS _HUMAN 9e-09 18% ref|XP_001634404.1| predicted protein [ ... [Nematostella vectensis] 3e-40 52% MPSNRLVAVPSNRLVALS SNRLVAVPSSRLVAMPSNRLVAVPSNRLVAVPSNRLVAVPSNRLVAVPSNR ... RFIAVSSNRLVAVPSNWLVAVPSNRLVDVPSNWLVDVSSNRFIAVSSNWFVALS SNWFVAMSSNRLVAMSSNWLFDVSSNWLIDVSSNRCVAVSSNRLVAVPSNW ...

  13. Identification of a novel type of processing sites in the precursor for the sea anemone neuropeptide Antho-RFamide (

    DEFF Research Database (Denmark)

    Schmutzler, C; Darmer, D; Diekhoff, D;

    1992-01-01

    Neuropeptides are synthesized as large precursor proteins that undergo posttranslational cleavages and modifications to produce bioactive peptides. Here, we have cloned two closely related precursor proteins for the sea anemone neuropeptide Antho-RFamide (...

  14. Gene : CBRC-DRER-07-0009 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available ed protein [Nematostella vectensis] gb|EDO49785.1| predicted protein [Nematostella vectensis] 3e-13 35% gnl|UG|Dr#S37240919 PREDICT...CBRC-DRER-07-0009 Novel 7 D UNKNOWN NU4M_ANOQU 0.002 23% ref|XP_001641848.1| predict...2) /gb=XM_001343547 /gi=125804710 /ug=Dr.132164 /len=2452 1e-17 29% MYTYLLFLLNYTYSDICT...LTLLLFLLNYTYSDICILTLLIFLLNYTHSDICTLTLLLFLLNYTYSDICTLTLLLFLLNYTYSDICTLTLLIFLLNYTYSDICILTLLIFLLNYTHSDICTLTLLLFLLNYTYSDICT...LTLLLFLLNYTYSDICTLTLLIFLLNYTYSDICILTLLIFLLNYTYSDICTLTFYSYSIILTLIYVHLPFYYSYSIILTLIYVHLPF ...

  15. Gene : CBRC-DRER-14-0060 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available ed protein [Nematostella vectensis] gb|EDO31694.1| predicted protein [Nematostella vectensis] 6e-41 30% gnl|UG|Dr#S37235664 PREDICT...CBRC-DRER-14-0060 Novel 14 D UNKNOWN V021_FOWPV 1.1 23% ref|XP_001623794.1| predict... /gb=XM_001341422 /gi=125824694 /ug=Dr.106923 /len=6614 9e-08 19% MSCFSIDIAICTIYRFSIHIAICTLYRFSIDISICT...IYHFSIDIAICTIYQFSIDIAICTKYHFITDIAICTKYRFSIDIAICTIYCFNIDIPICTKYRFSVDIAICTKYKFSIDIAICTIYRYNIDIAICTIYRFSVDIAICT...IYRFSIDIAICTIYRFSIDIAICTIYRFSVDIAICTKYQFSIDIAICTIYRYNIDIAICTIYRFSIDIAICTIYRFSIDIAICTIYRFNIDKTLYTYILTTVYTVLFYI ...

  16. Antimicrobial activity of tissue and associated bacteria from benthic sea anemone Stichodactyla haddoni against microbial pathogens.

    Science.gov (United States)

    Williams, G Prakash; Babu, S; Ravikumar, S; Kathiresan, K; Prathap, S Arul; Chinnapparaj, S; Marian, M P; Alikhan, S Liakath

    2007-10-01

    Associated bacteria from Stichodactyla haddoni are found maximum in tentacle tissues than the body tissue. There are eight associated bacterial species viz., Alcaligenes sp, Corynebacterium sp, Aeromonas sp, Sporosarcina sp, Renibacterium sp, Camobacterium sp1, Camobacterium sp2 and Salinococcus sp were recorded. The culture extracts from the associated bacterial species showed sensitivity against human bacterial and fungalpathogens. However, the hexane tissue extract of sea anemone showed maximum sensitivity (24 mm dia.) against the fish bacterial pathogen Aeromonas hydrophila than the other chosen pathogens. Comparatively the tissue extracts showed promising antimicrobial sensitivity than the cell free extracts of associated bacteria, and hence, the tissue samples from the sea anemone Stichodactyla haddoni is recommended for further exploration of novel antimicrobial drugs than the associated bacteria. PMID:18405113

  17. Two new triterpenoid saponins from the aerial parts of Anemone taipaiensis.

    Science.gov (United States)

    Li, Hui; Wang, Xiao-Yang; Wang, Xia-Yin; Hua, Dong; Liu, Yang; Tang, Hai-Feng

    2015-05-01

    Phytochemical study on the aerial parts of Anemone taipaiensis for the first time led to the isolation of two new oleanane-type triterpenoid saponins 1 and 2, together with four known saponins (3-6). Their structures were elucidated by extensive spectroscopic analysis and chemical evidences. Saponins 2-4 exhibited cytotoxicity against human glioblastoma U251MG cell line with IC50 values ranging from 1.56 to 80.62 μM. PMID:26021881

  18. Distribution and impact of the alien anemone Sagartia ornata in the West Coast National Park

    Directory of Open Access Journals (Sweden)

    Tamara B. Robinson

    2015-03-01

    Full Text Available Sagartia ornata is an alien anemone that occurs intertidally within the West Coast National Park (WCNP. Whilst baseline distributional data was gathered in 2001, the range and abundance of this alien has not been reassessed. The present study aimed to determine the current status and distribution of this anemone, to assess its diet so as to establish the role it may play as predator and to investigate its impact on sandy-shore communities. Sagartia ornata was found to be restricted to the WCNP, where it occurred in densities of up to 508 ± 218 individuals per m2 . Within the park the distribution of this anemone had changed. Populations were recorded in Nanozostera capensis seagrass beds for the first time and this alien was absent from two areas in which it had previously occurred. Diet analysis revealed indigenous polychaetes and amphipods as the dominant prey items consumed by S. ornata. This alien was found to significantly alter sandy-shore community structure, with differences caused primarily by increases in the abundance and biomass of the tanaid Anatanais gracilis and the polychaete Orbinia angrapequensis. Additionally, invaded areas supported significantly greater invertebrate diversity, density and biomass. It is concluded that whilst this anemone negatively affects native biota, its current dependence on restricted habitats precludes widespread impacts with the park.Conservation implications: With regard to conservation implications, this invasion should be routinely monitored outside the WCNP as in its native range S. ornata occurs on rocky shores and kelp holdfasts, suggesting a potential for spread along the west coast of South Africa.

  19. The Antitumor Effects of Triterpenoid Saponins from the Anemone flaccida and the Underlying Mechanism

    Directory of Open Access Journals (Sweden)

    Lin-Tao Han

    2013-01-01

    Full Text Available Anemone flaccida Fr. Schmidt, a family of ancient hopanoids, have been used as traditional Asian herbs for the treatments of inflammation and convulsant diseases. Previous study on HeLa cells suggested that triterpenoid saponins from Anemone flaccida Fr. Schmidt may have potential antitumor effect due to their apoptotic activities. Here, we confirmed the apoptotic activities of the following five triterpenoid saponins: glycoside St-I4a (1, glycoside St-J (2, anhuienoside E (3, hedera saponin B (4, and flaccidoside II (5 on human BEL-7402 and HepG2 hepatoma cell lines, as well as the model of HeLa cells treated with lipopolysaccharide (LPS. We found that COX-2/PGE2 signaling pathway, which plays key roles in the development of cancer, is involved in the antitumor activities of these saponins. These data provide the evidence that triterpenoid saponins can induce apoptosis via COX-2/PGE2 pathway, implying a preventive role of saponins from Anemone flaccida in tumor.

  20. Broad-scale Population Genetics of the Host Sea Anemone, Heteractis magnifica

    KAUST Repository

    Emms, Madeleine

    2015-12-01

    Broad-scale population genetics can reveal population structure across an organism’s entire range, which can enable us to determine the most efficient population-wide management strategy depending on levels of connectivity. Genetic variation and differences in genetic diversity on small-scales have been reported in anemones, but nothing is known about their broad-scale population structure, including that of “host” anemone species, which are increasingly being targeted in the aquarium trade. In this study, microsatellite markers were used as a tool to determine the population structure of a sessile, host anemone species, Heteractis magnifica, across the Indo-Pacific region. In addition, two rDNA markers were used to identify Symbiodinium from the samples, and phylogenetic analyses were used to measure diversity and geographic distribution of Symbiodinium across the region. Significant population structure was identified in H. magnifica across the Indo-Pacific, with at least three genetic breaks, possibly the result of factors such as geographic distance, geographic isolation and environmental variation. Symbiodinium associations were also affected by environmental variation and supported the geographic isolation of some regions. These results suggests that management of H. magnifica must be implemented on a local scale, due to the lack of connectivity between clusters. This study also provides further evidence for the combined effects of geographic distance and environmental distance in explaining genetic variance.

  1. Symbiodinium diversity in the sea anemone Entacmaea quadricolor on the east Australian coast

    Science.gov (United States)

    Pontasch, S.; Scott, A.; Hill, R.; Bridge, T.; Fisher, P. L.; Davy, S. K.

    2014-06-01

    The diversity of Symbiodinium spp. in Entacmaea quadricolor was analysed from five locations along ~2,100 km on the east coast of Australia using denaturing gradient gel electrophoresis (DGGE) of the internal transcribed spacer 2 region (ITS2) combined with bacterial cloning. DGGE revealed that E. quadricolor predominantly associated with six types of clade C (four of which are novel) and that most anemones harboured multiple types simultaneously. Anemones from southern locations associated with a mixed assemblage of C25 and a variant of C3. This assemblage also dominated the central location, but was absent at the northern location. At central and northern sites, two novel variants of C42(type2) and C1 were found. Anemones hosting C42(type2) also showed a low abundance of variants of C3 and C1, and E1 was found in one sample, as revealed by bacterial cloning. The occurrence of geographically distinct ITS2 types or a consortium of types might reflect a need to optimise physiological performance of the symbiosis at different latitudes.

  2. The 'Antenna Balloon Anemone' Found in the Seto Inland Sea: New Genus and Species of Sea Anemone, Antennapeachia setouchi (Cnidaria, Actinaria, Haloclavidae).

    Science.gov (United States)

    Izumi, Takato; Yanagi, Kensuke; Fujita, Toshihiko

    2016-08-01

    In the present study, we report the identification of a sea anemone, Antennapeachia setouchi, collected in the Seto Inland Sea, which represents a new genus and new species. This new species has unusual tentacle and mesenterial arrangements that have not been observed in other species of Haloclavidae. There are 12 regular marginal tentacles and two 'antenna tentacles,' with the latter always rising upward and located on the oral disk near the mouth; the species is also characterized by its peculiar mesenterial pairs, consisting of a macrocneme and a microcneme. Furthermore, this species shows an interesting behavior: it can inflate its body like a balloon, lift above the seafloor, and drift with the sea current. The presence of a single, strong siphonoglyph, physa-like aboral end, and the lack of sphincter muscle classify this sea anemone within Haloclavidae. It resembles Peachia species, but cannot be classified in this genus as the new species has two pairs of mesenteries, consisting of a macrocneme and a microcneme, and irregular antenna tentacles. Therefore, we propose a new genus Antennapeachia to accommodate this species. PMID:27498806

  3. Isolation of L-3-phenyllactyl-Phe-Lys-Ala-NH2 (Antho-KAamide), a novel neuropeptide from sea anemones

    DEFF Research Database (Denmark)

    Nothacker, H P; Rinehart, K L; Grimmelikhuijzen, C J

    1991-01-01

    We have isolated and sequenced the neuropeptide L-3-phenyllactyl-Phe-Lys-Ala-NH2 from the sea anemone Anthopleura elegantissima. This neuropeptide (named Antho-KAamide) has the unusual N-terminal L-3-phenyllactyl blocking group which has recently also been discovered in 2 other neuropeptides from...... sea anemones. We propose that the L-3-phenyllactyl residue renders Antho-KAamide resistant to nonspecific aminopeptidases, thereby increasing the stability of the neuropeptide after neuronal release. The existence of the L-3-phenyllactyl residue in 3 neuropeptides isolated so far suggests...... that this blocking group is more generally occurring....

  4. Responses of the sea anemone, Exaiptasia pallida, to ocean acidification conditions and copper exposure.

    Science.gov (United States)

    Siddiqui, Samreen; Bielmyer-Fraser, Gretchen K

    2015-10-01

    Ocean acidification (OA) is a growing concern due to its deleterious effects on aquatic organisms. Additionally, the combined effects of OA and other local stressors like metal pollution are largely unknown. In this study, we examined physiological effects in the sea anemone, Exaiptasia pallida after exposure to the global stressor carbon dioxide (CO2), as well as the local stressor copper (Cu) over 7 days. Cu accumulated in the tissues of E. pallida in a concentration-dependent manner. At some time points, sea anemones exposed to 1000 ppm CO2 had higher tissue Cu concentrations than those exposed to 400 ppm CO2 at the same Cu exposure concentrations. In general, the activities of all anti-oxidant enzymes measured (catalase, CAT; glutathione peroxidase, GPx, glutathione reductase, GR) increased with exposure to increasing Cu concentrations. Significant differences in GR, CAT and to some degree GPx activity, were observed due to increasing CO2 exposure in control treatments. Sea anemones exposed to Cu in combination with higher CO2 generally had higher anti-oxidant enzyme activities than those exposed to the same concentration of Cu and lower CO2. Activity of the enzyme, carbonic anhydrase (CA), involved in acid-base balance, was significantly decreased with increasing Cu exposure. At the two lowest Cu concentrations, the extent of CA inhibition was lessened with increasing CO2 concentration. These results provide insight into toxic mechanisms of both Cu and CO2 exposure to the sensitive cnidarian E. pallida and have implications for environmental exposure of multiple contaminants. PMID:26363274

  5. Increased cell proliferation and mucocyte density in the sea anemone Aiptasia pallida recovering from bleaching.

    Directory of Open Access Journals (Sweden)

    David Fransolet

    Full Text Available Recovery of coral after bleaching episodes is a critical period for the health of the reef ecosystem. While events such as symbiont (genus Symbiodinium shifting/shuffling or tissue apoptosis have been demonstrated to occur following bleaching, little is known concerning tissue recovery or cell proliferation. Here, we studied the sea anemone Aiptasia pallida exposed to a transient elevation of water temperature combined with high illumination (33°C and 1900 µmol photons x m(-2 x s(-1 for 30 h. Following such treatment bleached anemones showed a significant reduction of their Symbiodinium density. Cell proliferation in the ectodermis and gastrodermis was determined by assessing the densities of cells labeled with a thymidine analogue (EdU. Cell proliferation significantly increased during the first day following stress in both tissue types. This increased cell proliferation returned to pre-stress values after one week. Although cell proliferation was higher in the ectodermis in absence of stress, it was relatively more pronounced in the gastrodermis of stressed anemones. In addition, the ratio of ectodermal mucocytes significantly increased three weeks after induced stress. These results suggest that thermal/photic stress coupled with the loss of the symbionts is able to enhance cell proliferation in both gastrodermis and ectodermis of cnidarians. While new cells formed in the gastrodermis are likely to host new Symbiodinium, the fate of new cells in the ectodermis was only partially revealed. Some new ectodermal cells may, in part, contribute to the increased number of mucocytes which could eventually help strengthen the heterotrophic state until restoration of the symbiosis.

  6. Comparative effects of dissolved copper and copper oxide nanoparticle exposure to the sea anemone, Exaiptasia pallida

    International Nuclear Information System (INIS)

    Highlights: • Differences between CuO NP and CuCl2 exposure were characterized. • Copper accumulation in E. pallida was concentration-dependent. • E. pallida exposed to CuCl2 accumulated higher copper tissue burdens. • The oxidative stress response was greater in E. pallida exposed to CuO NP. • Both forms of copper inhibited CA activity in E. pallida. - Abstract: Increasing use of metal oxide nanoparticles (NP) by various industries has resulted in substantial output of these NP into aquatic systems. At elevated concentrations, NP may interact with and potentially affect aquatic organisms. Environmental implications of increased NP use are largely unknown, particularly in marine systems. This research investigated and compared the effects of copper oxide (CuO) NP and dissolved copper, as copper chloride (CuCl2), on the sea anemone, Exaiptasia pallida. Sea anemones were collected over 21 days and tissue copper accumulation and activities of the enzymes: catalase, glutathione peroxidase, glutathione reductase, and carbonic anhydrase were quantified. The size and shape of CuO NP were observed using a ecanning electron microscope (SEM) and the presence of copper was confirmed by using Oxford energy dispersive spectroscopy systems (EDS/EDX). E. pallida accumulated copper in their tissues in a concentration- and time-dependent manner, with the animals exposed to CuCl2 accumulating higher tissue copper burdens than those exposed to CuO NP. As a consequence of increased copper exposure, as CuO NP or CuCl2, anemones increased activities of all of the antioxidant enzymes measured to some degree, and decreased the activity of carbonic anhydrase. Anemones exposed to CuO NP generally had higher anti-oxidant enzyme activities than those exposed to the same concentrations of CuCl2. This study is useful in discerning differences between CuO NP and dissolved copper exposure and the findings have implications for exposure of aquatic organisms to NP in the environment

  7. Cytotoxic Oleanane-Type Triterpenoid Saponins from the Rhizomes of Anemone rivularis var. flore-minore

    OpenAIRE

    Xiaoyang Wang; Minchang Wang; Min Xu; Yi Wang; Haifeng Tang; Xiaoli Sun

    2014-01-01

    Phytochemical investigation of the n-BuOH extract of the rhizomes of Anemone rivularis var. flore-minore led to the isolation of five new oleanane-type triterpenoid saponins 1–5, together with five known saponins 6–10. Their structures were determined by the extensive use of 1D and 2D NMR experiments, along with ESIMS analyses and acid hydrolysis. The aglycone of 4 and 5 was determined as 21α-hydroxyoleanolic acid, which was reported in this genus for the first time. The cytotoxicity of these...

  8. Comparative effects of dissolved copper and copper oxide nanoparticle exposure to the sea anemone, Exaiptasia pallida

    Energy Technology Data Exchange (ETDEWEB)

    Siddiqui, Samreen; Goddard, Russell H.; Bielmyer-Fraser, Gretchen K., E-mail: gkbielmyer@valdosta.edu

    2015-03-15

    Highlights: • Differences between CuO NP and CuCl{sub 2} exposure were characterized. • Copper accumulation in E. pallida was concentration-dependent. • E. pallida exposed to CuCl{sub 2} accumulated higher copper tissue burdens. • The oxidative stress response was greater in E. pallida exposed to CuO NP. • Both forms of copper inhibited CA activity in E. pallida. - Abstract: Increasing use of metal oxide nanoparticles (NP) by various industries has resulted in substantial output of these NP into aquatic systems. At elevated concentrations, NP may interact with and potentially affect aquatic organisms. Environmental implications of increased NP use are largely unknown, particularly in marine systems. This research investigated and compared the effects of copper oxide (CuO) NP and dissolved copper, as copper chloride (CuCl{sub 2}), on the sea anemone, Exaiptasia pallida. Sea anemones were collected over 21 days and tissue copper accumulation and activities of the enzymes: catalase, glutathione peroxidase, glutathione reductase, and carbonic anhydrase were quantified. The size and shape of CuO NP were observed using a ecanning electron microscope (SEM) and the presence of copper was confirmed by using Oxford energy dispersive spectroscopy systems (EDS/EDX). E. pallida accumulated copper in their tissues in a concentration- and time-dependent manner, with the animals exposed to CuCl{sub 2} accumulating higher tissue copper burdens than those exposed to CuO NP. As a consequence of increased copper exposure, as CuO NP or CuCl{sub 2}, anemones increased activities of all of the antioxidant enzymes measured to some degree, and decreased the activity of carbonic anhydrase. Anemones exposed to CuO NP generally had higher anti-oxidant enzyme activities than those exposed to the same concentrations of CuCl{sub 2}. This study is useful in discerning differences between CuO NP and dissolved copper exposure and the findings have implications for exposure of aquatic

  9. Genomic organization and splicing variants of a peptidylglycine alpha-hydroxylating monooxygenase from sea anemones

    DEFF Research Database (Denmark)

    Williamson, M; Hauser, F; Grimmelikhuijzen, C J

    2000-01-01

    Cnidarians are primitive animals that use neuropeptides as their transmitters. All the numerous cnidarian neuropeptides isolated, so far, have a carboxy-terminal amide group that is essential for their actions. This strongly suggests that alpha-amidating enzymes are essential for the functioning......, peptidylglycine alpha-amidating monooxygenase (PAM), which is coded for by a single gene. In a previous paper (F. Hauser et al., Biochem. Biophys. Res. Commun. 241, 509-512, 1997) we have cloned the first known cnidarian PHM from the sea anemone Calliactis parasitica. In the present paper we have determined...

  10. Reef fishes can recognize bleached habitat during settlement: sea anemone bleaching alters anemonefish host selection.

    Science.gov (United States)

    Scott, Anna; Dixson, Danielle L

    2016-05-25

    Understanding how bleaching impacts the settlement of symbiotic habitat specialists and whether there is flexibility in settlement choices with regard to habitat quality is essential given our changing climate. We used five anemonefishes (Amphiprion clarkii, Amphiprion latezonatus, Amphiprion ocellaris, Amphiprion percula and Premnas biaculeatus) and three host sea anemones (Entacmaea quadricolor, Heteractis crispa and Heteractis magnifica) in paired-choice flume experiments to determine whether habitat naive juveniles have the olfactory capabilities to distinguish between unbleached and bleached hosts, and how this may affect settlement decisions. All anemonefishes were able to distinguish between bleached and unbleached hosts, and responded only to chemical cues from species-specific host anemones irrespective of health status, indicating a lack of flexibility in host use. While bleached hosts were selected as habitat, this occurred only when unbleached options were unavailable, with the exception of A. latezonatus, which showed strong preferences for H. crispa regardless of health. This study highlights the potential deleterious indirect impacts of declining habitat quality during larval settlement in habitat specialists, which could be important in the field, given that bleaching events are becoming increasingly common. PMID:27226472

  11. Patterns of Symbiodinium spp. associations within the family Aiptasiidae, a monophyletic lineage of symbiotic of sea anemones (Cnidaria, Actiniaria)

    Science.gov (United States)

    Grajales, Alejandro; Rodríguez, Estefanía; Thornhill, Daniel J.

    2016-03-01

    Although the symbiotic relationships between dinoflagellates and cnidarians are well recognized, few studies have examined these associations from an evolutionary perspective. This is especially true for symbiotic sea anemones, in which many reports consist of an approximate species identification of the host, followed by the identification of the dinoflagellate symbiont using molecular genetic markers. To further explore the evolutionary history of sea anemone-dinoflagellate associations, we documented the diversity of Symbiodinium spp. in a monophyletic clade of sea anemones, the family Aiptasiidae. We combined information from several molecular genetic markers, including nuclear ITS2 and plastid cp23S-rDNA, to evaluate the patterns of evolution and diversification of Symbiodinium in the light of an existing phylogenetic framework for the sea anemone host. At the host family level, we found no evidence for coevolution or reciprocal phylogenies between host and endosymbiont. However, within some individual host species, Symbiodinium spp. exhibited patterns of host specialization and cladogenesis. This pattern suggests that coevolution between host and symbiont occurred within species and genera lineages, but that this process was regularly disrupted and symbiotic partners were recombined during the longer-term evolutionary history of the Aiptasiidae. Furthermore, we observed independent cases of phylogeographical partitioning of Symbiodinium within a single host species, suggesting that ecological speciation along an environmental gradient contributed to the diversity of associations found in nature.

  12. Menthol-induced bleaching rapidly and effectively provides experimental aposymbiotic sea anemones (Aiptasia sp.) for symbiosis investigations.

    Science.gov (United States)

    Matthews, Jennifer L; Sproles, Ashley E; Oakley, Clinton A; Grossman, Arthur R; Weis, Virginia M; Davy, Simon K

    2016-02-01

    Experimental manipulation of the symbiosis between cnidarians and photosynthetic dinoflagellates (Symbiodinium spp.) is crucial to advancing the understanding of the cellular mechanisms involved in host-symbiont interactions, and overall coral reef ecology. The anemone Aiptasia sp. is a model for cnidarian-dinoflagellate symbiosis, and notably it can be rendered aposymbiotic (i.e. dinoflagellate-free) and re-infected with a range of Symbiodinium types. Various methods exist for generating aposymbiotic hosts; however, they can be hugely time consuming and not wholly effective. Here, we optimise a method using menthol for production of aposymbiotic Aiptasia. The menthol treatment produced aposymbiotic hosts within just 4 weeks (97-100% symbiont loss), and the condition was maintained long after treatment when anemones were held under a standard light:dark cycle. The ability of Aiptasia to form a stable symbiosis appeared to be unaffected by menthol exposure, as demonstrated by successful re-establishment of the symbiosis when anemones were experimentally re-infected. Furthermore, there was no significant impact on photosynthetic or respiratory performance of re-infected anemones. PMID:26596538

  13. Cytotoxic Oleanane-Type Triterpenoid Saponins from the Rhizomes of Anemone rivularis var. flore-minore

    Directory of Open Access Journals (Sweden)

    Xiaoyang Wang

    2014-02-01

    Full Text Available Phytochemical investigation of the n-BuOH extract of the rhizomes of Anemone rivularis var. flore-minore led to the isolation of five new oleanane-type triterpenoid saponins 1–5, together with five known saponins 6–10. Their structures were determined by the extensive use of 1D and 2D NMR experiments, along with ESIMS analyses and acid hydrolysis. The aglycone of 4 and 5 was determined as 21α-hydroxyoleanolic acid, which was reported in this genus for the first time. The cytotoxicity of these compounds was evaluated against four human cancer cell line, including HL-60 (promyelocytic leukemia, HepG2 (hepatocellular carcinoma, A549 (lung carcinoma and HeLa (cervical carcinoma. The monodesmosidic saponins 6–8 exhibited cytotoxic activity toward all tested cancer cell lines, with IC50 values in the 7.25–22.38 μM range.

  14. Chemical Constituents of the Roots of Anemone altaica Fisch. ex C. A. Mey.

    Institute of Scientific and Technical Information of China (English)

    Zhong-Jie ZOU; Yue-Sheng DONG; Jun-Shan YANG

    2005-01-01

    The roots of Anemone altaica Fisch. ex C. A. Mey. have been used in the treatment of epilepsia,neurasthenia, and arthritis in Chinese folk medicine for a long time. In order to find new and bioactive compounds, the chemical constituents of the roots of A. altaica were investigated and nine compounds were isolated from the EtOH extract of this plant. On the basis of spectroscopic methods, the structures of these compounds were elucidated as 4-(9H-β-carbolin-1-yl)-4-oxo-butyric acid (1), carboxymethyl isoferulate (2), isoferulic acid (3), cirsiumaldehyde (4), 5-hydroxy-4-oxo-pentanoic acid (5), triacontane (6), palmic acid (7), β-sitosterol (8), and daucosterol (9). Among them, 1 and 2 were new compounds, and 3 and 4 were obtained from this genus for the first time.

  15. Variation in partner benefits in a shrimp-sea anemone symbiosis.

    Science.gov (United States)

    McKeon, C Seabird; O'Donnell, James L

    2015-01-01

    Symbiotic interactions, where two species occur in close physical proximity for the majority of the participants' lifespans, may constrain the fitness of one or both of the participants. Host choice could result in lineage divergence in symbionts if fitness benefits vary across the interaction with hosts. Symbiotic interactions are common in the marine environment, particularly in the most diverse marine ecosystems: coral reefs. However, the variation in symbiotic interactions that may drive diversification is poorly understood in marine systems. We measured the fecundity of the symbiotic shrimp Periclimenes yucatanicus on two anemone hosts on coral reefs in Panama, and found that while fecundity varies among host species, this variation is explained largely by host size, not species. This suggests that shrimp on larger hosts may have higher fitness regardless of host species, which in turn could drive selection for host choice, a proposed driver of diversification in this group. PMID:26618082

  16. Early evolution of the LIM homeobox gene family

    Directory of Open Access Journals (Sweden)

    Degnan Bernard M

    2010-01-01

    Full Text Available Abstract Background LIM homeobox (Lhx transcription factors are unique to the animal lineage and have patterning roles during embryonic development in flies, nematodes and vertebrates, with a conserved role in specifying neuronal identity. Though genes of this family have been reported in a sponge and a cnidarian, the expression patterns and functions of the Lhx family during development in non-bilaterian phyla are not known. Results We identified Lhx genes in two cnidarians and a placozoan and report the expression of Lhx genes during embryonic development in Nematostella and the demosponge Amphimedon. Members of the six major LIM homeobox subfamilies are represented in the genomes of the starlet sea anemone, Nematostella vectensis, and the placozoan Trichoplax adhaerens. The hydrozoan cnidarian, Hydra magnipapillata, has retained four of the six Lhx subfamilies, but apparently lost two others. Only three subfamilies are represented in the haplosclerid demosponge Amphimedon queenslandica. A tandem cluster of three Lhx genes of different subfamilies and a gene containing two LIM domains in the genome of T. adhaerens (an animal without any neurons indicates that Lhx subfamilies were generated by tandem duplication. This tandem cluster in Trichoplax is likely a remnant of the original chromosomal context in which Lhx subfamilies first appeared. Three of the six Trichoplax Lhx genes are expressed in animals in laboratory culture, as are all Lhx genes in Hydra. Expression patterns of Nematostella Lhx genes correlate with neural territories in larval and juvenile polyp stages. In the aneural demosponge, A. queenslandica, the three Lhx genes are expressed widely during development, including in cells that are associated with the larval photosensory ring. Conclusions The Lhx family expanded and diversified early in animal evolution, with all six subfamilies already diverged prior to the cnidarian-placozoan-bilaterian last common ancestor. In

  17. Early evolution of the LIM homeobox gene family

    Energy Technology Data Exchange (ETDEWEB)

    Srivastava, Mansi; Larroux, Claire; Lu, Daniel R; Mohanty, Kareshma; Chapman, Jarrod; Degnan, Bernard M; Rokhsar, Daniel S

    2010-01-01

    LIM homeobox (Lhx) transcription factors are unique to the animal lineage and have patterning roles during embryonic development in flies, nematodes and vertebrates, with a conserved role in specifying neuronal identity. Though genes of this family have been reported in a sponge and a cnidarian, the expression patterns and functions of the Lhx family during development in non-bilaterian phyla are not known. We identified Lhx genes in two cnidarians and a placozoan and report the expression of Lhx genes during embryonic development in Nematostella and the demosponge Amphimedon. Members of the six major LIM homeobox subfamilies are represented in the genomes of the starlet sea anemone, Nematostella vectensis, and the placozoan Trichoplax adhaerens. The hydrozoan cnidarian, Hydra magnipapillata, has retained four of the six Lhx subfamilies, but apparently lost two others. Only three subfamilies are represented in the haplosclerid demosponge Amphimedon queenslandica. A tandem cluster of three Lhx genes of different subfamilies and a gene containing two LIM domains in the genome of T. adhaerens (an animal without any neurons) indicates that Lhx subfamilies were generated by tandem duplication. This tandem cluster in Trichoplax is likely a remnant of the original chromosomal context in which Lhx subfamilies first appeared. Three of the six Trichoplax Lhx genes are expressed in animals in laboratory culture, as are all Lhx genes in Hydra. Expression patterns of Nematostella Lhx genes correlate with neural territories in larval and juvenile polyp stages. In the aneural demosponge, A. queenslandica, the three Lhx genes are expressed widely during development, including in cells that are associated with the larval photosensory ring. The Lhx family expanded and diversified early in animal evolution, with all six subfamilies already diverged prior to the cnidarian-placozoan-bilaterian last common ancestor. In Nematostella, Lhx gene expression is correlated with neural

  18. Force-dependent discharge of nematocysts in the sea anemone Haliplanella luciae (Verrill

    Directory of Open Access Journals (Sweden)

    Dustin Todaro

    2012-05-01

    Sea anemones discharge cnidae (‘stinging capsules’ including nematocysts to capture prey and to defend themselves. In the present study, we tested the relationship between the force of test probes striking feeding tentacles and discharge of microbasic p-mastigophore nematocysts into the test probes. In seawater alone, the response curve is bimodal with maximal discharge observed at 0.33 and 1.10 millinewtons (mN and with minimal discharge at 1.50 mN. Upon activating chemoreceptors for N-acetylated sugars, maximal discharge is observed across a broad range of smaller forces from 0.16 to 0.9 mN before decreasing to a minimum at 1.50 mN. Likewise, in the presence of nearby vibrations at key frequencies, maximal discharge is observed over a broad range of smaller forces before decreasing to a minimum at 1.50 mN. It appears that sensory input indicating proximity of potential prey expands the range of small forces of impact that stimulate maximal discharge (i.e. to less than 1.10 mN but not at larger forces of impact (i.e. at approximately 1.50 mN. Thus, contact by small prey would stimulate maximal discharge, and all the more so if such contact is accompanied by specific odorants or by vibrations at specific frequencies. Nevertheless, anemones would not maximally discharge nematocysts into large animals that blunder into contact with their tentacles.

  19. Observations on a population of the sea anemone Anemonia viridis (Forskal, 1775) in the North Aegean Sea

    Energy Technology Data Exchange (ETDEWEB)

    Chariton Chintiroglou, C. [Thessaloniki, Aristotle Univ. (Greece). Dept. of Zoology

    1996-12-31

    The present paper is concerned with the structural aspects of Anemonia viridis populations found in the North Aegean Sea. It was found that mean wet weight and density of anemone populations increases with depth and distance from shore. Differences in the structure of the Anemonia viridis populations were attributed both to the specific hydrodynamic characteristics of the biotopes and to a number biotic interactions. From our results and t previous investigations the adoption of three different lifestyles by the anemones was assumed.: (1) a colonial form, with population densities around 650 individuals per m{sup 2}, found in substrates exposed to increased hydrodynamism; (2) a colonial form, with lower densities (90 indiv. per m{sup 2}), found in less exposed sites; (3) finally, large individuals in deeper waters chose a solitary lifestyle, as mechanical stresses were much lower.

  20. Stylobates birtlesi sp. n., a new species of carcinoecium-forming sea anemone (Cnidaria, Actiniaria, Actiniidae from eastern Australia

    Directory of Open Access Journals (Sweden)

    Andrea Crowther

    2011-04-01

    Full Text Available We describe a new species of carcinoecium-forming sea anemone, Stylobates birtlesi sp. n., from sites 680-960 m deep in the Coral Sea, off the coast of Queensland, Australia. An anemone of this genus settles on a gastropod shell inhabited by a hermit crab, then covers and extends the shell to produce a chitinous structure termed a carcinoecium. Stylobates birtlesi sp. n. is symbiotic with the hermit crab Sympagurus trispinosus (Balss, 1911. The nature of marginal sphincter muscle and nematocyst size and distribution distinguish Stylobates birtlesi sp. n. from other species in the genus. The four known species are allopatric, each inhabiting a separate ocean basin of the Indo-west Pacific. We also extend the known range of Stylobates loisetteae in the Indian Ocean off the coast of Western Australia.

  1. A sea anemone-like CuO/Co3O4 composite: an effective catalyst for electrochemical water splitting.

    Science.gov (United States)

    Li, Xiumin; Guan, Guoqing; Du, Xiao; Cao, Ji; Hao, Xiaogang; Ma, Xuli; Jagadale, Ajay D; Abudula, Abuliti

    2015-10-18

    A facile unipolar pulse electrodeposition combined with the thermal oxidation method was applied for fabrication of CuO/Co3O4 composites on carbon electrode for water electrolysis, and it was found that the sea anemone-like one with a 3D hierarchical structure formed at -0.8 V exhibited excellent performance for water electrolysis at a low overpotential with high stability. PMID:26311303

  2. Notes on the genus Amphiprion Bloch & Schneider, 1801 (Teleostei: Pomacentridae) and its host sea anemones in the Seychelles

    OpenAIRE

    Hartog, den, J.M.P.

    1997-01-01

    The genus Amphiprion Bloch & Schneider, 1801, is represented in the Seychelles by two species, A. akallopisos Bleeker, 1853, and the endemic A. fuscocaudatus Allen, 1972. Throughout its distributional range Amphiprion akallopisos has exclusively been recorded to associate with the clownfish anemones Heteractis magnifica (Quoy & Gaimard, 1833) and Stichodactyla mertensii Brandt, 1835. During the Netherlands Indian Ocean Programme (NIOP) Seychelles Expedition 19921993 this was confirmed for the...

  3. Characterization, purification and phylogenetic analysis of a cytolysin from the sea anemone Heteractis magnifica of the Indian Ocean

    Directory of Open Access Journals (Sweden)

    S Karthikayalu

    2010-01-01

    Full Text Available It is well established that sea anemones comprise a rich source of cytolytic toxins. The present study reports the isolation and characterization of a cytolysin obtained from the sea anemone Heteractis magnifica collected in the Andaman Islands of the Indian Ocean. The crude extract was screened for hemolytic activity by a blood agar plate method and a 6-mm zone of clearance was observed after incubation. The hemolytic property of the crude extract, tested by the microtiter plate method, revealed positive results at concentrations as low as 120 ng/mL. Furthermore, it was favored by alkaline pH and was stable up to 60°C. On the other hand, the hemolytic effect was abolished by the addition of human serum. Purification steps involved ammonium sulfate precipitation and subsequent desalting by dialysis, followed by anion- and cation-exchange chromatographies. The purified fractions displayed the presence of a 19-kDa cytolysin when analyzed by SDS-PAGE. The conserved region of the cytolysin (with 303 bp was amplified by RT-PCR and was sequenced. The sequence showed maximum homology (97% with the already reported cytolysins from other sea anemone species.

  4. Reproductive biology of the sea anemone shrimp Periclimenes rathbunae (Caridea, Palaemonidae, Pontoniinae), from the Caribbean coast of Costa Rica

    Science.gov (United States)

    Azofeifa-Solano, Juan Carlos; Elizondo-Coto, Marcelo; Wehrtmann, Ingo S.

    2014-01-01

    Abstract Caridean shrimps are a highly diverse group and many species form symbiotic relationships with different marine invertebrates. Periclimenes rathbunae is a brightly colored shrimp that lives predominantly in association with sea anemones. Information about the reproductive ecology of the species is scarce. Therefore, we collected 70 ovigerous females inhabiting the sun sea anemone Stichodactyla helianthus in coral reefs from the southern Caribbean coast of Costa Rica. Females produced on average 289 ± 120 embryos. The volume of recently-produced embryos was on average 0.038 mm3, and embryo volume increased by 192% during the incubation period. The average embryo mortality during embryogenesis was 24%. The reproductive output was 0.24 ± 0.094, considerably higher than in many other pontoniine shrimps. Females carrying embryos close to hatching showed fully developed ovaries, suggesting consecutive spawning. We assume that the sheltered habitat, living on sea anemones, allows Periclimenes rathbunae to allocate more energy in embryo production than most other free-living caridean shrimps. This is the first record of Periclimenes rathbunae for Costa Rica. PMID:25561838

  5. Fine-scale population structure of two anemones (Stichodactyla gigantea and Heteractis magnifica) in Kimbe Bay, Papua New Guinea

    KAUST Repository

    Gatins, Remy

    2014-12-01

    Anemonefish are one of the main groups that have been used over the last decade to empirically measure larval dispersal and connectivity in coral reef populations. A few species of anemones are integral to the life history of these fish, as well as other obligate symbionts, yet the biology and population structure of these anemones remains poorly understood. The aim of this study was to measure the genetic structure of these anemones within and between two reefs in order to assess their reproductive mode and dispersal potential. To do this, we sampled almost exhaustively two anemones species (Stichodactyla gigantea and Heteractis magnifica) at two small islands in Kimbe Bay (Papua New Guinea) separated by approximately 25 km. Both the host anemones and the anemonefish are heavily targeted for the aquarium trade, in addition to the populations being affected by bleaching pressures (Hill and Scott 2012; Hobbs et al. 2013; Saenz- Agudelo et al. 2011; Thomas et al. 2014), therefore understanding their biology is crucial for better management strategies. Panels of microsatellite markers were developed for each species using next generation sequencing tools. Clonality analyses confirm six pairs of identical genotypes for S. gigantea (n=350) and zero for H. magnifica (n=128), indicating presence/absence of asexual reproduction in this region. S. gigantea showed low structure between islands (FST= 0.003, p-value= 0.000), however, even if the majority of the individuals were unrelated (r~0), 81 families that shared 50% of their genetic material formed from two to four members were found. Out of these families, 45% were found with individuals only within Tuare Island, 11% only in Kimbe Island, and 44% were sharing individuals among islands. In comparison, H. magnifica showed no structure (FST= 0.002, p-value= 0.278), mean relatedness indicated the majority of individuals were unrelated, and 31 families were identified. Families again consisted from two to four members and

  6. Prolonged exposure to elevated CO2 promotes growth of the algal symbiont Symbiodinium muscatinei in the intertidal sea anemone Anthopleura elegantissima

    Directory of Open Access Journals (Sweden)

    Trisha Towanda

    2012-05-01

    Some photosynthetic organisms benefit from elevated levels of carbon dioxide, but studies on the effects of elevated PCO2 on the algal symbionts of animals are very few. This study investigated the impact of hypercapnia on a photosynthetic symbiosis between the anemone Anthopleura elegantissima and its zooxanthella Symbiodinium muscatinei. Anemones were maintained in the laboratory for 1 week at 37 Pa PCO2 and pH 8.1. Clonal pairs were then divided into two groups and maintained for 6 weeks under conditions naturally experienced in their intertidal environment, 45 Pa PCO2, pH 8.1 and 231 Pa PCO2, pH 7.3. Respiration and photosynthesis were measured after the 1-week acclimation period and after 6 weeks in experimental conditions. Density of zooxanthellal cells, zooxanthellal cell size, mitotic index and chlorophyll content were compared between non-clonemate anemones after the 1-week acclimation period and clonal anemones at the end of the experiment. Anemones thrived in hypercapnia. After 6 weeks, A. elegantissima exhibited higher rates of photosynthesis at 45 Pa (4.2 µmol O2 g−1 h−1 and 231 Pa (3.30 µmol O2 g−1 h−1 than at the initial 37 Pa (1.53 µmol O2 g−1 h−1. Likewise, anemones at 231 Pa received more of their respiratory carbon from zooxanthellae (CZAR  = 78.2% than those at 37 Pa (CZAR  = 66.6% but less than anemones at 45 Pa (CZAR  = 137.3%. The mitotic index of zooxanthellae was significantly greater in the hypercapnic anemones than in anemones at lower PCO2. Excess zooxanthellae were expelled by their hosts, and cell densities, cell diameters and chlorophyll contents were not significantly different between the groups. The response of A. elegantissima to hypercapnic acidification reveals the potential adaptation of an intertidal, photosynthetic symbiosis for high PCO2.

  7. Re-description of Phymactis papillosa (Lesson, 1830) and Phymanthea pluvia (Drayton in Dana, 1846) (Cnidaria: Anthozoa), two common actiniid sea anemones from the south east Pacific with a discussion of related genera

    NARCIS (Netherlands)

    Häussermann, V.

    2004-01-01

    Actiniid sea anemones possess few characteristics of taxonomic value, which makes columnar outgrowths one of the most important features for systematic work. There are two species of actiniid sea anemones known from Chile and southern Peru that exhibit a column densely covered with non-adhesive vesi

  8. Iodine labelling of sea anemone toxin II, and binding to normal and denervated diaphragm

    International Nuclear Information System (INIS)

    1. Sea anemone toxin II (ATX II) which keeps the activated sodium channels open, can be labelled at its histidine residues with 125I up to a specific radioactivity of 500 Ci/mmole. Upon intraventricular injection in mice, ATX II causes acute, short-lasting hyperexcitation and convulsions. Its LD50 in mice is between 25 and 50 ng of the native peptide, and between 50 and 100 ng of the radioactive material per animal. 2. The labelled peptide is bound to mouse diaphragm from where it can be displaced by ATX II and, even better, by scorpion neurotoxin but not by other basic peptides, e.g., histone or aprotinin. Binding is not significantly influenced by 50 mM potassium, by replacing sodium with choline, by veratridine or tetrodotoxin. In contrast to binding of α-bungarotoxin, binding of ATX II is not changed by denervation of the diaphragm. ATX II binds not only to the muscular but also to the tendinous moiety of the mouse diaphragm. 3. ATX II lowers the surface tension of water. Further experiments are needed to establish the usefulness of 125I-ATX for labelling sodium channels in excitable membranes. (orig.)

  9. Analysis of an Anemone-Type Eruption in an On-Disk Coronal Hole

    Science.gov (United States)

    Tennant, Allyn; Sterling, Alphonse; Adams, Mitzi; Alexander, Caroline; Moore, Ronald; Woolley, Robert

    2016-01-01

    We report on an eruption seen in a very small coronal hole (about 120 arcseconds across), beginning at approximately 19:00 Universal Time on March 3, 2016. The event was initially observed by an amateur astronomer (RW) in an H-alpha movie from the Global Oscillation Network Group (GONG); the eruption attracted the attention of the observer because there was no nearby active region. To examine the region in detail, we use data from the Solar Dynamics Observatory (SDO), provided by the Atmospheric Imaging Assembly (AIA) in wavelengths 193 angstroms, 304 angstroms, and 94 angstroms, and the Helioseismic and Magnetic Imager (HMI). Data analysis and calibration activities such as scaling, rotation so that north is up, and removal of solar rotation are accomplished with SunPy. The eruption in low-cadence HMI data begins with the appearance of a bipole in the location of the coronal hole, followed by (apparent) expansion outwards when the intensity of the AIA wavelengths brighten; as the event proceeds, the coronal hole disappears. From high-cadence data, we will present results on the magnetic evolution of this structure, how it is related to intensity brightenings seen in the various SDO/AIA wavelengths, and how this event compares with the standard-anemone picture.

  10. Analysis of an Anemone-Type Eruption in an On-Disk Coronal Hole

    Science.gov (United States)

    Adams, Mitzi; Tennant, Allyn F.; Alexander, Caroline E.; Sterling, Alphonse C.; Moore, Ronald L.; Woolley, Robert

    2016-05-01

    We report on an eruption seen in a very small coronal hole (about 120'' across), beginning at approximately 19:00 UT on March 3, 2016. The event was initially observed by an amateur astronomer (RW) in an H-alpha movie from the Global Oscillation Network Group (GONG); the eruption attracted the attention of the observer because there was no nearby active region. To examine the region in detail, we use data from the Solar Dynamics Observatory (SDO), provided by the Atmospheric Imaging Assembly (AIA) in wavelengths 193 Å, 304 Å, and 94 Å, and the Helioseismic and Magnetic Imager (HMI). Data analysis and calibration activities such as scaling, rotation so that north is up, and removal of solar rotation are accomplished with SunPy. The eruption in low-cadence HMI data begins with the appearance of a bipole in the location of the coronal hole, followed by (apparent) expansion outwards when the intensity of the AIA wavelengths brighten; as the event proceeds, the coronal hole disappears. From high-cadence data, we will present results on the magnetic evolution of this structure, how it is related to intensity brightenings seen in the various SDO/AIA wavelengths, and how this event compares with the standard-anemone picture.

  11. High in situ repeatability of behaviour indicates animal personality in the beadlet anemone Actinia equina (Cnidaria.

    Directory of Open Access Journals (Sweden)

    Mark Briffa

    Full Text Available 'Animal personality' means that individuals differ from one another in either single behaviours or suites of related behaviours in a way that is consistent over time. It is usually assumed that such consistent individual differences in behaviour are driven by variation in how individuals respond to information about their environment, rather than by differences in external factors such as variation in microhabitat. Since behavioural variation is ubiquitous in nature we might expect 'animal personality' to be present in diverse taxa, including animals with relatively simple nervous systems. We investigated in situ startle responses in a sea anemone, Actinia equina, to determine whether personalities might be present in this example of an animal with a simple nervous system. We found very high levels of repeatability among individuals that were re-identified in the same locations over a three week sampling period. In a subset of the data, where we used tide-pool temperature measurements to control for a key element of variation in microhabitat, these high levels of repeatability remained. Although a range of other consistent differences in micro-habitat features could have contributed to consistent differences between the behaviour of individuals, these data suggest the presence of animal personality in A. equina. Rather than being restricted to certain groups, personality may be a general feature of animals and may be particularly pronounced in species with simple nervous systems.

  12. Variations in the Life Cycle of Anemone patens L. (Ranunculaceae in Wild Populations of Canada

    Directory of Open Access Journals (Sweden)

    Vladimir Kricsfalusy

    2016-06-01

    Full Text Available Based on a study of a perennial herb Anemone patens L. (Ranunculaceae in a variety of natural habitats in Saskatchewan, Canada, eight life stages (seed, seedling, juvenile, immature, vegetative, generative, subsenile, and senile are distinguished and characterized in detail. The species ontogenetic growth patterns are investigated. A. patens has a long life cycle that may last for several decades which leads to the formation of compact clumps. The distribution and age of clumps vary substantially in different environments with different levels of disturbance. The plant ontogeny includes the regular cycle with reproduction occurring through seeds. There is an optional subsenile vegetative disintegration at the end of the life span. The following variations in the life cycle of A. patens are identified: with slower development in young age, with an accelerated development, with omission of the generative stage, with retrogression to previous life stages in mature age, and with vegetative dormancy. The range of variations in the life cycle of A. patens may play an important role in maintaining population stability in different environmental conditions and management regimes.

  13. Pharmacological effects of two cytolysins isolated from the sea anemone Stichodactyla helianthus

    Indian Academy of Sciences (India)

    T García; D Martinez; A Palmero; C Soto; M Tejuca; F Pazos; R Menéndez; C Alvarez; A Garateix

    2009-12-01

    Sticholysins I and II (St I/II) are cytolysins purified from the sea anemone Stichodactyla helianthus. In this study, we show their pharmacological action on guinea-pig and snail models in native and pH-denatured conditions in order to correlate the pharmacological findings with the pore-forming activity of both isoforms. In guinea-pig erythrocytes ( = 3), St II possessed higher haemolytic activity in comparison with St I and this activity was lost at an alkaline pH. In molluscan central neurons ( = 30), they irreversibly decreased the amplitude of the cholinergic response; St I (EC50 0.6 molL–1) was more potent than St II (EC50 > 6.6 molL–1) and they both increased the duration of the action potential; these effects were absent at an alkaline pH. In guinea-pig isolated atrium ( = 25), both increased the amplitude of the contraction force, but St II was more potent than St I (EC50 0.03 molL–1 and 0.3 molL–1, respectively) and this effect persisted at an alkaline pH. In summary, both cytolysins have neuroactive and cardioactive properties. The main mechanism in molluscan neurons seems to be associated with the cytolytic activity of these molecules, whereas in guinea-pig atrium, the existence of an additional pharmacological mechanism might be contributing to the observed effect.

  14. Comprehensive Analysis of the Triterpenoid Saponins Biosynthetic Pathway in Anemone flaccida by Transcriptome and Proteome Profiling

    Science.gov (United States)

    Zhan, Chuansong; Li, Xiaohua; Zhao, Zeying; Yang, Tewu; Wang, Xuekui; Luo, Biaobiao; Zhang, Qiyun; Hu, Yanru; Hu, Xuebo

    2016-01-01

    Background: Anemone flaccida Fr. Shmidt (Ranunculaceae), commonly known as ‘Di Wu’ in China, is a perennial herb with limited distribution. The rhizome of A. flaccida has long been used to treat arthritis as a tradition in China. Studies disclosed that the plant contains a rich source of triterpenoid saponins. However, little is known about triterpenoid saponins biosynthesis in A. flaccida. Results: In this study, we conducted the tandem transcriptome and proteome profiling of a non-model medicinal plant, A. flaccida. Using Illumina HiSeq 2000 sequencing and iTRAQ technique, a total of 46,962 high-quality unigenes were obtained with an average sequence length of 1,310 bp, along with 1473 unique proteins from A. flaccida. Among the A. flaccida transcripts, 36,617 (77.97%) showed significant similarity (E-value HiSeq 2000 sequencing platform and iTRAQ technique was shown to be a powerful method for the discovery of candidate genes, which encoded enzymes that were responsible for the biosynthesis of novel secondary metabolites in a non-model plant. The transcriptome data of our study provides a very important resource for the understanding of the triterpenoid saponins biosynthesis of A. flaccida. PMID:27504115

  15. The genome of Aiptasia, a sea anemone model for coral symbiosis.

    Science.gov (United States)

    Baumgarten, Sebastian; Simakov, Oleg; Esherick, Lisl Y; Liew, Yi Jin; Lehnert, Erik M; Michell, Craig T; Li, Yong; Hambleton, Elizabeth A; Guse, Annika; Oates, Matt E; Gough, Julian; Weis, Virginia M; Aranda, Manuel; Pringle, John R; Voolstra, Christian R

    2015-09-22

    The most diverse marine ecosystems, coral reefs, depend upon a functional symbiosis between a cnidarian animal host (the coral) and intracellular photosynthetic dinoflagellate algae. The molecular and cellular mechanisms underlying this endosymbiosis are not well understood, in part because of the difficulties of experimental work with corals. The small sea anemone Aiptasia provides a tractable laboratory model for investigating these mechanisms. Here we report on the assembly and analysis of the Aiptasia genome, which will provide a foundation for future studies and has revealed several features that may be key to understanding the evolution and function of the endosymbiosis. These features include genomic rearrangements and taxonomically restricted genes that may be functionally related to the symbiosis, aspects of host dependence on alga-derived nutrients, a novel and expanded cnidarian-specific family of putative pattern-recognition receptors that might be involved in the animal-algal interactions, and extensive lineage-specific horizontal gene transfer. Extensive integration of genes of prokaryotic origin, including genes for antimicrobial peptides, presumably reflects an intimate association of the animal-algal pair also with its prokaryotic microbiome. PMID:26324906

  16. The genome of Aiptasia, a sea anemone model for coral symbiosis

    KAUST Repository

    Baumgarten, Sebastian

    2015-08-31

    The most diverse marine ecosystems, coral reefs, depend upon a functional symbiosis between a cnidarian animal host (the coral) and intracellular photosynthetic dinoflagellate algae. The molecular and cellular mechanisms underlying this endosymbiosis are not well understood, in part because of the difficulties of experimental work with corals. The small sea anemone Aiptasia provides a tractable laboratory model for investigating these mechanisms. Here we report on the assembly and analysis of the Aiptasia genome, which will provide a foundation for future studies and has revealed several features that may be key to understanding the evolution and function of the endosymbiosis. These features include genomic rearrangements and taxonomically restricted genes that may be functionally related to the symbiosis, aspects of host dependence on alga-derived nutrients, a novel and expanded cnidarian-specific family of putative pattern-recognition receptors that might be involved in the animal–algal interactions, and extensive lineage-specific horizontal gene transfer. Extensive integration of genes of prokaryotic origin, including genes for antimicrobial peptides, presumably reflects an intimate association of the animal–algal pair also with its prokaryotic microbiome.

  17. Antifouling and Fungicidal Resorcylic Acid Lactones from the Sea Anemone-Derived Fungus Cochliobolus lunatus.

    Science.gov (United States)

    Liu, Qing-Ai; Shao, Chang-Lun; Gu, Yu-Cheng; Blum, Mathias; Gan, Li-She; Wang, Kai-Ling; Chen, Min; Wang, Chang-Yun

    2014-03-25

    Three new 14-membered resorcylic acid lactones, cochliomycins D-F, 1-3, and eight known analogues, 4-11, were isolated from the sea anemone-derived fungus Cochliobolus lunatus. Compounds 1-4 are diastereomers differing from each other by the absolute configurations of the 4',5'-diol chiral centers. The absolute configurations of 1-4 were established by the CD exciton chirality method and TDDFT ECD calculations. In antifouling assays, 1, 3-6, and 6a exhibited potent antifouling activities against the larval settlement of the barnacle Balanus amphitrite at nontoxic concentrations, with EC50 values ranging from 1.82 to 22.5 μg/mL. Noticeably, fungicide whole-plant assays indicated that 6 showed excellent activity on the Plasmopara viticola preventative test at 6 ppm and concentration-dependent activity on the Phytophthora infestans preventative application at 200, 60, and 20 ppm. Preliminary structure-activity relationships are also discussed. PMID:24635109

  18. Changes of Cellular Superficial Configuration of Symbiotic Algae During Cultivation from Two Anemones Found in the South China Sea

    Institute of Scientific and Technical Information of China (English)

    2008-01-01

    Symbiotic algae from two anemones, Radianthus macrodactylus and Stichodactyla mertensii, found in the South China Sea, were cultivated in ASP-8A medium in this study. Changes of superficial configuration of symbiotic algae during the cultivation were studied by means of a microscope and a scanning electron microscope (SEM). A number of small cavities appeared on the surfaces of symbiotic algae after they were cultivated for 10 h. The cavities enlarged and the cell contents were lost with extended cultivation. Our data suggested that the presence of cavities on symbiotic algae surfaces may be one of the main reasons for failure to culture symbiotic algae in an artificial medium.

  19. Tenacibaculum aiptasiae sp. nov., isolated from a sea anemone Aiptasia pulchella.

    Science.gov (United States)

    Wang, Jih-Terng; Chou, Yi-Ju; Chou, Jui-Hsing; Chen, Chaolun Allen; Chen, Wen-Ming

    2008-04-01

    A novel bacterial strain, designated a4T, isolated from a sea anemone (Aiptasia pulchella) in Taiwan, was characterized using a polyphasic taxonomic approach. Strain a4T was aerobic, Gram-negative, pale-yellow-pigmented and rod-shaped. It grew optimally at 30-35 degrees C, in the presence of 3-4 % (w/v) NaCl and at pH 8.0. Phylogenetic analyses based on 16S rRNA gene sequences showed that the strain belonged to the genus Tenacibaculum (family Flavobacteriaceae, phylum Bacteroidetes). The closest neighbours were Tenacibaculum lutimaris TF-26T (97.6 % similarity) and Tenacibaculum aestuarii SMK-4T (97.7 % similarity). The novel isolate could be distinguished from all Tenacibaculum species by several phenotypic characteristics. The major fatty acids were summed feature 3 (comprising C16 : 1 omega 7c and/or iso-C15 : 0 2-OH, 19.6 %), iso-C15 : 0 (12.9 %), iso-C16 : 0 3-OH (10.2 %), iso-C17 : 0 3-OH (9.9 %) and iso-C15 : 1 (9.5 %). The DNA G+C content was 35.0 mol%. Hence, genotypic and phenotypic data demonstrate that strain a4(T) should be classified as a representative of a novel species in the genus Tenacibaculum, for which the name Tenacibaculum aiptasiae sp. nov. is proposed. The type strain is a4T (=BCRC 17655T =LMG 24004T). PMID:18398166

  20. Differential distribution of lipids in epidermis, gastrodermis and hosted Symbiodinium in the sea anemone Anemonia viridis.

    Science.gov (United States)

    Revel, Johana; Massi, Lionel; Mehiri, Mohamed; Boutoute, Marc; Mayzaud, Patrick; Capron, Laure; Sabourault, Cécile

    2016-01-01

    Cnidarian-dinoflagellate symbiosis mainly relies on nutrient recycling, thus providing both partners with a competitive advantage in nutrient-poor waters. Essential processes related to lipid metabolism can be influenced by various factors, including hyperthermal stress. This can affect the lipid content and distribution in both partners, while contributing to symbiosis disruption and bleaching. In order to gain further insight into the role and distribution of lipids in the cnidarian metabolism, we investigated the lipid composition of the sea anemone Anemonia viridis and its photosynthetic dinoflagellate endosymbionts (Symbiodinium). We compared the lipid content and fatty acid profiles of the host cellular layers, non-symbiotic epidermal and symbiont-containing gastrodermal cells, and those of Symbiodinium, in a mass spectrometry-based assessment. Lipids were more concentrated in Symbiodinium cells, and the lipid class distribution was dominated by polar lipids in all tissues. The fatty acid distribution between host cell layers and Symbiodinium cells suggested potential lipid transfers between the partners. The lipid composition and distribution was modified during short-term hyperthermal stress, mainly in Symbiodinium cells and gastrodermis. Exposure to elevated temperature rapidly caused a decrease in polar lipid C18 unsaturated fatty acids and a strong and rapid decrease in the abundance of polar lipid fatty acids relative to sterols. These lipid indicators could therefore be used as sensitive biomarkers to assess the physiology of symbiotic cnidarians, especially the effect of thermal stress at the onset of cnidarian bleaching. Overall, the findings of this study provide some insight on key lipids that may regulate maintenance of the symbiotic interaction. PMID:26478191

  1. Identification of hemolytic and neuroactive fractions in the venom of the sea anemone Bunodosoma cangicum

    Directory of Open Access Journals (Sweden)

    P. Lagos

    2001-07-01

    Full Text Available Sea anemones are a rich source of biologically active substances. In crayfish muscle fibers, Bunodosoma cangicum whole venom selectively blocks the I K(Ca currents. In the present study, we report for the first time powerful hemolytic and neuroactive effects present in two different fractions obtained by gel-filtration chromatography from whole venom of B. cangicum. A cytolytic fraction (Bcg-2 with components of molecular mass ranging from 8 to 18 kDa elicited hemolysis of mouse erythrocytes with an EC50 = 14 µg/ml and a maximum dose of 22 µg/ml. The effects of the neuroactive fraction, Bcg-3 (2 to 5 kDa, were studied on isolated crab nerves. This fraction prolonged the compound action potentials by increasing their duration and rise time in a dose-dependent manner. This effect was evident after the washout of the preparation, suggesting the existence of a reversible substance that was initially masking the effects of an irreversible one. In order to elucidate the target of Bcg-3 action, the fraction was applied to a tetraethylammonium-pretreated preparation. An additional increase in action potential duration was observed, suggesting a blockade of a different population of K+ channels or of tetraethylammonium-insensitive channels. Also, tetrodotoxin could not block the action potentials in a Bcg-3-pretreated preparation, suggesting a possible interaction of Bcg-3 with Na+ channels. The present data suggest that B. cangicum venom contains at least two bioactive fractions whose activity on cell membranes seems to differ from the I K(Ca blockade described previously.

  2. Staining protocol for the histological study of sea anemones (Anthozoa: Actiniaria with recommendations for anesthesia and fixation of specimens

    Directory of Open Access Journals (Sweden)

    Carlos Spano

    2013-11-01

    Full Text Available Many of the characteristics used in sea anemone taxonomy can only be examined through histological sections. Since there is no standardized procedure for this purpose, various anesthesia and fixation techniques applied to specimens of the intertidal species Anthopleura hermaphroditica and Bunodactis hermafroditica are discussed. Additionally, further modifications are proposed to the Masson's trichrome method according to the results obtained on these species. The combined effect of the short application of menthol crystals, together with small doses of MgCl2 were the most satisfactory anesthetics for maintaining the specimens expanded. The best preparations were obtained from samples fixed for several months in 8% seawater formalin; however, in order to achieve a good differentiation of the tissue, mordanting the samples with Bouin's fixative was necessary. Besides being a fast method, the modified Masson's trichrome gives very good contrasts between the epithelia and the mesoglea, and allows controlling the timing of differentiation during staining. The present paper includes suggestions and precautions and thus offers practical help for the histological study of sea anemones.

  3. Characterization of a novel EF-hand homologue, CnidEF, in the sea anemone Anthopleura elegantissima.

    Science.gov (United States)

    Hauck, Laura L; Phillips, Wendy S; Weis, Virginia M

    2007-04-01

    The superfamily of EF-hand proteins is comprised of a large and diverse group of proteins that contain one or more characteristic EF-hand calcium-binding domains. This study describes and characterizes a novel EF-hand cDNA, CnidEF, from the sea anemone Anthopleura elegantissima (Phylum Cnidaria, Class Anthozoa). CnidEF was found to contain two EF-hand motifs near the C-terminus of the deduced amino acid sequence and two regions near the N-terminus that could represent degenerate EF-hand motifs. CnidEF homologues were also identified from two other sea anemone species. A combination of bioinformatic and molecular phylogenetic analyses was used to compare CnidEF to EF-hand proteins in other organisms. The closest homologues identified from these analyses were a luciferin binding protein (LBP) involved in the bioluminescence of the anthozoan Renilla reniformis, and a sarcoplasmic calcium-binding protein (SARC) involved in fluorescence of the annelid worm Nereis diversicolor. Predicted structure and folding analysis revealed a close association with bioluminescent aequorin (AEQ) proteins from the hydrozoan cnidarian Aequorea aequorea. Neighbor-joining analyses grouped CnidEF within the SARC lineage along with AEQ and other cnidarian bioluminescent proteins rather than in the lineage containing calmodulin (CAM) and troponin-C (TNC). PMID:17280859

  4. Domain combination of the vertebrate-like TLR gene family: implications for their origin and evolution

    Indian Academy of Sciences (India)

    Baojun Wu; Tianxiao Huan; Jing Gong; Pin Zhou; Zengliang Bai

    2011-12-01

    Domain shuffling, which is an important mechanism in the evolution of multi-domain proteins, has shaped the evolutionary development of the immune system in animals. Toll and Toll-like receptors (TLRs) are a class of proteins that play a key role in the innate and adaptive immune systems. Draft genome sequences provide the opportunity to compare the Toll/TLR gene repertoire among representative metazoans. In this study, we investigated the combination of Toll/interleukin-1 receptor (TIR) and leucine-rich repeat (LRR) domains of metazoan Toll/TLRs. Before Toll with both domains occurred in Cnidaria (sea anemone, Nematostella vectensis), through domain combinations, TIR-only and LRR-only proteins had already appeared in sponges (Amphimedon queenslandica). Although vertebrate-like TIR (V-TIR) domain already appeared in Cnidaria, the vertebrate-like TLR (V-TLR) with both domains appeared much later. The first combination between V-TIR domain and vertebrate-like LRR (V-LRR) domain for V-TLR may have occurred after the divergence of Cnidaria and bilateria. Then, another combination for V-TLR, a recombination of both domains, possibly occurred before or during the evolution of primitive vertebrates. Taken together, two rounds of domain combinations may thus have co-shaped the vertebrate TLRs.

  5. From Sea Anemone to Homo Sapiens: The Evolution of the p53 Family of Genes

    Energy Technology Data Exchange (ETDEWEB)

    Levine, Arnold (Institute for Advanced Study)

    2009-09-14

    The human genome contains three transcription factors termed p53, p63 and p73 which are related orthologues. The function of the p53 protein is to respond to a wide variety of stresses which can disrupt the fidelity of DNA replication and cell division in somatic cells of the body. These stress signals, such as DNA damage, increase the mutation rate during DNA duplication and so an active p53 protein responds by eliminating clones of cells with mutations employing apoptosis, senescence or cell cycle arrest. In this way the p53 protein acts as a tumor suppressor preventing the mutations that can lead to cancers. The p63 and p73 proteins act in a similar fashion to protect the germ line cells in females (eggs). In addition the p63 protein plays a central role in the formation of epithelial cell layers and p73 plays a critical role in the formation of several structures in the central nervous system. Based upon their amino acid sequences and structural considerations the oldest organisms that contain an ancestor of the p53/p63/p73 gene are the sea anemone or hydra. The present day representatives of these animals contain a p63/p73 like ancestor gene and the protein functions in germ cells of this animal to enforce the fidelity of DNA replication after exposure to ultraviolet light. Thus the structure and functions of this gene family have been preserved for over one billion years of evolution. Other invertebrates such as the worm, the fly and the clam contain a very similar ancestor gene with a similar set of functions. The withdrawal of a food source from a worm results in the p63/p73 mediated apoptosis of the eggs so that new organisms will not be hatched into a poor environment. A similar response is thought to occur in humans. Thus this ancestor gene ensures the fidelity of the next generation of organisms. The first time a clearly distinct new p53 gene arises is in the cartilaginous fish and in the bony fish a separation of the p

  6. Population genetics of the invasive cryptogenic anemone, Anemonia alicemartinae, along the southeastern Pacific coast

    Science.gov (United States)

    Canales-Aguirre, C. B.; Quiñones, A.; Hernández, C. E.; Neill, P. E.; Brante, A.

    2015-08-01

    One of the most important issues in biological invasions is understanding the factors and mechanisms determining the invasion success of non-native species. Theoretical and empirical works have shown that genetic diversity is a determinant of invasion success; thus, studying spatial patterns of genetic diversity, and exploring how biological and physical factors shape this population trait, are fundamental for understanding this phenomenon. Coastal marine ecosystems are one of the most susceptible habitats to invasion given the complex network of maritime transport. In this work we study the cryptogenic anemone, Anemonia alicemartinae, which has rapidly increased its geographical range southward during the last 50 years (approx. 2000 km) along the southeastern Pacific coast. Based on COI mtDNA sequences we evaluated three main hypotheses: a) the genetic diversity of A. alicemartinae decreases according to the direction of invasion (from north to south); b) there is biogeographic-phylogeographic concordance at the 30°S biogeographic break; and c) the demographic history is coherent with a recent geographic expansion. A total of 161 individual samples of A. alicemartinae were collected along the southeastern Pacific coast range of distribution, covering more than 2000 km, including samples along the 30°S biogeographical break. Results showed low genetic diversity (Hd = 0.253; π = 0.08) and a lack of geographic population genetic structure (FST = - 0.009, p-value = 0.656). The highest genetic diversity was observed in Peru (Chero and Mesas) and at localities close to the main Chilean seaports. We did not observe concordance between biogeographic and phylogeographic patterns or isolation by distance. Demographic indices (D = - 2.604, p < 0.001; Fu's = - 26.619, p < 0.001), as well as a star-like configuration of the haplotype network support recent population expansion of this species. Our results, together with historical field observations, support the idea that

  7. In silico assessment of interaction of sea anemone toxin APETx2 and acid sensing ion channel 3

    International Nuclear Information System (INIS)

    Highlights: • We have made a reasonable model of rat ASIC3 using published structure of chicken ASIC1. • We have docked sea anemone toxin APETx2 on the model. • We have identified two putative sites for toxin binding. • We have argued for plausibility one site over the other. • We have identified the residues that are likely to be critical for APETx2–ASIC3 interaction. - Abstract: Acid sensing ion channels (ASICs) are proton-gated cation channels that are expressed throughout the nervous system and have been implicated in mediating sensory perception of noxious stimuli. Amongst the six ASIC isoforms, ASIC1a, 1b, 2a and 3 form proton-gated homomers, which differ in their activation and inactivation kinetics, expression profiles and pharmacological modulation; protons do not gate ASIC2b and ASIC4. As with many other ion channels, structure-function studies of ASICs have been greatly aided by the discovery of some toxins that act in isoform-specific ways. ASIC3 is predominantly expressed by sensory neurons of the peripheral nervous system where it acts to detect acid as a noxious stimulus and thus plays an important role in nociception. ASIC3 is the only ASIC subunit that is inhibited by the sea anemone (Anthopleura elegantissima)-derived toxin APETx2. However, the molecular mechanism by which APETx2 interacts with ASIC3 remains largely unknown. In this study, we made a homology model of ASIC3 and used extensive protein–protein docking to predict for the first time, the probable sites of APETx2 interaction on ASIC3. Additionally, using computational alanine scanning, we also suggest the ‘hot-spots’ that are likely to be critical for ASIC3–APETx2 interaction

  8. In silico assessment of interaction of sea anemone toxin APETx2 and acid sensing ion channel 3

    Energy Technology Data Exchange (ETDEWEB)

    Rahman, Taufiq, E-mail: mtur2@cam.ac.uk; Smith, Ewan St. John

    2014-07-18

    Highlights: • We have made a reasonable model of rat ASIC3 using published structure of chicken ASIC1. • We have docked sea anemone toxin APETx2 on the model. • We have identified two putative sites for toxin binding. • We have argued for plausibility one site over the other. • We have identified the residues that are likely to be critical for APETx2–ASIC3 interaction. - Abstract: Acid sensing ion channels (ASICs) are proton-gated cation channels that are expressed throughout the nervous system and have been implicated in mediating sensory perception of noxious stimuli. Amongst the six ASIC isoforms, ASIC1a, 1b, 2a and 3 form proton-gated homomers, which differ in their activation and inactivation kinetics, expression profiles and pharmacological modulation; protons do not gate ASIC2b and ASIC4. As with many other ion channels, structure-function studies of ASICs have been greatly aided by the discovery of some toxins that act in isoform-specific ways. ASIC3 is predominantly expressed by sensory neurons of the peripheral nervous system where it acts to detect acid as a noxious stimulus and thus plays an important role in nociception. ASIC3 is the only ASIC subunit that is inhibited by the sea anemone (Anthopleura elegantissima)-derived toxin APETx2. However, the molecular mechanism by which APETx2 interacts with ASIC3 remains largely unknown. In this study, we made a homology model of ASIC3 and used extensive protein–protein docking to predict for the first time, the probable sites of APETx2 interaction on ASIC3. Additionally, using computational alanine scanning, we also suggest the ‘hot-spots’ that are likely to be critical for ASIC3–APETx2 interaction.

  9. Pharmacological and biomedical properties of sea anemones Paracondactylis indicus, Paracondactylis sinensis, Heteractis magnificaand Stichodactyla haddonifrom East coast of India

    Institute of Scientific and Technical Information of China (English)

    Bragadeeswaran Subramanian; Thangaraj Sangappellai; Rajiv Chandra Rajak; Balaji Diraviam

    2011-01-01

    Objective:To explore the biomedical and pharmacological activity ofParacondactylis indicus (P. indicus),Paracondactylis sinensis(P. sinensis),Heteractis magnifica (H. magnifica) and Stichodactyla haddoni (S. haddoni).Methods: The live sea anemones were kept inside the glass bowl along with some amount of distilled water in an ice container for15 min. During stress condition, nematocysts released from the tentacles were collected and centrifuged at5 000 rpm for 15 min. The supernatant were collected in separate cleaned beakers for lyophilisation.Results:The protein content of crude extracts was15.2, 28.7, 18.2 and35.4μg/mL. In hemolytic assay, the P. indicus was sensitive (16.842 HT/mg) on chicken blood butP. sinensis was less sensitive (1.114 HT/mg) on chicken and goat blood. WhereasH. magnificaandS. haddoni showed hemolysis (0.879, 0.903 HT/mg and 56.263, 0.451 HT/mg) in chicken and goat blood. In antimicrobial assay, the methanol extract ofP. indicus showed maximum inhibition zone of9.7mm againstS. typhii andP. sinensisshowed9.8 mm againstK. pneumonia in methanol and ethanol extracts. Whereas theH. magnifica andS. haddoni showed maximum of10 mm againstS. typhii, K. pneumonia in methanol and ethanol extracts.Conclusions: The high toxic sea anemones may also contain some biologically active agents which has haemolytic, analgesic and anti-infilamatory activity.

  10. Proteome-wide dataset supporting the study of ancient metazoan macromolecular complexes

    OpenAIRE

    Sadhna Phanse; Cuihong Wan; Blake Borgeson; Fan Tu; Kevin Drew; Greg Clark; Xuejian Xiong; Olga Kagan; Julian Kwan; Alexandr Bezginov; Kyle Chessman; Swati Pal; Graham Cromar; Ophelia Papoulas; Zuyao Ni

    2015-01-01

    Our analysis examines the conservation of multiprotein complexes among metazoa through use of high resolution biochemical fractionation and precision mass spectrometry applied to soluble cell extracts from 5 representative model organisms Caenorhabditis elegans, Drosophila melanogaster, Mus musculus, Strongylocentrotus purpuratus, and Homo sapiens. The interaction network obtained from the data was validated globally in 4 distant species (Xenopus laevis, Nematostella vectensis, Dictyostelium ...

  11. Two variants of the major serine protease inhibitor from the sea anemone Stichodactyla helianthus, expressed in Pichia pastoris.

    Science.gov (United States)

    García-Fernández, Rossana; Ziegelmüller, Patrick; González, Lidice; Mansur, Manuel; Machado, Yoan; Redecke, Lars; Hahn, Ulrich; Betzel, Christian; Chávez, María de Los Ángeles

    2016-07-01

    The major protease inhibitor from the sea anemone Stichodactyla helianthus (ShPI-1) is a non-specific inhibitor that binds trypsin and other trypsin-like enzymes, as well as chymotrypsin, and human neutrophil elastase. We performed site-directed mutagenesis of ShPI-1 to produce two variants (rShPI-1/K13L and rShPI/Y15S) that were expressed in Pichia pastoris, purified, and characterized. After a single purification step, 65 mg and 15 mg of protein per liter of culture supernatant were obtained for rShPI-1/K13L and rShPI/Y15S, respectively. Functional studies demonstrated a 100-fold decreased trypsin inhibitory activity as result of the K13L substitution at the reactive (P1) site. This protein variant has a novel tight-binding inhibitor activity of pancreatic elastase and increased activity toward neutrophil elastase in comparison to rShPI-1A. In contrast, the substitution Y15S at P2' site did not affect the Ki value against trypsin, but did reduce activity 10-fold against chymotrypsin and neutrophil elastase. Our results provide two new ShPI-1 variants with modified inhibitory activities, one of them with increased biomedical potential. This study also offers new insight into the functional impact of the P1 and P2' sites on ShPI-1 specificity. PMID:26993255

  12. Comparative analysis and culturing of the microbial community of Aiptasia pallida, A Sea Anemone Model for Coral Biology

    KAUST Repository

    Binsarhan, Mohammad

    2016-01-01

    Recent works has highlighted the contribution of microbes to animal function. In this regard, the microbial community associated with corals has become a growing field of research in order to understand how microbes contribute to the host organisms’ response to environmental changes. It has been shown that microbes associated with corals have important functions in the coral holobiont such as immunity and nutrient assimilation. However, corals are notoriously difficult to work with. To this end, the sea anemone Aiptasia is becoming a model organism for coral symbiosis. Given the importance of host-­microbiome interactions, the topic of this thesis is to assess microbial structure of Aiptasia, culture prominent bacterial members, and compare bacterial community structure to corals. Different molecular methods have been applied using 16S rRNA bacterial gene fragments to characterize the microbial composition of Aiptasia. 16S rRNA gene sequence derived from cultured bacteria was compared to 16S rRNA gene sequences retrieved from native Red Sea Aiptasia. Inter-­individual as well as methodological differences were found to account for variance in microbiome composition. However, all approaches showed a highly abundant microbial taxon belonging to the genus Alteromonas in all samples. The Alteromonas species was successfully isolated for further research targeting microbiome selection mechanisms in Aiptasia. Future investigations by using different molecular tools will help to define the functions and relationship between the Aiptasia and its complex microbiome.

  13. Studies on the comparison of pollen morphology and viability of four naturally distributed and commercial varieties of anemone coronaria L

    International Nuclear Information System (INIS)

    The present study presents a comparison of the pollen morphology and viability of naturally distributed four varieties of Anemone coronaria L. These are A. coronaria var. coccinea (Jord.) Burn, A. coronaria var. rosea (Hanry) Batt, A. coronaria var. cyanea, A. coronaria var. alba Goaty and Pens) and its commercial cultivars. The four varieties were collected from areas near the road side along the Kirkagac-Soma highway in the State of Manisa. The commercial cultivars were obtained from the commercial flower growers in the Urla region of zmir. Pollen viability levels decreased in all commercial cultivars of A. coronaria. The highest reduction in pollen viability was recorded in A. coronaria pink cultivars of de Caen group. The general pollen type is prolate spheroidal in all pure forms, but there are some pollen morphological features which were not observed in the natural ones, although encountered in all commercial cultivars. On the other hand, various non-viable pollen types like wrinkled pollens, with abnormally shaped pollens or pollinia were found in the commercial cultivars. It was concluded that pesticides used to produce more flowers with rapid growth are the major cause for his reduction. Another reason could be the use of tetraploid F1 hybrids of A. coronaria cultivars of de Caen group as commercial samples. (author)

  14. Molecular cloning of a preprohormone from sea anemones containing numerous copies of a metamorphosis-inducing neuropeptide: a likely role for dipeptidyl aminopeptidase in neuropeptide precursor processing

    DEFF Research Database (Denmark)

    Leviev, I; Grimmelikhuijzen, C J

    1995-01-01

    Neuropeptides are an important group of hormones mediating or modulating neuronal communication. Neuropeptides are especially abundant in evolutionarily "old" nervous systems, such as those of cnidarians, the lowest animal group having a nervous system. Cnidarians often have a life cycle including...... a polyp, a medusa, and a planula larva stage. Recently, a neuropeptide, isolated from sea anemones that induces metamorphosis in a hydroid planula larva to become a hydropolyp [Leitz, T., Morand, K. & Mann, M. (1994) Dev. Biol. 163, 440-446]. Here, we have cloned...

  15. Developing the anemone Aiptasia as a tractable model for cnidarian-dinoflagellate symbiosis: the transcriptome of aposymbiotic A. pallida

    Directory of Open Access Journals (Sweden)

    Lehnert Erik M

    2012-06-01

    Full Text Available Abstract Background Coral reefs are hotspots of oceanic biodiversity, forming the foundation of ecosystems that are important both ecologically and for their direct practical impacts on humans. Corals are declining globally due to a number of stressors, including rising sea-surface temperatures and pollution; such stresses can lead to a breakdown of the essential symbiotic relationship between the coral host and its endosymbiotic dinoflagellates, a process known as coral bleaching. Although the environmental stresses causing this breakdown are largely known, the cellular mechanisms of symbiosis establishment, maintenance, and breakdown are still largely obscure. Investigating the symbiosis using an experimentally tractable model organism, such as the small sea anemone Aiptasia, should improve our understanding of exactly how the environmental stressors affect coral survival and growth. Results We assembled the transcriptome of a clonal population of adult, aposymbiotic (dinoflagellate-free Aiptasia pallida from ~208 million reads, yielding 58,018 contigs. We demonstrated that many of these contigs represent full-length or near-full-length transcripts that encode proteins similar to those from a diverse array of pathways in other organisms, including various metabolic enzymes, cytoskeletal proteins, and neuropeptide precursors. The contigs were annotated by sequence similarity, assigned GO terms, and scanned for conserved protein domains. We analyzed the frequency and types of single-nucleotide variants and estimated the size of the Aiptasia genome to be ~421 Mb. The contigs and annotations are available through NCBI (Transcription Shotgun Assembly database, accession numbers JV077153-JV134524 and at http://pringlelab.stanford.edu/projects.html. Conclusions The availability of an extensive transcriptome assembly for A. pallida will facilitate analyses of gene-expression changes, identification of proteins of interest, and other studies in this

  16. Structure-function relationships of the major neurotoxin from the sea anemone Stichodactyla helianthus with a new sodium channel receptor site

    International Nuclear Information System (INIS)

    We have determined that ShN I, a 48-residue type 2 sea anemone toxin, delays the inactivation of the Na channel in lobster olfactory somas. The receptor for ShN I was identified in vesicle preparations of neuronal tissues from both crustaceans and mammals; however, the KD values for the former is more than 1,000 fold lower for the later. The binding of [125I]-ShN I to this receptor was determined to be unaffected by Anemonia sulcata II, depolarization of the membrane, or veratridine. ShN I was unable to displace [125I]-Androctonus austrialis Hector II, whereas unlabeled AaH II and As II displaced the labeled scorpion toxin from rat brain synaptosomes. This is the first characterization of a new Na channel receptor site which specifically binds type 2 anemone toxins. To study the interactions that specific amino acid residues of ShN I have with this receptor, we developed a strategy using solid phase peptide synthesis. Prior to the synthesis of analogs to ShN I, we assembled the native ShN I sequence and reoxidized the three intramolecular disulfide bonds. Chemical, physical, and pharmacological characterization of the purified synthetic ShN I showed it to be indistinguishable from the natural toxin

  17. Evolution of an ancient venom: recognition of a novel family of cnidarian toxins and the common evolutionary origin of sodium and potassium neurotoxins in sea anemone.

    Science.gov (United States)

    Jouiaei, Mahdokht; Sunagar, Kartik; Federman Gross, Aya; Scheib, Holger; Alewood, Paul F; Moran, Yehu; Fry, Bryan G

    2015-06-01

    Despite Cnidaria (sea anemones, corals, jellyfish, and hydroids) being the oldest venomous animal lineage, structure-function relationships, phyletic distributions, and the molecular evolutionary regimes of toxins encoded by these intriguing animals are poorly understood. Hence, we have comprehensively elucidated the phylogenetic and molecular evolutionary histories of pharmacologically characterized cnidarian toxin families, including peptide neurotoxins (voltage-gated Na(+) and K(+) channel-targeting toxins: NaTxs and KTxs, respectively), pore-forming toxins (actinoporins, aerolysin-related toxins, and jellyfish toxins), and the newly discovered small cysteine-rich peptides (SCRiPs). We show that despite long evolutionary histories, most cnidarian toxins remain conserved under the strong influence of negative selection-a finding that is in striking contrast to the rapid evolution of toxin families in evolutionarily younger lineages, such as cone snails and advanced snakes. In contrast to the previous suggestions that implicated SCRiPs in the biomineralization process in corals, we demonstrate that they are potent neurotoxins that are likely involved in the envenoming function, and thus represent the first family of neurotoxins from corals. We also demonstrate the common evolutionary origin of type III KTxs and NaTxs in sea anemones. We show that type III KTxs have evolved from NaTxs under the regime of positive selection, and likely represent a unique evolutionary innovation of the Actinioidea lineage. We report a correlation between the accumulation of episodically adaptive sites and the emergence of novel pharmacological activities in this rapidly evolving neurotoxic clade. PMID:25757852

  18. Molecular cloning of a novel, putative G protein-coupled receptor from sea anemones structurally related to members of the FSH, TSH, LH/CG receptor family from mammals

    DEFF Research Database (Denmark)

    Nothacker, H P; Grimmelikhuijzen, C J

    1993-01-01

    hormone (FSH, TSH, LH/CG) receptor family from mammals, including a very large, extracellular N terminus (18-25% sequence identity) and a 7 transmembrane region (44-48% sequence identity). As with the mammalian glycoprotein hormone receptor genes, the sea anemone receptor gene yields transcripts which can...

  19. Redescription of Oulactis concinnata (Drayton in Dana, 1846) (Cnidaria: Anthozoa: Actiniidae), an actiniid sea anemone from Chile and Perú with special fighting tentacles; with a preliminary revision of the genera with a “frond-like” marginal ruff

    NARCIS (Netherlands)

    Häussermann, V.

    2003-01-01

    Two species of sea anemones with a conspicuous marginal ruff of frond-like structures encompassing the tentacular crown occur on the Chilean coast. Oulactis concinnata (= Isoulactis chilensis) (Drayton in Dana, 1846) is re-described in detail and further information is provided for Oulactis coliumen

  20. The role of complement in cnidarian-dinoflagellate symbiosis and immune challenge in the sea anemone Aiptasia pallida

    Directory of Open Access Journals (Sweden)

    Angela ePoole

    2016-04-01

    Full Text Available The complement system is an innate immune pathway that in vertebrates, is responsible for initial recognition and ultimately phagocytosis and destruction of microbes. Several complement molecules including C3, Factor B, and mannose binding lectin associated serine proteases (MASP have been characterized in invertebrates and while most studies have focused on their conserved role in defense against pathogens, little is known about their role in managing beneficial microbes. The purpose of this study was to (1 characterize complement pathway genes in the symbiotic sea anemone A. pallida, (2 investigate the evolution of complement genes in invertebrates, and (3 examine the potential dual role of complement genes Factor B and MASP in the onset and maintenance of cnidarian-dinoflagellate symbiosis and immune challenge using qPCR based studies. The results demonstrate that A. pallida has multiple Factor B genes (Ap_Bf-1, Ap_Bf-2a, and Ap_Bf-2b and one MASP gene (Ap_MASP. Phylogenetic analysis indicates that the evolutionary history of complement genes is complex, and there have been many gene duplications or gene loss events, even within members of the same phylum. Gene expression analyses revealed a potential role for complement in both onset and maintenance of cnidarian-dinoflagellate symbiosis and immune challenge. Specifically, Ap_Bf-1 and Ap_MASP are significantly upregulated in the light at the onset of symbiosis and in response to challenge with the pathogen Serratia marcescens suggesting that they play a role in the initial recognition of both beneficial and harmful microbes. Ap_Bf-2b in contrast was generally downregulated during the onset and maintenance of symbiosis and in response to challenge with S. marcescens. Therefore the exact role of Ap_Bf-2b in response to microbes remains unclear, but the results suggests that the presence of microbes leads to repressed expression. Together these results indicate functional divergence between Ap

  1. A conserved cluster of three PRD-class homeobox genes (homeobrain, rx and orthopedia in the Cnidaria and Protostomia

    Directory of Open Access Journals (Sweden)

    Mazza Maureen E

    2010-07-01

    Full Text Available Abstract Background Homeobox genes are a superclass of transcription factors with diverse developmental regulatory functions, which are found in plants, fungi and animals. In animals, several Antennapedia (ANTP-class homeobox genes reside in extremely ancient gene clusters (for example, the Hox, ParaHox, and NKL clusters and the evolution of these clusters has been implicated in the morphological diversification of animal bodyplans. By contrast, similarly ancient gene clusters have not been reported among the other classes of homeobox genes (that is, the LIM, POU, PRD and SIX classes. Results Using a combination of in silico queries and phylogenetic analyses, we found that a cluster of three PRD-class homeobox genes (Homeobrain (hbn, Rax (rx and Orthopedia (otp is present in cnidarians, insects and mollusks (a partial cluster comprising hbn and rx is present in the placozoan Trichoplax adhaerens. We failed to identify this 'HRO' cluster in deuterostomes; in fact, the Homeobrain gene appears to be missing from the chordate genomes we examined, although it is present in hemichordates and echinoderms. To illuminate the ancestral organization and function of this ancient cluster, we mapped the constituent genes against the assembled genome of a model cnidarian, the sea anemone Nematostella vectensis, and characterized their spatiotemporal expression using in situ hybridization. In N. vectensis, these genes reside in a span of 33 kb with the same gene order as previously reported in insects. Comparisons of genomic sequences and expressed sequence tags revealed the presence of alternative transcripts of Nv-otp and two highly unusual protein-coding polymorphisms in the terminal helix of the Nv-rx homeodomain. A population genetic survey revealed the Rx polymorphisms to be widespread in natural populations. During larval development, all three genes are expressed in the ectoderm, in non-overlapping territories along the oral-aboral axis, with distinct

  2. Dicty_cDB: Contig-U16276-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ostella vectensis Nemve m... 40 3.5 2 ( FE856739 ) CAFU791.rev CAFU Pichia stipitis oxygen limited d... 44 3... mRNA s... 36 3.6 2 ( FE859230 ) CAFX772.fwd CAFX Pichia stipitis oxygen limited ...N2145.fwd CAGN Nematostella vectensis Nemve mi... 40 3.7 2 ( FE860538 ) CAFY685.rev CAFY Pichia stipitis oxygen limited...811 ) CAFU1067.rev CAFU Pichia stipitis oxygen limited ... 44 3.7 2 ( FE859229 ) ...CAFX772.rev CAFX Pichia stipitis oxygen limited x... 44 3.7 2 ( FE845511 ) CAFI1004.rev CAFI Pichia stipitis

  3. Dicty_cDB: SHC777 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 45_478( CP000745 |pid:none) Methanococcus maripaludis C7, co... 33 6.3 CP000507_144( CP000507 |pid:none) Shewanella ama... musculus 9 days embryo cDNA, RIKEN full-length enriched library, clone:D030048K07, 3' end partial...cles of secretory system 4.0 %: extracellular, including cell wall >> prediction for SHC777 is end 5' end se...vikqt*hilplhwntqcvslvt clfqsk*titswvvitlsqfkvplmfqnatsmsq*tkltknlkvly*hllnnllynlmah lkcmslimmtiki*siknqllqhh...tostella vectensis normalized cDNA library 327 Nematostella vectensis cDNA clone 327-384-15_I19_KS, mR

  4. A framework for the establishment of a cnidarian gene regulatory network for "endomesoderm" specification: the inputs of ß-catenin/TCF signaling.

    Directory of Open Access Journals (Sweden)

    Eric Röttinger

    Full Text Available Understanding the functional relationship between intracellular factors and extracellular signals is required for reconstructing gene regulatory networks (GRN involved in complex biological processes. One of the best-studied bilaterian GRNs describes endomesoderm specification and predicts that both mesoderm and endoderm arose from a common GRN early in animal evolution. Compelling molecular, genomic, developmental, and evolutionary evidence supports the hypothesis that the bifunctional gastrodermis of the cnidarian-bilaterian ancestor is derived from the same evolutionary precursor of both endodermal and mesodermal germ layers in all other triploblastic bilaterian animals. We have begun to establish the framework of a provisional cnidarian "endomesodermal" gene regulatory network in the sea anemone, Nematostella vectensis, by using a genome-wide microarray analysis on embryos in which the canonical Wnt/ß-catenin pathway was ectopically targeted for activation by two distinct pharmaceutical agents (lithium chloride and 1-azakenpaullone to identify potential targets of endomesoderm specification. We characterized 51 endomesodermally expressed transcription factors and signaling molecule genes (including 18 newly identified with fine-scale temporal (qPCR and spatial (in situ analysis to define distinct co-expression domains within the animal plate of the embryo and clustered genes based on their earliest zygotic expression. Finally, we determined the input of the canonical Wnt/ß-catenin pathway into the cnidarian endomesodermal GRN using morpholino and mRNA overexpression experiments to show that NvTcf/canonical Wnt signaling is required to pattern both the future endomesodermal and ectodermal domains prior to gastrulation, and that both BMP and FGF (but not Notch pathways play important roles in germ layer specification in this animal. We show both evolutionary conserved as well as profound differences in endomesodermal GRN structure compared

  5. The evolutionary diversification of LSF and Grainyhead transcription factors preceded the radiation of basal animal lineages

    Directory of Open Access Journals (Sweden)

    Kaufman Les

    2010-04-01

    Full Text Available Abstract Background The transcription factors of the LSF/Grainyhead (GRH family are characterized by the possession of a distinctive DNA-binding domain that bears no clear relationship to other known DNA-binding domains, with the possible exception of the p53 core domain. In triploblastic animals, the LSF and GRH subfamilies have diverged extensively with respect to their biological roles, general expression patterns, and mechanism of DNA binding. For example, Grainyhead (GRH homologs are expressed primarily in the epidermis, and they appear to play an ancient role in maintaining the epidermal barrier. By contrast, LSF homologs are more widely expressed, and they regulate general cellular functions such as cell cycle progression and survival in addition to cell-lineage specific gene expression. Results To illuminate the early evolution of this family and reconstruct the functional divergence of LSF and GRH, we compared homologs from 18 phylogenetically diverse taxa, including four basal animals (Nematostella vectensis, Vallicula multiformis, Trichoplax adhaerens, and Amphimedon queenslandica, a choanoflagellate (Monosiga brevicollis and several fungi. Phylogenetic and bioinformatic analyses of these sequences indicate that (1 the LSF/GRH gene family originated prior to the animal-fungal divergence, and (2 the functional diversification of the LSF and GRH subfamilies occurred prior to the divergence between sponges and eumetazoans. Aspects of the domain architecture of LSF/GRH proteins are well conserved between fungi, choanoflagellates, and metazoans, though within the Metazoa, the LSF and GRH families are clearly distinct. We failed to identify a convincing LSF/GRH homolog in the sequenced genomes of the algae Volvox carteri and Chlamydomonas reinhardtii or the amoebozoan Dictyostelium purpureum. Interestingly, the ancestral GRH locus has become split into two separate loci in the sea anemone Nematostella, with one locus encoding a DNA binding

  6. Dicty_cDB: Contig-U15678-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 00508 ) Rattus norvegicus EST, 5'-end sequence, clone etn... 66 3e-24 4 ( FC288217 ) CAGN4339.fwd CAGN Nematostella vectensis Nem...s cDNA, mRNA seq... 54 6e-20 4 ( FC250485 ) CAGH6384.fwd CAGH Nematostella vectensis Nem...74 ) A0534D09-5 NIA Mouse Mesenchymal Stem Cell cDNA L... 66 1e-10 2 ( CN662460 ) A0734D09-5 NIA Mouse Hematopoietic Stem...030-1-F12-T3_F12 Whitefly Bemisia tabaci... 50 6e-10 2 ( T34713 ) EST73889 Human Bone Homo sapiens cDNA 5' end si...ekewekahtdffeafkny deagnsrriqclkylvlacmlmlstinpfdsteakpykndpdilamtnlvmayekndiya fekilkdnrktimddpfirmyied

  7. Generation and analysis of transcriptomic resources for a model system on the rise: the sea anemone Aiptasia pallida and its dinoflagellate endosymbiont

    Directory of Open Access Journals (Sweden)

    Sunagawa Shinichi

    2009-06-01

    Full Text Available Abstract Background The most diverse marine ecosystems, coral reefs, depend upon a functional symbiosis between cnidarian hosts and unicellular dinoflagellate algae. The molecular mechanisms underlying the establishment, maintenance, and breakdown of the symbiotic partnership are, however, not well understood. Efforts to dissect these questions have been slow, as corals are notoriously difficult to work with. In order to expedite this field of research, we generated and analyzed a collection of expressed sequence tags (ESTs from the sea anemone Aiptasia pallida and its dinoflagellate symbiont (Symbiodinium sp., a system that is gaining popularity as a model to study cellular, molecular, and genomic questions related to cnidarian-dinoflagellate symbioses. Results A set of 4,925 unique sequences (UniSeqs comprising 1,427 clusters of 2 or more ESTs (contigs and 3,498 unclustered ESTs (singletons was generated by analyzing 10,285 high-quality ESTs from a mixed host/symbiont cDNA library. Using a BLAST-based approach to predict which unique sequences derived from the host versus symbiont genomes, we found that the contribution of the symbiont genome to the transcriptome was surprisingly small (1.6–6.4%. This may reflect low levels of gene expression in the symbionts, low coverage of alveolate genes in the sequence databases, a small number of symbiont cells relative to the total cellular content of the anemones, or failure to adequately lyse symbiont cells. Furthermore, we were able to identify groups of genes that are known or likely to play a role in cnidarian-dinoflagellate symbioses, including oxidative stress pathways that emerged as a prominent biological feature of this transcriptome. All ESTs and UniSeqs along with annotation results and other tools have been made accessible through the implementation of a publicly accessible database named AiptasiaBase. Conclusion We have established the first large-scale transcriptomic resource for

  8. Natural selection and neutral evolution jointly drive population divergence between alpine and lowland ecotypes of the allopolyploid plant Anemone multifida (Ranunculaceae.

    Directory of Open Access Journals (Sweden)

    Jamie R McEwen

    Full Text Available Population differentiation can be driven in large part by natural selection, but selectively neutral evolution can play a prominent role in shaping patters of population divergence. The decomposition of the evolutionary history of populations into the relative effects of natural selection and selectively neutral evolution enables an understanding of the causes of population divergence and adaptation. In this study, we examined heterogeneous genomic divergence between alpine and lowland ecotypes of the allopolyploid plant, Anemone multifida. Using peak height and dominant AFLP data, we quantified population differentiation at non-outlier (neutral and outlier loci to determine the potential contribution of natural selection and selectively neutral evolution to population divergence. We found 13 candidate loci, corresponding to 2.7% of loci, with signatures of divergent natural selection between alpine and lowland populations and between alpine populations (Fst  = 0.074-0.445 at outlier loci, but neutral population differentiation was also evident between alpine populations (FST  = 0.041-0.095 at neutral loci. By examining population structure at both neutral and outlier loci, we determined that the combined effects of selection and neutral evolution are associated with the divergence of alpine populations, which may be linked to extreme abiotic conditions and isolation between alpine sites. The presence of outlier levels of genetic variation in structured populations underscores the importance of separately analyzing neutral and outlier loci to infer the relative role of divergent natural selection and neutral evolution in population divergence.

  9. Cyclisation Increases the Stability of the Sea Anemone Peptide APETx2 but Decreases Its Activity at Acid-Sensing Ion Channel 3

    Directory of Open Access Journals (Sweden)

    Lachlan D. Rash

    2012-07-01

    Full Text Available APETx2 is a peptide isolated from the sea anemone Anthopleura elegantissima. It is the most potent and selective inhibitor of acid-sensing ion channel 3 (ASIC3 and it is currently in preclinical studies as a novel analgesic for the treatment of chronic inflammatory pain. As a peptide it faces many challenges in the drug development process, including the potential lack of stability often associated with therapeutic peptides. In this study we determined the susceptibility of wild-type APETx2 to trypsin and pepsin and tested the applicability of backbone cyclisation as a strategy to improve its resistance to enzymatic degradation. Cyclisation with either a six-, seven- or eight-residue linker vastly improved the protease resistance of APETx2 but substantially decreased its potency against ASIC3. This suggests that either the N- or C-terminus of APETx2 is involved in its interaction with the channel, which we confirmed by making N- and C-terminal truncations. Truncation of either terminus, but especially the N-terminus, has detrimental effects on the ability of APETx2 to inhibit ASIC3. The current work indicates that cyclisation is unlikely to be a suitable strategy for stabilising APETx2, unless linkers can be engineered that do not interfere with binding to ASIC3.

  10. Triterpenoid saponin flaccidoside II from Anemone flaccida triggers apoptosis of NF1-associated malignant peripheral nerve sheath tumors via the MAPK-HO-1 pathway

    Directory of Open Access Journals (Sweden)

    Han LT

    2016-04-01

    Full Text Available Lin-tao Han,1 Yin Fang,1 Yan Cao,2 Feng-hua Wu,1 E Liu,2 Guo-yan Mo,2 Fang Huang1 1China Key Laboratory of TCM Resource and Prescription, Ministry of Education, 2Department of Pharmacy, Hubei University of Chinese Medicine, Wuhan, Hubei, People’s Republic of China Abstract: Malignant peripheral nerve sheath tumors (MPNSTs are highly aggressive soft tissue neoplasms that are extremely rare and are frequently associated with neurofibromatosis type 1 patients. MPNSTs are typically fatal, and there is no effective treatment so far. In our previous study, we showed that flaccidoside II, one of the triterpenoid saponins isolated from Anemone flaccida Fr. Schmidt, has antitumor potential by inducing apoptosis. In the present study, we found that flaccidoside II inhibits proliferation and facilitates apoptosis in MPNST cell lines ST88-14 and S462. Furthermore, this study provides a mechanism by which the downregulation of heme oxygenase-1 via extracellular signal-regulated kinase-1/2 and p38 mitogen-activated protein kinase pathways is involved in the apoptotic role of flaccidoside II. This study suggested the potential of flaccidoside II as a novel pharmacotherapeutic approach for MPNSTs. Keywords: flaccidoside II, malignant peripheral nerve sheath tumors, apoptosis, MAPK, HO-1

  11. Nutrients, signals, and photosynthetic release by symbiotic algae. The impact of taurine on the dinoflagellate alga Symbiodinium from the sea anemone Aiptasia pulchella

    International Nuclear Information System (INIS)

    Exogenous concentrations of 10 micromolar to 1 mM of the nonprotein amino acid taurine stimulated photosynthate release from the dinoflagellate alga Symbiodinium, which had been freshly isolated from the sea anemone Aiptasia pulchella. Photosynthate release, as induced by taurine and animal extract, was metabolically equivalent at both concentrations in that they (a) stimulated photosynthate release to the same extent and (b) induced the selective release of photosynthetically derived organic acids. A complex mixture of amino acids at 75 mM also promoted photosynthate release, but the release rate was reduced by 34% after the omission of taurine (3 mM) from the mixture, suggesting that much of the effect of amino acids was largely attributable to taurine. Exogenous 14C-labeled taurine was taken up by the cells, and more than 95% of the internalized 14C was recovered as taurine, indicating that taurine-induced photosynthate release was not dependent on taurine metabolism. Both taurine uptake and taurine-induced photosynthate release by Symbiodinium exhibited saturation kinetics, but with significantly different Km values of 68 and 21 micromolar, respectively. The difference in Km values is compatible with the hypothesis that Symbiodinium has a taurine signal transducer that is responsible for photosynthate release and is distinct from the taurine transporter

  12. Primary structure of the precursor for the sea anemone neuropeptide Antho-RFamide (less than Glu-Gly-Arg-Phe-NH2)

    DEFF Research Database (Denmark)

    Darmer, D; Schmutzler, C; Diekhoff, D; Grimmelikhuijzen, C J

    1991-01-01

    Neuropeptides containing the carboxylterminal sequence Arg-Phe-NH2 are found throughout the animal kingdom and are important substances mediating neuronal communication. Here, we have cloned the cDNA coding for the precursor protein of the sea anemone neuropeptide (Antho-RFamide) less than Glu......-Gly-Arg-Phe-NH2. This precursor is 334 amino acids in length and contains 19 copies of unprocessed Antho-RFamide (Gln-Gly-Arg-Phe-Gly), which are tandemly arranged in the C-terminal part of the protein. Paired basic residues (Lys-Arg) or single basic residues (Arg) occur at the C-terminal side of each Antho...... glutamic acid residues. Such processing is, to our knowledge, hitherto unknown for peptidergic neurons. The Antho-RFamide precursor also contains two copies of the putative Antho-RFamide-related peptide Phe-Gln-Gly-Arg-Phe-NH2 and one copy of Tyr-Val-Pro-Gly-Arg-Tyr-NH2. In addition, the precursor protein...

  13. Floral Morphogenesis of Anemone rivularis Buch.-Ham. ex DC. var.flore-minore Maxim. (Ranunculaceae) with Special Emphasis on Androecium Developmental Sequence

    Institute of Scientific and Technical Information of China (English)

    Hong-Li CHANG; Yi REN; An-Min LU

    2005-01-01

    The floral morphogenesis and androecium developmental sequence of Anemone rivularis Buch.-Ham. ex DC. var. flore-minore Maxim. were observed under a scanning electron microscope (SEM)and by means of histological methods in order to expand our knowledge of the morphogenesis and development of the floral organs of the Ranunculaceae. The initiation of the floral elements is a centripetal spiral and the direction of the spiral is clockwise or anti-clockwise. However, the development of the androecium is highly unusual: in a longitudinal series of four stamens, the second stamen develops first from the inner to outer, then the third one, the fourth one and the first one in turn. The microsporogenesis and anther maturation follows the same developmental sequence. The tepals are different from the bracts and the stamens in both shape and size in the early developmental stage, but there is no difference between the stamens and carpels in the early developmental stage. Therefore, we established a spatio-temporal process of the floral morphogenesis of4. rivularis var.flore-minore and offer another meaning of the floral diversity patterns attributed to the level of the genus.

  14. Characteristics and biosynthetic pathway of melanin in Ascochyta anemones%白头翁叶斑病菌黑色素的理化性质及其生物合成途径初步研究

    Institute of Scientific and Technical Information of China (English)

    苏丹; 吕国忠; 周如军; 杨红; 傅俊范

    2014-01-01

    对白头翁叶斑病菌胞壁结合黑色素和胞外黑色素进行了理化性质和红外光谱扫描测定,结果表明两者具有相似的理化性质,均易溶于KOH、H2 O2和NaClO,不溶于水、乙醇和丙酮。红外光谱分析表明,白头翁叶斑病菌YS-24菌株的胞壁结合黑色素与胞外黑色素为同一种类型的黑色素。DHN黑色素的特异性抑制剂—三环唑,对白头翁叶斑病菌黑色素的产生有明显的抑制作用;以白头翁叶斑病菌基因组DNA为模板,通过PCR扩增,得到了聚酮体合成酶基因的同源片段AaPKS,初步推断白头翁叶斑病菌黑色素合成属于DHN途径。%The characteristics of melanin,extracted from cell wall and fermented filtrate of Ascochyta anemones, were determined by diagnostic test and infrared spectroscopy. The results indicated that they have similar physical and chemical properties,and they are soluble in KOH,H2 O2 and NaClO,but not in water,ethanol and acetone. Infrared spectrum analysis showed that the wall-bound melanin and extracellular melanin belonged to the same type. Tricyclazole,a specific inhibitor of DHN melanin synthesis,could inhibit the fungal melanin’s biosynthesis of A.anemones. The homologous fragment of polyketide synthase gene (AaPKS)was amplified by PCR using A.anemones genomic DNA as a template. The results suggested that the melanin in A.anemones might be synthe-sized from DHN pathway.

  15. CgNa, a type I toxin from the giant Caribbean sea anemone Condylactis gigantea shows structural similarities to both type I and II toxins, as well as distinctive structural and functional properties

    OpenAIRE

    Salceda, Emilio; Pérez-Castells, Javier; López-Méndez, Blanca; Garateix, Anoland; Salazar, Hector; López, Omar; Aneiros, Abel; Ständker, Ludger; Béress, Lászlo; Forssmann, Wolf Georg; Soto, Enrique; Jiménez-Barbero, Jesús; Giménez-Gallego, Guillermo

    2007-01-01

    Abstract CgNa is a toxin from the sea anemone Condylactis gigantea that is comprised of 47-residues. The structure of CgNa, solved by 1}H NMR spectroscopy, is somewhat atypical, displaying significant homologies to both type I and II anemonae toxins, as well as a considerable number of exceptions to what are considered as canonical structural elements of this group of toxins, and that are thought to be essential for their activity. Furthermore, unique residues in CgNa define a cha...

  16. Antifouling activity by sea anemone (Heteractis magnifica and H. aurora extracts against marine biofilm bacteria Actividades antiincrustantes de las extractos de las anémonas marinas Heteractis magnifica y H. aurora frente a biofilm de bacterias marinas

    Directory of Open Access Journals (Sweden)

    Subramanian Bragadeeswaran

    2011-07-01

    Full Text Available Sea anemones (Actiniaria are solitary, ocean-dwelling members of the phylum Cnidaria and the class Anthozoa. In this study, we screened antibacterial activity of two benthic sea anemones (Heteractis magnifica and H. aurora collected from the Mandapam coast of southeast India. Crude extracts of the sea anemone were assayed against seven bacterial biofilms isolated from three different test panels. The crude extract of H. magnifica showed a maximum inhibition zone of 18 mm against Pseudomonas sp. and Escherichia coli and a minimum inhibition zone of 3 mm against Pseudomonas aeruginosa, Micrococcus sp., and Bacillus cerens for methanol, acetone, and DCM extracts, respectively. The butanol extract of H. aurora showed a maximum inhibition zone of 23 mm against Vibrio parahaemolyticus, whereas the methanol extract revealed a minimum inhibition zone of 1 mm against V. parahaemolyticus. The present study revealed that the H. aurora extracts were more effective than those of H. magnifica and that the active compounds from the sea anemone can be used as antifouling compounds.Las anémonas de mar (Actiniaria son solitarias, habitantes oceánicos del phylum Cnidaria y de la clase Anthozoa. En este estudio se determina la actividad antibacteriana de dos anémonas bentónicas Heteractis magnifica y H. aurora recolectadas en la costa de Mandapam, sudeste de India. Los extractos crudos de estas anémonas fueron ensayados frente a siete biofilms bacterianos aislados de tres paneles de control distintos. El extracto crudo de la anémona H. magnifica mostró una zona inhibición máxima de 18 mm contra Psudomonas sp. y Escherichia coli y la zona de inhibición mínima de 3 mm fue encontrada frente a Pseudomonas aeruginosa, Micrococus sp. y Bacillus cerens de extractos de metanol, acetona y DCM respectivamente. El extracto de butanol de la anémona H. magnifica mostró una zona de inhibición máxima de 23 mm frente a Vibrio parahemolyticus, mientras que con el

  17. NUMERICAL INVESTIGATION OF A CORONAL MASS EJECTION FROM AN ANEMONE ACTIVE REGION: RECONNECTION AND DEFLECTION OF THE 2005 AUGUST 22 ERUPTION

    International Nuclear Information System (INIS)

    We present a numerical investigation of the coronal evolution of a coronal mass ejection (CME) on 2005 August 22 using a three-dimensional thermodynamic magnetohydrodynamic model, the space weather modeling framework. The source region of the eruption was anemone active region (AR) 10798, which emerged inside a coronal hole. We validate our modeled corona by producing synthetic extreme-ultraviolet (EUV) images, which we compare to EIT images. We initiate the CME with an out-of-equilibrium flux rope with an orientation and chirality chosen in agreement with observations of an Hα filament. During the eruption, one footpoint of the flux rope reconnects with streamer magnetic field lines and with open field lines from the adjacent coronal hole. It yields an eruption which has a mix of closed and open twisted field lines due to interchange reconnection and only one footpoint line-tied to the source region. Even with the large-scale reconnection, we find no evidence of strong rotation of the CME as it propagates. We study the CME deflection and find that the effect of the Lorentz force is a deflection of the CME by about 30 R-1sun toward the east during the first 30 minutes of the propagation. We also produce coronagraphic and EUV images of the CME, which we compare with real images, identifying a dimming region associated with the reconnection process. We discuss the implication of our results for the arrival at Earth of CMEs originating from the limb and for models to explain the presence of open field lines in magnetic clouds.

  18. 国产毛茛科银莲花族十七种植物的细胞学研究%Cytology of ten species in Anemone,one in Anemoclema and six in Clematis (Trib. Anemoneae, Ranunculaceae) from China

    Institute of Scientific and Technical Information of China (English)

    杨亲二

    2002-01-01

    研究了国产毛茛科银莲花族Trib. Anemoneae 17种植物的染色体数目和核型.10种银莲花属Anemone L.植物中,1种(西南银莲花A. davidii)为x=8的四倍体(2n=4x=32),5种 (匍枝银莲花A. stolonifera、草玉梅A. rivularis、卵叶银莲花A. begoniifolia、水棉花 A. hupehensis f. alba、大火草A. tomentosa)为x=8的二倍体 (2n=2x=16), 4种 (鹅掌草A. flaccida、湿地银莲花A. rupestris、蓝匙叶银莲花A. trullifolia var. colestina、拟条叶银莲花A. trullifolia var. holophylla、展毛银莲花A. demissa) 为x=7 的二倍体 (2n=2x=14).罂粟莲花 Anemoclema glaucifolium为x=8 的二倍体.6种铁线莲属Clematis L. 植物 (滇川铁线莲C. kockiana、长花铁线莲 C. rehderiana、毛茛铁线莲 C. ranunculoides、扬子铁线莲C. puberula var. ganpiniana、短尾铁线莲 C. brevicaudata、金毛铁线莲 A. chrysocoma)均为 x=8的二倍体.银莲花属中x=7的种类的核型彼此十分相似,均由6对大型具中部着丝点的染色体和1对具端部着丝点的染色体组成;x=8的二倍体种类的核型与罂粟莲花属和铁线莲属植物的核型十分相似,均由5对大型具中部着丝点和3对具端部或近端部着丝点的染色体组成.%The somatic chromosome number and detailed chromosome morphology have been studied in ten species of Anemone, one species of Anemoclema, and six species of Clematis, all from China, namely Anemone davidii Franch. (2n=4x=32), A. stolonifera Maxim. (2n=2x=16), A. flaccida Fr. Schmidt (2n=2x=14), A. rivularis Buch.-Ham. (2n=2x=16), A. begoniifolia Lévl. et Vant. (2n=2x=16), A. hupehensis Lem. f. alba W. T. Wang (2n=2x =16), A. tomentosa (Maxim.) Péi (2n=2x=16), A. rupestris Hook. f. et Thoms. (2n=2x=14), A. trullifolia var. colestina (Franch.) Finet et Gagnep. (2n=2x=14), A. trullifolia var. holophylla Diels (2n=2x=14), A. demissa Hook. f. et Thoms. (2n=2x=14), Anemoclema glaucifolium (Franch.) W. T. Wang (2n=2x=16), Clematis kockiana Schneid. (2n=2x=16

  19. Evolutionary conservation of the mature oocyte proteome

    Directory of Open Access Journals (Sweden)

    Tamar Lotan

    2014-06-01

    Significance: The current study provides the first proteomic profile of an oocyte of a cnidarian organism the starlet sea anemone N. vectensis and gives new insights on the ancient origin of an oocyte proteome template. The comparative analysis with a chordate oocyte suggests that the oocyte proteome predates the divergence of the cnidarian and bilaterian lineages. In addition, the data generated in the study will serve as a valuable resource for further developmental and evolutional studies.

  20. Dicty_cDB: Contig-U04751-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 4 5.8 1 ( DV089115 ) 327-384-28_P03_T7 Nematostella vectensis normaliz... 44 5.8 1 ( FE813455 ) CCAG31077.g1...th2-45l22... 38 5.6 4 ( BD061520 ) Genome DNA of symbiotic bacteria of aphid. 34 5.6 11 ( AR409405 ) Sequence 1 from pate... CCAG Petrolisthes cinctipes heart, g... 44 5.8 1 ( FC248268 ) CAGH5229.rev CAGH Nematostella vecte...da K H 1.37 0.711 1.31 Gapped Lambda K H 1.37 0.711 1.31 Matrix: blastn matrix:1 -3 Gap Penalties: Existe..._1( AY336747 |pid:none) Homo sapiens putative transmembran... 42 0.012 (Q6UX65) RecName: Full=Transmembrane prote

  1. Phylogenomics of caspase-activated DNA fragmentation factor

    International Nuclear Information System (INIS)

    The degradation of nuclear DNA by DNA fragmentation factor (DFF) is a key step in apoptosis of mammalian cells. Using comparative genomics, we have here determined the evolutionary history of the genes encoding the two DFF subunits, DFFA (also known as ICAD) and DFFB (CAD). Orthologs of DFFA and DFFB were identified in Nematostella vectensis, a representative of the primitive metazoan clade cnidarians, and in various vertebrates and insects, but not in representatives of urochordates, echinoderms, and nematodes. The domains mediating the interaction of DFFA and DFFB, a caspase cleavage site in DFFA, and the amino acid residues critical for endonuclease activity of DFFB were conserved in Nematostella. These findings suggest that DFF has been a part of the primordial apoptosis system of the eumetazoan common ancestor and that the ancient cell death machinery has degenerated in several evolutionary lineages, including the one leading to the prototypical apoptosis model, Caenorhabditis elegans

  2. Functional Expression in Escherichia coli of the Disulfide-Rich Sea Anemone Peptide APETx2, a Potent Blocker of Acid-Sensing Ion Channel 3

    Directory of Open Access Journals (Sweden)

    Glenn F. King

    2012-07-01

    Full Text Available Acid-sensing ion channels (ASICs are proton-gated sodium channels present in the central and peripheral nervous system of chordates. ASIC3 is highly expressed in sensory neurons and plays an important role in inflammatory and ischemic pain. Thus, specific inhibitors of ASIC3 have the potential to be developed as novel analgesics. APETx2, isolated from the sea anemone Anthopleura elegantissima, is the most potent and selective inhibitor of ASIC3-containing channels. However, the mechanism of action of APETx2 and the molecular basis for its interaction with ASIC3 is not known. In order to assist in characterizing the ASIC3-APETx2 interaction, we developed an efficient and cost-effective Escherichia coli periplasmic expression system for the production of APETx2. NMR studies on uniformly 13C/15N-labelled APETx2 produced in E. coli showed that the recombinant peptide adopts the native conformation. Recombinant APETx2 is equipotent with synthetic APETx2 at inhibiting ASIC3 channels expressed in Xenopus oocytes. Using this system we mutated Phe15 to Ala, which caused a profound loss of APETx2’s activity on ASIC3. These findings suggest that this expression system can be used to produce mutant versions of APETx2 in order to facilitate structure-activity relationship studies.

  3. 香格里拉高山植物园银莲花属访花者初步研究%Preliminary Investigation on Visitors of Anemone in Shangri-La Alpine Botanical Garden

    Institute of Scientific and Technical Information of China (English)

    汤晓辛; 黄至欢; 王向平; 张潮

    2012-01-01

    Visitors of three species of Anemone were compared in Shangri-La Alpine Botanical Garden in this article, and the visitors of A. demissa with different floral colors were observed and compared. The results indicated that A, ruptstris and A. rivutaris have more visitor types than A. demissa. The visiting frequency of different visitors to A. demissa with different flower colors is not significantly different, and floral color and visitor types have no significant effect on visiting frequency. Further study should focus on flower color change in A. demissa, so as to provide conditions for exploiting wild flower resources.%对香格里拉高山植物园3种银莲花属植物的访花者进行比较,并对不同颜色展毛银莲花的访问者进行观察和比较.结果表明,湿地银莲花与草玉梅的访花者种类较多,而展毛银莲花的则相对较少.访问者不同对花色展毛银莲花的访问次数没有明显差异,颜色不同和访问者不同对访问频次没有明显影响.应对展毛银莲花的花色变化进行深入研究,为开发利用野生花卉资源创造条件.

  4. Crystal Structure of Menin Reveals Binding Site for Mixed Lineage Leukemia (MLL) Protein

    Energy Technology Data Exchange (ETDEWEB)

    Murai, Marcelo J.; Chruszcz, Maksymilian; Reddy, Gireesh; Grembecka, Jolanta; Cierpicki, Tomasz (Michigan); (UV)

    2014-10-02

    Menin is a tumor suppressor protein that is encoded by the MEN1 (multiple endocrine neoplasia 1) gene and controls cell growth in endocrine tissues. Importantly, menin also serves as a critical oncogenic cofactor of MLL (mixed lineage leukemia) fusion proteins in acute leukemias. Direct association of menin with MLL fusion proteins is required for MLL fusion protein-mediated leukemogenesis in vivo, and this interaction has been validated as a new potential therapeutic target for development of novel anti-leukemia agents. Here, we report the first crystal structure of menin homolog from Nematostella vectensis. Due to a very high sequence similarity, the Nematostella menin is a close homolog of human menin, and these two proteins likely have very similar structures. Menin is predominantly an {alpha}-helical protein with the protein core comprising three tetratricopeptide motifs that are flanked by two {alpha}-helical bundles and covered by a {beta}-sheet motif. A very interesting feature of menin structure is the presence of a large central cavity that is highly conserved between Nematostella and human menin. By employing site-directed mutagenesis, we have demonstrated that this cavity constitutes the binding site for MLL. Our data provide a structural basis for understanding the role of menin as a tumor suppressor protein and as an oncogenic co-factor of MLL fusion proteins. It also provides essential structural information for development of inhibitors targeting the menin-MLL interaction as a novel therapeutic strategy in MLL-related leukemias.

  5. Axis Patterning by BMPs: Cnidarian Network Reveals Evolutionary Constraints

    Directory of Open Access Journals (Sweden)

    Grigory Genikhovich

    2015-03-01

    Full Text Available BMP signaling plays a crucial role in the establishment of the dorso-ventral body axis in bilaterally symmetric animals. However, the topologies of the bone morphogenetic protein (BMP signaling networks vary drastically in different animal groups, raising questions about the evolutionary constraints and evolvability of BMP signaling systems. Using loss-of-function analysis and mathematical modeling, we show that two signaling centers expressing different BMPs and BMP antagonists maintain the secondary axis of the sea anemone Nematostella. We demonstrate that BMP signaling is required for asymmetric Hox gene expression and mesentery formation. Computational analysis reveals that network parameters related to BMP4 and Chordin are constrained both in Nematostella and Xenopus, while those describing the BMP signaling modulators can vary significantly. Notably, only chordin, but not bmp4 expression needs to be spatially restricted for robust signaling gradient formation. Our data provide an explanation of the evolvability of BMP signaling systems in axis formation throughout Eumetazoa.

  6. Actiniarian Sea anemone fauna of India

    Digital Repository Service at National Institute of Oceanography (India)

    Parulekar, A.H.

    stream_size 11 stream_content_type text/plain stream_name Mar_Biofouling_Power_Plants_1990_218.pdf.txt stream_source_info Mar_Biofouling_Power_Plants_1990_218.pdf.txt Content-Encoding ISO-8859-1 Content-Type text/plain; charset...

  7. Taxonomy Icon Data: Sea anemone [Taxonomy Icon

    Lifescience Database Archive (English)

    Full Text Available nia_equina_S.png Actinia_equina_NS.png http://biosciencedbc.jp/taxonomy_icon/icon.cgi?i=Actinia+equina&t=L h...ttp://biosciencedbc.jp/taxonomy_icon/icon.cgi?i=Actinia+equina&t=NL http://biosciencedbc.jp/taxonomy_icon/ic...on.cgi?i=Actinia+equina&t=S http://biosciencedbc.jp/taxonomy_icon/icon.cgi?i=Actinia+equina&t=NS ...

  8. Proteome-wide dataset supporting the study of ancient metazoan macromolecular complexes

    Directory of Open Access Journals (Sweden)

    Sadhna Phanse

    2016-03-01

    Full Text Available Our analysis examines the conservation of multiprotein complexes among metazoa through use of high resolution biochemical fractionation and precision mass spectrometry applied to soluble cell extracts from 5 representative model organisms Caenorhabditis elegans, Drosophila melanogaster, Mus musculus, Strongylocentrotus purpuratus, and Homo sapiens. The interaction network obtained from the data was validated globally in 4 distant species (Xenopus laevis, Nematostella vectensis, Dictyostelium discoideum, Saccharomyces cerevisiae and locally by targeted affinity-purification experiments. Here we provide details of our massive set of supporting biochemical fractionation data available via ProteomeXchange (PXD002319-PXD002328, PPIs via BioGRID (185267; and interaction network projections via (http://metazoa.med.utoronto.ca made fully accessible to allow further exploration. The datasets here are related to the research article on metazoan macromolecular complexes in Nature [1].

  9. Proteome-wide dataset supporting the study of ancient metazoan macromolecular complexes.

    Science.gov (United States)

    Phanse, Sadhna; Wan, Cuihong; Borgeson, Blake; Tu, Fan; Drew, Kevin; Clark, Greg; Xiong, Xuejian; Kagan, Olga; Kwan, Julian; Bezginov, Alexandr; Chessman, Kyle; Pal, Swati; Cromar, Graham; Papoulas, Ophelia; Ni, Zuyao; Boutz, Daniel R; Stoilova, Snejana; Havugimana, Pierre C; Guo, Xinghua; Malty, Ramy H; Sarov, Mihail; Greenblatt, Jack; Babu, Mohan; Derry, W Brent; Tillier, Elisabeth R; Wallingford, John B; Parkinson, John; Marcotte, Edward M; Emili, Andrew

    2016-03-01

    Our analysis examines the conservation of multiprotein complexes among metazoa through use of high resolution biochemical fractionation and precision mass spectrometry applied to soluble cell extracts from 5 representative model organisms Caenorhabditis elegans, Drosophila melanogaster, Mus musculus, Strongylocentrotus purpuratus, and Homo sapiens. The interaction network obtained from the data was validated globally in 4 distant species (Xenopus laevis, Nematostella vectensis, Dictyostelium discoideum, Saccharomyces cerevisiae) and locally by targeted affinity-purification experiments. Here we provide details of our massive set of supporting biochemical fractionation data available via ProteomeXchange (PXD002319-PXD002328), PPIs via BioGRID (185267); and interaction network projections via (http://metazoa.med.utoronto.ca) made fully accessible to allow further exploration. The datasets here are related to the research article on metazoan macromolecular complexes in Nature [1]. PMID:26870755

  10. Early origin of the bilaterian developmental toolkit

    Science.gov (United States)

    Erwin, Douglas H.

    2009-01-01

    Whole-genome sequences from the choanoflagellate Monosiga brevicollis, the placozoan Trichoplax adhaerens and the cnidarian Nematostella vectensis have confirmed results from comparative evolutionary developmental studies that much of the developmental toolkit once thought to be characteristic of bilaterians appeared much earlier in the evolution of animals. The diversity of transcription factors and signalling pathway genes in animals with a limited number of cell types and a restricted developmental repertoire is puzzling, particularly in light of claims that such highly conserved elements among bilaterians provide evidence of a morphologically complex protostome–deuterostome ancestor. Here, I explore the early origination of elements of what became the bilaterian toolkit, and suggest that placozoans and cnidarians represent a depauperate residue of a once more diverse assemblage of early animals, some of which may be represented in the Ediacaran fauna (c. 585–542 Myr ago). PMID:19571245

  11. Pre-bilaterian origin of the blastoporal axial organizer

    Science.gov (United States)

    Kraus, Yulia; Aman, Andy; Technau, Ulrich; Genikhovich, Grigory

    2016-01-01

    The startling capacity of the amphibian Spemann organizer to induce naïve cells to form a Siamese twin embryo with a second set of body axes is one of the hallmarks of developmental biology. However, the axis-inducing potential of the blastopore-associated tissue is commonly regarded as a chordate feature. Here we show that the blastopore lip of a non-bilaterian metazoan, the anthozoan cnidarian Nematostella vectensis, possesses the same capacity and uses the same molecular mechanism for inducing extra axes as chordates: Wnt/β-catenin signaling. We also demonstrate that the establishment of the secondary, directive axis in Nematostella by BMP signaling is sensitive to an initial Wnt signal, but once established the directive axis becomes Wnt-independent. By combining molecular analysis with experimental embryology, we provide evidence that the emergence of the Wnt/β-catenin driven blastopore-associated axial organizer predated the cnidarian-bilaterian split over 600 million years ago. PMID:27229764

  12. Functional Characterization of Cnidarian HCN Channels Points to an Early Evolution of Ih.

    Directory of Open Access Journals (Sweden)

    Emma C Baker

    Full Text Available HCN channels play a unique role in bilaterian physiology as the only hyperpolarization-gated cation channels. Their voltage-gating is regulated by cyclic nucleotides and phosphatidylinositol 4,5-bisphosphate (PIP2. Activation of HCN channels provides the depolarizing current in response to hyperpolarization that is critical for intrinsic rhythmicity in neurons and the sinoatrial node. Additionally, HCN channels regulate dendritic excitability in a wide variety of neurons. Little is known about the early functional evolution of HCN channels, but the presence of HCN sequences in basal metazoan phyla and choanoflagellates, a protozoan sister group to the metazoans, indicate that the gene family predates metazoan emergence. We functionally characterized two HCN channel orthologs from Nematostella vectensis (Cnidaria, Anthozoa to determine which properties of HCN channels were established prior to the emergence of bilaterians. We find Nematostella HCN channels share all the major functional features of bilaterian HCNs, including reversed voltage-dependence, activation by cAMP and PIP2, and block by extracellular Cs+. Thus bilaterian-like HCN channels were already present in the common parahoxozoan ancestor of bilaterians and cnidarians, at a time when the functional diversity of voltage-gated K+ channels was rapidly expanding. NvHCN1 and NvHCN2 are expressed broadly in planulae and in both the endoderm and ectoderm of juvenile polyps.

  13. Plasma composition in a sigmoidal anemone active region

    CERN Document Server

    Baker, D; Demoulin, P; van Driel-Gesztelyi, L; Green, L M; Steed, K; Carlyle, J

    2013-01-01

    Using spectra obtained by the EIS instrument onboard Hinode, we present a detailed spatially resolved abundance map of an active region (AR)-coronal hole (CH) complex that covers an area of 359 arcsec x 485 arcsec. The abundance map provides first ionization potential (FIP) bias levels in various coronal structures within the large EIS field of view. Overall, FIP bias in the small, relatively young AR is 2-3. This modest FIP bias is a consequence of the AR age, its weak heating, and its partial reconnection with the surrounding CH. Plasma with a coronal composition is concentrated at AR loop footpoints, close to where fractionation is believed to take place in the chromosphere. In the AR, we found a moderate positive correlation of FIP bias with nonthermal velocity and magnetic flux density, both of which are also strongest at the AR loop footpoints. Pathways of slightly enhanced FIP bias are traced along some of the loops connecting opposite polarities within the AR. We interpret the traces of enhanced FIP b...

  14. Plasma composition in a sigmoidal anemone active region

    International Nuclear Information System (INIS)

    Using spectra obtained by the EUV Imaging Spectrometer (EIS) instrument onboard Hinode, we present a detailed spatially resolved abundance map of an active region (AR)-coronal hole (CH) complex that covers an area of 359'' × 485''. The abundance map provides first ionization potential (FIP) bias levels in various coronal structures within the large EIS field of view. Overall, FIP bias in the small, relatively young AR is 2-3. This modest FIP bias is a consequence of the age of the AR, its weak heating, and its partial reconnection with the surrounding CH. Plasma with a coronal composition is concentrated at AR loop footpoints, close to where fractionation is believed to take place in the chromosphere. In the AR, we found a moderate positive correlation of FIP bias with nonthermal velocity and magnetic flux density, both of which are also strongest at the AR loop footpoints. Pathways of slightly enhanced FIP bias are traced along some of the loops connecting opposite polarities within the AR. We interpret the traces of enhanced FIP bias along these loops to be the beginning of fractionated plasma mixing in the loops. Low FIP bias in a sigmoidal channel above the AR's main polarity inversion line, where ongoing flux cancellation is taking place, provides new evidence of a bald patch magnetic topology of a sigmoid/flux rope configuration.

  15. Expression and phylogenetic analysis of the zic gene family in the evolution and development of metazoans

    Directory of Open Access Journals (Sweden)

    Layden Michael J

    2010-11-01

    Full Text Available Abstract Background zic genes are members of the gli/glis/nkl/zic super-family of C2H2 zinc finger (ZF transcription factors. Homologs of the zic family have been implicated in patterning neural and mesodermal tissues in bilaterians. Prior to this study, the origin of the metazoan zic gene family was unknown and expression of zic gene homologs during the development of early branching metazoans had not been investigated. Results Phylogenetic analyses of novel zic candidate genes identified a definitive zic homolog in the placozoan Trichoplax adhaerens, two gli/glis/nkl-like genes in the ctenophore Mnemiopsis leidyi, confirmed the presence of three gli/glis/nkl-like genes in Porifera, and confirmed the five previously identified zic genes in the cnidarian Nematostella vectensis. In the cnidarian N. vectensis, zic homologs are expressed in ectoderm and the gastrodermis (a bifunctional endomesoderm, in presumptive and developing tentacles, and in oral and sensory apical tuft ectoderm. The Capitella teleta zic homolog (Ct-zic is detectable in a subset of the developing nervous system, the foregut, and the mesoderm associated with the segmentally repeated chaetae. Lastly, expression of gli and glis homologs in Mnemiopsis. leidyi is detected exclusively in neural cells in floor of the apical organ. Conclusions Based on our analyses, we propose that the zic gene family arose in the common ancestor of the Placozoa, Cnidaria and Bilateria from a gli/glis/nkl-like gene and that both ZOC and ZF-NC domains evolved prior to cnidarian-bilaterian divergence. We also conclude that zic expression in neural ectoderm and developing neurons is pervasive throughout the Metazoa and likely evolved from neural expression of an ancestral gli/glis/nkl/zic gene. zic expression in bilaterian mesoderm may be related to the expression in the gastrodermis of a cnidarian-bilaterian common ancestor.

  16. Gene : CBRC-PABE-20-0007 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available vectensis] 7e-24 26% MMFVGGPSRCPMMFVGGPSRCPMMFVGGPSRCPMMFVGGPSRCPVMFVGGPSRCPVMFVGGPSRCPVMFVGGPSRCPVMFVGGPSRCPVMFVGGPSRCPVMFVGGPS...RCPVMFVGGPSRCPVMFVGGPSRCPVMFVGGPSRCPVMFVGGPSRCPVMFVGGPSRCPVMFVGGPSRCPVMFVGGPS...RCPVMFVGGPSRCPVMFVGGPSRCPVMFVGGPSRCPVMFVGGPSRCPVMFVGGPSRCPVMFVWRHLAGGPR ...

  17. Gene : CBRC-OGAR-01-0781 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available vectensis] 2e-15 26% MLMLLPASNLSLVYTAMLMLLPASHLSLVYTAIPTLPPASQLRSVYTAIPMLLPASHLSLVYTAMLMLLPASHVSSVYTAIPTLLLALHLSLVYTAIPTLLPASH...LSLVYTAIPTLLPASHLSLVYTAMLMLLPASHLSLVYTAIPTLPPALQLRSVYTAIPMLLPASHLSLVYTAMLMLLPASH...VSSVYTAIPTLLLALHLSLVYTAIPMLLPASHLSLVYTAMLMLLPAAHVSSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX...XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGTLPQTCSTHGTLLQTCSVHGAVLKPAACMELCSNLQHAWSCAQTPTVSHPEWQCSHPLIMPFQLVKNIAVKNYIVCFLL ...

  18. The cnidarian origin of the proto-oncogenes NF-κB/STAT and WNT-like oncogenic pathway drives the ctenophores (Review).

    Science.gov (United States)

    Sinkovics, Joseph G

    2015-10-01

    The cell survival pathways of the diploblastic early multicellular eukaryotic hosts contain and operate the molecular machinery resembling those of malignantly transformed individual cells of highly advanced multicellular hosts (including Homo). In the present review, the STAT/NF-κB pathway of the cnidarian Nematostella vectensis is compared with that of human tumors (malignant lymphomas, including Reed-Sternberg cells) pointing out similarities, including possible viral initiation in both cases. In the ctenophore genome and proteome, β-catenin gains intranuclear advantages due to a physiologically weak destructive complex in the cytoplasm, and lack of natural inhibitors (the dickkopfs). Thus, a scenario similar to what tumor cells initiate and achieve is presented through several constitutive loss-of-function type mutations in the destructive complex and in the elimination of inhibitors. Vice versa, malignantly transformed individual cells of advanced multicellular hosts assume pheno-genotypic resemblance to cells of unicellular or early multicellular hosts, and presumably to their ancient predecessors, by returning to the semblance of immortality and to the resumption of the state of high degree of resistance to physicochemical insults. Human leukemogenic and oncogenic pathways are presented for comparisons. The supreme bioengineers RNA/DNA complex encoded both the malignantly transformed immortal cell and the human cerebral cortex. The former generates molecules for the immortality of cellular life in the Universe. The latter invents the inhibitors of the process in order to gain control over it. PMID:26239915

  19. The dynamic genome of Hydra

    Science.gov (United States)

    Chapman, Jarrod A.; Kirkness, Ewen F.; Simakov, Oleg; Hampson, Steven E.; Mitros, Therese; Weinmaier, Therese; Rattei, Thomas; Balasubramanian, Prakash G.; Borman, Jon; Busam, Dana; Disbennett, Kathryn; Pfannkoch, Cynthia; Sumin, Nadezhda; Sutton, Granger G.; Viswanathan, Lakshmi Devi; Walenz, Brian; Goodstein, David M.; Hellsten, Uffe; Kawashima, Takeshi; Prochnik, Simon E.; Putnam, Nicholas H.; Shu, Shengquiang; Blumberg, Bruce; Dana, Catherine E.; Gee, Lydia; Kibler, Dennis F.; Law, Lee; Lindgens, Dirk; Martinez, Daniel E.; Peng, Jisong; Wigge, Philip A.; Bertulat, Bianca; Guder, Corina; Nakamura, Yukio; Ozbek, Suat; Watanabe, Hiroshi; Khalturin, Konstantin; Hemmrich, Georg; Franke, André; Augustin, René; Fraune, Sebastian; Hayakawa, Eisuke; Hayakawa, Shiho; Hirose, Mamiko; Hwang, Jung Shan; Ikeo, Kazuho; Nishimiya-Fujisawa, Chiemi; Ogura, Atshushi; Takahashi, Toshio; Steinmetz, Patrick R. H.; Zhang, Xiaoming; Aufschnaiter, Roland; Eder, Marie-Kristin; Gorny, Anne-Kathrin; Salvenmoser, Willi; Heimberg, Alysha M.; Wheeler, Benjamin M.; Peterson, Kevin J.; Böttger, Angelika; Tischler, Patrick; Wolf, Alexander; Gojobori, Takashi; Remington, Karin A.; Strausberg, Robert L.; Venter, J. Craig; Technau, Ulrich; Hobmayer, Bert; Bosch, Thomas C. G.; Holstein, Thomas W.; Fujisawa, Toshitaka; Bode, Hans R.; David, Charles N.; Rokhsar, Daniel S.; Steele, Robert E.

    2015-01-01

    The freshwater cnidarian Hydra was first described in 17021 and has been the object of study for 300 years. Experimental studies of Hydra between 1736 and 1744 culminated in the discovery of asexual reproduction of an animal by budding, the first description of regeneration in an animal, and successful transplantation of tissue between animals2. Today, Hydra is an important model for studies of axial patterning3, stem cell biology4 and regeneration5. Here we report the genome of Hydra magnipapillata and compare it to the genomes of the anthozoan Nematostella vectensis6 and other animals. The Hydra genome has been shaped by bursts of transposable element expansion, horizontal gene transfer, trans-splicing, and simplification of gene structure and gene content that parallel simplification of the Hydra life cycle. We also report the sequence of the genome of a novel bacterium stably associated with H. magnipapillata. Comparisons of the Hydra genome to the genomes of other animals shed light on the evolution of epithelia, contractile tissues, developmentally regulated transcription factors, the Spemann–Mangold organizer, pluripotency genes and the neuromuscular junction. PMID:20228792

  20. MyD88-deficient Hydra reveal an ancient function of TLR signaling in sensing bacterial colonizers

    Science.gov (United States)

    Franzenburg, Sören; Fraune, Sebastian; Künzel, Sven; Baines, John F.; Domazet-Lošo, Tomislav; Bosch, Thomas C. G.

    2012-01-01

    Toll-like receptor (TLR) signaling is one of the most important signaling cascades of the innate immune system of vertebrates. Studies in invertebrates have focused on the fruit fly Drosophila melanogaster and the nematode Caenorhabditis elegans, and there is little information regarding the evolutionary origin and ancestral function of TLR signaling. In Drosophila, members of the Toll-like receptor family are involved in both embryonic development and innate immunity. In C. elegans, a clear immune function of the TLR homolog TOL-1 is controversial and central components of vertebrate TLR signaling including the key adapter protein myeloid differentiation primary response gene 88 (MyD88) and the transcription factor NF-κB are not present. In basal metazoans such as the cnidarians Hydra magnipapillata and Nematostella vectensis, all components of the vertebrate TLR signaling cascade are present, but their role in immunity is unknown. Here, we use a MyD88 loss-of-function approach in Hydra to demonstrate that recognition of bacteria is an ancestral function of TLR signaling and that this process contributes to both host-mediated recolonization by commensal bacteria as well as to defense against bacterial pathogens. PMID:23112184

  1. Environ: E00407 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available E00407 Anemone altaica rhizome ... Rhizoma anemone Crude drug Anemone altaica, Anemone [TAX:22868] R ... anunculaceae (buttercup family) Anemone altaica rhizome ... (dried) Crude drugs [BR:br08305] Dicot plants: oth ... culaceae (buttercup family) E00407 Anemone altaica rhizome ...

  2. Evolution of hedgehog and hedgehog-related genes, their origin from Hog proteins in ancestral eukaryotes and discovery of a novel Hint motif

    Directory of Open Access Journals (Sweden)

    Bürglin Thomas R

    2008-03-01

    Full Text Available Abstract Background The Hedgehog (Hh signaling pathway plays important roles in human and animal development as well as in carcinogenesis. Hh molecules have been found in both protostomes and deuterostomes, but curiously the nematode Caenorhabditis elegans lacks a bona-fide Hh. Instead a series of Hh-related proteins are found, which share the Hint/Hog domain with Hh, but have distinct N-termini. Results We performed extensive genome searches of the cnidarian Nematostella vectensis and several nematodes to gain further insights into Hh evolution. We found six genes in N. vectensis with a relationship to Hh: two Hh genes, one gene with a Hh N-terminal domain fused to a Willebrand factor type A domain (VWA, and three genes containing Hint/Hog domains with distinct novel N-termini. In the nematode Brugia malayi we find the same types of hh-related genes as in C. elegans. In the more distantly related Enoplea nematodes Xiphinema and Trichinella spiralis we find a bona-fide Hh. In addition, T. spiralis also has a quahog gene like C. elegans, and there are several additional hh-related genes, some of which have secreted N-terminal domains of only 15 to 25 residues. Examination of other Hh pathway components revealed that T. spiralis - like C. elegans - lacks some of these components. Extending our search to all eukaryotes, we recovered genes containing a Hog domain similar to Hh from many different groups of protists. In addition, we identified a novel Hint gene family present in many eukaryote groups that encodes a VWA domain fused to a distinct Hint domain we call Vint. Further members of a poorly characterized Hint family were also retrieved from bacteria. Conclusion In Cnidaria and nematodes the evolution of hh genes occurred in parallel to the evolution of other genes that contain a Hog domain but have different N-termini. The fact that Hog genes comprising a secreted N-terminus and a Hog domain are also found in many protists suggests that this

  3. Distribution, habitat use and ecology of deepwater Anemones (Actiniaria) in the Gulf of Mexico

    Science.gov (United States)

    Ammons, Archie W.; Daly, Marymegan

    2008-12-01

    The distribution of deepwater Actiniaria is poorly known. Rarely are these organisms identified to family, as this requires both well-preserved specimens and taxonomic expertise. Ecological information is similarly lacking. From the results of a comprehensive surveying program in the deep Gulf of Mexico, we report the occurrence of nine species of Actiniaria. For the most abundant four of these, we plot distributions and discuss habitat use, morphological variation, and feeding strategies. Actiniaria in the Gulf appear to have broad, basin-wide distributions with little depth preference. Faunal biomass is highest in the NE Gulf within submarine canyons or at the base of slope escarpments. Attachment mode is mostly opportunistic on various types of hard substrata, including trash. Sediment-dwelling forms are very abundant at an organically rich site within a large submarine canyon.

  4. Taxonomic, Spatial and Temporal Patterns of Bleaching in Anemones Inhabited by Anemonefishes

    OpenAIRE

    Hobbs, Jean-Paul A.; Frisch, Ashley J.; Ford, Benjamin M.; Thums, Michele; Saenz-Agudelo, Pablo; Furby, Kathryn A.; Berumen, Michael L.

    2013-01-01

    Background Rising sea temperatures are causing significant destruction to coral reef ecosystems due to coral mortality from thermally-induced bleaching (loss of symbiotic algae and/or their photosynthetic pigments). Although bleaching has been intensively studied in corals, little is known about the causes and consequences of bleaching in other tropical symbiotic organisms. Methodology/Principal Findings This study used underwater visual surveys to investigate bleaching in the 10 species of a...

  5. HISTOLOGICAL RESPONSES OF THE SEA ANEMONE A. PALLIDA TO BLEACHING INDUCING STRESSES

    OpenAIRE

    Fransolet, David

    2014-01-01

    Tropical Coral reefs are among the richest and most important ecosystem on Earth. This success would not be possible without the symbiosis established between corals and unicellular algae of the genus Symbiodinium that provide them with photosynthesis-derived carbon. Unfortunately, with the climatic upheaval that we witness today, the long-term survival of coral reefs could be in jeopardy. Massive loss of symbiotic algae, a phenomenon known as coral bleaching, becomes indeed more and more fre...

  6. NMR analysis of sequence of toxin II from the sea anemone Radianthus paumotensis

    International Nuclear Information System (INIS)

    Toxin II from Radianthus paumotensis (Rp/sub II/) has been investigated by high-resolution NMR and chemical sequencing methods. Resonance assignments have been obtained for this protein by the sequential approach. NMR assignments could not be made consistent with the previously reported primary sequence for this protein, and chemical methods have been used to determine a sequence with which the NMR data are consistent. Analysis of the 2D NOE spectra shows that the protein secondary structure is comprised of two sequences of β-sheet, probably joined into a distorted continuous sheet, connected by turns and extended loops, without any regular α-helical segments. The residues previously implicated in activity in this class of proteins, D8 and R13, occur in a loop region

  7. Taxonomic, Spatial and Temporal Patterns of Bleaching in Anemones Inhabited by Anemonefishes

    OpenAIRE

    Hobbs, Jean-Paul A; Ashley J Frisch; Ford, Benjamin M.; Michele Thums; Pablo Saenz-Agudelo; Kathryn A Furby; Berumen, Michael L.

    2013-01-01

    BACKGROUND: Rising sea temperatures are causing significant destruction to coral reef ecosystems due to coral mortality from thermally-induced bleaching (loss of symbiotic algae and/or their photosynthetic pigments). Although bleaching has been intensively studied in corals, little is known about the causes and consequences of bleaching in other tropical symbiotic organisms. METHODOLOGY/PRINCIPAL FINDINGS: This study used underwater visual surveys to investigate bleaching in the 10 species of...

  8. New records on sea anemones (Anthozoa: Actiniaria) from hydrothermal vents and cold seeps

    NARCIS (Netherlands)

    López-González, P.J.; Rodríguez, E.; Gili, J.-M.; Segonzac, M.

    2003-01-01

    During several cruises carried out by the Ifremer (Institut français de recherche pour l’exploitation de la mer) with the submersile “Nautile” at different hydrothermal sites and cold seeps, an important collection of anthozoans - mainly actiniarians - was sampled. Additional material was collected

  9. Evolution of selenoproteins in the metazoan

    Directory of Open Access Journals (Sweden)

    Jiang Liang

    2012-09-01

    Full Text Available Abstract Background The selenocysteine (Sec containing proteins, selenoproteins, are an important group of proteins present throughout all 3 kingdoms of life. With the rapid progression of selenoprotein research in the post-genomic era, application of bioinformatics methods to the identification of selenoproteins in newly sequenced species has become increasingly important. Although selenoproteins in human and other vertebrates have been investigated, studies of primitive invertebrate selenoproteomes are rarely reported outside of insects and nematodes. Result A more integrated view of selenoprotein evolution was constructed using several representative species from different evolutionary eras. Using a SelGenAmic-based selenoprotein identification method, 178 selenoprotein genes were identified in 6 invertebrates: Amphimedon queenslandica, Trichoplax adhaerens, Nematostella vectensis, Lottia gigantean, Capitella teleta, and Branchiostoma floridae. Amphioxus was found to have the most abundant and variant selenoproteins of any animal currently characterized, including a special selenoprotein P (SelP possessing 3 repeated Trx-like domains and Sec residues in the N-terminal and 2 Sec residues in the C-terminal. This gene structure suggests the existence of two different strategies for extension of Sec numbers in SelP for the preservation and transportation of selenium. In addition, novel eukaryotic AphC-like selenoproteins were identified in sponges. Conclusion Comparison of various animal species suggests that even the most primitive animals possess a selenoproteome range and variety similar to humans. During evolutionary history, only a few new selenoproteins have emerged and few were lost. Furthermore, the massive loss of selenoproteins in nematodes and insects likely occurred independently in isolated partial evolutionary branches.

  10. FGFRL1 is a neglected putative actor of the FGF signalling pathway present in all major metazoan phyla

    Directory of Open Access Journals (Sweden)

    Lamonerie Thomas

    2009-09-01

    Full Text Available Abstract Background Fibroblast Growth Factors (FGF and their receptors are well known for having major implications in cell signalling controlling embryonic development. Recently, a gene coding for a protein closely related to FGFRs (Fibroblast Growth Factor Receptors called FGFR5 or FGFR-like 1 (FGFRL1, has been described in vertebrates. An orthologous gene was also found in the cephalochordate amphioxus, but no orthologous genes were found by the authors in other non-vertebrate species, even if a FGFRL1 gene was identified in the sea urchin genome, as well as a closely related gene, named nou-darake, in the planarian Dugesia japonica. These intriguing data of a deuterostome-specific gene that might be implicated in FGF signalling prompted us to search for putative FGFRL1 orthologues in the completely sequenced genomes of metazoans. Results We found FGFRL1 genes in the cnidarian Nematostella vectensis as well as in many bilaterian species. Our analysis also shows that FGFRL1 orthologous genes are linked in the genome with other members of the FGF signalling pathway from cnidarians to bilaterians (distance in situ hybridization. We show that some homologous expression territories can be defined, and we propose that FGFRL1 and FGF8/17/18 were already co-expressed in the pharyngeal endoderm in the ancestor of chordates. Conclusion Our work sheds light on the existence of a putative FGF signalling pathway actor present in the ancestor of probably all metazoans, the function of which has received little attention until now.

  11. Deep mRNA sequencing of the Tritonia diomedea brain transcriptome provides access to gene homologues for neuronal excitability, synaptic transmission and peptidergic signalling.

    Directory of Open Access Journals (Sweden)

    Adriano Senatore

    Full Text Available The sea slug Tritonia diomedea (Mollusca, Gastropoda, Nudibranchia, has a simple and highly accessible nervous system, making it useful for studying neuronal and synaptic mechanisms underlying behavior. Although many important contributions have been made using Tritonia, until now, a lack of genetic information has impeded exploration at the molecular level.We performed Illumina sequencing of central nervous system mRNAs from Tritonia, generating 133.1 million 100 base pair, paired-end reads. De novo reconstruction of the RNA-Seq data yielded a total of 185,546 contigs, which partitioned into 123,154 non-redundant gene clusters (unigenes. BLAST comparison with RefSeq and Swiss-Prot protein databases, as well as mRNA data from other invertebrates (gastropod molluscs: Aplysia californica, Lymnaea stagnalis and Biomphalaria glabrata; cnidarian: Nematostella vectensis revealed that up to 76,292 unigenes in the Tritonia transcriptome have putative homologues in other databases, 18,246 of which are below a more stringent E-value cut-off of 1x10-6. In silico prediction of secreted proteins from the Tritonia transcriptome shotgun assembly (TSA produced a database of 579 unique sequences of secreted proteins, which also exhibited markedly higher expression levels compared to other genes in the TSA.Our efforts greatly expand the availability of gene sequences available for Tritonia diomedea. We were able to extract full length protein sequences for most queried genes, including those involved in electrical excitability, synaptic vesicle release and neurotransmission, thus confirming that the transcriptome will serve as a useful tool for probing the molecular correlates of behavior in this species. We also generated a neurosecretome database that will serve as a useful tool for probing peptidergic signalling systems in the Tritonia brain.

  12. Nanoporous TiO2 nanoparticle assemblies with mesoscale morphologies: nano-cabbage versus sea-anemone.

    Science.gov (United States)

    Darbandi, Masih; Gebre, Tesfaye; Mitchell, Lucas; Erwin, William; Bardhan, Rizia; Levan, M Douglas; Mochena, Mogus D; Dickerson, James H

    2014-06-01

    We report the novel synthesis of nanoporous TiO2 nanoparticle ensembles with unique mesoscale morphologies. Constituent nanoparticles evolved into multifaceted assemblies, exhibiting excellent crystallinity and enhanced photocatalytic activity compared with commercial TiO2. Such materials could be exploited for applications, like organic pollutant degradation. PMID:24760418

  13. Selective and oriented immobilization of (phospho lipases from the Caribbean Sea anemone Stichodactyla helianthus (Ellis, 1768 by interfacial adsorption

    Directory of Open Access Journals (Sweden)

    Alberto del Monte-Martínez

    2012-01-01

    Full Text Available Las lipasas inmovilizadas por adsorción interfacial a soportes hidrofóbicos constituyen sistemas enzimáticos con potencialidades comprobadas para diversas aplicaciones como la bioconversión. Por otro lado, las enzimas de invertebrados marinos muestran especificidades de sustrato poco usuales, que las convierten en blancos atractivos para el desarrollo de biocatalizadores inmovilizados. En este trabajo se describe la inmovilización por adsorción interfacial al soporte Octyl-Sepharose CL 4B de dos (fosfolipasas: las Sticholysinas I y II, y una actividad esterasa de alto peso molecular, a partir del extracto total de la anémona del mar Caribe Stichodactyla helianthus. La inmovilización fue selectiva para las lipasas, que mostraron actividad esterolítica frente a p-nitrofenilacetato, B-naftilcaprilato y tributirina. Esta actividad esterolítica de las Sticholysinas frente a sustratos no fosfolípidos no había sido informada con anterioridad. La actividad enzimática específica máxima aparente frente a p-nitrofenilacetato fue menor en los derivados inmovilizados que en las muestras solubles. La inmovilización resultó además orientada, ya que aumentó la afinidad aparente por el sustrato, lo que indica una mayor accesibilidad a los centros activos. El 68 % de las (fosfolipasas inmovilizadas conservaron la actividad hidrolítica frente a la tributirina. Estas enzimas requieren el ion Ca2+ para hidrolizar p-nitrofenilacetato y se inhibieron a concentraciones de p-nitrofenilacetato mayores que 1,185 mmol/L. Concentraciones de Ca2+ iguales a 40 mmol/L eliminaron la inhibición por exceso de sustrato en el extracto inmovilizado. Estas características cinéticas sugieren un posible uso de los biocatalizadores obtenidos en bioconversión enzimática.

  14. Granulocytes of sea anemone Actinia equina (Linnaeus, 1758 body fluid contain and release cytolysins forming plaques of lysis

    Directory of Open Access Journals (Sweden)

    MG Parisi

    2014-01-01

    Full Text Available The Cnidaria phylum includes organisms that are among the most poisonous animals. The exact composition of cnidarian bioactive molecules is not known in detail, but little is known on the cells that produce the toxins. Here we have shown that the presence of cytolysins is not exclusive of nematocysts. A plaque-forming assay was carried out with cell populations extracted from the percoled body fluid showed for the first time that anthozoan granulocytes are able to form plaque of lysis. We have partitioned the total population of free cells into three distinct discrete bands by discontinuous Percoll gradient, and we have identified six small different types cells: morular granulocytes; cells with large or small peripherical granules, granulocytes with irregular shape containing blue and red granules, cells showing one fine red granule of uniform size and, finally, cells with elongated shape and small dispersed granules. Cell lysate of each cellular band resulted cytolytic toward different erythrocytes types. SDS page analysis of the lysate cell fraction showed a predominant of 20 kDa that corresponds to the weight of the cytolytic equinatoxin. The nature of equinatoxins-related activity was demonstrated by inhibition experiments using bovine sphingomyelin.

  15. Coral life history and symbiosis: Functional genomic resources for two reef building Caribbean corals, Acropora palmata and Montastraea faveolata

    Directory of Open Access Journals (Sweden)

    Szmant Alina M

    2008-02-01

    -scleractinian cnidarians Nematostella vectensis and Hydra magnipapillata. Conclusion Partial sequencing of 5 cDNA libraries each for A. palmata and M. faveolata has produced a rich set of candidate genes (4,980 genes from A. palmata, and 1,732 genes from M. faveolata that we can use as a starting point for examining the life history and symbiosis of these two species, as well as to further expand the dataset of cnidarian genes for comparative genomics and evolutionary studies.

  16. EST Table: AV400071 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available ostella vectensis] ref|XP_002113772.1| replacement histone H3.3 [Trichoplax adhaerens] ref|XP_002154470.1| P...tella vectensis] gb|EDV24246.1| replacement histone H3.3 [Trichoplax adhaerens] 10/08/28 92 %/115 aa FBpp027

  17. Sea-anemone toxin ATX-II elicits A-fiber-dependent pain and enhances resurgent and persistent sodium currents in large sensory neurons

    Directory of Open Access Journals (Sweden)

    Klinger Alexandra B

    2012-09-01

    Full Text Available Abstract Background Gain-of-function mutations of the nociceptive voltage-gated sodium channel Nav1.7 lead to inherited pain syndromes, such as paroxysmal extreme pain disorder (PEPD. One characteristic of these mutations is slowed fast-inactivation kinetics, which may give rise to resurgent sodium currents. It is long known that toxins from Anemonia sulcata, such as ATX-II, slow fast inactivation and skin contact for example during diving leads to various symptoms such as pain and itch. Here, we investigated if ATX-II induces resurgent currents in sensory neurons of the dorsal root ganglion (DRGs and how this may translate into human sensations. Results In large A-fiber related DRGs ATX-II (5 nM enhances persistent and resurgent sodium currents, but failed to do so in small C-fiber linked DRGs when investigated using the whole-cell patch-clamp technique. Resurgent currents are thought to depend on the presence of the sodium channel β4-subunit. Using RT-qPCR experiments, we show that small DRGs express significantly less β4 mRNA than large sensory neurons. With the β4-C-terminus peptide in the pipette solution, it was possible to evoke resurgent currents in small DRGs and in Nav1.7 or Nav1.6 expressing HEK293/N1E115 cells, which were enhanced by the presence of extracellular ATX-II. When injected into the skin of healthy volunteers, ATX-II induces painful and itch-like sensations which were abolished by mechanical nerve block. Increase in superficial blood flow of the skin, measured by Laser doppler imaging is limited to the injection site, so no axon reflex erythema as a correlate for C-fiber activation was detected. Conclusion ATX-II enhances persistent and resurgent sodium currents in large diameter DRGs, whereas small DRGs depend on the addition of β4-peptide to the pipette recording solution for ATX-II to affect resurgent currents. Mechanical A-fiber blockade abolishes all ATX-II effects in human skin (e.g. painful and itch-like paraesthesias, suggesting that it mediates its effects mainly via activation of A-fibers.

  18. Sea-anemone toxin ATX-II elicits A-fiber-dependent pain and enhances resurgent and persistent sodium currents in large sensory neurons

    OpenAIRE

    Klinger Alexandra B; Eberhardt Mirjam; Link Andrea S; Namer Barbara; Kutsche Lisa K; Schuy E; Sittl Ruth; Hoffmann Tali; Alzheimer Christian; Huth Tobias; Carr Richard W; Lampert Angelika

    2012-01-01

    Abstract Background Gain-of-function mutations of the nociceptive voltage-gated sodium channel Nav1.7 lead to inherited pain syndromes, such as paroxysmal extreme pain disorder (PEPD). One characteristic of these mutations is slowed fast-inactivation kinetics, which may give rise to resurgent sodium currents. It is long known that toxins from Anemonia sulcata, such as ATX-II, slow fast inactivation and skin contact for example during diving leads to various symptoms such as pain and itch. Her...

  19. Tree litter and forest understorey vegetation: a conceptual framework to understand the effects of tree litter on a perennial geophyte, Anemone nemorosa

    OpenAIRE

    Baltzinger, M; Archaux, F.; Dumas, Y.

    2012-01-01

    BACKGROUND AND AIMS: Litter is a key factor in structuring plant populations, through positive or negative interactions. The litter layer forms a mechanical barrier that is often strongly selective against individuals lacking hypocotyle plasticity. Litter composition also interacts with plant growth by providing beneficial nutrients or, inversely, by allowing harmful allelopathic leaching. As conspicuous litter fall accumulation is often observed under deciduous forests, interactions betwe...

  20. For she that hath, to her shall be given…Implications of flowering in Anemone nemorosa L

    DEFF Research Database (Denmark)

    Pontoppidan, Maj-Britt; Petersen, Peter Milan; Philipp, Marianne

    2011-01-01

    the following spring. We hypothesised that the decision to invest in flower buds depends on the amount of resources stored in the recently formed annual segment. We also hypothesised a trade-off between flowering and segment growth and, finally, as a consequence, we expected individual rhizomes to...... alternate between the flowering and the non-flowering state. We found that segments producing flower buds were significantly longer than non-flowering segments, indicating that resource level influences the function of the preformed buds. Contrary to our expectations, we found flowering rhizomes produced...... longer annual segments than non-flowering rhizomes. We suggest the larger leaf area of flowering rhizomes and occasional abortion of flowers or seeds as possible mechanisms behind this pattern. Our study shows that even though the decision to produce a flower bud is taken in another time-frame than that...

  1. CALLING AQUARIUM LOVERS...

    CERN Multimedia

    2002-01-01

    CERN's anemones will soon be orphans. We are looking for someone willing to look after the aquarium in the main building, for one year. If you are interested, or if you would like more information, please call 73830. (The anemones living in the aquarium thank you in anticipation.)

  2. Marine organisms and their adaption - Adaptions solve the challenges of existence in the sea.

    Digital Repository Service at National Institute of Oceanography (India)

    Gonsalves, M.J.B.D.; Das, A.; LokaBharathi, P.A.

    great diversity of organisms. To survive, these organisms need to secure food, successfully reproduce and avoid predation. Simple animals, such as anemones or worms, absorb the gases through their skin. Mobile animals use gills, or even lungs to absorb...

  3. Etologie sasankové krevety \\kur{Ancylomenes longicarpus} v Rudém moři

    OpenAIRE

    KARÁSKOVÁ, Martina

    2011-01-01

    In this Master thesis the behaviour of anemone shrimp Ancylomenes longicarpus was studied in situ in the Red Sea. The diurnal activity, signalling behaviour and also cleaning behaviour was observed and analyzed.

  4. Plant-derived visual signals may protect beetle herbivores from bird predators

    OpenAIRE

    Tamar Keasar; Miriam Kishinevsky; Avi Shmida; Yoram Gerchman; Nicka Chinkov; Avi Koplovich; Gadi Katzir

    2013-01-01

    Insect herbivores often use chemical signals obtained from their food plants to deter enemies and/or attract sexual partners. Do plant-based visual signals act similarly, i.e., repel consumers' enemies and appeal to potential mates? We explored this question using the pollen-feeding beetle Pygopleurus israelitus (Glaphyridae), a specialized pollinator of Anemone coronaria's chemically defended red-morph flowers. We presented dead beetles, which had fed either on anemones or on cat-food, to yo...

  5. Morphological and functional study of the marginal sphincter of the sea anemones Phymactis clematis and Aulactinia marplatensis from intertidal of Mar del Plata, Argentina Estudio morfológico y funcional del esfínter marginal de las anémonas de mar Phymactis clematis y Aulactinia marplatensis del intermareal de Mar del Plata, Argentina

    Directory of Open Access Journals (Sweden)

    Elvira A. González Oliveira

    2009-09-01

    Full Text Available It was made the characterization of marginal sphincter to the species Phymactis clematis (Drayton in Dana, 1849 and Aulactinia marplatensis (Zamponi, 1977, from intertidal ecosystem through their morphogical and functional study. The species P. clematis has a circumscript sphincter of palmate type. This muscle is constituted by a mesogloeal axis and several mesogloeal subaxes. Axis as well as subaxes give a support to the endoderm which border is smooth. Aulactinia marplatensis has a circunscript sphincter pinnate type. The axis has a truncated cone shape while in P. clematis the shape is cylindrical on its origin and it is bifurcated at the end. Both species experiments were carried out using the isolated muscles. They were stimulated at increasing KCl concentrations ranging from 20 to 200 mM. The results were analysed in the form of dose-response curves expressed in tension in grams force vs concentration. Contractil force increases in a sigmoid form to increasing KCl concentrations. The correlation between morphology and function and the differences shown in both species would be related to their intertidal distribution.Se realizó la caracterización de las anémonas de mar Phymactis clematis (Drayton in Dana, 1849 y Aulactinia marplatensis (Zamponi, 1977 del ecosistema intermareal mediante estudio morfológico y funcional. La especie P. clematis tiene un esfínter circunscripto de tipo palmado. Este músculo está constituido por un eje mesogloeal y varios subejes mesogloeales. Tanto el eje como los subejes dan soporte al endodermo cuyo borde es liso. La especie A. marplatensis tiene un esfínter circunscripto de tipo pinnado. El eje tiene forma de cono truncado mientras que en P. clematis es cilíndrico en su origen bifurcándose en su parte final. Los experimentos fueron llevados a cabo usando el músculo aislado de ambas especies. Estos fueron estimulados a concentraciones crecientes de KCl en un rango de 20 a 200 mM. Los resultados fueron analizados mediante curvas dosis-respuesta expresados en tensión en gramos fuerza vs concentración. La fuerza contráctil se incrementó en forma sigmoidea. La correlación entre la morfología y función y las diferencias mostradas en ambas especies podrían estar relacionadas con su distribución en el intertidal.

  6. Morphological and functional study of the marginal sphincter of the sea anemones Phymactis clematis and Aulactinia marplatensis from intertidal of Mar del Plata, Argentina Estudio morfológico y funcional del esfínter marginal de las anémonas de mar Phymactis clematis y Aulactinia marplatensis del intermareal de Mar del Plata, Argentina

    OpenAIRE

    Elvira A. González Oliveira; Darlo Luis Patronelli; Mauricio O. Zamponi

    2009-01-01

    It was made the characterization of marginal sphincter to the species Phymactis clematis (Drayton in Dana, 1849) and Aulactinia marplatensis (Zamponi, 1977), from intertidal ecosystem through their morphogical and functional study. The species P. clematis has a circumscript sphincter of palmate type. This muscle is constituted by a mesogloeal axis and several mesogloeal subaxes. Axis as well as subaxes give a support to the endoderm which border is smooth. Aulactinia marplatensis has a circun...

  7. The rapid separation and identification of saponins from Chinese herb Anemone raddeana REGEL by RP-HPLC-MS-MS%高效液相色谱-质谱-质谱法快速鉴定中药竹节香附的皂苷

    Institute of Scientific and Technical Information of China (English)

    李顺意; 李紫; 王世敏; 陈勇

    2000-01-01

    应用反相高效液相色谱-电喷雾-质谱-质谱(RP-HPLC-ESI-MS-MS)方法对竹节香附皂苷提取物的化学成分进行分析.通过一步分析可以同时 分离并鉴定出竹节香附中的竹节香附皂苷R2、R3、R6、R7、R8和R9等6种有效 成分.同时也发现一些本药材中原来没有报道的成分.本研究结果为竹节香附及其相关药品有效成分分析和鉴定提供一种快速鉴定方法.

  8. Cohabitation promotes high diversity of clownfishes in the Coral Triangle.

    Science.gov (United States)

    Camp, Emma F; Hobbs, Jean-Paul A; De Brauwer, Maarten; Dumbrell, Alex J; Smith, David J

    2016-03-30

    Global marine biodiversity peaks within the Coral Triangle, and understanding how such high diversity is maintained is a central question in marine ecology. We investigated broad-scale patterns in the diversity of clownfishes and their host sea anemones by conducting 981 belt-transects at 20 locations throughout the Indo-Pacific. Of the 1508 clownfishes encountered, 377 fish occurred in interspecific cohabiting groups and cohabitation was almost entirely restricted to the Coral Triangle. Neither the diversity nor density of host anemone or clownfish species alone influenced rates of interspecific cohabitation. Rather cohabitation occurred in areas where the number of clownfish species exceeds the number of host anemone species. In the Coral Triangle, cohabiting individuals were observed to finely partition their host anemone, with the subordinate species inhabiting the periphery. Furthermore, aggression did not increase in interspecific cohabiting groups, instead dominant species were accepting of subordinate species. Various combinations of clownfish species were observed cohabiting (independent of body size, phylogenetic relatedness, evolutionary age, dentition, level of specialization) in a range of anemone species, thereby ensuring that each clownfish species had dominant reproductive individuals in some cohabiting groups. Clownfishes are obligate commensals, thus cohabitation is an important process in maintaining biodiversity in high diversity systems because it supports the persistence of many species when host availability is limiting. Cohabitation is a likely explanation for high species richness in other obligate commensals within the Coral Triangle, and highlights the importance of protecting these habitats in order to conserve unique marine biodiversity. PMID:27030417

  9. 101 questions on corals: Towards awareness

    Digital Repository Service at National Institute of Oceanography (India)

    Wafar, M.V.M.; Wafar, S.

    . In reality, a coral is a simple animal like the sea anemone we find on rocky beaches. Unlike the anemone, the coral animal is generally small and constructs a skeleton around its body for protection. A coral animal is also called a polyp. 2.... Are polyp and coral the same? No. The term coral is usually denotes the skeleton though at times the polyp is also called coral animal. 3. What does a polyp look like? Each polyp is a hollow cylinder of tissues with tentacles and a central mouth opening...

  10. Crustaceans associated with Cnidaria, Bivalvia, Echinoidea and Pisces at São Tomé and Príncipe islands.

    Directory of Open Access Journals (Sweden)

    Wirtz, P.

    2008-01-01

    Full Text Available Symbiotic crustaceans were searched for at sea anemones (Actiniaria, encrusting anemones (Zoantharia, horny coral (Gorgonaria, black coral (Antipatharia, bivalves (Bivalvia, and sea urchins (Echinoidea at São Tomé and Príncipe Islands (Gulf of Guinea, eastern central Atlantic. Sixteen species of crustaceans were found in association with these invertebrate hosts; eleven of them were new records for the area and two species, belonging to the genera Hippolyte and Heteromysis, were new for science. The thalassinid Axiopsis serratifrons was occasionally associated with an undescribed species of gobiid fish.

  11. Peptides in the nervous systems of cnidarians: structure, function, and biosynthesis

    DEFF Research Database (Denmark)

    Grimmelikhuijzen, C J; Leviev, I; Carstensen, Kathrine

    1996-01-01

    Cnidarians are the lowest animal group having a nervous system and it was probably within this phylum or in a related ancestor group that nervous systems first evolved. The primitive nervous systems of cnidarians are strongly peptidergic. From a single sea anemone species, Anthopleura elegantissi...

  12. Toelating Herbasan SC welkom voor dahlia, A. coronaria en narcis

    NARCIS (Netherlands)

    Leeuwen, van P.J.; Koster, A.T.J.; Trompert, J.P.T.

    2005-01-01

    Onlangs is Herbasan SC voor de onkruidbestrijding in onder meer dahlia, narcis en Anemone coronaria toegelaten. PPO ging na hoe het middel het beste is in te zetten. In dit artikel zijn de resultaten van het onderzoek vermeld en een advies voor toepassing

  13. To Build an Ecosystem: An Introductory Lab for Environmental Science & Biology Students

    Science.gov (United States)

    Hudon, Daniel; Finnerty, John R.

    2013-01-01

    A hypothesis-driven laboratory is described that introduces students to the complexities of ecosystem function. Students work with live algae, brine shrimp, and sea anemones to test hypotheses regarding the trophic interactions among species, the exchange of nutrients and gases, and the optimal ratio of producers to consumers and predators in…

  14. Gastrin/CCK-like immunoreactivity in the nervous system of coelenterates

    DEFF Research Database (Denmark)

    Grimmelikhuijzen, C J; Sundler, F; Rehfeld, J F

    1980-01-01

    Using immunocytochemistry, gastrin/CCK-like immunoreactivity is found in sensory nerve cells in the ectoderm of the mouth region of hydra and in nerve cells in the endoderm of all body regions of the sea anemone tealia. These results are corroborated by radioimmunoassay: One hydra contains at least...

  15. The proteomic profile of Stichodactyla duerdeni secretion reveals the presence of a novel O-linked glycopeptide

    DEFF Research Database (Denmark)

    Cassoli, Juliana Silva; Verano-Braga, Thiago; Oliveira, Joacir Stolarz;

    2013-01-01

    , a new peptide of 3431Da, named U-SHTX-Sdd1, was purified and completely sequenced by automated Edman's degradation and tandem mass spectrometry. An analysis of U-SHTX-Sdd1 revealed a modified O-HexNAc-Threonine at position 1, which, at the best of our knowledge, constitutes the first sea anemone toxin...

  16. The Kunitz-Type Protein ShPI-1 Inhibits Serine Proteases and Voltage-Gated Potassium Channels.

    Science.gov (United States)

    García-Fernández, Rossana; Peigneur, Steve; Pons, Tirso; Alvarez, Carlos; González, Lidice; Chávez, María A; Tytgat, Jan

    2016-01-01

    The bovine pancreatic trypsin inhibitor (BPTI)-Kunitz-type protein ShPI-1 (UniProt: P31713) is the major protease inhibitor from the sea anemone Stichodactyla helianthus. This molecule is used in biotechnology and has biomedical potential related to its anti-parasitic effect. A pseudo wild-type variant, rShPI-1A, with additional residues at the N- and C-terminal, has a similar three-dimensional structure and comparable trypsin inhibition strength. Further insights into the structure-function relationship of rShPI-1A are required in order to obtain a better understanding of the mechanism of action of this sea anemone peptide. Using enzyme kinetics, we now investigated its activity against other serine proteases. Considering previous reports of bifunctional Kunitz-type proteins from anemones, we also studied the effect of rShPI-1A on voltage-gated potassium (Kv) channels. rShPI-1A binds Kv1.1, Kv1.2, and Kv1.6 channels with IC50 values in the nM range. Hence, ShPI-1 is the first member of the sea anemone type 2 potassium channel toxins family with tight-binding potency against several proteases and different Kv1 channels. In depth sequence analysis and structural comparison of ShPI-1 with similar protease inhibitors and Kv channel toxins showed apparent non-sequence conservation for known key residues. However, we detected two subtle patterns of coordinated amino acid substitutions flanking the conserved cysteine residues at the N- and C-terminal ends. PMID:27089366

  17. Isolation and distribution of iridescent Cellulophaga and further iridescent marine bacteria in the Charente Maritime coast, French Atlantic coast

    OpenAIRE

    Kientz, Betty; Agogué, Hélène; Lavergne, Céline; Marié, Pauline; Rosenfeld, Eric

    2013-01-01

    An intense colored marine bacterium, identified as Cellulophaga lytica, has been previously isolated from a sea anemone surface on the Charente Maritime rocky shore (Atlantic Coast, France). Iridescence of the colonies under direct light was recently described and proved physically. Iridescence intensities were found to strongly differ among C. lytica strains from culture collections. Importantly, the occurrence and distribution of iridescent bacteria in the marine environment were still unkn...

  18. Strategies toward structural and functional 'optimization' of animal peptide toxins

    OpenAIRE

    Andreotti N; Ziadi H; Mouhat S; De Waard M; Sabatier J-M

    2012-01-01

    Background: venoms of a variety of animal species (i.e. scorpions, snakes, spiders, sea anemones, marine cone snails, worms, and insects) are rich sources of bioactive compounds that possess obvious pharmacological, therapeutic and/or biotechnological values. A majority of these compounds are peptides that mainly target enzymes, membrane receptors or ion channels. Aim: In recent years, much efforts of researchers have been focused on characterizing and ‘improving’ the pharmacological profile ...

  19. Comparative lipid profiling of the cnidarian Aiptasia pallida and its dinoflagellate symbiont.

    Directory of Open Access Journals (Sweden)

    Teresa A Garrett

    Full Text Available Corals and other cnidarians house photosynthetic dinoflagellate symbionts within membrane-bound compartments inside gastrodermal cells. Nutritional interchanges between the partners produce carbohydrates and lipids for metabolism, growth, energy stores, and cellular structures. Although lipids play a central role in the both the energetics and the structural/morphological features of the symbiosis, previous research has primarily focused on the fatty acid and neutral lipid composition of the host and symbiont. In this study we conducted a mass spectrometry-based survey of the lipidomic changes associated with symbiosis in the sea anemone Aiptasia pallida, an important model system for coral symbiosis. Lipid extracts from A. pallida in and out of symbiosis with its symbiont Symbiodinium were prepared and analyzed using negative-ion electrospray ionization quadrupole time-of-flight mass spectrometry. Through this analysis we have identified, by exact mass and collision-induced dissociation mass spectrometry (MS/MS, several classes of glycerophospholipids in A. pallida. Several molecular species of di-acyl phosphatidylinositol and phosphatidylserine as well as 1-alkyl, 2-acyl phosphatidylethanolamine (PE and phosphatidycholine were identified. The 1-alkyl, 2-acyl PEs are acid sensitive suggestive that they are plasmalogen PEs possessing a double bond at the 1-position of the alkyl linked chain. In addition, we identified several molecular species of phosphonosphingolipids called ceramide aminoethylphosphonates in anemone lipid extracts by the release of a characteristic negative product ion at m/z 124.014 during MS/MS analysis. Sulfoquinovosyldiacylglycerol (SQDG, an anionic lipid often found in photosynthetic organisms, was identified as a prominent component of Symbiodinium lipid extracts. A comparison of anemone lipid profiles revealed a subset of lipids that show dramatic differences in abundance when anemones are in the symbiotic state as

  20. Symbiosis induces widespread changes in the proteome of the model cnidarian Aiptasia.

    Science.gov (United States)

    Oakley, Clinton A; Ameismeier, Michael F; Peng, Lifeng; Weis, Virginia M; Grossman, Arthur R; Davy, Simon K

    2016-07-01

    Coral reef ecosystems are metabolically founded on the mutualism between corals and photosynthetic dinoflagellates of the genus Symbiodinium. The glass anemone Aiptasia sp. has become a tractable model for this symbiosis, and recent advances in genetic information have enabled the use of mass spectrometry-based proteomics in this model. We utilized label-free liquid chromatography electrospray-ionization tandem mass spectrometry to analyze the effects of symbiosis on the proteomes of symbiotic and aposymbiotic Aiptasia. We identified and obtained relative quantification of more than 3,300 proteins in 1,578 protein clusters, with 81 protein clusters showing significantly different expression between symbiotic states. Symbiotic anemones showed significantly higher expression of proteins involved in lipid storage and transport, nitrogen transport and cycling, intracellular trafficking, endocytosis and inorganic carbon transport. These changes reflect shifts in host metabolism and nutrient reserves due to increased nutritional exchange with the symbionts, as well as mechanisms for supplying inorganic nutrients to the algae. Aposymbiotic anemones exhibited increased expression of multiple systems responsible for mediating reactive oxygen stress, suggesting that the host derives direct or indirect protection from oxidative stress while in symbiosis. Aposymbiotic anemones also increased their expression of an array of proteases and chitinases, indicating a metabolic shift from autotrophy to heterotrophy. These results provide a comprehensive Aiptasia proteome with more direct relative quantification of protein abundance than transcriptomic methods. The extension of "omics" techniques to this model system will allow more powerful studies of coral physiology, ecosystem function, and the effects of biotic and abiotic stress on the coral-dinoflagellate mutualism. PMID:26716757

  1. Cell Biology of Cnidarian-Dinoflagellate Symbiosis

    OpenAIRE

    Davy, Simon K; Allemand, Denis; Weis, Virginia M.

    2012-01-01

    Summary: The symbiosis between cnidarians (e.g., corals or sea anemones) and intracellular dinoflagellate algae of the genus Symbiodinium is of immense ecological importance. In particular, this symbiosis promotes the growth and survival of reef corals in nutrient-poor tropical waters; indeed, coral reefs could not exist without this symbiosis. However, our fundamental understanding of the cnidarian-dinoflagellate symbiosis and of its links to coral calcification remains poor. Here we review ...

  2. Saponin 1 Induces Apoptosis and Suppresses NF-κB-Mediated Survival Signaling in Glioblastoma Multiforme (GBM)

    OpenAIRE

    Li, Juan; Tang, Haifeng; Zhang, Yun; Tang, Chi; Li, Bo; Wang, Yuangang; Gao, Zhenhui; Luo, Peng; Yin, Anan; Wang, Xiaoyang; Cheng, Guang; Fei, Zhou

    2013-01-01

    Saponin 1 is a triterpeniod saponin extracted from Anemone taipaiensis, a traditional Chinese medicine against rheumatism and phlebitis. It has also been shown to exhibit significant anti-tumor activity against human leukemia (HL-60 cells) and human hepatocellular carcinoma (Hep-G2 cells). Herein we investigated the effect of saponin 1 in human glioblastoma multiforme (GBM) U251MG and U87MG cells. Saponin 1 induced significant growth inhibition in both glioblastoma cell lines, with a 50% inhi...

  3. Environ: E00378 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available monin [CPD:C16913] Pulsatilla chinensis, Pulsatilla dahurica, Pulsatilla koreana [TAX:387930], Pulsatilla [T...931], Artemisia [TAX:4219], Gerbera piloselloides [TAX:496626], Saussurea radiata, Saussurea...e (buttercup family) Anemone, Asteraceae (daisy family) Inula cappa, Artemisia, Gerbera piloselloides, Saussurea...4], Potentilla chinensis [TAX:210858], Potentilla discolor [TAX:648872], Polycarpaea cor...ymbosa, Polycarpaea [TAX:431020] Ranunculaceae (buttercup family) Pulsatilla root Homonym: Ranunculacea

  4. The Kunitz-Type Protein ShPI-1 Inhibits Serine Proteases and Voltage-Gated Potassium Channels

    Science.gov (United States)

    García-Fernández, Rossana; Peigneur, Steve; Pons, Tirso; Alvarez, Carlos; González, Lidice; Chávez, María A.; Tytgat, Jan

    2016-01-01

    The bovine pancreatic trypsin inhibitor (BPTI)-Kunitz-type protein ShPI-1 (UniProt: P31713) is the major protease inhibitor from the sea anemone Stichodactyla helianthus. This molecule is used in biotechnology and has biomedical potential related to its anti-parasitic effect. A pseudo wild-type variant, rShPI-1A, with additional residues at the N- and C-terminal, has a similar three-dimensional structure and comparable trypsin inhibition strength. Further insights into the structure-function relationship of rShPI-1A are required in order to obtain a better understanding of the mechanism of action of this sea anemone peptide. Using enzyme kinetics, we now investigated its activity against other serine proteases. Considering previous reports of bifunctional Kunitz-type proteins from anemones, we also studied the effect of rShPI-1A on voltage-gated potassium (Kv) channels. rShPI-1A binds Kv1.1, Kv1.2, and Kv1.6 channels with IC50 values in the nM range. Hence, ShPI-1 is the first member of the sea anemone type 2 potassium channel toxins family with tight-binding potency against several proteases and different Kv1 channels. In depth sequence analysis and structural comparison of ShPI-1 with similar protease inhibitors and Kv channel toxins showed apparent non-sequence conservation for known key residues. However, we detected two subtle patterns of coordinated amino acid substitutions flanking the conserved cysteine residues at the N- and C-terminal ends. PMID:27089366

  5. Mechanisms of equinatoxin II-induced transport through the membrane of a giant phospholipid vesicle.

    OpenAIRE

    Mally, M; Majhenc, J; Svetina, S; Zeks, B.

    2002-01-01

    Protein equinatoxin II from sea anemone Actinia equina L. was used to form pores in phospholipid membranes. We studied the effect of these pores on the net transmembrane transport of sucrose and glucose by observing single giant (cell-size) vesicles under the phase contrast microscope. Sugar composition in the vesicle was determined by measuring the width of the halo, which appears around the vesicle in the phase contrast image. The transport of sugars was induced when a vesicle, filled with ...

  6. The multigene families of actinoporins (part II): Strategies for heterologous production in Escherichia coli.

    Science.gov (United States)

    Valle, A; Hervis, Y P; Socas, L B P; Canet, L; Faheem, M; Barbosa, J A R G; Lanio, M E; Pazos, I F

    2016-08-01

    The sea anemone venom contains pore-forming proteins (PFP) named actinoporins, due to their purification from organisms belonging to Actiniaria order and its ability to form pores in sphingomyelin-containing membranes. Actinoporins are generally basic, monomeric and single-domain small proteins (∼20 kDa) that are classified as α-type PFP since the pore formation in membranes occur through α-helical elements. Different actinoporin isoforms have been isolated from most of the anemones species, as was analyzed in the first part of this review. Several actinoporin full-length genes have been identified from genomic-DNA libraries or messenger RNA. Since the actinoporins lack carbohydrates and disulfide bridges, their expression in bacterial systems is suitable. The actinoporins heterologous expression in Escherichia coli simplifies their production, replaces the natural source reducing the ecological damage in anemone populations, and allows the production of site-specific mutants for the study of the structure-function relationship. In this second part of the review, the strategies for heterologous production of actinoporins in Escherichia coli are analyzed, as well as the different approaches used for their purification. The activity of the recombinant proteins with respect to the wild-type is also reviewed. PMID:27080349

  7. AcEST: BP917860 [AcEST

    Lifescience Database Archive (English)

    Full Text Available MVE Predicted protein OS=Nematostella vectens... 206 4e-52 tr|Q59FM2|Q59FM2_HUMAN PWP2 periodic...7ZUV4|Q7ZUV4_DANRE PWP2 periodic tryptophan protein homolog ... 213 3e-54 tr|Q4FZ...2M1K2|Q2M1K2_MOUSE PWP2 periodic tryptophan protein homolog ... 206 5e-52 tr|B6MI...of the U3 pr... 225 1e-57 tr|Q6PLP8|Q6PLP8_CHLRE Putative uncharacterized protein (Fragmen... 223 5e-57 tr|Q...r to Homo sa... 206 4e-52 tr|Q8R538|Q8R538_MOUSE WD-repeat protein p103 OS=Mus musculus GN... 206 5e-52 tr|Q

  8. AcEST: DK950895 [AcEST

    Lifescience Database Archive (English)

    Full Text Available |A7SFA3|A7SFA3_NEMVE Predicted protein OS=Nematostella vectens... 210 5e-53 tr|Q0CVA9|Q0CVA9_ASPTN ATP-citrate synthase subunit...stX Result : Swiss-Prot sp_hit_id Q54YA0 Definition sp|Q54YA0|ACLY_DICDI Probable ATP-citrate synthase OS=Dictyos...PIDYSWAQELGLIRKPAAFISTI 404 >sp|Q8X097|ACL1_NEUCR Probable ATP-citrate synthase subunit 1 OS=Neurospora cras...IRKPASFMTSI 844 >sp|Q9P7W3|ACL1_SCHPO Probable ATP-citrate synthase subunit 1 OS=Schizosaccharomyces pombe G....done Score E Sequences producing significant alignments: (bits) Value sp|Q54YA0|ACLY_DICDI Probable ATP-citrate synthase OS=Dictyos

  9. New tricks with old genes: the genetic bases of novel cnidarian traits.

    Science.gov (United States)

    Forêt, Sylvain; Knack, Brent; Houliston, Evelyn; Momose, Tsuyoshi; Manuel, Michael; Quéinnec, Eric; Hayward, David C; Ball, Eldon E; Miller, David J

    2010-04-01

    Recent thought on genome evolution has focused on the creation of new genes and changes in regulatory mechanisms while ignoring the role of selective gene loss in shaping genomes. Using data from two cnidarians, the jellyfish Clytia and the coral Acropora, we examined the relative significance of new 'taxonomically restricted' genes and selectively retained ancestral genes in enabling the evolution of novel traits. Consistent with its more complex life-cycle, the proportion of novel genes identified in Clytia was higher than that in the 'polyp only' cnidarians Nematostella and Hydra, but each of these cnidarians has retained a proportion of ancestral genes not present in the other two. The ubiquity and near-stochastic nature of gene loss can explain the discord between patterns of gene distribution and taxonomy. PMID:20129693

  10. Partitioning of Respiration in an Animal-Algal Symbiosis: Implications for Different Aerobic Capacity Between Symbiodinium spp.

    Directory of Open Access Journals (Sweden)

    Thomas David Hawkins

    2016-04-01

    Full Text Available Cnidarian-dinoflagellate symbioses are ecologically important and the subject of much investigation. However, our understanding of critical aspects of symbiosis physiology, such as the partitioning of total respiration between the host and symbiont, remains incomplete. Specifically, we know little about how the relationship between host and symbiont respiration varies between different holobionts (host-symbiont combinations. We applied molecular and biochemical techniques to investigate aerobic respiratory capacity in naturally symbiotic Exaiptasia pallida sea anemones, alongside animals infected with either homologous ITS2-type A4 Symbiodinium or a heterologous isolate of Symbiodinium minutum (ITS2-type B1. In naturally symbiotic anemones, host, symbiont, and total holobiont mitochondrial citrate synthase (CS enzyme activity, but not host mitochondrial copy number, were reliable predictors of holobiont respiration. There was a positive association between symbiont density and host CS specific activity (mg protein-1, and a negative correlation between host- and symbiont CS specific activities. Notably, partitioning of total CS activity between host and symbiont in this natural E. pallida population was significantly different to the host/symbiont biomass ratio. In re-infected anemones, we found significant between-holobiont differences in the CS specific activity of the algal symbionts. Furthermore, the relationship between the partitioning of total CS activity and the host/symbiont biomass ratio differed between holobionts. These data have broad implications for our understanding of cnidarian-algal symbiosis. Specifically, the long-held assumption of equivalency between symbiont/host biomass and respiration ratios can result in significant overestimation of symbiont respiration and potentially erroneous conclusions regarding the percentage of carbon translocated to the host. The interspecific variability in symbiont aerobic capacity provides

  11. The Alkaloid Ageladine A, Originally Isolated from Marine Sponges, Used for pH-Sensitive Imaging of Transparent Marine Animals

    OpenAIRE

    Ulf Bickmeyer

    2012-01-01

    The brominated pyrrole-imidazole Ageladine A was used for live imaging of the jellyfish (jellies) Nausithoe werneri, the sea anemone Metridium senile and the flatworm Macrostomum lignano. The fluorescence properties of Ageladine A allow for estimation of pH values in tissue and organs in living animals. The results showed that Nausithoe werneri had the most acidic areas in the tentacles and close to the mouth (pH 4–6.5), Metridium senile harbours aggregates of high acidity in the tentacles (p...

  12. Neurones and neuropeptides in coelenterates

    DEFF Research Database (Denmark)

    Grimmelikhuijzen, C J; Ebbesen, Ditte Graff; McFarlane, I D

    1989-01-01

    The first nervous system probably evolved in coelenterates. Many neurons in coelenterates have morphological characteristics of both sensory and motor neurones, and appear to be multifunctional. Using immunocytochemistry with antisera to the sequence Arg-Phe-NH2 (RFamide), RFamide-like peptides......) was isolated, which also belongs to the less than Glu...Arg-X-NH2 family. Using specific antisera it was shown that all four peptides were located in neurones. Application of low doses of Antho-RFamide, or Antho-RWamide I or II induced contractions of endodermal muscles of sea anemones. This indicates...

  13. DOĞU AKDENİZ BÖLGESİNDE YETİŞEN BAZI OTSU VE ODUNSU MAKİ BİTKİLERİNİN TOPRAK ÖZELLİKLERİNİN KARŞILAŞTIRILMASI

    OpenAIRE

    Kızıldağ, Nacide; Özer, Gülistan; Cenkseven, Şahin; Kutlay, Ahu; KOÇAK, Burak; Aka Sağlıker, Hüsniye; Darıcı, Cengiz

    2012-01-01

    Bu çalışmada Akdeniz Bölgesi’ne özgü üç farklı otsu (Anemone coronaria, Asphodelus aestivus, Cyclamen sp.), çalı (Calycotome villosa, Cistus creticus, Osyris alba) ve odunlu bitki yaprağının (Cupressus sempervirens, Olea europaea ve Pinus brutia) C, N ve P içerikleri (%) ile topraklarının bazı fiziksel ve kimyasal özellikleri ve bu toprakların 30 günlük karbon mineralizasyonu belirlenerek aynı ekosistem içindeki farkl...

  14. Caryological notes in some portuguese Ranunculaceae

    OpenAIRE

    Queirós, Margarida

    1990-01-01

    Chromosome numbers of fourteen portuguese laxa of Ranunculaceae are reported: Helleborus foetidus 20 = 32; Nigella damascena 2n = 12; N. gallica 2n = 12; Delphinium Pentagynum 2n = 16; D. Halteratum subsp. verdunense 2n = 16; Anemone palmeta 2n = 32; Clematis campaniflora 2n = 16; Ranunculus muricatus 2n =...

  15. The transcriptomic response of the coral Acropora digitifera to a competent Symbiodinium strain: the symbiosome as an arrested early phagosome.

    Science.gov (United States)

    Mohamed, A R; Cumbo, V; Harii, S; Shinzato, C; Chan, C X; Ragan, M A; Bourne, D G; Willis, B L; Ball, E E; Satoh, N; Miller, D J

    2016-07-01

    Despite the ecological significance of the relationship between reef-building corals and intracellular photosynthetic dinoflagellates of the genus Symbiodinium, very little is known about the molecular mechanisms involved in its establishment. Indeed, microarray-based analyses point to the conclusion that host gene expression is largely or completely unresponsive during the establishment of symbiosis with a competent strain of Symbiodinium. In this study, the use of Illumina RNA-Seq technology allowed detection of a transient period of differential expression involving a small number of genes (1073 transcripts; corals and symbiotic sea anemones with their endosymbionts. PMID:27094992

  16. Do juvenile Amphiprion ocellaris (Pisces

    DEFF Research Database (Denmark)

    Brolund, Thea Marie; Nielsen, Lis Engdahl; Arvedlund, Michael

    2003-01-01

    results indicate that juvenile A. ocellaris recognize conspecifics visually rather than by olfaction. This is contrary to their finding mechanism of their host anemone. However, the results also indicate that the juvenile A ocellaris are neither attracted nor deterred by the presence of conspecifics. This...... is contrary to the settling mechanisms of the damselfish D. aruanus and D. reticulatus, and of the temperate herring Clupea harengus. Hence the results emphasize the variation of sensory abilities and behaviours in fish larvae and juveniles. It is not an area prone for generalizations....

  17. Long-term phyto-, ornitho- and ichthyophenological time-series analyses in Estonia

    Science.gov (United States)

    Ahas, Rein

    This study analyzes a long-term phenological time series for the impact assessment of climate changes on Estonian nature and for the methodological study of the possible limitations of using phenological time series for climate trend analyses. These limiting factors can influence the results of studies more than the real impact of climate changes, which may have a much smaller numeric value. The 132-year series of the arrival of the skylark (Alauda arvensis) and the white wagtail (Motacilla alba), the 78-year series of the blossoming of the wood anemone (Anemone nemorosa), the bird cherry (Padus racemosa), apple trees (Malus domestica) and lilacs (Syringa vulgaris), and the 44-year series of the spawning of pike (Esox lucius) and bream (Abramis brama) were studied at three selected observation points in Estonia. The study of the phenological time series shows that Estonian springs have, on the basis of the database, advanced 8 days on average over the last 80-year period; the last 40-year period has warmed even faster.

  18. Ascertaining the potential effects of temperature on growth, survival and feeding of different juvenile clown ifsh

    Institute of Scientific and Technical Information of China (English)

    Vishwas Rao Methari; Mohideen Abdul Badhul Haq; Chinna Raja; Sheik Mohamed

    2015-01-01

    Objective:To determine the physiological and ecological responses of marine ornamental fishes to the change of water temperature with its potential effects on the growth, survival and feeding in clown fish. Methods: Three different sea anemone fish (Premnas biaculeatus, Amphiprion clarkii, Amphiprion akallopisos) were reared in confinement at water temperatures of 26, 28, 30, 32, and 34 oC using thermostat and they were maintained up to the marketable size, and growth, survival and feeding were evaluated during the experimental period. Results: The results illustrated that water temperature influenced the physiological performance of juveniles of three different sea anemone fish significantly. The growth and survival rates of juveniles of three different clown fish significantly increased with the increase of water temperature from 26 oC to 34 oC (P Conclusions:This study deliberately reveals that the physiological response of juveniles of clown fish as the change of water temperature and substantiated that water temperature influenced juvenile growth, survival and feeding significantly. This study also put forward that the reduced growth, survival and feeding of juveniles at lower temperature which have ecological impacts on clown fish juveniles in settlement and population replacement in the wild.

  19. Trimethylamine oxide, betaine and other osmolytes in deep-sea animals: depth trends and effects on enzymes under hydrostatic pressure.

    Science.gov (United States)

    Yancey, P H; Rhea, M D; Kemp, K M; Bailey, D M

    2004-06-01

    Most shallow teleosts have low organic osmolyte contents, e.g. 70 mmol/kg or less of trimethylamine oxide (TMAO). Our previous work showed that TMAO contents increase with depth in muscles of several Pacific families of teleost fishes, to about 180 mmol/kg wet wt at 2.9 km depth in grenadiers. We now report that abyssal grenadiers (Coryphaenoides armatus, Macrouridae) from the Atlantic at 4.8 km depth contain 261 mmol/kg wet wt in muscle tissue. This precisely fits a linear trend extrapolated from the earlier data. We also found that anemones show a trend of increasing contents of methylamines (TMAO, betaine) and scyllo-inositol with increasing depth. Previously we found that TMAO counteracts the inhibitory effects of hydrostatic pressure on a variety of proteins. We now report that TMAO and, to a lesser extent, betaine, are generally better stabilizers than other common osmolytes (myo-inositol, taurine and glycine), in terms of counteracting the effects of pressure on NADH Km of grenadier lactate dehydrogenase and ADP Km of anemone and rabbit pyruvate kinase. PMID:15529747

  20. Protease Inhibitors from Marine Venomous Animals and Their Counterparts in Terrestrial Venomous Animals

    Directory of Open Access Journals (Sweden)

    Caroline B. F. Mourão

    2013-06-01

    Full Text Available The Kunitz-type protease inhibitors are the best-characterized family of serine protease inhibitors, probably due to their abundance in several organisms. These inhibitors consist of a chain of ~60 amino acid residues stabilized by three disulfide bridges, and was first observed in the bovine pancreatic trypsin inhibitor (BPTI-like protease inhibitors, which strongly inhibit trypsin and chymotrypsin. In this review we present the protease inhibitors (PIs described to date from marine venomous animals, such as from sea anemone extracts and Conus venom, as well as their counterparts in terrestrial venomous animals, such as snakes, scorpions, spiders, Anurans, and Hymenopterans. More emphasis was given to the Kunitz-type inhibitors, once they are found in all these organisms. Their biological sources, specificity against different proteases, and other molecular blanks (being also K+ channel blockers are presented, followed by their molecular diversity. Whereas sea anemone, snakes and other venomous animals present mainly Kunitz-type inhibitors, PIs from Anurans present the major variety in structure length and number of Cys residues, with at least six distinguishable classes. A representative alignment of PIs from these venomous animals shows that, despite eventual differences in Cys assignment, the key-residues for the protease inhibitory activity in all of them occupy similar positions in primary sequence. The key-residues for the K+ channel blocking activity was also compared.

  1. Lesions of Copper Toxicosis in Captive Marine Invertebrates With Comparisons to Normal Histology.

    Science.gov (United States)

    LaDouceur, E E B; Wynne, J; Garner, M M; Nyaoke, A; Keel, M K

    2016-05-01

    Despite increasing concern for coral reef ecosystem health within the last decade, there is scant literature concerning the histopathology of diseases affecting the major constituents of coral reef ecosystems, particularly marine invertebrates. This study describes histologic findings in 6 species of marine invertebrates (California sea hare [Aplysia californica], purple sea urchin [Strongylocentrotus purpuratus], sunburst anemone [Anthopleura sola], knobby star [Pisaster giganteus], bat star [Asterina miniata], and brittle star [Ophiopteris papillosa]) with spontaneous copper toxicosis, 4 purple sea urchins with experimentally induced copper toxicosis, and 1 unexposed control of each species listed. The primary lesions in the California sea hare with copper toxicosis were branchial and nephridial necrosis. Affected echinoderms shared several histologic lesions, including epidermal necrosis and ulceration and increased numbers of coelomocytes within the water-vascular system. The sunburst anemone with copper toxicosis had necrosis of both epidermis and gastrodermis, as well as expulsion of zooxanthellae from the gastrodermis. In addition to the lesions attributed to copper toxicosis, our results describe normal microscopic features of these animals that may be useful for histopathologic assessment of marine invertebrates. PMID:26459519

  2. Nucleosides from Anthopleura stell%绿海葵中的核苷类成分

    Institute of Scientific and Technical Information of China (English)

    禚如朋; 付宏征; 张礼和; 林文翰

    2001-01-01

    目的 为了寻找抗肿瘤的活性成分。方法 利用溶剂法和色谱法对绿海葵进行了研究。结果 分离得到5 个核苷,经波谱学解析鉴定为2-羟基嘌呤核苷(Ⅰ),脱氧肌苷(Ⅱ),1-甲基黄嘌呤核苷(Ⅲ),脱氧鸟苷(Ⅳ),脱氧核糖胸腺嘧啶(Ⅴ)。结论 Ⅲ为一新天然产物,其余均为海洋生物中首次发现。%To study the chemical constituents of sea anemone, Anthopleura stell Verrill.Methods The chemical constituents were isolated and purified by chromatographic methods and their structures elucidated by chemical evidences and spectra data.Results 5 nucleosides were obtained and identified from the ethanolic extract as 2-hydroxy purine (Ⅰ); deoxyinosine (Ⅱ); 1-methylxanthosine (Ⅲ); deoxyguanosine (Ⅳ), and deoxyribo-thymidine (Ⅴ).Conclusion Compound Ⅲ was a new natural product, while the others were found from sea anemone for the first time.

  3. Elucidating the evolutionary relationships of the Aiptasiidae, a widespread cnidarian-dinoflagellate model system (Cnidaria: Anthozoa: Actiniaria: Metridioidea).

    Science.gov (United States)

    Grajales, Alejandro; Rodríguez, Estefanía

    2016-01-01

    Sea anemones of the family Aiptasiidae sensu Grajales and Rodríguez (2014) are conspicuous members of shallow-water environments, including several species widely used as model systems for the study of cnidarian-dinoflagellate symbiosis and coral bleaching. Although previously published phylogenetic studies of sea anemones recovered Aiptasiidae as polyphyletic, they only included a sparse sample in terms of its taxonomic diversity and membership of the family had not been yet revised. This study explores the phylogenetic relationships of this family using five molecular markers and including newly collected material from the geographical distribution of most of the currently described genera and species. We find a monophyletic family Aiptasiidae. All the currently proposed genera were recovered as monophyletic units, a finding also supported by diagnostic morphological characters. Our results confirm Bellactis and Laviactis as members of Aiptasiidae, also in agreement with previous morphological studies. The monophyly of the group is congruent with the morphological homogeneity of the members of this family. The obtained results also allow discussing the evolution of morphological characters within the family. Furthermore, we find evidence for and describe a new cryptic species, Exaiptasia brasiliensis sp. nov., based on molecular data, geographical distribution, and the identity of its endosymbiotic dinoflagellate. PMID:26375331

  4. AcEST: DK955339 [AcEST

    Lifescience Database Archive (English)

    Full Text Available Q9R1J8 Definition sp|Q9R1J8|P3H1_RAT Prolyl 3-hydroxylase 1 OS=Rattus norvegicus Align length 39 Score (bit) 33.5 E-value 0.76 Repor...se NCED3, c... 32 2.2 sp|Q89A36|PTM3C_BUCBP PTS system mannitol-specific EIICBA compon... 32 2.9 sp|Q0BGI1|PPK_BURCM Polyphosphate...383 PLSVSPRKRDSNSR 424 + V P+ ++SN++ Sbjct: 71 AIVVKPKAKESNTK 84 >sp|Q89A36|PTM3C_BUCBP PTS system mannitol-specific EIICBA compo...in OS=Phaeosphaeria nodorum Align length 80 Score (bit) 35.4 E-value 2.2 Report BLASTX 2.2.19 [Nov-02-2008] Refere...in OS=Ixode... 33 8.5 tr|A7SXL9|A7SXL9_NEMVE Predicted protein OS=Nematostella vectens... 33

  5. The evolutionary origin of the Runx/CBFbeta transcription factors – Studies of the most basal metazoans

    Directory of Open Access Journals (Sweden)

    Groner Yoram

    2008-08-01

    Full Text Available Abstract Background Members of the Runx family of transcriptional regulators, which bind DNA as heterodimers with CBFβ, are known to play critical roles in embryonic development in many triploblastic animals such as mammals and insects. They are known to regulate basic developmental processes such as cell fate determination and cellular potency in multiple stem-cell types, including the sensory nerve cell progenitors of ganglia in mammals. Results In this study, we detect and characterize the hitherto unexplored Runx/CBFβ genes of cnidarians and sponges, two basal animal lineages that are well known for their extensive regenerative capacity. Comparative structural modeling indicates that the Runx-CBFβ-DNA complex from most cnidarians and sponges is highly similar to that found in humans, with changes in the residues involved in Runx-CBFβ dimerization in either of the proteins mirrored by compensatory changes in the binding partner. In situ hybridization studies reveal that Nematostella Runx and CBFβ are expressed predominantly in small isolated foci at the base of the ectoderm of the tentacles in adult animals, possibly representing neurons or their progenitors. Conclusion These results reveal that Runx and CBFβ likely functioned together to regulate transcription in the common ancestor of all metazoans, and the structure of the Runx-CBFβ-DNA complex has remained extremely conserved since the human-sponge divergence. The expression data suggest a hypothesis that these genes may have played a role in nerve cell differentiation or maintenance in the common ancestor of cnidarians and bilaterians.

  6. AcEST: BP917188 [AcEST

    Lifescience Database Archive (English)

    Full Text Available RLLFTKLDESESYGCIVNAQVRN 415 >tr|B8KW59|B8KW59_9GAMM Iron-sulfur cluster binding protein, putative OS=gamma proteobacte...id... 30 6.7 sp|A1S7L7|FADI_SHEAM 3-ketoacyl-CoA thiolase OS=Shewanella amazo... 30 6.7 sp|Q92JD4|Y133_RICCN Uncharacterized prote... Hemicentin 2 OS=Mus musculus GN=Hmcn2 PE=... 34 3.8 tr|A3ZSD0|A3ZSD0_9PLAN Putative uncharacterized protein OS=Bla...A0B2Y2_BURCH Transcriptional regulator, DeoR family OS... 33 8.3 tr|A7T3H3|A7T3H3_NEMVE Predicted protein OS=Nematostella vecte...CSNAAGTSSQEQS 2283 >tr|A3ZSD0|A3ZSD0_9PLAN Putative uncharacterized protein OS=Blastopirellula marina DSM 36

  7. AcEST: BP918302 [AcEST

    Lifescience Database Archive (English)

    Full Text Available ive fructosamine-3-kinase-related pr... 45 0.002 tr|A9S043|A9S043_PHYPA Predicted protein OS=Physcomitr...Q1ZQA9|Q1ZQA9_9VIBR Putative uncharacterized protein OS=Vibri... 41 0.026 tr|A4BMW0|A4BMW0_9GAMM Fructosamine kinase OS=Nitr...idylserine decarboxylase OS=Vibri... 41 0.034 tr|A4CI58|A4CI58_9FLAO Fructosamine kinase OS=Robiginitalea bifo... 41 0.034 tr...eococcus ta... 47 5e-04 tr|A7S4K9|A7S4K9_NEMVE Predicted protein OS=Nematostella vectens... 45 0.001 tr|B5FXV6|B5FXV6_TAEGU Putat...|A1WZD1|A1WZD1_HALHL Fructosamine kinase OS=Halorhodospira hal... 44 0.005 tr|Q5R7D2|Q5R7D2_PONAB Putative unchara

  8. Comparing chemolithoautotrophic subseafloor communities across geochemical gradients using meta-omics and RNA-SIP

    Science.gov (United States)

    Fortunato, C. S.; Huber, J. A.

    2015-12-01

    The chemolithoautotrophic microbial community of the rocky subseafloor potentially provides a large amount of organic carbon to the deep ocean, yet our understanding of the activity and metabolic complexity of subseafloor organisms remains poorly described. Past studies have shown that the taxonomic structure of subseafloor communities differs based on the geochemical signatures of individual vents. In this study, we expanded beyond phylogeny and used a combination of metagenomic, metatranscriptomic, and RNA-based stable isotope probing (RNA-SIP) analyses to identify the metabolic potential, expression patterns, and the active autotrophic players and genomic pathways present in venting fluids from Axial Seamount, an active submarine volcano off the coast of Oregon, USA. Low-temperature diffuse vent fluids from three hydrothermal vents, Marker 113, Marker 33, and Anemone, were filtered and preserved on the seafloor for metagenome and metatranscriptome analyses. Fluid for RNA-SIP was also collected and incubated shipboard with 13C-labeled sodium bicarbonate at 30ºC, 55ºC, and 80ºC for each vent. Taxonomically, Epsilonproteobacteria comprised a significant proportion of the community at all three vents, but each vent also had distinct groups that were abundant including SUP05 at Anemone and Methanococcus at Marker 113. Functionally, vents shared many metabolic processes including genes for denitrification, sulfur reduction and sulfur, hydrogen, and ammonium oxidation, which were present and expressed in similar abundance across all three vents. One metabolic difference between vents was the presence and expression of genes for methanogenesis, which were highly abundant and expressed at Marker 113, in lower abundance and expression at Marker 33, and not present at Anemone. RNA-SIP analysis is ongoing but initial results from Marker 113 revealed that at mesophilic, thermophilic, or hyperthemophilic temperatures, different genera and autotrophic metabolisms dominated

  9. Morphological changes of V-79 cells after equinatoxin II treatment.

    Science.gov (United States)

    Batista, U; Jezernik, K

    1992-02-01

    Morphological observations on the V-79-379 A cells after treatment with equinatoxin II (EqT II), isolated from the sea anemone Actina equina L., and fetal calf serum (FCS) treated toxin were examined by transmission electron microscopy. Our results showed that the cells incubated with FCS treated EqT II were almost ultrastructurally unaltered. When the cells were treated with low concentrations of EqT II alone cell ultrastructure was altered with the evidence of numerous blebs and decreased microvilli number on the cell surface and appearance of numerous vesicles in the Golgi regions. High concentrations of EqT II caused disintegration of plasmalemma and intracellular membranes as well as degradation of cytosol. PMID:1348018

  10. Autocrine-Based Selection of Drugs That Target Ion Channels from Combinatorial Venom Peptide Libraries.

    Science.gov (United States)

    Zhang, Hongkai; Du, Mingjuan; Xie, Jia; Liu, Xiao; Sun, Jingying; Wang, Wei; Xin, Xiu; Possani, Lourival D; Yea, Kyungmoo; Lerner, Richard A

    2016-08-01

    Animal venoms represent a rich source of pharmacologically active peptides that interact with ion channels. However, a challenge to discovering drugs remains because of the slow pace at which venom peptides are discovered and refined. An efficient autocrine-based high-throughput selection system was developed to discover and refine venom peptides that target ion channels. The utility of this system was demonstrated by the discovery of novel Kv1.3 channel blockers from a natural venom peptide library that was formatted for autocrine-based selection. We also engineered a Kv1.3 blocker peptide (ShK) derived from sea anemone to generate a subtype-selective Kv1.3 blocker with a long half-life in vivo. PMID:27197631

  11. Effect of power plant heated effluent on distribution of sedentary fauna and flora

    International Nuclear Information System (INIS)

    Sedentary fauna and floral assemblages at heated (st.3) and non-heated (st.2) areas of the discharge canal of Madras atomic power station (MAPS) were observed over an annual cycle and compared with those of the intake area (st.1). Barnacles (30-57%) followed by hydroids, ascidians, gree mussels, tube worms (8-12%) brown mussels (5-10%), and sea anemones (10-14%) were conspicuous in the intake area. Macroalgae (15-59%) followed by barnacle (12-34%), tube worm (8-21%) and brown mussel (10-15%) were the components at st.2 whereas st.3 was bare except for bluegreen algal mats (100%) with few periwinkles. (author). 23 refs., 2 figs., 2 tabs

  12. Molecular cloning of a preprohormone from Hydra magnipapillata containing multiple copies of Hydra-L Wamide (Leu-Trp-NH2) neuropeptides: evidence for processing at Ser and Asn residues

    DEFF Research Database (Denmark)

    Leviev, I; Williamson, M; Grimmelikhuijzen, C J

    1997-01-01

    The simple, freshwater polyp Hydra is often used as a model to study development in cnidarians. Recently, a neuropeptide, < Glu-Gln-Pro-Gly-Leu-Trp-NH2, has been isolated from sea anemones that induces metamorphosis in a hydroid planula larva to become a polyp. Here, we have cloned a preprohormone...... from Hydra magnipapillata containing 11 (eight different) immature neuropeptide sequences that are structurally related to the metamorphosis-inducing neuropeptide from sea anermones. During the final phase of our cloning experiments, another research team independently isolated and sequenced five of...... processing sites. Thus, the structure of the Hydra preprohormone confirms our earlier findings that cnidarian preprohormones contain unusual or novel processing sites. Nearly all neuropeptide copies located on the Hydra preprohormone will give rise to mature neuropeptides with a C-terminal Gly-Leu-Trp-NH2...

  13. First molecular identification of the transgene red fluorescent protein (RFP in transgenic ornamental zebrafish (Danio rerio introduced in Peru

    Directory of Open Access Journals (Sweden)

    Carlos Scotto

    2013-09-01

    Full Text Available In this paper the transgenic fluorescent red, orange and pink zebra fish (Danio rerio, found in local aquariums in Peru, were identified using the PCR technique to amplify the transgene RFP sea anemone belonging to Discosoma spp. The gene expression of the red fluorescent protein (RFP transgene was found to determine different gradients-of-bioluminescence (shades in color in each GMO fish analyzed. We performed sequence analysis of the two variants of the RFP along with six variants of the existing fluorescent protein GFP from the Genbank, this could help identify quickly if they are new genes or variants thereof as these novel fluorescent proteins may be introduced in aquatic GMO in the future. Thus, developing and improving biosecurity measures through its timely detection at the molecular genetic level.

  14. The Alkaloid Ageladine A, Originally Isolated from Marine Sponges, Used for pH-Sensitive Imaging of Transparent Marine Animals

    Directory of Open Access Journals (Sweden)

    Ulf Bickmeyer

    2012-01-01

    Full Text Available The brominated pyrrole-imidazole Ageladine A was used for live imaging of the jellyfish (jellies Nausithoe werneri, the sea anemone Metridium senile and the flatworm Macrostomum lignano. The fluorescence properties of Ageladine A allow for estimation of pH values in tissue and organs in living animals. The results showed that Nausithoe werneri had the most acidic areas in the tentacles and close to the mouth (pH 4–6.5, Metridium senile harbours aggregates of high acidity in the tentacles (pH 5 and in Macrostomum lignano, the rhabdoids, the gonads and areas close to the mouth were the most acidic with values down to pH 5.

  15. The alkaloid Ageladine A, originally isolated from marine sponges, used for pH-sensitive imaging of transparent marine animals.

    Science.gov (United States)

    Bickmeyer, Ulf

    2012-01-01

    The brominated pyrrole-imidazole Ageladine A was used for live imaging of the jellyfish (jellies) Nausithoe werneri, the sea anemone Metridium senile and the flatworm Macrostomum lignano. The fluorescence properties of Ageladine A allow for estimation of pH values in tissue and organs in living animals. The results showed that Nausithoe werneri had the most acidic areas in the tentacles and close to the mouth (pH 4-6.5), Metridium senile harbours aggregates of high acidity in the tentacles (pH 5) and in Macrostomum lignano, the rhabdoids, the gonads and areas close to the mouth were the most acidic with values down to pH 5. PMID:22363232

  16. Potent Human α-Amylase Inhibition by the β-Defensin-like Protein Helianthamide

    Science.gov (United States)

    2016-01-01

    Selective inhibitors of human pancreatic α-amylase (HPA) are an effective means of controlling blood sugar levels in the management of diabetes. A high-throughput screen of marine natural product extracts led to the identification of a potent (Ki = 10 pM) peptidic HPA inhibitor, helianthamide, from the Caribbean sea anemone Stichodactyla helianthus. Active helianthamide was produced in Escherichia coli via secretion as a barnase fusion protein. X-ray crystallographic analysis of the complex of helianthamide with porcine pancreatic α-amylase revealed that helianthamide adopts a β-defensin fold and binds into and across the amylase active site, utilizing a contiguous YIYH inhibitory motif. Helianthamide represents the first of a novel class of glycosidase inhibitors and provides an unusual example of functional malleability of the β-defensin fold, which is rarely seen outside of its traditional role in antimicrobial peptides. PMID:27066537

  17. A deep sea community at the Kebrit brine pool in the Red Sea

    KAUST Repository

    Vestheim, Hege

    2015-02-26

    Approximately 25 deep sea brine pools occur along the mid axis of the Red Sea. These hypersaline, anoxic, and acidic environments have previously been reported to host diverse microbial communities. We visited the Kebrit brine pool in April 2013 and found macrofauna present just above the brine–seawater interface (~1465 m). In particular, inactive sulfur chimneys had associated epifauna of sea anemones, sabellid type polychaetes, and hydroids, and infauna consisting of capitellid polychaetes, gastropods of the genus Laeviphitus (fam. Elachisinidae), and top snails of the family Cocculinidae. The deep Red Sea generally is regarded as extremely poor in benthos. We hypothesize that the periphery along the Kebrit holds increased biomass and biodiversity that are sustained by prokaryotes associated with the brine pool or co-occurring seeps.

  18. The phylogenetic significance of fruit structures in ranunculaceae of china

    International Nuclear Information System (INIS)

    The external and internal structures of fruits from 95 taxa representing 27 Ranunculaceae genera of China were studied. The results show that Ranunculaceae could be divided into 4 groups based on the fruit types, epidermal surface, vascular bundle, mesocarp cell, and endocarp cell structures: Group 1: follicle or achene, branching or branching and anastomosing vascular bundles, mesocarp parenchyma, and endocarp with one layer of lignified cells (including Aconitum and other genera); Group 2: achene, vascular bundle branching, mesocarp lignified, endocarp with one layer of irregular and partly lignified cells (Thalictrum only); Group 3: achene, endocarp with multilayered thick-walled cells (including Adonis, Batrachium and Ranunculus); Group 4: achene, two non-branching vascular bundles, and endocarp with one layer of fibers (including Anemone, Clematis and Pulsatilla). This study show that the fruit structures of Ranunculaceae could provide morphological and anatomical evidences for molecular phylogeny. (author)

  19. 小菊品种‘钟山金桂’与亚菊属细裂亚菊F1回交后代的性状遗传表现%Genetic Presentation of BC1 Between ‘Zhongshanjingui' and ‘Zhongshanjingui' x Ajania przewalskii

    Institute of Scientific and Technical Information of China (English)

    朱文莹; 刘新春; 房伟民; 管志勇; 陈素梅; 蒋甲福; 陈发棣

    2012-01-01

    [Objective] Genetic presentation of BC1 between 'Zhongshanjingui' and 'Zhongshanjingui' ×Ajania przewalskii. Was studied in order to obtain new germplasm with higher ornamental and cold tolerance. [Method] Backcross hybridizations were made between Dendranthema morifolium variety 'Zhongshanjingui' (as female) and 'Zhongshanjingui' Xajania przewalskⅡ (as male). The backcross hybrids were obtained and their hybridity was confirmed by a combination of morphological, cytological analysis and resistance comparison. [Result] A total of 17 backcross hybrids were obtained. The hybrids differentiated obviously from their parents in many morphological characters and all hybrid lines bloomed normally. There happened three flower types, I.e. standard anemone type, mid-anemone type and non-anemone type, and most were anemone type. Some hybeids' inflorescence diameter was greater than 'Zhongshanjingui', the flower color was the same as 'Zhongshanjingui'. Compared with the male parent, the ornamental value was greatly improved. The chromosome number of 'Zhongshanjingui' and 'Zhongshanjingui' ×Ajania przewalskⅡ were 54 and 45, respectively. Their backcross hybrids chromosome number was between 41-54. In comparison of cold resistance, almost all the hybrids showed higher tolerance than 'Zhongshanjingui', which illustrated the backcross hybrids preserved the cold tolerance of Ajania przewalskii. [ Conclusion ] By using backcross between intergeneric hybrid F1 and its chrysanthemum parent, not only the intergeneric hybrid's ornamental vatue can be improved, but new germplasm of chrysanthemum also can be created.%[目的]对菊属栽培菊‘钟山金桂’与亚菊属细裂亚菊F1回交后代的性状遗传表现进行研究,获得观赏性和抗性改良的优异属间新种质.[方法]以‘钟山金桂’×细裂亚菊F1为父本,‘钟山金桂’为轮回亲本开展回交试验.对获得的回交后代进行细胞学鉴定,对BC1代的形态性状观测,对经过越冬

  20. Recombinant expression and solution structure of antimicrobial peptide aurelin from jellyfish Aurelia aurita

    International Nuclear Information System (INIS)

    Highlights: ► Aurelin was overexpressed in Escherichia coli, and its spatial structure was studied by NMR. ► Aurelin compact structure encloses helical regions cross-linked by three disulfide bonds. ► Aurelin shows structural homology to the BgK and ShK toxins of sea anemones. ► Aurelin binds to the anionic lipid vesicles, but does not interact with zwitterionic ones. ► Aurelin binds to DPC micelle surface with moderate affinity via two helical regions. -- Abstract: Aurelin is a 40-residue cationic antimicrobial peptide isolated from the mezoglea of a scyphoid jellyfish Aurelia aurita. Aurelin and its 15N-labeled analogue were overexpressed in Escherichia coli and purified. Antimicrobial activity of the recombinant peptide was examined, and its spatial structure was studied by NMR spectroscopy. Aurelin represents a compact globule, enclosing one 310-helix and two α-helical regions cross-linked by three disulfide bonds. The peptide binds to anionic lipid (POPC/DOPG, 3:1) vesicles even at physiological salt concentration, it does not interact with zwitterionic (POPC) vesicles and interacts with the DPC micelle surface with moderate affinity via two α-helical regions. Although aurelin shows structural homology to the BgK and ShK toxins of sea anemones, its surface does not possess the “functional dyad” required for the high-affinity interaction with the K+-channels. The obtained data permit to correlate the modest antibacterial properties and membrane activity of aurelin.

  1. Raddeanin A induces human gastric cancer cells apoptosis and inhibits their invasion in vitro

    International Nuclear Information System (INIS)

    Highlights: •Raddeanin A is a triterpenoid saponin in herb medicine Anemone raddeana Regel. •Raddeanin A can inhibit 3 kinds of gastric cancer cells’ proliferation and invasion. •Caspase-cascades’ activation indicates apoptosis induced by Raddeanin A. •MMPs, RECK, Rhoc and E-cad are involved in Raddeanin A-induced invasion inhibition. -- Abstract: Raddeanin A is one of the triterpenoid saponins in herbal medicine Anemone raddeana Regel which was reported to suppress the growth of liver and lung cancer cells. However, little was known about its effect on gastric cancer (GC) cells. This study aimed to investigate its inhibitory effect on three kinds of different differentiation stage GC cells (BGC-823, SGC-7901 and MKN-28) in vitro and the possible mechanisms. Proliferation assay and flow cytometry demonstrated Raddeanin A’s dose-dependent inhibitory effect and determined its induction of cells apoptosis, respectively. Transwell assay, wounding heal assay and cell matrix adhesion assay showed that Raddeanin A significantly inhibited the abilities of the invasion, migration and adhesion of the BGC-823 cells. Moreover, quantitative real time PCR and Western blot analysis found that Raddeanin A increased Bax expression while reduced Bcl-2, Bcl-xL and Survivin expressions and significantly activated caspase-3, caspase-8, caspase-9 and poly-ADP ribose polymerase (PARP). Besides, Raddeanin A could also up-regulate the expression of reversion inducing cysteine rich protein with Kazal motifs (RECK), E-cadherin (E-cad) and down-regulate the expression of matrix metalloproteinases-2 (MMP-2), MMP-9, MMP-14 and Rhoc. In conclusion, Raddeanin A inhibits proliferation of human GC cells, induces their apoptosis and inhibits the abilities of invasion, migration and adhesion, exhibiting potential to become antitumor drug

  2. Raddeanin A induces human gastric cancer cells apoptosis and inhibits their invasion in vitro

    Energy Technology Data Exchange (ETDEWEB)

    Xue, Gang [Department of Oncology, Nanjing University of Chinese Medicine, Nanjing (China); Zou, Xi [Department of Oncology, Affiliated Hospital of Nanjing University of Chinese Medicine, Jiangsu Province Hospital of Traditional Chinese Medicine, Nanjing (China); Zhou, Jin-Yong [Laboratory Center, Affiliated Hospital of Nanjing University of Chinese Medicine, Jiangsu Province Hospital of Traditional Chinese Medicine, Nanjing (China); Sun, Wei [Department of Oncology, Affiliated Hospital of Nanjing University of Chinese Medicine, Jiangsu Province Hospital of Traditional Chinese Medicine, Nanjing (China); Wu, Jian [Laboratory Center, Affiliated Hospital of Nanjing University of Chinese Medicine, Jiangsu Province Hospital of Traditional Chinese Medicine, Nanjing (China); Xu, Jia-Li [Department of Oncology, Nanjing University of Chinese Medicine, Nanjing (China); Wang, Rui-Ping, E-mail: ruipingwang61@hotmail.com [Department of Oncology, Affiliated Hospital of Nanjing University of Chinese Medicine, Jiangsu Province Hospital of Traditional Chinese Medicine, Nanjing (China)

    2013-09-20

    Highlights: •Raddeanin A is a triterpenoid saponin in herb medicine Anemone raddeana Regel. •Raddeanin A can inhibit 3 kinds of gastric cancer cells’ proliferation and invasion. •Caspase-cascades’ activation indicates apoptosis induced by Raddeanin A. •MMPs, RECK, Rhoc and E-cad are involved in Raddeanin A-induced invasion inhibition. -- Abstract: Raddeanin A is one of the triterpenoid saponins in herbal medicine Anemone raddeana Regel which was reported to suppress the growth of liver and lung cancer cells. However, little was known about its effect on gastric cancer (GC) cells. This study aimed to investigate its inhibitory effect on three kinds of different differentiation stage GC cells (BGC-823, SGC-7901 and MKN-28) in vitro and the possible mechanisms. Proliferation assay and flow cytometry demonstrated Raddeanin A’s dose-dependent inhibitory effect and determined its induction of cells apoptosis, respectively. Transwell assay, wounding heal assay and cell matrix adhesion assay showed that Raddeanin A significantly inhibited the abilities of the invasion, migration and adhesion of the BGC-823 cells. Moreover, quantitative real time PCR and Western blot analysis found that Raddeanin A increased Bax expression while reduced Bcl-2, Bcl-xL and Survivin expressions and significantly activated caspase-3, caspase-8, caspase-9 and poly-ADP ribose polymerase (PARP). Besides, Raddeanin A could also up-regulate the expression of reversion inducing cysteine rich protein with Kazal motifs (RECK), E-cadherin (E-cad) and down-regulate the expression of matrix metalloproteinases-2 (MMP-2), MMP-9, MMP-14 and Rhoc. In conclusion, Raddeanin A inhibits proliferation of human GC cells, induces their apoptosis and inhibits the abilities of invasion, migration and adhesion, exhibiting potential to become antitumor drug.

  3. A vertical wall dominated by Acesta excavata and Neopycnodonte zibrowii, part of an undersampled group of deep-sea habitats.

    Directory of Open Access Journals (Sweden)

    Mark P Johnson

    Full Text Available We describe a novel biotope at 633 to 762 m depth on a vertical wall in the Whittard Canyon, an extensive canyon system reaching from the shelf to the deep sea on Ireland's continental margin. We explored this wall with an ROV and compiled a photomosaic of the habitat. The assemblage contributing to the biotope was dominated by large limid bivalves, Acesta excavata (mean shell height 10.4 cm, and deep-sea oysters, Neopycnodonte zibrowii, at high densities, particularly at overhangs. Mean density of N. zibrowii increased with depth, with densities of the most closely packed areas of A. excavata also increasing with depth. Other taxa associated with the assemblage included the solitary coral Desmophyllum dianthus, cerianthid anemones, comatulid crinoids, the trochid gastropod Margarites sp., the portunid crab Bathynectes longispina and small fish of the family Bythitidae. The scleractinian coral Madrepora oculata, the pencil urchin Cidaris cidaris and a species of Epizoanthus were also common. Prominent but less abundant species included the flytrap anemone Actinoscyphia saginata, the carrier crab Paramola cuvieri, and the fishes Lepidion eques and Conger conger. Observations of the hydrography of the canyon system identified that the upper 500 m was dominated by Eastern North Atlantic Water, with Mediterranean Outflow Water beneath it. The permanent thermocline is found between 600 and 1000 m depth, i.e., in the depth range of the vertical wall and the dense assemblage of filter feeders. Beam attenuation indicated nepheloid layers present in the canyon system with the greatest amounts of suspended material at the ROV dive site between 500 and 750 m. A cross-canyon CTD transect indicated the presence of internal waves between these depths. We hypothesise that internal waves concentrate suspended sediment at high concentrations at the foot of the vertical wall, possibly explaining the large size and high density of filter-feeding molluscs.

  4. Transcriptome analysis of a cnidarian – dinoflagellate mutualism reveals complex modulation of host gene expression

    Directory of Open Access Journals (Sweden)

    Phillips Wendy S

    2006-02-01

    Full Text Available Abstract Background Cnidarian – dinoflagellate intracellular symbioses are one of the most important mutualisms in the marine environment. They form the trophic and structural foundation of coral reef ecosystems, and have played a key role in the evolutionary radiation and biodiversity of cnidarian species. Despite the prevalence of these symbioses, we still know very little about the molecular modulators that initiate, regulate, and maintain the interaction between these two different biological entities. In this study, we conducted a comparative host anemone transcriptome analysis using a cDNA microarray platform to identify genes involved in cnidarian – algal symbiosis. Results We detected statistically significant differences in host gene expression profiles between sea anemones (Anthopleura elegantissima in a symbiotic and non-symbiotic state. The group of genes, whose expression is altered, is diverse, suggesting that the molecular regulation of the symbiosis is governed by changes in multiple cellular processes. In the context of cnidarian – dinoflagellate symbioses, we discuss pivotal host gene expression changes involved in lipid metabolism, cell adhesion, cell proliferation, apoptosis, and oxidative stress. Conclusion Our data do not support the existence of symbiosis-specific genes involved in controlling and regulating the symbiosis. Instead, it appears that the symbiosis is maintained by altering expression of existing genes involved in vital cellular processes. Specifically, the finding of key genes involved in cell cycle progression and apoptosis have led us to hypothesize that a suppression of apoptosis, together with a deregulation of the host cell cycle, create a platform that might be necessary for symbiont and/or symbiont-containing host cell survival. This first comprehensive molecular examination of the cnidarian – dinoflagellate associations provides critical insights into the maintenance and regulation of the

  5. Adaptations to endosymbiosis in a cnidarian-dinoflagellate association: differential gene expression and specific gene duplications.

    Directory of Open Access Journals (Sweden)

    Philippe Ganot

    2011-07-01

    Full Text Available Trophic endosymbiosis between anthozoans and photosynthetic dinoflagellates forms the key foundation of reef ecosystems. Dysfunction and collapse of symbiosis lead to bleaching (symbiont expulsion, which is responsible for the severe worldwide decline of coral reefs. Molecular signals are central to the stability of this partnership and are therefore closely related to coral health. To decipher inter-partner signaling, we developed genomic resources (cDNA library and microarrays from the symbiotic sea anemone Anemonia viridis. Here we describe differential expression between symbiotic (also called zooxanthellate anemones or aposymbiotic (also called bleached A. viridis specimens, using microarray hybridizations and qPCR experiments. We mapped, for the first time, transcript abundance separately in the epidermal cell layer and the gastrodermal cells that host photosynthetic symbionts. Transcriptomic profiles showed large inter-individual variability, indicating that aposymbiosis could be induced by different pathways. We defined a restricted subset of 39 common genes that are characteristic of the symbiotic or aposymbiotic states. We demonstrated that transcription of many genes belonging to this set is specifically enhanced in the symbiotic cells (gastroderm. A model is proposed where the aposymbiotic and therefore heterotrophic state triggers vesicular trafficking, whereas the symbiotic and therefore autotrophic state favors metabolic exchanges between host and symbiont. Several genetic pathways were investigated in more detail: i a key vitamin K-dependant process involved in the dinoflagellate-cnidarian recognition; ii two cnidarian tissue-specific carbonic anhydrases involved in the carbon transfer from the environment to the intracellular symbionts; iii host collagen synthesis, mostly supported by the symbiotic tissue. Further, we identified specific gene duplications and showed that the cnidarian-specific isoform was also up-regulated both

  6. Contrasting physiological plasticity in response to environmental stress within different cnidarians and their respective symbionts

    Science.gov (United States)

    Hoadley, Kenneth D.; Pettay, Daniel. T.; Dodge, Danielle; Warner, Mark E.

    2016-06-01

    Given concerns surrounding coral bleaching and ocean acidification, there is renewed interest in characterizing the physiological differences across the multiple host-algal symbiont combinations commonly found on coral reefs. Elevated temperature and CO2 were used to compare physiological responses within the scleractinian corals Montipora hirsuta ( Symbiodinium C15) and Pocillopora damicornis ( Symbiodinium D1), as well as the corallimorph (a non-calcifying anthozoan closely related to scleractinians) Discosoma nummiforme ( Symbiodinium C3). Several physiological proxies were affected more by temperature than CO2, including photochemistry, algal number and cellular chlorophyll a. Marked differences in symbiont number, chlorophyll and volume contributed to distinctive patterns of chlorophyll absorption among these animals. In contrast, carbon fixation either did not change or increased under elevated temperature. Also, the rate of photosynthetically fixed carbon translocated to each host did not change, and the percent of carbon translocated to the host increased in the corallimorph. Comparing all data revealed a significant negative correlation between photosynthetic rate and symbiont density that corroborates previous hypotheses about carbon limitation in these symbioses. The ratio of symbiont-normalized photosynthetic rate relative to the rate of symbiont-normalized carbon translocation (P:T) was compared in these organisms as well as the anemone, Exaiptasia pallida hosting Symbiodinium minutum, and revealed a P:T close to unity ( D. nummiforme) to a range of 2.0-4.5, with the lowest carbon translocation in the sea anemone. Major differences in the thermal responses across these organisms provide further evidence of a range of acclimation potential and physiological plasticity that highlights the need for continued study of these symbioses across a larger group of host taxa.

  7. Life history and feeding biology of the deep-sea pycnogonid Nymphon hirtipes

    Science.gov (United States)

    Mercier, Annie; Baillon, Sandrine; Hamel, Jean-François

    2015-12-01

    Pycnogonids (sea spiders) are commonly collected at bathyal and abyssal depths all around the world; however, little is known about species from deep-water habitats. The present study explores the life history of Nymphon hirtipes collected in northeastern Newfoundland between 700 and 1450 m depth and monitored in mesocosms for over 2 years. The pycnogonids were found in association with octocorals, hydrozoans and sea anemones. Adult females developed mature oocytes between June and August. Paired mating followed by oviposition occurred between early July and mid-October. Up to three egg masses were brooded by each male. It took a maximum of 4 months for the propagules to hatch from the egg mass. Offspring developed from walking leg-bearing larvae to early juveniles over the next ~5 months before leaving the male's protection. Mating and oviposition coincided with the highest water temperatures of the annual cycle and dispersal of juveniles occurred in spring, when phytodetritus deposition was high and as ocean temperature rose markedly. All the females died after oviposition and the males ~9 months later, after juvenile dispersal. The sex ratio of mature individuals (~55-60 mm leg span) was 2 males for 3 females. Fecundity was estimated to be 184-288 eggs per adult female. Adults of N. hirtipes were seen feeding on hydrozoan polyps, small sea anemones (Stephanauge nexilis) and nudibranchs. Larvae and early juveniles did not feed while brooded by the male. Upon dispersal, their feeding apparatus became functional and they began feeding on hydrozoan polyps. After 13 months of growth post hatching, the juveniles reached ~21 mm leg span. Curve fitting estimated that ~7 years are required to reach the adult size of 55 mm leg span.

  8. High amino acid diversity and positive selection at a putative coral immunity gene (tachylectin-2

    Directory of Open Access Journals (Sweden)

    Hellberg Michael E

    2010-05-01

    Full Text Available Abstract Background Genes involved in immune functions, including pathogen recognition and the activation of innate defense pathways, are among the most genetically variable known, and the proteins that they encode are often characterized by high rates of amino acid substitutions, a hallmark of positive selection. The high levels of variation characteristic of immunity genes make them useful tools for conservation genetics. To date, highly variable immunity genes have yet to be found in corals, keystone organisms of the world's most diverse marine ecosystem, the coral reef. Here, we examine variation in and selection on a putative innate immunity gene from Oculina, a coral genus previously used as a model for studies of coral disease and bleaching. Results In a survey of 244 Oculina alleles, we find high nonsynonymous variation and a signature of positive selection, consistent with a putative role in immunity. Using computational protein structure prediction, we generate a structural model of the Oculina protein that closely matches the known structure of tachylectin-2 from the Japanese horseshoe crab (Tachypleus tridentatus, a protein with demonstrated function in microbial recognition and agglutination. We also demonstrate that at least three other genera of anthozoan cnidarians (Acropora, Montastrea and Nematostella possess proteins structurally similar to tachylectin-2. Conclusions Taken together, the evidence of high amino acid diversity, positive selection and structural correspondence to the horseshoe crab tachylectin-2 suggests that this protein is 1 part of Oculina's innate immunity repertoire, and 2 evolving adaptively, possibly under selective pressure from coral-associated microorganisms. Tachylectin-2 may serve as a candidate locus to screen coral populations for their capacity to respond adaptively to future environmental change.

  9. The evolution of modern corals and their early history

    Science.gov (United States)

    Stanley, George D.

    2003-02-01

    Scleractinians are a group of calcified anthozoan corals, many of which populate shallow-water tropical to subtropical reefs. Most of these corals calcify rapidly and their success on reefs is related to a symbiotic association with zooxanthellae. These one-celled algal symbionts live in the endodermal tissues of their coral host and are thought responsible for promoting rapid calcification. The evolutionary significance of this symbiosis and the implications it holds for explaining the success of corals is of paramount importance. Scleractinia stands out as one of the few orders of calcified metazoans that arose in Triassic time, long after a greater proliferation of calcified metazoan orders in the Paleozoic. The origin of this coral group, so important in reefs of today, has remained an unsolved problem in paleontology. The idea that Scleractinia evolved from older Paleozoic rugose corals that somehow survived the Permian mass extinction persists among some schools of thought. Paleozoic scleractiniamorphs also have been presented as possible ancestors. The paleontological record shows the first appearance of fossils currently classified within the order Scleractinia to be in the Middle Triassic. These earliest Scleractinia provide a picture of unexpectedly robust taxonomic diversity and high colony integration. Results from molecular biology support a polyphyletic evolution for living Scleractinia and the molecular clock, calibrated against the fossil record, suggests that two major groups of ancestors could extend back to late Paleozoic time. The idea that Scleractinia were derived from soft-bodied, "anemone-like" ancestors that survived the Permian mass extinction, has become a widely considered hypothesis. The 14-million year Mesozoic coral gap stands as a fundamental obstacle to verification of many of these ideas. However, this obstacle is not a barrier for derivation of scleractinians from anemone-like, soft-bodied ancestors. The hypothesis of the

  10. Environmental Impact of a Submarine Cable: Case Study of the Acoustic Thermometry of Ocean Climate (ATOC)/ Pioneer Seamount Cable

    Science.gov (United States)

    Kogan, I.; Paull, C. K.; Kuhnz, L.; von Thun, S.; Burton, E.; Greene, H. G.; Barry, J. P.

    2003-12-01

    substrates on the continental shelf whereas much of the cable remains exposed in sediments at deeper depths. The cable is exposed in rocky environments of the nearshore region and on all of Pioneer Seamount. The main biological features associated with the cable were organisms utilizing the cable as substrate and occasionally as shelter. Considerable care was taken to count megafauna in video transects and macrofauna from the top 5 cm of push cores. Few differences were found between cable and control sites at the 95% confidence level. Anemones Metridium farcimen and Stomphia sp. colonized the cable and were more abundant in cable transects at most soft sediment sites. Coarse extrapolation of the transect data suggest that more than 5,000 M. farcimen may live on the continental shelf portion of the cable. Several other species of anemones living on the cable are common along deeper sections of the cable route. Where the cable was buried, the presence of linear rows of sea anemones proved to be a reliable indicator of the cable's position. Flatfish and rockfish apparently congregate near the cable and were as much as 1 order of magnitude more abundant near the cable at some sites.

  11. Caryological notes in some portuguese Ranunculaceae

    Directory of Open Access Journals (Sweden)

    Queirós, Margarida

    1990-05-01

    Full Text Available Chromosome numbers of fourteen portuguese laxa of Ranunculaceae are reported: Helleborus foetidus 20 = 32; Nigella damascena 2n = 12; N. gallica 2n = 12; Delphinium Pentagynum 2n = 16; D. Halteratum subsp. verdunense 2n = 16; Anemone palmeta 2n = 32; Clematis campaniflora 2n = 16; Ranunculus muricatus 2n = 48; R. repens 2n = 32; R. bulbosus subsp. aleae var. adscendens 2n =16; R. sceleratus 2n = 32; R. paludosus 2n = 32; R. nigrescens 2n = 16; Aquilegia vulgaris subsp. dichroa 2n = 14. The chromosome numbers are in accordance with previous results.

    Se estudia el número cromosómico de algunos táxones de Ranunculaceae portugueses: Helleborus foetidus 2n = 32; Nigella damascena 2n = 12; N. gallica 2n = 12; Delphinium Pentagynum 2n = 16; D. Halteratum subsp. verdunense 2n = 16; Anemone palmeta 2n = 32; Clematis campaniflora 2n = 16; Ranunculus muricatus 2n = 48; R. repens 2n = 32; R. bulbosus subsp. aleae var. adscendens 2n =16; R. sceleratus 2n = 32; R. paludosus 2n = 32; R. nigrescens 2n = 16; Aquilegia vulgaris subsp. dichroa 2n = 14. Estos recuentos coinciden con los obtenidos anteriormente por otros autores.

  12. 云南云龙水库库区野生药用种子植物资源调查与分析%Investigation and Analysis on the Wild Resources of Medicinal Seed Plants from Yunlong Reservoir Area in Yunnan Province

    Institute of Scientific and Technical Information of China (English)

    李孙文; 赵昶灵; 张丽梅; 李荣春; 赵蕾; 李信

    2006-01-01

    In the area of Yunlong reservoir of Yunnan province,there are 104 species of wild resources of medicinal seed plants which belong to 56 families and 94 genera. The percentage of the medicinal seed plants to the total seed plants in the same area is 23.3%. The preponderant families of medicinal seed plants are Compositae,Labiatae,Campanulaceae,Umbelliferae,Ranunculaceae,Rosaceae,Rubiaceae and Scrophulariaceae. The preponderant genera are Anemone,Artemisia,Carpesium,Conyza and Elsholtzia. The perpendicular distribution of the medicinal seed plants is asymmetrical. The species number in the altitude of 2 070~2 080 m is the maximum,next is the 2 010~2 030 m and the third is the 2 430~2 440 m. After the water-storing of reservoir is fulfilled entirely,53.8% of the wild resources of medicinal seed plants will permanently be submerged. This research may provide a preparatory information for the protection of the entironment surrounding the reservoir and for the scientific safeguard and utilization of the wild resources of medicinal seed plants.%云南云龙水库库区共有药用种子植物104种,隶属于56科94属,占该区全部种子植物种的23.3%,优势科为Compositae,Labiatae,Campanulaceae,Umbelliferae,Ranunculaceae,Rosaceae,Rubiaceae和Scrophulariaceae,优势属为Anemone,Artemisia,Carpesium,Conyza和Elsholtzia.该区药用种子植物垂直分布不均匀,在海拔2 070~2 080 m种最多,其次是2 010~2 030 m,再次是2 430~2 440 m.水库完成蓄水后,将53.8%的药用种子植物被永久淹没.研究结果可为库区周边生态环境保护和对该区药用种子植物资源的科学保护和开发利用提供参考.

  13. A journey into the wild of the cnidarian model system Aiptasia and its symbionts

    KAUST Repository

    Voolstra, Christian R.

    2013-08-27

    The existence of coral reef ecosystems relies critically on the mutualistic relationship between calcifying cnidarians and photosynthetic, dinoflagellate endosymbionts in the genus Symbiodinium. Reef-corals have declined globally due to anthropogenic stressors, for example, rising sea-surface temperatures and pollution that often disrupt these symbiotic relationships (known as coral bleaching), exacerbating mass mortality and the spread of disease. This threatens one of the most biodiverse marine ecosystems providing habitats to millions of species and supporting an estimated 500 million people globally (Hoegh-Guldberg et al. 2007). Our understanding of cnidarian-dinoflagellate symbioses has improved notably with the recent application of genomic and transcriptomic tools (e.g. Voolstra et al. 2009; Bayer et al. 2012; Davy et al. 2012), but a model system that allows for easy manipulation in a laboratory environment is needed to decipher underlying cellular mechanisms important to the functioning of these symbioses. To this end, the sea anemone Aiptasia, otherwise known as a \\'pest\\' to aquarium hobbyists, is emerging as such a model system (Schoenberg & Trench 1980; Sunagawa et al. 2009; Lehnert et al. 2012). Aiptasia is easy to grow in culture and, in contrast to its stony relatives, can be maintained aposymbiotically (i.e. dinoflagellate free) with regular feeding. However, we lack basic information on the natural distribution and genetic diversity of these anemones and their endosymbiotic dinoflagellates. These data are essential for placing the significance of this model system into an ecological context. In this issue of Molecular Ecology, Thornhill et al. (2013) are the first to present genetic evidence on the global distribution, diversity and population structure of Aiptasia and its associated Symbiodinium spp. By integrating analyses of the host and symbiont, this research concludes that the current Aitpasia taxonomy probably needs revision and that two

  14. Can artificial reefs mimic natural reef communities? The roles of structural features and age.

    Science.gov (United States)

    Perkol-Finkel, S; Shashar, N; Benayahu, Y

    2006-03-01

    In light of the deteriorating state of coral reefs worldwide, the need to rehabilitate marine environments has greatly increased. Artificial reefs (ARs) have been suggested as a tool for reef conservation and rehabilitation. Although successions of AR communities have been thoroughly studied, current understanding of the interactions between artificial and natural reefs (NRs) is poor and a fundamental question still to be answered is that of whether AR communities can mimic adjacent NR communities. We suggest three alternative hypotheses: Neighboring ARs and NRs will (1) achieve a similar community structure given sufficient time; (2) be similar only if they possess similar structural features; (3) always differ, regardless of age or structural features. We examined these hypotheses by comparing the community structure on a 119-year old shipwreck to a neighboring NR. Fouling organisms, including stony and soft corals, sponges, tunicates, sea anemones and hydrozoans were recorded and measured along belt transects. The ahermatypic stony coral Tubastrea micrantha dominated vertical AR regions while the soft corals Nephthea sp. and Xenia sp. dominated both artificial and natural horizontal surfaces. Our results support the second hypothesis, indicating that even after a century an AR will mimic its adjacent NR communities only if it possesses structural features similar to those of the natural surroundings. However, if the two differ structurally, their communities will remain distinct. PMID:16198411

  15. Sicily in D.H. Lawrence’s Imagery

    Directory of Open Access Journals (Sweden)

    Carla Comellini

    2008-04-01

    Full Text Available D.H. Lawrence, who spent two years in Sicily, precisely in Fontana Vecchia, near Taormina and Aetna (where the God Vulcan used to live, has always been fascinated by Italy and Sicily in particular, the places where, in his opinion, most myths are rooted. His fascination for Sicily is due both to the sculpture of The Seated Demeter or Core, that he saw in the archaeological Museum in Syracuse, and to the Sicilians, described “as handsome as Adonis”, and who seem to manifest and share the sexual energy usually connected to Pan and Dionysus. The image of Sicily recurs in D.H. Lawrence’s entire production, often indirectly suggested by images such as: the volcanoes, the mythical Sicilian monsters “Scylla and Charybdis”, and the references to the Myth of Pluto and Persephone, which took place in Enna, as told in his poem "Purple Anemones" (in Birds, Beasts and Flowers. Moreover, his novella Sun deals with the flourishing Mediterranean landscape of Sicily, with Aetna in the distance, and the memory of the Sicules, the archaic inhabitants of the island. It is also worth mentioning that D.H. Lawrence translated several works by the Sicilian Giovanni Verga: from Mastro-Don Gesualdo (1923 to Cavalleria Rusticana and Other Stories (1928.

  16. Analyses of Simulated Reconnection-Driven Solar Polar Jets

    Science.gov (United States)

    Roberts, M. A.; Uritsky, V. M.; Karpen, J. T.; DeVore, C. R.

    2014-12-01

    Solar polar jets are observed to originate in regions within the open field of solar coronal holes. These so called "anemone" regions are generally accepted to be regions of opposite polarity, and are associated with an embedded dipole topology, consisting of a fan-separatrix and a spine line emanating from a null point occurring at the top of the dome shaped fan surface. Previous analysis of these jets (Pariat et al. 2009,2010) modeled using the Adaptively Refined Magnetohydrodynamics Solver (ARMS) has supported the claim that magnetic reconnection across current sheets formed at the null point between the highly twisted closed field of the dipole and open field lines surrounding it releases the energy necessary to drive these jets. However, these initial simulations assumed a "static" environment for the jets, neglecting effects due to gravity, solar wind and the expanding spherical geometry. A new set of ARMS simulations taking into account these additional physical processes was recently performed. Initial results are qualitatively consistent with the earlier Cartesian studies, demonstrating the robustness of the underlying ideal and resistive mechanisms. We focus on density and velocity fluctuations within a narrow radial slit aligned with the direction of the spine of the jet, as well as other physical properties, in order to identify and refine their signatures in the lower heliosphere. These refined signatures can be used as parameters by which plasma processes initiated by these jets may be identified in situ by future missions such as Solar Orbiter and Solar Probe Plus.

  17. Bacterial communities associated with the ctenophores Mnemiopsis leidyi and Beroe ovata.

    Science.gov (United States)

    Daniels, Camille; Breitbart, Mya

    2012-10-01

    Residing in a phylum of their own, ctenophores are gelatinous zooplankton that drift through the ocean's water column. Although ctenophores are known to be parasitized by a variety of eukaryotes, no studies have examined their bacterial associates. This study describes the bacterial communities associated with the lobate ctenophore Mnemiopsis leidyi and its natural predator Beroe ovata in Tampa Bay, Florida, USA. Investigations using terminal restriction fragment length polymorphism (T-RFLP) and cloning and sequencing of 16S rRNA genes demonstrated that ctenophore bacterial communities were distinct from the surrounding water. In addition, each ctenophore genus contained a unique microbiota. Ctenophore samples contained fewer bacterial operational taxonomic units (OTUs) by T-RFLP and lower diversity communities by 16S rRNA gene sequencing than the water column. Both ctenophore genera contained sequences related to bacteria previously described in marine invertebrates, and sequences similar to a sea anemone pathogen were abundant in B. ovata. Temporal sampling revealed that the ctenophore-associated bacterial communities varied over time, with no single OTU detected at all time points. This is the first report of distinct and dynamic bacterial communities associated with ctenophores, suggesting that these microbial consortia may play important roles in ctenophore ecology. Future work needs to elucidate the functional roles and mode of acquisition of these bacteria. PMID:22571334

  18. Gigantoxin-4-4D5 scFv is a novel recombinant immunotoxin with specific toxicity against HER2/neu-positive ovarian carcinoma cells.

    Science.gov (United States)

    Lv, Xinxin; Zhang, Jian; Xu, Rui; Dong, Yuguo; Sun, Aiyou; Shen, Yaling; Wei, Dongzhi

    2016-07-01

    Immunotoxins are a new class of antibody-targeted therapy in clinical development. Traditional immunotoxins that are constructed from the toxins of plants or bacteria need to be internalized to the cytoplasm and thus have limited antitumor efficacy. In the present study, we combined a recently reported sea anemone cytolysin Gigantoxin-4 with an anti-HER2/neu single-chain variable fragment 4D5 scFv to construct a novel immunotoxin. We fused a SUMO tag to the N-terminus of Gigantoxin-4-4D5 scFv and it was successfully expressed in Escherichia coli strain BL21 (DE3) in a soluble form. After purification, the purity of Gigantoxin-4-4D5 scFv reached 96 % and the yield was 14.3 mg/L. Our results demonstrated that Gigantoxin-4-4D5 scFv exerted a highly cytotoxic effect on the HER2/neu-positive ovarian carcinoma SK-OV-3 cell line. And the hemolytic activity was weaker, making it safe for normal cells. The results of immunofluorescence analysis showed that this novel immunotoxin could specifically bind to SK-OV-3 cells with no recognition of human embryonic kidney 293 cells. Scanning electron microscope observations and extracellular lactate dehydrogenase activity indicated that it could induce necrosis in SK-OV-3 cells by disrupting the cell membrane. Moreover, it could also mediate apoptosis of SK-OV-3 cells. PMID:27063011

  19. Structural and Developmental Disparity in the Tentacles of the Moon Jellyfish Aurelia sp.1.

    Directory of Open Access Journals (Sweden)

    David A Gold

    Full Text Available Tentacles armed with stinging cells (cnidocytes are a defining trait of the cnidarians, a phylum that includes sea anemones, corals, jellyfish, and hydras. While cnidarian tentacles are generally characterized as structures evolved for feeding and defense, significant variation exists between the tentacles of different species, and within the same species across different life stages and/or body regions. Such diversity suggests cryptic distinctions exist in tentacle function. In this paper, we use confocal and transmission electron microscopy to contrast the structure and development of tentacles in the moon jellyfish, Aurelia species 1. We show that polyp oral tentacles and medusa marginal tentacles display markedly different cellular and muscular architecture, as well as distinct patterns of cellular proliferation during growth. Many structural differences between these tentacle types may reflect biomechanical solutions to different feeding strategies, although further work would be required for a precise mechanistic understanding. However, differences in cell proliferation dynamics suggests that the two tentacle forms lack a conserved mechanism of development, challenging the textbook-notion that cnidarian tentacles can be homologized into a conserved bauplan.

  20. Symbiont type influences trophic plasticity of a model cnidarian-dinoflagellate symbiosis.

    Science.gov (United States)

    Leal, Miguel C; Hoadley, Kenneth; Pettay, D Tye; Grajales, Alejandro; Calado, Ricardo; Warner, Mark E

    2015-03-01

    The association between cnidarians and photosynthetic dinoflagellates within the genus Symbiodinium is a prevalent relationship in tropical and subtropical marine environments. Although the diversity of Symbiodinium provides a possible axis for niche diversification, increased functional range and resilience to physical stressors such as elevated temperature, how such diversity relates to the physiological balance between autotrophy and heterotrophy of the host animal remains unknown. Here, we experimentally show interspecific and intraspecific variability of photosynthetic carbon fixation and subsequent translocation by Symbiodinium to the model cnidarian host Aiptasia pallida. By using a clonal anemone line harboring different species of Symbiodinium, we determined that symbiont identity influences trophic plasticity through its density, capacity to fix carbon, quantity of translocated carbon and ultimately the host's capacity to ingest and digest prey. Symbiont carbon translocation and host prey ingestion were positively correlated across symbiont combinations that consisted of different isoclonal lines of Symbiodinium minutum, while a combination with type D4-5 Symbiodinium displayed lower carbon translocation, and prey capture and digestion more similar to Aiptasia lacking symbionts. The absence of a shift toward greater heterotrophy when carbon translocation is low suggests that the metabolic demand of feeding and digestion may overwhelm nutritional stores when photosynthesis is reduced, and amends the possible role of animal feeding in resistance to or recovery from the effects of climate change in more obligate symbioses such as reef-building corals. PMID:25617454

  1. Catalog to families, genera, and species of orders Actiniaria and Corallimorpharia (Cnidaria: Anthozoa).

    Science.gov (United States)

    Fautin, Daphne Gail

    2016-01-01

    This book inventories all available (and some unavailable) names in the family, genus, and species groups of extant members of orders Actiniaria and Corallimorpharia [cnidarian subclass Hexacorallia (Zoantharia) of class Anthozoa], providing a benchmark of names, their status, and taxon membership. I have attempted to make the compilation complete as of 2010; some names created after 2010 are included. The book is derived from a database I compiled that was available through a website. Most of the book is from the literature that defines taxa and documents their geographic distribution-primarily publications on nomenclature, taxonomy, and biogeography, but also some on ecology, pharmacology, reproductive biology, physiology, etc. of anemones (the common name for these groups); the reference section comprises 845 entries. As for previous anemone catalogs, this contains taxonomic as well as nomenclatural information,  the former based on subjective opinion of working biologists, the latter objectively verifiable and unchanging (except by action of the International Commission on Zoological Nomenclature).        Each family-group name, genus-group name, and original combination for species-group names has an entry. The entry contains the bibliographic reference to the publication in which each name was made available. This book contains for Corallimorpharia seven family names (four considered valid [57%]), 20 generic names (10 considered valid [50%] and one unavailable), and 65 species names (46 considered valid [70%]). It contains for Actiniaria 86 family names (50 considered valid [58%] and three unavailable), 447 generic names (264 considered valid [59%] and two unavailable), and 1427 species names (1101 considered valid [77%] and nine unavailable). Type specimens are inventoried from more than 50 natural history museums in Africa, Australia, Europe, New Zealand, and North America, including those with the largest collections of anemones; the geographic

  2. Morphological Variability and Distinct Protein Profiles of Cultured and Endosymbiotic Symbiodinium cells Isolated from Exaiptasia pulchella

    Science.gov (United States)

    Pasaribu, Buntora; Weng, Li-Chi; Lin, I.-Ping; Camargo, Eddie; Tzen, Jason T. C.; Tsai, Ching-Hsiu; Ho, Shin-Lon; Lin, Mong-Rong; Wang, Li-Hsueh; Chen, Chii-Shiarng; Jiang, Pei-Luen

    2015-10-01

    Symbiodinium is a dinoflagellate that plays an important role in the physiology of the symbiotic relationships of Cnidarians such as corals and sea anemones. However, it is very difficult to cultivate free-living dinoflagellates after being isolated from the host, as they are very sensitive to environmental changes. How these symbiont cells are supported by the host tissue is still unclear. This study investigated the characteristics of Symbiodinium cells, particularly with respect to the morphological variability and distinct protein profiles of both cultured and endosymbiotic Symbiodinium which were freshly isolated from Exaiptasia pulchella. The response of the cellular morphology of freshly isolated Symbiodinium cells kept under a 12 h L:12 h D cycle to different temperatures was measured. Cellular proliferation was investigated by measuring the growth pattern of Symbiodinium cells, the results of which indicated that the growth was significantly reduced in response to the extreme temperatures. Proteomic analysis of freshly isolated Symbiodinium cells revealed twelve novel proteins that putatively included transcription translation factors, photosystem proteins, and proteins associated with energy and lipid metabolism, as well as defense response. The results of this study will bring more understandings to the mechanisms governing the endosymbiotic relationship between the cnidarians and dinoflagellates.

  3. Isolation and distribution of iridescent Cellulophaga and other iridescent marine bacteria from the Charente-Maritime coast, French Atlantic.

    Science.gov (United States)

    Kientz, Betty; Agogué, Hélène; Lavergne, Céline; Marié, Pauline; Rosenfeld, Eric

    2013-06-01

    An intense colored marine bacterium, identified as Cellulophaga lytica, was isolated previously from a sea anemone surface on the Charente-Maritime rocky shore (Atlantic Coast, France), and iridescence of its colonies under direct light was recently described. In addition, iridescence intensities were found to differ strongly between C. lytica strains from different culture collections. However, importantly, the occurrence and distribution of iridescent bacteria in the marine environment were still unknown. Therefore, in this study, a search was undertaken for marine iridescent bacterial strains in different biotopes of the Charente-Maritime coast. Various marine samples (water, sediment, macroalgae, other macroorganisms and detritus) were collected from seven biotopes using a direct plate inoculation method. As a result, 34 iridescent strains related to the genus Cellulophaga, as well as 63 iridescent strains affiliated to the genera Tenacibaculum and Aquimarina, were isolated. Iridescent colors were different according to the genera but iridescent marine bacteria were widely distributed. However, a majority of strains were isolated from rocky shores and, in particular, red seaweed surfaces and mollusks. The data from the study suggested that isolates with iridescent properties were well conserved in stressful environments such as the coastal shoreline. This origin may provide an insight into the ecological and biological functions of iridescence. PMID:23623798

  4. Unravelling the role of zooxanthellae in the uptake and depuration of an essential metal in Exaiptasia pallida; an experiment using a model cnidarian

    International Nuclear Information System (INIS)

    Highlights: • We examined zooxanthellae and tissue zinc partitioning in Exaiptasia pallida. • Zooxanthellae density has a strong influence on whole organism metal loading. • Zooxanthellae loss through stress is likely to result in metal depuration. • There are implications for interpreting studies of metal loads in symbiotic organisms. • Studies of metal loads in symbiotic organisms must consider zooxanthellae density. - Abstract: Coral skeletons record historical trace metal levels in the environment, however, the use of coral skeletal records for biomonitoring studies mostly fail to consider the influence of metal regulation by the living components of coral and subsequent incorporation into the skeleton. This study presents Exaiptasia pallida as a representative of the living components of coral and shows metal partitioning between the tissue and zooxanthellae after chronic exposure to Zn. A strong tendency for preferential accumulation in the zooxanthellae occurred after 32 days exposure and Zn concentrations in tissue and zooxanthellae were 123.3 ± 0.7 mg kg−1 and 294.9 ± 8.5 respectively. This study shows zooxanthellae density plays an important role in controlling Zn loading in whole anemones and must be considered when investigating metal uptake and loading in zooxanthellate organisms. Further studies that investigate links between aragonite deposition rates and zooxanthellae density and incorporation pathways of metals into skeleton are warranted

  5. High contents of trimethylamine oxide correlating with depth in deep-sea teleost fishes, skates, and decapod crustaceans.

    Science.gov (United States)

    Kelly, R H; Yancey, P H

    1999-02-01

    In muscles of shallow-living marine animals, the osmolyte trimethylamine N-oxide (TMAO) is reportedly found (in millimoles of TMAO per kilogram of tissue wet weight) at 30-90 in shrimp, 5-50 in crabs, 61-181 in skates, and 10-70 in most teleost fish. Recently our laboratory reported higher levels (83-211 mmol/kg), correlating with habitat depth, in deep-sea gadiform teleosts. We now report the same trend in muscles of other animals, collected off the coast of Oregon from bathyal (1800-2000 m) and abyssal plain (2850 m) sites. TMAO contents (mmol/kg +/- SD) were as follows: zoarcid teleosts, 103 +/- 9 (bathyal) and 197 +/- 2 (abyssal); scorpaenid teleosts, 32 +/- 0 (shallow) and 141 +/- 16 (bathyal); rajid skates, 215 +/- 13 (bathyal) and 244 +/- 23 (abyssal); caridean shrimp, 76 +/- 16 (shallow), 203 +/- 35 (bathyal), and 299 +/- 28 (abyssal); Chionoecetes crabs, 22 +/- 2 (shallow) and 164 +/- 15 (bathyal). Deep squid, clams, and anemones also had higher contents than shallow species. Osmoconformers showed compensation between TMAO and other osmolytes. Urea contents (typically 300 mmol/kg in shallow elasmobranchs) in skates were 214 +/- 5 (bathyal) and 136 +/- 9 (abyssal). Glycine contents in shrimp were 188 +/- 17 (shallow) and 52 +/- 20 (abyssal). High TMAO contents may reflect diet, reduce osmoregulatory costs, increase buoyancy, or counteract destabilization of proteins by pressure. PMID:25575382

  6. Food web of the intertidal rocky shore of the west Portuguese coast - Determined by stable isotope analysis.

    Science.gov (United States)

    Vinagre, Catarina; Mendonça, Vanessa; Narciso, Luís; Madeira, Carolina

    2015-09-01

    The characterization of food web structure, energy pathways and trophic linkages is essential for the understanding of ecosystem functioning. Isotopic analysis was performed on food web components of the rocky intertidal ecosystem in four sites along the Portuguese west coast. The aim was to 1) determine the general food web structure, 2) estimate the trophic level of the dominant organisms and 3) track the incorporation of organic carbon of different origins in the diet of the top consumers. In this food web, fish are top consumers, followed by shrimp. Anemones and gastropods are intermediate consumers, while bivalves and zooplankton are primary consumers. Macroalgae Bifurcaria bifurcata, Ulva lactuca, Fucus vesiculosus, Codium sp. and phytoplankton are the dominant producers. Two energy pathways were identified, pelagic and benthic. Reliance on the benthic energy pathway was high for many of the consumers but not as high as previously observed in subtidal coastal food webs. The maximum TL was 3.3, which is indicative of a relatively short food web. It is argued that the diet of top consumers relies directly on low levels of the food web to a considerable extent, instead of on intermediate levels, which shortens the trophic length of the food web. PMID:26275753

  7. The Mauve Stinger Pelagia noctiluca (Forsskål, 1775. Distribution, Ecology, Toxicity and Epidemiology of Stings.

    Directory of Open Access Journals (Sweden)

    Luigi Pane

    2008-09-01

    Full Text Available The toxicity of Cnidaria is a subject of concern due to its influence on humans. In particular, jellyfish blooms can highly affect human economical activities, such as bathing, fishery, tourism, etc., as well as the public health. Stinging structures of Cnidaria (nematocysts produce remarkable effects on human skin, such as erythema, swelling, burning and vesicles, and at times further severe dermonecrotic, cardio- and neurotoxic effects, which are particularly dangerous in sensitive subjects. In several zones the toxicity of jellyfish is a very important health problem, thus it has stimulated the research on these organisms; to date toxicological research on Cnidarian venoms in the Mediterranean region is not well developed due to the weak poisonousness of venoms of jellyfish and anemones living in this area. In spite of this, during last decades several problems were also caused in the Mediterranean by stinging consequent to Cnidarian blooms mainly caused by Pelagia noctiluca (Forsskål, 1775 which is known to be the most venomous Mediterranean jellyfish. This paper reviews the knowledge on this jellyfish species, particularly considering its occurrence and toxicity.

  8. Strategies toward structural and functional ‘optimization’ of animal peptide toxins

    Directory of Open Access Journals (Sweden)

    Andreotti N

    2012-01-01

    Full Text Available Background: venoms of a variety of animal species (i.e. scorpions, snakes, spiders, sea anemones, marine cone snails, worms, and insects are rich sources of bioactive compounds that possess obvious pharmacological, therapeutic and/or biotechnological values. A majority of these compounds are peptides that mainly target enzymes, membrane receptors or ion channels. Aim: In recent years, much efforts of researchers have been focused on characterizing and ‘improving’ the pharmacological profile of some venom toxins, mainly because of their structural/functional diversity and potential value as chemotherapeutic drugs in the treatment of specific human pathologies. Materials and methods: This study reviews the strategies towards optimization of animal peptide toxins. Results: These peptides are most often in a size range that allows their production in vitro by chemical synthesis or genetic engineering. Unfortunately, they rarely display the required characteristics in terms of selectivity, affinity, stability and targeting with regard to the desired application. During the last decade, a number of successful structural approaches or strategies have been developed to improve the intrinsic potential of venom peptides. Using different strategies (reviewed herein, a number of highly potent and selective toxin-derived candidate drugs were designed and produced by chemical synthesis. Conclusion: Such strategies proved to be effective as several toxin-based drugs are already marketed while an increasing number of candidate chemotherapeutics are currently being developed in clinical phase.

  9. Initiation and recovery processes of endotoxin induced disseminated intravascular coagulation (DIC: scanning and transmission electron microscopic observations of rat renal tissues.

    Directory of Open Access Journals (Sweden)

    Miyashima,Takanao

    1989-04-01

    Full Text Available To clarify the initiation, development and recovery processes of disseminated intravascular coagulation (DIC, rat glomerular capillaries and fibrin thrombi were examined under transmission and scanning electron microscopes. DIC was induced in rats by a single intraperitoneal injection of endotoxin (Et., 7.5 mg/kg lipopolysaccharide:B, E. coli 026:B6. At 2 h after Et. injection, the endothelial surface of the glomerular capillary became irregular with projections like a sea anemone. At 4 h after Et. injection, agglomerated fibrin thrombi composed of fibrin fiber bundles with fine cross-striated fibriform structures were observed in the capillary lumen. The fibrin thrombi gradually changed into fine reticular systems suggesting a degradation process by 6 h after Et. injection, and formed a coarse granular agglomerate by 8 h after Et. injection. These fibrin thrombi disappeared within 12 h of Et. injection, but the endothelial surface remained edematous. At 24 h after Et. injection, the microstructure of the glomerular capillaries returned normal. Based on these observations, we concluded that DIC was primarily initiated by injury to the capillary endothelium, and that changes on the endothelial surface contributed to the development of DIC.

  10. Transcriptomic responses to heat stress and bleaching in the elkhorn coral Acropora palmata

    KAUST Repository

    DeSalvo, MK

    2010-03-08

    The emergence of genomic tools for reef-building corals and symbiotic anemones comes at a time when alarming losses in coral cover are being observed worldwide. These tools hold great promise in elucidating novel and unforeseen cellular processes underlying the successful mutualism between corals and their dinoflagellate endosymbionts Symbiodinium spp. Since thermal stress triggers a breakdown in the symbiosis (coral bleaching), measuring the transcriptomic response to thermal stress-induced bleaching offers an extraordinary view of cellular processes that are specific to coral–algal symbioses. In the present study, we utilized a cDNA microarray containing 2059 genes of the threatened Caribbean elkhorn coral Acropora palmata to identify genes that are differentially expressed upon thermal stress. Fragments from replicate colonies were exposed to elevated temperature for 2 d, and samples were frozen for microarray analysis after 24 and 48 h. Totals of 204 and 104 genes were differentially expressed in samples that were collected 1 and 2 d after thermal stress, respectively. Analysis of the differentially expressed genes indicates a cellular stress response in A. palmata involving (1) growth arrest, (2) chaperone activity, (3) nucleic acid stabilization and repair, and (4) removal of damaged macromolecules. Other differentially expressed processes include sensory perception, metabolite transfer between host and endosymbiont, nitric oxide signaling, and modifications to the actin cytoskeleton and extracellular matrix. The results are compared with those from a previous coral microarray study of thermal stress in Montastraea faveolata, and point to an overall evolutionary conserved bleaching response in scleractinian corals.

  11. Naked Stony Corals: Skeleton Loss in Scleractinia

    Energy Technology Data Exchange (ETDEWEB)

    Medina, Monica; Collins, Allen G.; Takaoka, Tori L.; Kuehl,Jennifer; Boore, Jeffrey L.

    2005-12-01

    Hexacorallia includes the Scleractinia, or stony corals, characterized by having an external calcareous skeleton made of aragonite, and the Corallimorpharia, or mushroom corals, that lack such a skeleton. Although each group has traditionally been considered monophyletic, some molecular phylogenetic analyses have challenged this, suggesting that skeletal features are evolutionarily plastic, and reviving notions that the scleractinian skeleton may be ephemeral and that the group itself may be polyphyletic. Nevertheless, the most comprehensive phylogenetic study of Hexacorallia supported scleractinian monophyly (REF), and so this remains controversial. In order to resolve this contentious issue, we sequenced the complete mitochondrial genome sequences of nine scleractinians and four corallimorpharians and performed phylogenetic analysis that also included three outgroups (an octocoral and two sea anemones). Our data provide the first strong evidence that Scleractinia is paraphyletic and that the Corallimorpharia is derived from within the group, from which we conclude that skeletal loss has occurred in the latter group secondarily. It is possible that a driving force in such skeletal loss could be the high levels of CO{sub 2} in the ocean during the mid-Cretaceous, which would have impacted aragonite solubility. We estimate from molecular divergence measures that the Corallimorpharia arose in the mid-Cretaceous, approximately 87 million years ago (Ma), supporting this view. These data also permit us to date the origin of Scleractinia to 265 Ma, narrowing the gap between the group's phylogenetic origin and its earliest fossil record.

  12. [Intoxications specific to the Aquitaine region].

    Science.gov (United States)

    Bédry, R; Gromb, S

    2009-07-01

    Some intoxications are more specifically linked to the Aquitaine region than to other regions of France, due to environmental circumstances (fauna, flora, climate) or traditional activities (gastronomy). Three types of intoxications are particular in this area. Pine processionary caterpillar envenomations (Thaumetopoea pityocampa), a Southern Europe pinewood parasite, are frequently encountered in the Landes' forest. They are responsible of ocular and/or skin lesions with urticaria or contact dermatitis, seldom associated with immediate IgE hypersensitivity. According to the south Atlantic coastal region geology and the marine streams, venomous marine animals are mainly located in Charente-Maritime for jellyfish, in Gironde and in Landes for weeverfish and in Atlantic Pyrenees for sea anemone. Usually not dangerous, first-aid workers treat most cases of these envenomations. Some endemic mushrooms (Tricholoma auratum) which grow on the dunes of the Atlantic coastal region, are usually considered as very good comestibles, but were recently responsible for serious intoxications: T.auratum was responsible of several cases of rhabdomyolysis, without neurological involvement, nor renal or hepatic lesion. Three deaths were notified. Animal studies confirmed the responsibility of the mushrooms. PMID:19375827

  13. Mutation Breeding of various spray chrysanthemum cultivars by gamma-ray irradiation

    International Nuclear Information System (INIS)

    This study was carried out to analyze mutation rate and spectrum of chrysanthemum by gamma-ray irradiation. Five flower types, 16 cultivars including 'Geumsu', 'Hwiparam', 'Ilwol', 'Magic', 'Moonlight', 'Noblewine', 'Pinky', 'Progy', 'Sangtte', 'Waterfog', 'Whitneypangpang', 'Yelloweye', 'Yellowpangpang', 'Yesmiso', 'Yesmorning', and 'Yestogether' were irradiated as 30, 50, and 70 Gy dose during 24 hours. As a result, mutation rate was identified as the highest in single type among five flower types, but there was a little difference according to cultivars. Mutation rate was increased in proportion to irradiation dose in anemone, pompon, and spider type cultivars, but there wasn't clear in single and semi-double type cultivars. Mutation spectrum was identified as the highest in the cultivar 'Noblewine'. The most sensitive cultivars to radiation were revealed as 'Noblewine' and 'Yesmorning' and the least were Moonlight', 'Waterfog', and 'Yellowpangpang'. Consequently, there was much difference in radio-sensitivity according to cultivars of chrysanthemum and flower type was correlated a little with mutation rate

  14. Expression in Pichia pastoris and characterization of APETx2, a specific inhibitor of acid sensing ion channel 3.

    Science.gov (United States)

    Anangi, Raveendra; Chen, Chih-Cheng; Lin, Yi-Wen; Cheng, Yuan-Ren; Cheng, Chun-Ho; Chen, Yi-Chun; Chu, Yuan-Ping; Chuang, Woei-Jer

    2010-12-01

    Acid sensing ion channels (ASICs) are family of proteins predominantly present in the central and peripheral nervous system. They are known to play important roles in the pathophysiology of pain and ischemic stroke. APETx2 is a potent and selective inhibitor of ASIC3-containing channels and was isolated from sea anemone Anthopleura elegantissima. To facilitate the study on the molecular determinants of ASIC3-ligand interactions, we expressed recombinant APETx2 in the Pichia pastoris (P. pastoris) expression system and purified it to homogeneity. Recombinant APETx2 produced in P. pastoris inhibited the acid-evoked ASIC3 current with the IC(50) value of 37.3 nM. The potency of recombinant toxin is similar to that of native APETx2. The sequential assignment and structure analysis of APETx2 were obtained by 2D and 3D (15)N-edited NMR spectra. Our NMR data suggests that APETx2 produced in P. pastoris retained its native fold. The results presented here provide the first direct evidence that highly disulfide bonded peptide inhibitor of ASIC3, APETx2, can be expressed in P. pastoris with correct fold and high yield. We also showed that the R17A mutant exhibited a decrease in activity, suggesting the feasibility of the use of this expression system to study the interactions between APETx2 and ASIC3. These evidences may serve as the basis for understanding the selectivity and activity of APETx2. PMID:20813121

  15. Coral Reef Bleaching at Agatti Island of Lakshadweep Atolls, India

    Institute of Scientific and Technical Information of China (English)

    Ramar Vinoth; Mohan Gopi; Thipramalai Thankappanpillai Ajith Kumar; Thirunavukarassu Thangaradjou; Thangavel Balasubramanian

    2012-01-01

    A survey on coral bleaching was carried out at Agatti Island of Lakshadweep from May to June 2010.Elevated sea surface temperatures (SSTs) of the region exceeded the seasonal average and delayed the onset of monsoon,which triggered widespread bleaching of corals.The Agatti reefs showed an average of 73% bleached corals with apparent bleaching-related mortality of sea anemones (87%) and giant clams (83%).The SST increased up to 34 ℃ with an average maximum SST of 32.5℃ during the study period between May and June 2010.Coral reefs on the southern side of the island are fully or partially exposed to sun light during low tide in contrast to the other side.This suggests that the mortality is more likely due to the low tide exposure than exclusively due to the elevated SST.Observations indicated a clear increase in coral bleaching during April 2010,at levels higher than that in normal summer.

  16. The mitochondrial 60-kDa heat shock protein in marine invertebrates: biochemical purification and molecular characterization

    Science.gov (United States)

    Choresh, Omer; Loya, Yossi; Müller, Werner E.G.; Wiedenmann, Jörg; Azem, Abdussalam

    2004-01-01

    Sessile marine invertebrates undergo constant direct exposure to the surrounding environmental conditions, including local and global environmental fluctuations that may lead to fatal protein damage. Induction of heat shock proteins (Hsps) constitutes an important defense mechanism that protects these organisms from deleterious stress conditions. In a previous study, we reported the immunological detection of a 60-kDa Hsp (Hsp60) in the sea anemone Anemonia viridis (formerly called Anemonia sulcata) and studied its expression under a variety of stress conditions. In the present study, we show that the sponge Tetilla sp. from tidal habitats with a highly variable temperature regime is characterized by an increased level of Hsp60. Moreover, we show the expression of Hsp60 in various species among Porifera and Cnidaria, suggesting a general importance of this protein among marine invertebrates. We further cloned the hsp60 gene from A viridis, using a combination of conventional protein isolation methods and screening of a complementary deoxyribonucleic acid library by polymerase chain reaction. The cloned sequence (1764 bp) encodes for a protein of 62.8 kDa (588 amino acids). The 62.8-kDa protein, which contains an amino terminal extension that may serve as a mitochondrial targeting signal, shares a significant identity with mitochondrial Hsp60s from several animals but less identity with Hsp60s from either bacteria or plants. PMID:15270076

  17. Rapid identification of long-chain polyunsaturated fatty acids in a marine extract by HPLC-MS using data-dependent acquisition.

    Science.gov (United States)

    Thomas, Michael C; Dunn, Simon R; Altvater, Jens; Dove, Sophie G; Nette, Geoffrey W

    2012-07-17

    The collision-induced dissociation (CID) of a range of deprotonated fatty acid standards was studied using linear ion trap mass spectrometry. Neutral losses of 78, 98, and 136 Da were consistently observed for fatty acids with five or more double bonds. Comparison of the MS/MS spectra of docosahexaenoic acid (DHA) and universally (13)C-labeled DHA allowed the molecular formulas for these neutral losses to be determined as C(6)H(6), C(5)H(6)O(2), and C(8)H(8)O(2). Knowledge of fatty acid fragmentation processes was then applied to identify fatty acids from a sea anemone, Aiptasia pulchella, and dinoflagellate symbiont, Symbiodinium sp. extract. Using HPLC-MS, fatty acids were separated and analyzed by tandem mass spectrometry in data-dependent acquisition mode. Neutral loss chromatograms for 78, 98, and 136 Da allowed the identification of long-chain fatty acids with five or more double bonds. On the basis of precursor ion m/z ratios, chain length and degree of unsaturation for these fatty acids were determined. The application of this technique to an Aiptasia sp.-Symbiodinium sp. lipid extract enabled the identification of the unusual, long-chain fatty acids 24:6, 26:6, 26:7, 28:7, and 28:8 during a single 40 min HPLC-MS analysis. PMID:22816781

  18. Tox-Prot, the toxin protein annotation program of the Swiss-Prot protein knowledgebase.

    Science.gov (United States)

    Jungo, Florence; Bairoch, Amos

    2005-03-01

    The Tox-Prot program was initiated in order to provide the scientific community a summary of the current knowledge on animal protein toxins. The aim of this program is to systematically annotate all proteins which act as toxins and are produced by venomous and poisonous animals. Venomous animals such as snakes, scorpions, spiders, jellyfish, insects, cone snails, sea anemones, lizards, some fish, and platypus are equipped with a specialized organ to inject venom in their prey. In contrast, poisonous animals such as some fish or worms, lack such organs. Each toxin is annotated according to the quality standards of Swiss-Prot. This means providing a wealth of information that includes the description of the function, domain structure, subcellular location, tissue specificity, variants, similarities to other proteins, keywords, etc. In the framework of this program, particular care has been made to capture what is known on the function and mode of action, posttranslational modifications and 3D structural data which are all relatively abundant in the field of protein toxins. Researchers are welcome to contribute their knowledge to the scientific community by submitting relevant findings to Swiss-Prot concerning toxins at Tox-Prot@isb-sib.ch. More information on Tox-Prot can be found at http://www.expasy.org/sprot/tox-prot. PMID:15683867

  19. The Mucus of Actinia equina (Anthozoa, Cnidaria: An Unexplored Resource for Potential Applicative Purposes

    Directory of Open Access Journals (Sweden)

    Loredana Stabili

    2015-08-01

    Full Text Available The mucus produced by many marine organisms is a complex mixture of proteins and polysaccharides forming a weak watery gel. It is essential for vital processes including locomotion, navigation, structural support, heterotrophic feeding and defence against a multitude of environmental stresses, predators, parasites, and pathogens. In the present study we focused on mucus produced by a benthic cnidarian, the sea anemone Actinia equina (Linnaeus, 1758 for preventing burial by excess sedimentation and for protection. We investigated some of the physico-chemical properties of this matrix such as viscosity, osmolarity, electrical conductivity, protein, carbohydrate, and total lipid contents. Some biological activities such as hemolytic, cytotoxic, and antibacterial lysozyme-like activities were also studied. The A. equina mucus is mainly composed by water (96.2% ± 0.3%, whereas its dry weight is made of 24.2% ± 1.3% proteins and 7.8% ± 0.2% carbohydrates, with the smallest and largest components referable to lipids (0.9% and inorganic matter (67.1%. The A. equina mucus matrix exhibited hemolytic activity on rabbit erythrocytes, cytotoxic activity against the tumor cell line K562 (human erythromyeloblastoid leukemia and antibacterial lysozyme-like activity. The findings from this study improve the available information on the mucus composition in invertebrates and have implications for future investigations related to exploitation of A. equina and other sea anemones’ mucus as a source of bioactive compounds of high pharmaceutical and biotechnological interest.

  20. Hydra actinoporin-like toxin-1, an unusual hemolysin from the nematocyst venom of Hydra magnipapillata which belongs to an extended gene family.

    Science.gov (United States)

    Glasser, Eliezra; Rachamim, Tamar; Aharonovich, Dikla; Sher, Daniel

    2014-12-01

    Cnidarians rely on their nematocysts and the venom injected through these unique weaponry systems to catch prey and protect themselves from predators. The development and physiology of the nematocysts of Hydra magnipapillata, a classic model organism, have been intensively studied, yet the composition and biochemical activity of their venom components are mostly unknown. Here, we show that hydra actinoporin-like toxins (HALTs), which have previously been associated with Hydra nematocysts, belong to a multigene family comprising six genes, which have diverged from a single common ancestor. All six genes are expressed in a population of Hydra magnipapillata. When expressed recombinantly, HALT-1 (Δ-HYTX-Hma1a), an actinoporin-like protein found in the stenoteles (the main penetrating nematocysts used in prey capture), reveals hemolytic activity, albeit about two-thirds lower than that of the anemone actinoporin equinatoxin II (EqTII, Δ-AITX-Aeq1a). HALT-1 also differs from EqTII in the size of its pores, and likely does not utilize sphingomyelin as a membrane receptor. We describe features of the HALT-1 sequence which may contribute to this difference in activity, and speculate on the role of this unusual family of pore-forming toxins in the ecology of Hydra. PMID:24768765

  1. Aiptasia sp. larvae as a model to reveal mechanisms of symbiont selection in cnidarians

    Science.gov (United States)

    Wolfowicz, Iliona; Baumgarten, Sebastian; Voss, Philipp A.; Hambleton, Elizabeth A.; Voolstra, Christian R.; Hatta, Masayuki; Guse, Annika

    2016-01-01

    Symbiosis, defined as the persistent association between two distinct species, is an evolutionary and ecologically critical phenomenon facilitating survival of both partners in diverse habitats. The biodiversity of coral reef ecosystems depends on a functional symbiosis with photosynthetic dinoflagellates of the highly diverse genus Symbiodinium, which reside in coral host cells and continuously support their nutrition. The mechanisms underlying symbiont selection to establish a stable endosymbiosis in non-symbiotic juvenile corals are unclear. Here we show for the first time that symbiont selection patterns for larvae of two Acropora coral species and the model anemone Aiptasia are similar under controlled conditions. We find that Aiptasia larvae distinguish between compatible and incompatible symbionts during uptake into the gastric cavity and phagocytosis. Using RNA-Seq, we identify a set of candidate genes potentially involved in symbiosis establishment. Together, our data complement existing molecular resources to mechanistically dissect symbiont phagocytosis in cnidarians under controlled conditions, thereby strengthening the role of Aiptasia larvae as a powerful model for cnidarian endosymbiosis establishment. PMID:27582179

  2. Coral larvae move toward reef sounds.

    Directory of Open Access Journals (Sweden)

    Mark J A Vermeij

    Full Text Available Free-swimming larvae of tropical corals go through a critical life-phase when they return from the open ocean to select a suitable settlement substrate. During the planktonic phase of their life cycle, the behaviours of small coral larvae (<1 mm that influence settlement success are difficult to observe in situ and are therefore largely unknown. Here, we show that coral larvae respond to acoustic cues that may facilitate detection of habitat from large distances and from upcurrent of preferred settlement locations. Using in situ choice chambers, we found that settling coral larvae were attracted to reef sounds, produced mainly by fish and crustaceans, which we broadcast underwater using loudspeakers. Our discovery that coral larvae can detect and respond to sound is the first description of an auditory response in the invertebrate phylum Cnidaria, which includes jellyfish, anemones, and hydroids as well as corals. If, like settlement-stage reef fish and crustaceans, coral larvae use reef noise as a cue for orientation, the alleviation of noise pollution in the marine environment may gain further urgency.

  3. A novel astaxanthin-binding photooxidative stress-inducible aqueous carotenoprotein from a eukaryotic microalga isolated from asphalt in midsummer.

    Science.gov (United States)

    Kawasaki, Shinji; Mizuguchi, Keisuke; Sato, Masaru; Kono, Tetsuya; Shimizu, Hirofumi

    2013-07-01

    Water-soluble orange carotenoid proteins (OCPs) that bind 3'-hydroxyechinenone are found in cyanobacteria, and are thought to play a key role in photoprotection. The distribution of OCPs in eukaryotes remains largely unknown. In this study, we identified a novel OCP that predominantly binds astaxanthin from a eukaryotic microalga, strain Ki-4, isolated from a dry surface of heated asphalt in midsummer. A purified astaxanthin-binding OCP, named AstaP, shows high solubility in water with an absorption peak at 484 nm, and possesses a heat-stable activity that quenches singlet oxygen. The deduced amino acid sequence of AstaP comprises an N-terminal hydrophobic signal peptide, fasciclin domains found in secreted and cell surface proteins, and N-linked glycosylation sites, the first example of a carotenoprotein among fasciclin family proteins. AstaP homologs of unknown function are distributed mainly in organisms from the hydrosphere, such as marine bacteria, cyanobacteria, sea anemone and eukaryotic microalgae; however, AstaP exhibits a unique extraordinarily high isoelectric point (pI) value among homologs. The gene encoding AstaP, as well as the AstaP peptide, is expressed abundantly under conditions of dehydration and salt stress in conjunction with high light exposure. As a unique aqueous carotenoprotein, AstaP will provide a novel function of OCPs in protection against extreme photooxidative stresses. PMID:23737502

  4. Aiptasia sp. larvae as a model to reveal mechanisms of symbiont selection in cnidarians.

    Science.gov (United States)

    Wolfowicz, Iliona; Baumgarten, Sebastian; Voss, Philipp A; Hambleton, Elizabeth A; Voolstra, Christian R; Hatta, Masayuki; Guse, Annika

    2016-01-01

    Symbiosis, defined as the persistent association between two distinct species, is an evolutionary and ecologically critical phenomenon facilitating survival of both partners in diverse habitats. The biodiversity of coral reef ecosystems depends on a functional symbiosis with photosynthetic dinoflagellates of the highly diverse genus Symbiodinium, which reside in coral host cells and continuously support their nutrition. The mechanisms underlying symbiont selection to establish a stable endosymbiosis in non-symbiotic juvenile corals are unclear. Here we show for the first time that symbiont selection patterns for larvae of two Acropora coral species and the model anemone Aiptasia are similar under controlled conditions. We find that Aiptasia larvae distinguish between compatible and incompatible symbionts during uptake into the gastric cavity and phagocytosis. Using RNA-Seq, we identify a set of candidate genes potentially involved in symbiosis establishment. Together, our data complement existing molecular resources to mechanistically dissect symbiont phagocytosis in cnidarians under controlled conditions, thereby strengthening the role of Aiptasia larvae as a powerful model for cnidarian endosymbiosis establishment. PMID:27582179

  5. Relative Contributions of Various Cellular Mechanisms to Loss of Algae during Cnidarian Bleaching

    Science.gov (United States)

    Bieri, Tamaki; Onishi, Masayuki; Xiang, Tingting; Grossman, Arthur R.; Pringle, John R

    2016-01-01

    When exposed to stress such as high seawater temperature, corals and other cnidarians can bleach due to loss of symbiotic algae from the host tissue and/or loss of pigments from the algae. Although the environmental conditions that trigger bleaching are reasonably well known, its cellular and molecular mechanisms are not well understood. Previous studies have reported the occurrence of at least four different cellular mechanisms for the loss of symbiotic algae from the host tissue: in situ degradation of algae, exocytic release of algae from the host, detachment of host cells containing algae, and death of host cells containing algae. The relative contributions of these several mechanisms to bleaching remain unclear, and it is also not known whether these relative contributions change in animals subjected to different types and/or durations of stresses. In this study, we used a clonal population of the small sea anemone Aiptasia, exposed individuals to various precisely controlled stress conditions, and quantitatively assessed the several possible bleaching mechanisms in parallel. Under all stress conditions tested, except for acute cold shock at 4°C, expulsion of intact algae from the host cells appeared to be by far the predominant mechanism of bleaching. During acute cold shock, in situ degradation of algae and host-cell detachment also became quantitatively significant, and the algae released under these conditions appeared to be severely damaged. PMID:27119147

  6. Deep-sea food web analysis using cross-reacting antisera

    Science.gov (United States)

    Feller, Robert J.; Zagursky, Gregory; Day, Elizabeth A.

    1985-04-01

    The high incidence of unrecognizable prey in the stomachs of deep-sea predators prompted the application of serological methods for identification of trophic connections. Antisera to whole-organism extracts of estuarine taxa cross-reacted with antigenic protein extracts of mid-water and deep-sea taxa along phylogenetically correct lines, indicating their potential as tools for gut contents immunoassay. Stomach, intestine, and rectum contents of grenadiers ( Coryphaenoides armatus) trapped at 2500 m in the North Atlantic were analyzed visually and with 32 antisera representing taxa from 10 common deep-sea phyla. While visual analysis only revealed the presence of fluids, parasites, crustacean exoskeletons, and gastropod opercula, the immunoassay indicated the presence of antigenic proteins from holothurian, anemone, gastropod, decapod, and foraminiferan prey in the same samples. This qualitative serological identification of prey at non-specific taxonomic levels provides evidence that benthic predation may be important within deep-sea communities. The immunoassay technique, although not a panacea for elucidating food web dynamics in remote environments, may be useful when other methods fail to identify trophic pathways.

  7. The membranotropic activity of N-terminal peptides from the pore-forming proteins sticholysin I and II is modulated by hydrophobic and electrostatic interactions as well as lipid composition

    Indian Academy of Sciences (India)

    Uris Ros; Lohans Pedrera; Daylín Díaz; Juan C De Karam; Tatiane P Sudbrack; Pedro A Valiente; Diana Martínez; Eduardo M Cilli; Fabiola Pazos; Rosangela Itri; Maria E Lanio; Shirley Schreier; Carlos Álvarez

    2011-12-01

    The sea anemone Stichodactyla helianthus produces two pore-forming proteins, sticholysins I and II (St I and St II). Despite their high identity (93%), these toxins exhibit differences in hemolytic activity that can be related to those found in their N-terminal. To clarify the contribution of the N-terminal amino acid residues to the activity of the toxins, we synthesized peptides spanning residues 1–31 of St I (StI1-31) or 1–30 of St II (StII1-30) and demonstrated that StII1-30 promotes erythrocyte lysis to a higher extent than StI1-31. For a better understanding of the molecular mechanism underlying the peptide activity, here we studied their binding to lipid monolayers and pemeabilizing activity in liposomes. For this, we examined the effect on peptide membranotropic activity of including phospatidic acid and cholesterol in a lipid mixture of phosphatidylcholine and sphingomyelin. The results suggest the importance of continuity of the 1–10 hydrophobic sequence in StII1-30 for displaying higher binding and activity, in spite of both peptides’ abilities to form pores in giant unilamellar vesicles. Thus, the different peptide membranotropic action is explained in terms of the differences in hydrophobic and electrostatic peptide properties as well as the enhancing role of membrane inhomogeneities.

  8. Chromophore Deprotonation State Alters the Optical Properties of Blue Chromoprotein.

    Directory of Open Access Journals (Sweden)

    Cheng-Yi Chiang

    Full Text Available Chromoproteins (CPs have unique colors and can be used in biological applications. In this work, a novel blue CP with a maximum absorption peak (λmax at 608 nm was identified from the carpet anemone Stichodactyla gigantea (sgBP. In vivo expression of sgBP in zebrafish would change the appearance of the fishes to have a blue color, indicating the potential biomarker function. To enhance the color properties, the crystal structure of sgBP at 2.25 Å resolution was determined to allow structure-based protein engineering. Among the mutations conducted in the Gln-Tyr-Gly chromophore and chromophore environment, a S157C mutation shifted the λmax to 604 nm with an extinction coefficient (ε of 58,029 M-1·cm-1 and darkened the blue color expression. The S157C mutation in the sgBP chromophore environment could affect the color expression by altering the deprotonation state of the phenolic group in the chromophore. Our results provide a structural basis for the blue color enhancement of the biomarker development.

  9. Palytoxin found in Palythoa sp. zoanthids (Anthozoa, Hexacorallia sold in the home aquarium trade.

    Directory of Open Access Journals (Sweden)

    Jonathan R Deeds

    Full Text Available Zoanthids (Anthozoa, Hexacorallia are colonial anemones that contain one of the deadliest toxins ever discovered, palytoxin (LD(50 in mice 300 ng/kg, but it is generally believed that highly toxic species are not sold in the home aquarium trade. We previously showed that an unintentionally introduced zoanthid in a home aquarium contained high concentrations of palytoxin and was likely responsible for a severe respiratory reaction when an individual attempted to eliminate the contaminant colonies using boiling water. To assess the availability and potential exposure of palytoxin to marine aquarium hobbyists, we analyzed zoanthid samples collected from local aquarium stores for palytoxin using liquid chromatography and high resolution mass spectrometry and attempted to identify the specimens through genetic analysis of 16S and cytochrome c oxidase 1 (COI markers. We found four specimens of the same apparent species of zoanthid, that we described previously to be responsible for a severe respiratory reaction in a home aquarium, to be available in three aquarium stores in the Washington D.C. area. We found all of these specimens (n = 4 to be highly toxic with palytoxin or palytoxin-like compounds (range 0.5-3.5 mg crude toxin/g zoanthid. One of the most potent non-protein compounds ever discovered is present in dangerous quantities in a select species of zoanthid commonly sold in the home aquarium trade.

  10. Identification of a membrane-bound prepore species clarifies the lytic mechanism of actinoporins

    CERN Document Server

    Morante, Koldo; Gil-Cartón, David; Redondo-Morata, Lorena; Sot, Jesús; Scheuring, Simon; Valle, Mikel; González-Mañas, Juan Manuel; Tsumoto, Kouhei; Caaveiro, Jose M M

    2016-01-01

    Pore-forming toxins (PFT) are cytolytic proteins belonging to the molecular warfare apparatus of living organisms. The assembly of the functional transmembrane pore requires several intermediate steps ranging from a water-soluble monomeric species to the multimeric ensemble inserted in the cell membrane. The non-lytic oligomeric intermediate known as prepore plays an essential role in the mechanism of insertion of the class of $\\beta$-PFT. However, in the class of $\\alpha$-PFT like the actinoporins produced by sea anemones, evidence of membrane-bound prepores is still lacking. We have employed single-particle cryo-electron microscopy (cryo-EM) and atomic force microscopy (AFM) to identify, for the first time, a prepore species of the actinoporin fragaceatoxin C (FraC) bound to lipid vesicles. The size of the prepore coincides that of the functional pore, except for the transmembrane region, which is absent in the prepore. Biochemical assays indicated that, in the prepore species, the N-terminus is not inserte...

  11. Signatures of interchange reconnection: STEREO, ACE and Hinode observations combined

    Directory of Open Access Journals (Sweden)

    D. Baker

    2009-10-01

    Full Text Available Combining STEREO, ACE and Hinode observations has presented an opportunity to follow a filament eruption and coronal mass ejection (CME on 17 October 2007 from an active region (AR inside a coronal hole (CH into the heliosphere. This particular combination of "open" and closed magnetic topologies provides an ideal scenario for interchange reconnection to take place. With Hinode and STEREO data we were able to identify the emergence time and type of structure seen in the in-situ data four days later. On the 21st, ACE observed in-situ the passage of an ICME with "open" magnetic topology. The magnetic field configuration of the source, a mature AR located inside an equatorial CH, has important implications for the solar and interplanetary signatures of the eruption. We interpret the formation of an "anemone" structure of the erupting AR and the passage in-situ of the ICME being disconnected at one leg, as manifested by uni-directional suprathermal electron flux in the ICME, to be a direct result of interchange reconnection between closed loops of the CME originating from the AR and "open" field lines of the surrounding CH.

  12. Signatures of Interchange Reconnection: STEREO, ACE and Hinode Observations Combined

    CERN Document Server

    Baker, D; Van Driel-Gesztelyi, L; Demoulin, P; Harra, L K; Lavraud, B; Davies, J A; Optiz, A; Luhmann, J G; Sauvaud, J A; Galvin, A B

    2009-01-01

    Combining STEREO, ACE and Hinode observations has presented an opportunity to follow a filament eruption and coronal mass ejection (CME) on the 17th of October 2007 from an active region (AR) inside a coronal hole (CH) into the heliosphere. This particular combination of `open' and closed magnetic topologies provides an ideal scenario for interchange reconnection to take place. With Hinode and STEREO data we were able to identify the emergence time and type of structure seen in the in-situ data four days later. On the 21st, ACE observed in-situ the passage of an ICME with `open' magnetic topology. The magnetic field configuration of the source, a mature AR located inside an equatorial CH, has important implications for the solar and interplanetary signatures of the eruption. We interpret the formation of an `anemone' structure of the erupting AR and the passage in-situ of the ICME being disconnected at one leg, as manifested by uni-directional suprathermal electron flux in the ICME, to be a direct result of i...

  13. [Dangerous marine animals].

    Science.gov (United States)

    Antensteiner, G

    1999-01-01

    Sea-biological basic knowledge for divers is offered only in special lessons for advanced scuba divers. According to statistics, however, five per cent of the deadly diving accidents are caused by underwater organisms. This number could be reduced to a fraction, by correct behaviour during the dive and after an accident. The most frequent accidents with sea animals during water sports are not by unprovoked shark attacks, which cause six deaths world-wide per year on the average, but turn out with usually well camouflaged sea inhabitants, that do not attack humans, rather by their inadvertence coincidentally get in contact with it. The various defense instruments of the often small, inconspicuous organisms reach from teeth over poison stings, pricks, spines, scalpelles, nettle injections and chemical weapons up to poison arrows. Due to that variety of the maritime life, the most important representatives of its type are explained including severity level of the caused injury or contamination. Both, diagnostic position and therapy possibility are described as follows: 1. Porifera (sponge), 2. Hydrozoa (white weed, yellow flower head), Actinaria (sea anemones), 3. Conidae (cone shells), Tridocna (giant clam), octopoda (octopus), 4. Acanthaster planci (crown of thorns), Echinodea (sea urchins), Holothurioidea (sea cucumber), 5. Selachoidei (shark), Batoidei (Ray), Muraenidae (moray), Plotosidae (barbel eels), Synanciidae (stonefish), Scorpaenidae (scorpionfish), Pterois (lion fish), Sphyraena Spec. (barracuda), Balistidae (triggerfish), Ostracionidae (puffer). PMID:11315406

  14. [Marine life envenomations: example in New Caledonia].

    Science.gov (United States)

    Rual, F

    1999-01-01

    Marine life in the waters of New Caledonia is extraordinarily rich. However some of the animals inhabiting this wonderland are dangerous including a number of venomous species. A retrospective study conducted at the Territorial Hospital in Noumea for the three-year period between 1995 and 1998 showed that nearly 200 people/year were victims of envenomation by marine animals. Findings also indicated that the incidence of envenomation was rising as the practice of marine activities by the local population and tourists increased. Venomous species can be classified into 4 categories according to the mechanism of envenomation, i.e., biting animals such as sea snakes, cephalopoda, and eels; stinging animals including not only fish such as scorpion fish (Pterois, stonefish), sting-rays, saltwater catfish, surgeon fish, and flatfish but also cones and crown of thorns (Acanthaster planci); animals with contact venoms such as cnidaria (jellyfish, corals, sea anemones, and men-of-war), glaucus, sea cucumbers (holothurioidae), and sponges; and animals with more than one envenomation apparatus such as sea urchins and sea worms which can bite and sting. Study focused on the characteristics of each species including biology, envenomation apparatus, and chemical composition and action of the venom; pharmacological and clinical aspects of envenomation; and management and prevention of accidents. PMID:10701210

  15. A manual collection of Syt, Esyt, Rph3a, Rph3al, Doc2, and Dblc2 genes from 46 metazoan genomes - an open access resource for neuroscience and evolutionary biology

    Directory of Open Access Journals (Sweden)

    Craxton Molly

    2010-01-01

    Full Text Available Abstract Background Synaptotagmin proteins were first identified in nervous tissue, residing in synaptic vesicles. Synaptotagmins were subsequently found to form a large family, some members of which play important roles in calcium triggered exocytic events. These members have been investigated intensively, but other family members are not well understood, making it difficult to grasp the meaning of family membership in functional terms. Further difficulty arises as families are defined quite legitimately in different ways: by common descent or by common possession of distinguishing features. One definition does not necessarily imply the other. The evolutionary range of genome sequences now available, can shed more light on synaptotagmin gene phylogeny and clarify family relationships. The aim of compiling this open access collection of synaptotagmin and synaptotagmin-like sequences, is that its use may lead to greater understanding of the biological function of these proteins in an evolutionary context. Results 46 metazoan genomes were examined and their complement of Syt, Esyt, Rph3a, Rph3al, Doc2 and Dblc2 genes identified. All of the sequences were compared, named, then examined in detail. Esyt genes were formerly named Fam62. The species in this collection are Trichoplax, Nematostella, Capitella, Helobdella, Lottia, Ciona, Strongylocentrotus, Branchiostoma, Ixodes, Daphnia, Acyrthosiphon, Tribolium, Nasonia, Apis, Anopheles, Drosophila, Caenorhabditis, Takifugu, Tetraodon, Gasterosteus, Oryzias, Danio, Xenopus, Anolis, Gallus, Taeniopygia,Ornithorhynchus, Monodelphis, Mus and Homo. All of the data described in this paper is available as additional files. Conclusions Only a subset of synaptotagmin proteins appear able to function as calcium triggers. Syt1, Syt7 and Syt9 are ancient conserved synaptotagmins of this type. Some animals carry extensive repertoires of synaptotagmin genes. Other animals of no less complexity, carry only a small

  16. Biological and Geological Characteristics of the Gakkel Ridge

    Science.gov (United States)

    Shank, T. M.; Bailey, J.; Edmonds, H.; Forte, P.; Helmke, E.; Humphris, S.; Kemp, J.; Nakamura, K.; Reves-Sohn, R.; Singh, H.; Willis, C.

    2007-12-01

    The Gakkel Ridge (Arctic Ocean) is one of the slowest (1.0 cm per yr), deepest (5000 m axial depth), and most hydrographically and tectonically isolated mid-ocean ridge systems on earth. This isolation from the global ridge system should have profound implications for the evolution and ecology of resident chemosynthetic fauna. The July 2007 Arctic GAkkel Vents Expedition (AGAVE) sought to define this Arctic biogeographic province and the relationship of Arctic vent fauna to Atlantic, Pacific, and hydrocarbon seep fauna through the use of an new under- ice vehicle `Camper', a fiber-optic video-guided sampling system drift towed 1 to 3 m above the seafloor. The imaging, sampling, and sensing capabilities were used to obtain high-resolution seafloor imagery to identify and collect benthic samples with a clamshell `grab' sampler and a suction 'slurp' sampler. Imagery from five video cameras, including obliquely-mounted video and downlooking digital high-definition color cameras were used to construct maps of seafloor features and faunal composition during 3 dives in the peridotite-hosted 7°E region and 13 dives in the volcanic 85°E region. The 7°E site was dominated by an almost continuous cover of pelagic sediment with abundant animal tracks, brittle stars, anemones, and shrimp. The explored 85°E area was dominated by relatively diverse and young lava morphologies- from large pillows hosting delicate surface ornamentation to lobates, long lava tubes, and fresh sheet flows, all with the upper surfaces covered (often cm thick) of fresh volcanic glass 'sediment' suggestive of explosive volcanic activity in the `recent' past. Fauna in these areas consisted mainly of sponges, anemones, amphipods and shrimp. Characterization of the newly-discovered Asgard volcanic chain, including `Oden', `Thor', and `Loke' volcanoes, in the 85°E axial valley revealed extensive microbial mats in the form of: 1) yellow `fluffy' material (often >5 cm thick) in places; and 2) yellow

  17. Patrones asociados a la conducta de desplazamiento local en Phymactis clematis Drayton (Anthozoa: Actiniidae Patterns of local movement behavior in Phymactis clematis Drayton (Anthozoa: Actiniidae

    Directory of Open Access Journals (Sweden)

    MARCELO M. RIVADENEIRA

    2001-12-01

    species of sea anemone along the South American coast. Likewise other sea anemone species, the adults of the P. clematis would have an active ability to make local movements. However, these have not been properly described, and causal factors are unknown. In this work we try to describe some of the basic patterns associated to the local movement behavior in P. clematis, assessed indirectly from the presence of bare rock halos around individuals in two rocky intertidal sites in the coast of northern Chile (Cavancha and Colorado Chico. Movements were more frequent and had a higher intensity at Colorado Chico, where over 50 % of individuals showed movements, although they were mainly lower than 60 mm in length. At Colorado Chico, movements would occur in individuals larger than 40 mm of pedal diameter, whereas their intensity would decrease with body size. We discussed that causes of higher movement activity at Colorado Chico could be associated to the higher abundance and lower inter-individual spacing, which would produce physical interference among individuals. In this way, we suggested that the patterns associated to the individual's body size would arise secondarily, being dependent on the levels of local abundance. Despite local movements of P. clematis at Colorado Chico occurred at a scale of a few centimeters, they could be affecting significantly the inter-individual spacing, increasing the average nearest neighbor distance. We argue that local movements could be an effective mechanism reducing the intraspecific competition in P. clematis

  18. Are Hox genes ancestrally involved in axial patterning? Evidence from the hydrozoan Clytia hemisphaerica (Cnidaria.

    Directory of Open Access Journals (Sweden)

    Roxane Chiori

    Full Text Available BACKGROUND: The early evolution and diversification of Hox-related genes in eumetazoans has been the subject of conflicting hypotheses concerning the evolutionary conservation of their role in axial patterning and the pre-bilaterian origin of the Hox and ParaHox clusters. The diversification of Hox/ParaHox genes clearly predates the origin of bilaterians. However, the existence of a "Hox code" predating the cnidarian-bilaterian ancestor and supporting the deep homology of axes is more controversial. This assumption was mainly based on the interpretation of Hox expression data from the sea anemone, but growing evidence from other cnidarian taxa puts into question this hypothesis. METHODOLOGY/PRINCIPAL FINDINGS: Hox, ParaHox and Hox-related genes have been investigated here by phylogenetic analysis and in situ hybridisation in Clytia hemisphaerica, an hydrozoan species with medusa and polyp stages alternating in the life cycle. Our phylogenetic analyses do not support an origin of ParaHox and Hox genes by duplication of an ancestral ProtoHox cluster, and reveal a diversification of the cnidarian HOX9-14 genes into three groups called A, B, C. Among the 7 examined genes, only those belonging to the HOX9-14 and the CDX groups exhibit a restricted expression along the oral-aboral axis during development and in the planula larva, while the others are expressed in very specialised areas at the medusa stage. CONCLUSIONS/SIGNIFICANCE: Cross species comparison reveals a strong variability of gene expression along the oral-aboral axis and during the life cycle among cnidarian lineages. The most parsimonious interpretation is that the Hox code, collinearity and conservative role along the antero-posterior axis are bilaterian innovations.

  19. Response of megabenthic assemblages to different scales of habitat heterogeneity on the Mauritanian slope

    Science.gov (United States)

    Jones, Daniel O. B.; Brewer, Michael E.

    2012-09-01

    The topographically complex deep seabed on the Mauritanian slope, from 990 to 1460 m water depth, was imaged with video in an extensive quantitative survey of 17,199 m2 of seafloor using a Remote Operated Vehicle (ROV). This study investigated the influence of habitat heterogeneity at two scales on the megafaunal assemblages observed by ROV. Changes in megafaunal assemblages on the Mauritanian slope were assessed at a broad scale, within depth zones, and at a finer scale, in response to changes in local geomorphology associated with submarine landslides. Geomorphology was determined by classification of habitat parameters (slope, aspect, bathymetric position, curvature, fractal dimension and ruggedness) derived from an autonomous underwater vehicle-based multibeam bathymetry survey. Habitat parameters were classified by Iterative Self Organizing Clustering into six major geomorphological groups, four of which were assessed in the ROV video survey. A total of 29 megafaunal taxa were observed along the entire survey, with an overall average faunal density of 0.344 ind m-2. Megafaunal assemblage density, species richness and evenness varied significantly across the depth range of the survey in the most common geomorphological zone (sedimentary plains of low slope and complexity). Characteristic species inhabited the shallow areas (asteroid, ophiuroid, anemone, small macrourid), intermediate areas (Benthothuria funabris, black cerianthid, squat lobster) and deeper areas (the holothurians Enypniastes eximia and Elipidia echinata). Megafaunal density, species richness and evenness were not significantly different between geomorphogical groups within one depth zone (1300-1400 m). However, the steepest zone, on the edge of a major headwall feature, had four unique taxa (Parapagurus pilosimanus, a comatulid crinoid, a gorgonian and its associated ophiuroid).

  20. Na+ channels as sites of action of the cardioactive agent DPI 201-106 with agonist and antagonist enantiomers

    International Nuclear Information System (INIS)

    This paper shows the interaction of the cardiotonic agent 4-[3-(4-diphenylmethyl-1-piperazinyl)-2-hydroxypropoxy]-1H-indole-2-carbonitrile (DPI 201-106) and its optic enantiomers R-DPI (205-429) and S-DPI (205-430) with the Na+ channel of a variety of excitable cells. Voltage-clamp experiments show that DPI 201-106 acts on neuroblastoma cells and rat cardiac cells. S-DPI (205-430) increases the peak Na+ current, slows down the kinetics of Na+ channel inactivation, and is cardiotonic on heart cells. Conversely, R-DPI (205-429) reduces the peak Na+ current and blocks Na+ channel activity and cardiac contractions. Binding experiments using radioactively labeled toxins indicate that DPI 201-106 and its enantiomers do not interact with sites already identified for tetrodotoxin or sea anemone and scorpion toxins. DPI 201-106 and its enantiomers inhibit binding of a 3H-labeled batrachotoxin derivative, [3H]batrachotoxinin A 20-α-benzoate, to brain membranes. The dissociation constant of the complex formed between the Na+ channel and both R-DPI and S-DPI is K/sub d/ ∼ 100 nM. 22Na+ uptake experiments using different cell types have shown that R and S enantiomers of DPI 201-106 are active on the different Na+ channel subtypes with similar IC50 values. These results are discussed in relation with the cardiotonic properties of DPI 201-106 that are not accompanied by cardiotoxic effects

  1. Mutations in Nature Conferred a High Affinity Phosphatidylinositol 4,5-Bisphosphate-binding Site in Vertebrate Inwardly Rectifying Potassium Channels.

    Science.gov (United States)

    Tang, Qiong-Yao; Larry, Trevor; Hendra, Kalen; Yamamoto, Erica; Bell, Jessica; Cui, Meng; Logothetis, Diomedes E; Boland, Linda M

    2015-07-01

    All vertebrate inwardly rectifying potassium (Kir) channels are activated by phosphatidylinositol 4,5-bisphosphate (PIP2) (Logothetis, D. E., Petrou, V. I., Zhang, M., Mahajan, R., Meng, X. Y., Adney, S. K., Cui, M., and Baki, L. (2015) Annu. Rev. Physiol. 77, 81-104; Fürst, O., Mondou, B., and D'Avanzo, N. (2014) Front. Physiol. 4, 404-404). Structural components of a PIP2-binding site are conserved in vertebrate Kir channels but not in distantly related animals such as sponges and sea anemones. To expand our understanding of the structure-function relationships of PIP2 regulation of Kir channels, we studied AqKir, which was cloned from the marine sponge Amphimedon queenslandica, an animal that represents the phylogenetically oldest metazoans. A requirement for PIP2 in the maintenance of AqKir activity was examined in intact oocytes by activation of a co-expressed voltage-sensing phosphatase, application of wortmannin (at micromolar concentrations), and activation of a co-expressed muscarinic acetylcholine receptor. All three mechanisms to reduce the availability of PIP2 resulted in inhibition of AqKir current. However, time-dependent rundown of AqKir currents in inside-out patches could not be re-activated by direct application to the inside membrane surface of water-soluble dioctanoyl PIP2, and the current was incompletely re-activated by the more hydrophobic arachidonyl stearyl PIP2. When we introduced mutations to AqKir to restore two positive charges within the vertebrate PIP2-binding site, both forms of PIP2 strongly re-activated the mutant sponge channels in inside-out patches. Molecular dynamics simulations validate the additional hydrogen bonding potential of the sponge channel mutants. Thus, nature's mutations conferred a high affinity activation of vertebrate Kir channels by PIP2, and this is a more recent evolutionary development than the structures that explain ion channel selectivity and inward rectification. PMID:25957411

  2. CoralWatch Data Analysis at Hoi Ha Wan Marine Park, Hong Kong

    Science.gov (United States)

    Lau, A.; Hodgson, P.

    2015-12-01

    CoralWatch is a conservation organization that is based at the University of Queensland in Australia. Their development of the "Coral Health Chart" standardized the colour of corals for the further investigation of coral health and bleaching. The location of this project is in the NE part of Hong Kong in New Territories. The location faces ShenZhen, a heavily industrialized city, which is known for its pollution of the Pearl River. This area is protected by the Hong Kong Government and the WWF since 1996.Human activities have caused large amounts of greenhouse gasses to be released into the atmosphere. Carbon dioxide has caused the global temperature to rise and made ocean waters more acidic due to ocean respiration. The ocean is a carbon sink for mankind and the effect of severe acidification is negatively affecting marine life. The increase of temperature diminishes the amount of diversity of marine life; the decreasing acidity of the water has eliminated many species of shellfish and sea anemone; the increase of marine exploitation has decreased the diversity of marine life. The release of toxic waste, mainly mercury, waste and plastic products has also polluted the oceans which negatively impact coral reefs and endanger marine life.The data has been collected by observing the colours and discolouration (bleaching) of the corals of approximately 40 colonies per month. The species of coral in Hoi Ha Wan include, Favites flexuosa, Goniopora columna,Leptastrea purpurea, Lithophyllon undulatum, Pavona decussata. and Platygyra acuta (AFCD,1). The evaluation of four years of coralwatch data has shown the bleaching of hard boulder corals in Hoi Ha Wan, Hong Kong, has halted and the reefs are being to show signs of regeneration. Local marine biologists credited the improved situation of the corals to protected status of the area.

  3. A critical assessment of marine aquarist biodiversity data and commercial aquaculture: identifying gaps in culture initiatives to inform local fisheries managers.

    Directory of Open Access Journals (Sweden)

    Joanna M Murray

    Full Text Available It is widely accepted that if well managed, the marine aquarium trade could provide socio-economic stability to local communities while incentivising the maintenance of coral reefs. However, the trade has also been implicated as having potentially widespread environmental impacts that has in part driven developments in aquaculture to relieve wild collection pressures. This study investigates the biodiversity in hobbyist aquaria (using an online survey and those species currently available from an aquaculture source (commercial data and hobbyist initiatives in the context of a traffic light system to highlight gaps in aquaculture effort and identify groups that require fisheries assessments. Two hundred and sixty nine species including clown fish, damsels, dotty backs, angelfish, gobies, sea horses and blennies, have reported breeding successes by hobbyists, a pattern mirrored by the European and US commercial organisations. However, there is a mismatch (high demand and low/non-existent aquaculture for a number of groups including tangs, starfish, anemones and hermit crabs, which we recommend are priority candidates for local stock assessments. Hobbyist perception towards the concept of a sustainable aquarium trade is also explored with results demonstrating that only 40% of respondents were in agreement with industry and scientists who believe the trade could be an exemplar of a sustainable use of coral reefs. We believe that a more transparent evidence base, including the publication of the species collected and cultured, will go some way to align the concept of a sustainable trade across industry stakeholders and better inform the hobbyist when purchasing their aquaria stock. We conclude by proposing that a certification scheme established with government support is the most effective way to move towards a self-regulating industry. It would prevent industry "greenwashing" from multiple certification schemes, alleviate conservation concerns

  4. Impact of grazing management with large herbivores on forest ground flora and bramble understorey

    Science.gov (United States)

    Van Uytvanck, Jan; Hoffmann, Maurice

    2009-07-01

    We investigated whether grazing management with large herbivores is appropriate to reduce expanding bramble ( Rubus sp.) in an ancient forest in Flanders (N. Belgium). We further studied interaction effects of four years (all year-round) grazing and Rubus cover on the presence, cover, and flowering of five forest ground flora species (unpalatable: Anemone nemorosa and Primula elatior; palatable: Hyacinthoides non-scripta, Vinca minor and Hedera helix). We collected data on eight transects and in 412 plots in adjacent grazed and ungrazed forest and used baseline datasets of 1996 and 2002 in the same area (i.e. before grazing). In a field experiment, we simulated grazing (by clipping) and trampling (by pressing a weight) in eight homogeneous A. nemorosa vegetation stands. Large Rubus thickets had a clear negative impact on cover and flowering of A. nemorosa due to competition for light. Four years of cattle grazing reduced bramble cover by more than 50%, but then the limiting factor for A. nemorosa cover and flowering shifted to trampling damage. We also found lower cover and flowering of H. non-scripta in grazed plots, as a consequence of direct grazing. The evergreen species V. minor and H. helix totally disappeared from the grazed forest. Simulated once-only effects of grazing and trampling had a small and short term negative impact on cover of A. nemorosa, but flowering was strongly reduced. Grazing reduced biomass with 25-30% in the following years. Year-round grazing with large herbivores is an appropriate measure for bramble control in forests, but negative effects on ground flora are possible if grazing pressure is high. A low or moderate grazing pressure (<0.25 animal units ha -1 y -1) should be maintained in landscape mosaics with grassland and forest; or intermittent periods of non-grazing should be provided to maintain forest ground flora diversity.

  5. Identification Of Some Strains Of Dinoflagellates Based On Morphology And Molecular Analysis

    Directory of Open Access Journals (Sweden)

    Hikmah Thoha

    2008-11-01

    Full Text Available Dinoflagellates are the important primary producers in aquatic environments. In oceans, they play interesting role in ecological functions such as red tide forming organisms, symbiont of coral reef or sea anemone and DSP (Diarrhetic Shellfish Poisoning or PSP (Paralytic Shellfish Poisoning producing organisms. Morphology and molecular analysis of dinoflagellates were conducted on November 2002 to March 2003. The phylogenetic studies based on 18S rDNA analyses, sequence have begun to appear more frequently in the literature, as attention has turned to relationships within the major eukaryotic lineages, particular importance for the taxonomy of the armored and unarmored genera of dinoflagellates (Gyrodinium sp., Cachonina sp., Gymnodinium sp., Amphidinium sp., because many of the genera cause extensive plankton blooms, fish kills and other harmful events, were studied used to amplify 18S rDNA, present in the total DNA extracted from algal pellet. The amplify approximately 1400 bp of the nuclear-encoded LSU rDNA gene using terminal primeirs DIR, products were cheked by 1.0 % agarose gel electrophoresis, then cloning with TA cloning KIT. Sequencing were analyzed by the GENETIX Mac Software, Homology search by Blast and Phylogenetic analysis. Results of hylogenetic analysis of 18S rDNA are: Strain no. 10893 (un identified from the genera, it is belonging Gymnodinium or Polarella. Strain no. 10795 is closely related other species Cachonina hallii. We tentatively named strain no 11151 and 11160 similar to Gyrodinium or Gymnodinium based on morphology, but these strain indepently position in this tree and is not a real of Gymnodinium sensu stricto. It is possible, we can establish the new genera for strain no. 11151; 11160 because this not cluster any other unarmored species.

  6. Current-Voltage Relationship for Late Na(+) Current in Adult Rat Ventricular Myocytes.

    Science.gov (United States)

    Clark, R B; Giles, W R

    2016-01-01

    It is now well established that the slowly inactivating component of the Na(+) current (INa-L) in the mammalian heart is a significant regulator of the action potential waveform. This insight has led to detailed studies of the role of INa-L in a number of important and challenging pathophysiological settings. These include genetically based ventricular arrhythmias (LQT 1, 2, and 3), ventricular arrhythmias arising from progressive cardiomyopathies (including diabetic), and proarrhythmic abnormalities that develop during local or global ventricular ischemia. Inhibition of INa-L may also be a useful strategy for management of atrial flutter and fibrillation. Many important biophysical parameters that characterize INa-L have been identified; and INa-L as an antiarrhythmia drug target has been studied extensively. However, relatively little information is available regarding (1) the ion transfer or current-voltage relationship for INa-L or (2) the time course of its reactivation at membrane potentials similar to the resting or diastolic membrane potential in mammalian ventricle. This chapter is based on our preliminary findings concerning these two very important physiological/biophysical descriptors for INa-L. Our results were obtained using whole-cell voltage clamp methods applied to enzymatically isolated rat ventricular myocytes. A chemical agent, BDF 9148, which was once considered to be a drug candidate in the Na(+)-dependent inotropic agent category has been used to markedly enhance INa-L current. BDF acts in a potent, selective, and reversible fashion. These BDF 9148 effects are compared and contrasted with the prototypical activator of INa-L, a sea anemone toxin, ATX II. PMID:27586292

  7. Analysis of karyotype diversity of 40 Chinese chrysanthemum cultivars

    Institute of Scientific and Technical Information of China (English)

    Yuan ZHANG; Ming-Li ZHU; Si-Lan DAI

    2013-01-01

    To investigate the genetic differences in Chinese large-flowered chrysanthemum (Chrysanthemum×morifolium Ramat.) cultivars,we selected 40 typical and stable cultivars on which to carry out cytological studies using karyotype analysis.The results showed that 67.5% of these cultivars were hexaploid-based aneuploid and that the proportion of hexaploid decreased with passing time.Moreover,35% of the cultivars had 1-4 satellite chromosome(s).The probability of satellite chromosomes rose with increasing chromosome number.Most of the karyotypes were 2A and 2B.The probability of types 2A and 2C also increased with increasing ploidy of the cultivars.The mean of long-/short-arm ratio and the variation of long-/short-ann ratio were positively correlated (r2 =0.72).There was no obvious difference in the asymmetry coefficient of karyotypes,but the discrepancy in the variance of karyotype asymmetry index and relative length of chromosomes was quite distinct.In terms ofkaryotype parameters,the petal types of chrysanthemums were classified to five groups as flat,tubular,spoon,abnormal,and anemone.We did not observe any obvious orderliness among flower head types.Considering the relationship between karyotype parameters and phenotypic characters,variation of long-/short-arm ratio and asymmetry coefficient ofkaryotypes had the greatest relevance toward most phenotypic characters.The above results indicate that karyotype parameters possess great values for cultivar identification,classification,and genetic analysis in chrysanthemums.

  8. Global transcriptome analysis of the scorpion Centruroides noxius: new toxin families and evolutionary insights from an ancestral scorpion species.

    Directory of Open Access Journals (Sweden)

    Martha Rendón-Anaya

    Full Text Available Scorpion venoms have been studied for decades, leading to the identification of hundreds of different toxins with medical and pharmacological implications. However, little emphasis has been given to the description of these arthropods from cellular and evolutionary perspectives. In this report, we describe a transcriptomic analysis of the Mexican scorpion Centruroides noxius Hoffmann, performed with a pyrosequencing platform. Three independent sequencing experiments were carried out, each including three different cDNA libraries constructed from RNA extracted from the whole body of the scorpion after telson removal, and from the venom gland before and after venom extraction. Over three million reads were obtained and assembled in almost 19000 isogroups. Within the telson-specific sequences, 72 isogroups (0.4% of total unique transcripts were found to be similar to toxins previously reported in other scorpion species, spiders and sea anemones. The annotation pipeline also revealed the presence of important elements of the small non-coding RNA processing machinery, as well as microRNA candidates. A phylogenomic analysis of concatenated essential genes evidenced differential evolution rates in this species, particularly in ribosomal proteins and proteasome components. Additionally, statistical comparison of transcript abundance before and after venom extraction showed that 3% and 2% of the assembled isogroups had higher expression levels in the active and replenishing gland, respectively. Thus, our sequencing and annotation strategies provide a general view of the cellular and molecular processes that take place in these arthropods, allowed the discovery of new pharmacological and biotechnological targets and uncovered several regulatory and metabolic responses behind the assembly of the scorpion venom. The results obtained in this report represent the first high-throughput study that thoroughly describes the universe of genes that are expressed in

  9. The role of marine reserves in the replenishment of a locally-impacted population of anemonefish on the Great Barrier Reef

    KAUST Repository

    Bonin, Mary C.

    2015-11-21

    The development of parentage analysis to track the dispersal of juvenile offspring has given us unprecedented insight into the population dynamics of coral reef fishes. These tools now have the potential to inform fisheries management and species conservation, particularly for small fragmented populations under threat from exploitation and disturbance. In this study we resolve patterns of larval dispersal for a population of the anemonefish Amphiprion melanopus in the Keppel Islands (southern Great Barrier Reef). Habitat loss and fishing appear to have impacted this population and a network of no-take marine reserves currently protects 75% of the potential breeders. Using parentage analysis, we estimate that 21% of recruitment in the island group was generated locally, and that breeding adults living in reserves were responsible for 79% (31 out of 39) of these of locally-produced juveniles. Overall, the network of reserves was fully connected via larval dispersal; however one reserve was identified as a critical source of larvae for the island group. The population in the Keppel Islands also appears to be well-connected to other source populations at least 60 km away, given that 79% (145 out of 184) of the juveniles sampled remained unassigned in the parentage analysis. We estimated the effective size of the A. melanopus metapopulation to be 745 (582-993 95% CI) and recommend continued monitoring of its genetic status. Maintaining connectivity with populations beyond the Keppel Islands and recovery of local recruitment habitat, potentially through active restoration of host anemone populations, will be important for its long-term persistence.

  10. Molecular cloning and in silico characterization of knottin peptide, U2-SCRTX-Lit2, from brown spider (Loxosceles intermedia) venom glands.

    Science.gov (United States)

    Meissner, Gabriel Otto; de Resende Lara, Pedro Túlio; Scott, Luis Paulo Barbour; Braz, Antônio Sérgio Kimus; Chaves-Moreira, Daniele; Matsubara, Fernando Hitomi; Soares, Eduardo Mendonça; Trevisan-Silva, Dilza; Gremski, Luiza Helena; Veiga, Silvio Sanches; Chaim, Olga Meiri

    2016-09-01

    Inhibitor cystine knots (ICKs) are a family of structural peptides with a large number of cysteine residues that form intramolecular disulfide bonds, resulting in a knot. These peptides are involved in a variety of biological functions including predation and defense, and are found in various species, such as spiders, scorpions, sea anemones, and plants. The Loxosceles intermedia venom gland transcriptome identified five groups of ICK peptides that represent more than 50 % of toxin-coding transcripts. Here, we describe the molecular cloning of U2-Sicaritoxin-Lit2 (U2-SCRTX-Lit2), bioinformatic characterization, structure prediction, and molecular dynamic analysis. The sequence of U2-SCRTX-Lit2 obtained from the transcriptome is similar to that of μ-Hexatoxin-Mg2, a peptide that inhibits the insect Nav channel. Bioinformatic analysis of sequences classified as ICK family members also showed a conservation of cysteine residues among ICKs from different spiders, with the three dimensional molecular model of U2-SCRTX-Lit2 similar in structure to the hexatoxin from μ-hexatoxin-Mg2a. Molecular docking experiments showed the interaction of U2-SCRTX-Lit2 to its predictable target-the Spodoptera litura voltage-gated sodium channel (SlNaVSC). After 200 ns of molecular dynamic simulation, the final structure of the complex showed stability in agreement with the experimental data. The above analysis corroborates the existence of a peptide toxin with insecticidal activity from a novel ICK family in L. intermedia venom and demonstrates that this peptide targets Nav channels. PMID:27488102

  11. Comparative study on the fauna composition of intertidal invertebrates between natural and artificial substrata in the northeastern coast of Jeju Island

    Science.gov (United States)

    Cha, Jae-Hoon; Kim, Kwang-Bae; Song, Ji-Na; Kim, In-Soo; Seo, Jeong-Bin; Kwoun, Chul-Hwi

    2013-12-01

    This study was carried out to learn about differences in the sessile macrobenthic fauna communities between the artificial and natural habitats. There were some differences in terms of species composition and dominant species and community structure between two habitat types. The dominant species include Pollicipes mitella and Granuilittorina exigua in natural rocky intertidal zones; Monodonta labio confusa, Ligia exotica, Tetraclita japonica in the artificial rocky intertidal zones. Among all the species, L. exotica and T. japonica occurred only in the artificial rocky intertidal zone. The results of cluster analysis and nMDS analysis showed a distinct difference in community structure between artificial and natural rocky intertidal zones. The fauna in the natural rocky intertidal zones were similar to each other and the fauna in the artificial rocky intertidal zones were divided depending on the slope of the substratum. In the case of a sloping tetrapod, M. labio confusa and P. mitella were dominant, but at the vertical artificial seawall, Cellana nigrolineata, L. exotica T. japonica were dominant. The analysis of the species presented in natural and artificial rocky intertidal areas showed the exclusive presence of 10 species on natural rocks and 12 species on artificial rocks. The species in the natural rocky intertidal area included mobile gastropods and cnidarians (i.e. rock anemones), and the species in the artificial rocky intertidal area mostly included non-mobile attached animals. The artificial novel structure seems to contribute to increasing the heterogeneity of habitats for marine invertebrate species and an increase the species diversity in rocky coastal areas.

  12. Animal venom studies: Current benefits and future developments

    Institute of Scientific and Technical Information of China (English)

    Yuri; N; Utkin

    2015-01-01

    Poisonous organisms are represented in many taxa, including kingdom Animalia. During evolution, animals have developed special organs for production and injection of venoms. Animal venoms are complex mixtures, compositions of which depend on species producing venom. The most known and studied poisonous terrestrial animals are snakes, scorpions and spiders. Among marine animals, these are jellyfishes, anemones and cone snails. The toxic substances in the venom ofthese animals are mainly of protein and peptide origin. Recent studies have indicated that the single venom may contain up to several hundred different components producing diverse physiological effects. Bites or stings by certain poisonous species result in severe envenomations leading in some cases to death. This raises the problem of bite treatment. The most effective treatment so far is the application of antivenoms. To enhance the effectiveness of such treatments, the knowledge of venom composition is needed. On the other hand, venoms contain substances with unique biological properties, which can be used both in basic science and in clinical applications. The best example of toxin application in basic science is α-bungarotoxin the discovery of which made a big impact on the studies of nicotinic acetylcholine receptor. Today compositions of venom from many species have already been examined. Based on these data, one can conclude that venoms contain a large number of individual components belonging to a limited number of structural types. Often minor changes in the amino acid sequence give rise to new biological properties. Change in the living conditions of poisonous animals lead to alterations in the composition of venoms resulting in appearance of new toxins. At the same time introduction of new methods of proteomics and genomics lead to discoveries of new compounds, which may serve as research tools or as templates for the development of novel drugs. The application of these sensitive and

  13. SECOM: A novel hash seed and community detection based-approach for genome-scale protein domain identification

    KAUST Repository

    Fan, Ming

    2012-06-28

    With rapid advances in the development of DNA sequencing technologies, a plethora of high-throughput genome and proteome data from a diverse spectrum of organisms have been generated. The functional annotation and evolutionary history of proteins are usually inferred from domains predicted from the genome sequences. Traditional database-based domain prediction methods cannot identify novel domains, however, and alignment-based methods, which look for recurring segments in the proteome, are computationally demanding. Here, we propose a novel genome-wide domain prediction method, SECOM. Instead of conducting all-against-all sequence alignment, SECOM first indexes all the proteins in the genome by using a hash seed function. Local similarity can thus be detected and encoded into a graph structure, in which each node represents a protein sequence and each edge weight represents the shared hash seeds between the two nodes. SECOM then formulates the domain prediction problem as an overlapping community-finding problem in this graph. A backward graph percolation algorithm that efficiently identifies the domains is proposed. We tested SECOM on five recently sequenced genomes of aquatic animals. Our tests demonstrated that SECOM was able to identify most of the known domains identified by InterProScan. When compared with the alignment-based method, SECOM showed higher sensitivity in detecting putative novel domains, while it was also three orders of magnitude faster. For example, SECOM was able to predict a novel sponge-specific domain in nucleoside-triphosphatase (NTPases). Furthermore, SECOM discovered two novel domains, likely of bacterial origin, that are taxonomically restricted to sea anemone and hydra. SECOM is an open-source program and available at http://sfb.kaust.edu.sa/Pages/Software.aspx. © 2012 Fan et al.

  14. Host–symbiont recombination versus natural selection in the response of coral–dinoflagellate symbioses to environmental disturbance

    Science.gov (United States)

    LaJeunesse, Todd C.; Smith, Robin; Walther, Mariana; Pinzón, Jorge; Pettay, Daniel T.; McGinley, Michael; Aschaffenburg, Matthew; Medina-Rosas, Pedro; Cupul-Magaña, Amilcar L.; Pérez, Andrés López; Reyes-Bonilla, Hector; Warner, Mark E.

    2010-01-01

    Mutualisms between reef-building corals and endosymbiotic dinoflagellates are particularly sensitive to environmental stress, yet the ecosystems they construct have endured major oscillations in global climate. During the winter of 2008, an extreme cold-water event occurred in the Gulf of California that bleached corals in the genus Pocillopora harbouring a thermally ‘sensitive’ symbiont, designated Symbiodinium C1b-c, while colonies possessing Symbiodinium D1 were mostly unaffected. Certain bleached colonies recovered quickly while others suffered partial or complete mortality. In most colonies, no appreciable change was observed in the identity of the original symbiont, indicating that these partnerships are stable. During the initial phases of recovery, a third species of symbiont B1Aiptasia, genetically identical to that harboured by the invasive anemone, Aiptasia sp., grew opportunistically and was visible as light-yellow patches on the branch tips of several colonies. However, this symbiont did not persist and was displaced in all cases by C1b-c several months later. Colonies with D1 were abundant at inshore habitats along the continental eastern Pacific, where seasonal turbidity is high relative to offshore islands. Environmental conditions of the central and southern coasts of Mexico were not sufficient to explain the exclusivity of D1 Pocillopora in these regions. It is possible that mass mortalities associated with major thermal disturbances during the 1997–1998 El Niño Southern Oscillation eliminated C1b-c holobionts from these locations. The differential loss of Pocillopora holobionts in response to thermal stress suggests that natural selection on existing variation can cause rapid and significant shifts in the frequency of particular coral–algal partnerships. However, coral populations may take decades to recover following episodes of severe selection, thereby raising considerable uncertainty about the long-term viability of these communities

  15. Selective Na+/Ca2+ exchanger inhibition prevents Ca2+ overload-induced triggered arrhythmias

    Science.gov (United States)

    Nagy, Norbert; Kormos, Anita; Kohajda, Zsófia; Szebeni, Áron; Szepesi, Judit; Pollesello, Piero; Levijoki, Jouko; Acsai, Károly; Virág, László; Nánási, Péter P; Papp, Julius Gy; Varró, András; Tóth, András

    2014-01-01

    Background and Purpose Augmented Na+/Ca2+ exchanger (NCX) activity may play a crucial role in cardiac arrhythmogenesis; however, data regarding the anti-arrhythmic efficacy of NCX inhibition are debatable. Feasible explanations could be the unsatisfactory selectivity of NCX inhibitors and/or the dependence of the experimental model on the degree of Ca2+i overload. Hence, we used NCX inhibitors SEA0400 and the more selective ORM10103 to evaluate the efficacy of NCX inhibition against arrhythmogenic Ca2+i rise in conditions when [Ca2+]i was augmented via activation of the late sodium current (INaL) or inhibition of the Na+/K+ pump. Experimental Approach Action potentials (APs) were recorded from canine papillary muscles and Purkinje fibres by microelectrodes. NCX current (INCX) was determined in ventricular cardiomyocytes utilizing the whole-cell patch clamp technique. Ca2+i transients (CaTs) were monitored with a Ca2+-sensitive fluorescent dye, Fluo-4. Key Results Enhanced INaL increased the Ca2+ load and AP duration (APD). SEA0400 and ORM10103 suppressed INCX and prevented/reversed the anemone toxin II (ATX-II)-induced [Ca2+]i rise without influencing APD, CaT or cell shortening, or affecting the ATX-II-induced increased APD. ORM10103 significantly decreased the number of strophanthidin-induced spontaneous diastolic Ca2+ release events; however, SEA0400 failed to restrict the veratridine-induced augmentation in Purkinje-ventricle APD dispersion. Conclusions and Implications Selective NCX inhibition – presumably by blocking revINCX (reverse mode NCX current) – is effective against arrhythmogenesis caused by [Na+]i-induced [Ca2+]i elevation, without influencing the AP waveform. Therefore, selective INCX inhibition, by significantly reducing the arrhythmogenic trigger activity caused by the perturbed Ca2+i handling, should be considered as a promising anti-arrhythmic therapeutic strategy. PMID:25073832

  16. Symbiotic association between symbiodinium and the gastropod Strombus gigas: larval acquisition of symbionts.

    Science.gov (United States)

    García Ramos, Maribel; Banaszak, Anastazia T

    2014-04-01

    The importance of the dinoflagellate Symbiodinium sp. was studied in the early life stages of the gastropod Strombus gigas. This dinoflagellate was not found in the eggs or the gelatinous mass surrounding the eggs of the mollusk; therefore, Symbiodinium is not inherited directly. To determine whether the planktonic veligers can acquire these algae from the environment, they were exposed to freshly isolated Symbiodinium from adult S. gigas (homologous). The optimal stage for Symbiodinium inoculation was found at 48 h post-hatching. Survival and growth rates of veligers and juveniles were higher when inoculated with freshly isolated Symbiodinium in conjunction with daily feeding of Isochrysis spp. Veligers inoculated with Symbiodinium freshly isolated from three host species elicited distinct responses: (1) veligers did not take up Symbiodinium isolated from the hydrozoan Millepora alcicornis suggesting that there is discrimination on contact prior to ingestion, (2) veligers did take up Symbiodinium isolated from the anemone Bartholomea annulata, but the algae did not persist in the host tissue suggesting that selection against this type took place after ingestion or that the algae did not divide in the host, and (3) veligers did take up Symbiodinium isolated from Pterogorgia anceps where it persisted and was associated with metamorphosis of the larvae. In contrast, the Symbiodinium freshly isolated from S. gigas were not associated with metamorphosis and required an inducer such as the red alga Laurencia poitei. These data present a significant advancement for the establishment of a new approach in the aquaculture of this important but declining Caribbean species. PMID:24037186

  17. 铁线莲属一新分类系统%A new system of classification of the genus Clematis(Ranunculaceae)

    Institute of Scientific and Technical Information of China (English)

    王文采; 李良千

    2005-01-01

    提出毛茛科Ranunculaceae铁线莲属Clematis一新分类系统.首先,简要回顾了此属的分类学研究历史,继对此属的营养器官和生殖器官的重要形态特征和花粉特征进行了分析,揭示出一系列演化趋势.这些趋势,尤其是萼片和雄蕊的演化趋势说明在现存的铁线莲属植物中,绣球藤Clematis montana与其少数近缘种的花构造最接近比铁线莲属原始的银莲花属Anemone,因此,包括绣球藤等植物的绣球藤组sect.Cheirpsis被认为是铁线莲属的原始群.主要根据花构造对铁线莲属现存的15组的亲缘关系进行了分析,发现它们是在4条演化干(绣球藤干、欧洲铁线莲干、尾叶铁线莲干、长瓣铁线莲干)的演化过程中先后形成的.本文将此4条演化干处理为亚属.最后做出属下各级分类群的系统排列,并给出简要的形态特征.

  18. Putative cross-kingdom horizontal gene transfer in sponge (Porifera) mitochondria

    Science.gov (United States)

    Rot, Chagai; Goldfarb, Itay; Ilan, Micha; Huchon, Dorothée

    2006-01-01

    Background The mitochondrial genome of Metazoa is usually a compact molecule without introns. Exceptions to this rule have been reported only in corals and sea anemones (Cnidaria), in which group I introns have been discovered in the cox1 and nad5 genes. Here we show several lines of evidence demonstrating that introns can also be found in the mitochondria of sponges (Porifera). Results A 2,349 bp fragment of the mitochondrial cox1 gene was sequenced from the sponge Tetilla sp. (Spirophorida). This fragment suggests the presence of a 1143 bp intron. Similar to all the cnidarian mitochondrial introns, the putative intron has group I intron characteristics. The intron is present in the cox1 gene and encodes a putative homing endonuclease. In order to establish the distribution of this intron in sponges, the cox1 gene was sequenced from several representatives of the demosponge diversity. The intron was found only in the sponge order Spirophorida. A phylogenetic analysis of the COI protein sequence and of the intron open reading frame suggests that the intron may have been transmitted horizontally from a fungus donor. Conclusion Little is known about sponge-associated fungi, although in the last few years the latter have been frequently isolated from sponges. We suggest that the horizontal gene transfer of a mitochondrial intron was facilitated by a symbiotic relationship between fungus and sponge. Ecological relationships are known to have implications at the genomic level. Here, an ecological relationship between sponge and fungus is suggested based on the genomic analysis. PMID:16972986

  19. Putative cross-kingdom horizontal gene transfer in sponge (Porifera mitochondria

    Directory of Open Access Journals (Sweden)

    Ilan Micha

    2006-09-01

    Full Text Available Abstract Background The mitochondrial genome of Metazoa is usually a compact molecule without introns. Exceptions to this rule have been reported only in corals and sea anemones (Cnidaria, in which group I introns have been discovered in the cox1 and nad5 genes. Here we show several lines of evidence demonstrating that introns can also be found in the mitochondria of sponges (Porifera. Results A 2,349 bp fragment of the mitochondrial cox1 gene was sequenced from the sponge Tetilla sp. (Spirophorida. This fragment suggests the presence of a 1143 bp intron. Similar to all the cnidarian mitochondrial introns, the putative intron has group I intron characteristics. The intron is present in the cox1 gene and encodes a putative homing endonuclease. In order to establish the distribution of this intron in sponges, the cox1 gene was sequenced from several representatives of the demosponge diversity. The intron was found only in the sponge order Spirophorida. A phylogenetic analysis of the COI protein sequence and of the intron open reading frame suggests that the intron may have been transmitted horizontally from a fungus donor. Conclusion Little is known about sponge-associated fungi, although in the last few years the latter have been frequently isolated from sponges. We suggest that the horizontal gene transfer of a mitochondrial intron was facilitated by a symbiotic relationship between fungus and sponge. Ecological relationships are known to have implications at the genomic level. Here, an ecological relationship between sponge and fungus is suggested based on the genomic analysis.

  20. Host-symbiont recombination versus natural selection in the response of coral-dinoflagellate symbioses to environmental disturbance.

    Science.gov (United States)

    LaJeunesse, Todd C; Smith, Robin; Walther, Mariana; Pinzón, Jorge; Pettay, Daniel T; McGinley, Michael; Aschaffenburg, Matthew; Medina-Rosas, Pedro; Cupul-Magaña, Amilcar L; Pérez, Andrés López; Reyes-Bonilla, Hector; Warner, Mark E

    2010-10-01

    Mutualisms between reef-building corals and endosymbiotic dinoflagellates are particularly sensitive to environmental stress, yet the ecosystems they construct have endured major oscillations in global climate. During the winter of 2008, an extreme cold-water event occurred in the Gulf of California that bleached corals in the genus Pocillopora harbouring a thermally 'sensitive' symbiont, designated Symbiodinium C1b-c, while colonies possessing Symbiodinium D1 were mostly unaffected. Certain bleached colonies recovered quickly while others suffered partial or complete mortality. In most colonies, no appreciable change was observed in the identity of the original symbiont, indicating that these partnerships are stable. During the initial phases of recovery, a third species of symbiont B1(Aiptasia), genetically identical to that harboured by the invasive anemone, Aiptasia sp., grew opportunistically and was visible as light-yellow patches on the branch tips of several colonies. However, this symbiont did not persist and was displaced in all cases by C1b-c several months later. Colonies with D1 were abundant at inshore habitats along the continental eastern Pacific, where seasonal turbidity is high relative to offshore islands. Environmental conditions of the central and southern coasts of Mexico were not sufficient to explain the exclusivity of D1 Pocillopora in these regions. It is possible that mass mortalities associated with major thermal disturbances during the 1997-1998 El Niño Southern Oscillation eliminated C1b-c holobionts from these locations. The differential loss of Pocillopora holobionts in response to thermal stress suggests that natural selection on existing variation can cause rapid and significant shifts in the frequency of particular coral-algal partnerships. However, coral populations may take decades to recover following episodes of severe selection, thereby raising considerable uncertainty about the long-term viability of these communities. PMID

  1. Temporal dynamics in a shallow coastal benthic food web: Insights from fatty acid biomarkers and their stable isotopes.

    Science.gov (United States)

    Braeckman, Ulrike; Provoost, Pieter; Sabbe, Koen; Soetaert, Karline; Middelburg, Jack J; Vincx, Magda; Vanaverbeke, Jan

    2015-07-01

    We investigated the temporal variation of pelagic and benthic food sources in the diet of benthic taxa at a depositional site in the Southern Bight of the North Sea by means of fatty acid (FA) biomarkers and compound-specific stable isotope analysis (CSIA). The taxa were the non-selective deposit feeding nematodes (Sabatieria spp. and 'other nematodes'), and three dominant macrobenthic species: two true suspension-deposit feeders (the bivalve Abra alba and the tube dwelling polychaete Owenia fusiformis) and the suspected predatory mud-dwelling anemone Sagartia sp. These species make up on average 16% (Abra alba), 17% (Sagartia sp.) and 20% (Owenia fusiformis) of the biomass in the Abra alba-Kurtiella bidentata community in this area. Phytoplankton dynamics in the suspended particulate matter of the water column as inferred from cell counts, chlorophyll-a and organic carbon content were clearly visible in sediment and animal FA abundance as well, whereas phytodetritus dynamics in the sediment FA composition were less clear, probably due to patchy distribution or stripping of FA by macrofauna. Nematodes appeared to assimilate mainly Polyunsaturated Fatty Acids (PUFAs) from their sedimentary environment and were further non-selectively accumulating more (Sabatieria spp.) or less ('other nematodes') FA from the deposited phytodetritus. In contrast, Abra alba FA composition was consistent with a diatom-dominated diet and consumption of Phaeocystis was observed in Owenia fusiformis, whereas Sagartia sp. showed evidence of a predatory behaviour. While the total FA content in Owenia fusiformis remained constant throughout the year, Sagartia sp. doubled and Abra alba increased its FA level more than 10-fold in response to the organic matter deposition from the phytoplankton bloom. This leads to the conclusion that there is no resource partitioning between non-selective deposit feeding nematodes and the suspension-deposit feeding macrobenthic organisms, suggesting they

  2. Effect of mexiletine on long QT syndrome model

    Institute of Scientific and Technical Information of China (English)

    WANGHong-Wei; ZHENGYan-Qian; 等

    2003-01-01

    AIM:To make a LQT3 model(one form of the long QT syndromes)and to investigate the effect of mexiletine on LQT3.METHODS:Sea anemone toxin(ATX Ⅱ)was used to produce the LQT3 model.The Effect of mexiletine on LQT3 was performed on single Na channel,action potential,and electrocardiography in guinea pigs,RESULTS.With the binding of ATXⅡto the Na+ channels,the probability of being in the open state and the open time constant of single Na+ channel with long opening mode increased significantly.Action potential duration APD50,APD90,and the maximal upstroke velocity of phase 0 were increased by 25.8%,26.1%,and 12%,respectively.The QT interval and QTc,a rectifed QT interval,increased by 12.8% and 16.9%.On the contrary,after application of mexiletine,the open probability of single Na+ channel was reduced greatly.In the presence of ATXⅡ(40nmol/L),mexiletine(1,5,15,45,70μmol/L)shortened the APD50 by 0.5%,6.7%,14.4%,19.45,and 18.8%,respectively,and decreased the APD90and Vmax accordingly.In the experiments with ECG,mexiletine reversed the ATX0Ⅱ-produced prolongation effects on QTc in a dose-dependent manner.CONCLUSION:Mexiletine may be an effective drug in the treatment of LQT3.

  3. Development and short-term dynamics of macrofouling assemblages on fish-cage nettings in a tropical estuary

    Science.gov (United States)

    Madin, John; Chong, V. C.; Basri, Badrulnizam

    2009-06-01

    A study was conducted at a fish culture farm in the Jaha River estuary, Malaysia, to examine the structure and development of macrofouling assemblages on floating net-cages. The study was conducted during the dry (August-October 2001) and wet (December-February 2002) seasons. Biofouling on 1.6 cm mesh net panels (size 0.2 m × 2 m) suspended inside (P, T) and outside (O) experimental net-cages was monitored every week until net openings were completely occluded by macrofouling organisms (8 wk and 12 wk for dry and wet seasons respectively). Seven species (6 phyla) of sessile organisms and 23 species (3 phyla) of non-sessile associates were recorded. Macro-colonization of net panels began with the hydroid Plumularia sp. irrespective of season and treatment (P, T, and O), while other species only appeared after 1 or 2 weeks of immersion. Inside net-cages where water flow was slow (mean macroalgae ( Polysiphonia sp.), anthozoans (unidentified anemone), barnacles ( Balanus amphitrite), amphipods ( Gammaropsis sp. & Photis sp.), and tanaids ( Leptognathia sp.) were dominant on the net panels during the dry season. In the wet season, hydroid ( Plumularia sp.), mussel ( Xenostrobus mangle), and nematode abundance were however significant. With stronger water flow (mean ≈ 20 cm s -1) as occurring outside the net-cages, macrofouling assemblages for both seasons comprised mainly Plumularia sp. and Gammaropsis sp. The macrofouling assemblage showed a clear succession of species that occupied different layers of the net panels. The study shows that while organic enrichment and retarded water flow together enhance the development of macrofouling assemblages, salinity, depth, substrate (net) area and species competition specifically influence community structure, colonization, and depth distribution of the macrofouling organisms.

  4. Metabolite profiling of symbiont and host during thermal stress and bleaching in a model cnidarian-dinoflagellate symbiosis.

    Science.gov (United States)

    Hillyer, Katie E; Tumanov, Sergey; Villas-Bôas, Silas; Davy, Simon K

    2016-02-01

    Bleaching (dinoflagellate symbiont loss) is one of the greatest threats facing coral reefs. The functional cnidarian-dinoflagellate symbiosis, which forms coral reefs, is based on the bi-directional exchange of nutrients. During thermal stress this exchange breaks down; however, major gaps remain in our understanding of the roles of free metabolite pools in symbiosis and homeostasis. In this study we applied gas chromatography-mass spectrometry (GC-MS) to explore thermally induced changes in intracellular pools of amino and non-amino organic acids in each partner of the model sea anemone Aiptasia sp. and its dinoflagellate symbiont. Elevated temperatures (32 °C for 6 days) resulted in symbiont photoinhibition and bleaching. Thermal stress induced distinct changes in the metabolite profiles of both partners, associated with alterations to central metabolism, oxidative state, cell structure, biosynthesis and signalling. Principally, we detected elevated pools of polyunsaturated fatty acids (PUFAs) in the symbiont, indicative of modifications to lipogenesis/lysis, membrane structure and nitrogen assimilation. In contrast, reductions of multiple PUFAs were detected in host pools, indicative of increased metabolism, peroxidation and/or reduced translocation of these groups. Accumulations of glycolysis intermediates were also observed in both partners, associated with photoinhibition and downstream reductions in carbohydrate metabolism. Correspondingly, we detected accumulations of amino acids and intermediate groups in both partners, with roles in gluconeogenesis and acclimation responses to oxidative stress. These data further our understanding of cellular responses to thermal stress in the symbiosis and generate hypotheses relating to the secondary roles of a number of compounds in homeostasis and heat-stress resistance. PMID:26685173

  5. Overview on the diversity of sounds produced by clownfishes (Pomacentridae: importance of acoustic signals in their peculiar way of life.

    Directory of Open Access Journals (Sweden)

    Orphal Colleye

    Full Text Available BACKGROUND: Clownfishes (Pomacentridae are brightly colored coral reef fishes well known for their mutualistic symbiosis with tropical sea anemones. These fishes live in social groups in which there is a size-based dominance hierarchy. In this structure where sex is socially controlled, agonistic interactions are numerous and serve to maintain size differences between individuals adjacent in rank. Clownfishes are also prolific callers whose sounds seem to play an important role in the social hierarchy. Here, we aim to review and to synthesize the diversity of sounds produced by clownfishes in order to emphasize the importance of acoustic signals in their way of life. METHODOLOGY/PRINCIPAL FINDINGS: Recording the different acoustic behaviors indicated that sounds are divided into two main categories: aggressive sounds produced in conjunction with threat postures (charge and chase, and submissive sounds always emitted when fish exhibited head shaking movements (i.e. a submissive posture. Both types of sounds showed size-related intraspecific variation in dominant frequency and pulse duration: smaller individuals produce higher frequency and shorter duration pulses than larger ones, and inversely. Consequently, these sonic features might be useful cues for individual recognition within the group. This observation is of significant importance due to the size-based hierarchy in clownfish group. On the other hand, no acoustic signal was associated with the different reproductive activities. CONCLUSIONS/SIGNIFICANCE: Unlike other pomacentrids, sounds are not produced for mate attraction in clownfishes but to reach and to defend the competition for breeding status, which explains why constraints are not important enough for promoting call diversification in this group.

  6. Elevated temperature inhibits recruitment of transferrin-positive vesicles and induces iron-deficiency genes expression in Aiptasia pulchella host-harbored Symbiodinium.

    Science.gov (United States)

    Song, Po-Ching; Wu, Tsung-Meng; Hong, Ming-Chang; Chen, Ming-Chyuan

    2015-10-01

    Coral bleaching is the consequence of disruption of the mutualistic Cnidaria-dinoflagellate association. Elevated seawater temperatures have been proposed as the most likely cause of coral bleaching whose severity is enhanced by a limitation in the bioavailability of iron. Iron is required by numerous organisms including the zooxanthellae residing inside the symbiosome of cnidarian cells. However, the knowledge of how symbiotic zooxanthellae obtain iron from the host cells and how elevated water temperature affects the association is very limited. Since cellular iron acquisition is known to be mediated through transferrin receptor-mediated endocytosis, a vesicular trafficking pathway specifically regulated by Rab4 and Rab5, we set out to examine the roles of these key proteins in the iron acquisition by the symbiotic Symbiodinium. Thus, we hypothesized that the iron recruitments into symbiotic zooxanthellae-housed symbiosomes may be dependent on rab4/rab5-mediated fusion with vesicles containing iron-bound transferrins and will be retarded under elevated temperature. In this study, we cloned a novel monolobal transferrin (ApTF) gene from the tropical sea anemone Aiptasia pulchella and confirmed that the association of ApTF with A. pulchella Rab4 (ApRab4) or A. pulchella Rab5 (ApRab5) vesicles is inhibited by elevated temperature through immunofluorescence analysis. We confirmed the iron-deficient phenomenon by demonstrating the induced overexpression of iron-deficiency-responsive genes, flavodoxin and high-affinity iron permease 1, and reduced intracellular iron concentration in zooxanthellae under desferrioxamine B (iron chelator) and high temperature treatment. In conclusion, our data are consistent with algal iron deficiency being a contributing factor for the thermal stress-induced bleaching of symbiotic cnidarians. PMID:25997368

  7. Ontogenetic changes in responses to settlement cues by Anemonefish

    Science.gov (United States)

    Dixson, D. L.; Munday, P. L.; Pratchett, M.; Jones, G. P.

    2011-12-01

    Population connectivity for most marine species is dictated by dispersal during the pelagic larval stage. Although reef fish larvae are known to display behavioral adaptations that influence settlement site selection, little is known about the development of behavioral preferences throughout the larval phase. Whether larvae are attracted to the same sensory cues throughout their larval phase, or exhibit distinct ontogenetic shifts in sensory preference is unknown. Here, we demonstrate an ontogenetic shift in olfactory cue preferences for two species of anemonefish, a process that could aid in understanding both patterns of dispersal and settlement. Aquarium-bred naïve Amphiprion percula and A. melanopus larvae were tested for olfactory preference of relevant reef-associated chemical cues throughout the 11-day pelagic larval stage. Age posthatching had a significant effect on the preference for olfactory cues from host anemones and live corals for both species. Preferences of olfactory cues from tropical plants of A. percula, increased by approximately ninefold between hatching and settlement, with A. percula larvae showing a fivefold increase in preference for the olfactory cue produced by the grass species. Larval age had no effect on the olfactory preference for untreated seawater over the swamp-based tree Melaleuca nervosa, which was always avoided compared with blank seawater. These results indicate that reef fish larvae are capable of utilizing olfactory cues early in the larval stage and may be predisposed to disperse away from reefs, with innate olfactory preferences drawing newly hatched larvae into the pelagic environment. Toward the end of the larval phase, larvae become attracted to the olfactory cues of appropriate habitats, which may assist them in identification of and navigation toward suitable settlement sites.

  8. The discovery of new deep-sea hydrothermal vent communities in the southern ocean and implications for biogeography.

    Directory of Open Access Journals (Sweden)

    Alex D Rogers

    2012-01-01

    Full Text Available Since the first discovery of deep-sea hydrothermal vents along the Galápagos Rift in 1977, numerous vent sites and endemic faunal assemblages have been found along mid-ocean ridges and back-arc basins at low to mid latitudes. These discoveries have suggested the existence of separate biogeographic provinces in the Atlantic and the North West Pacific, the existence of a province including the South West Pacific and Indian Ocean, and a separation of the North East Pacific, North East Pacific Rise, and South East Pacific Rise. The Southern Ocean is known to be a region of high deep-sea species diversity and centre of origin for the global deep-sea fauna. It has also been proposed as a gateway connecting hydrothermal vents in different oceans but is little explored because of extreme conditions. Since 2009 we have explored two segments of the East Scotia Ridge (ESR in the Southern Ocean using a remotely operated vehicle. In each segment we located deep-sea hydrothermal vents hosting high-temperature black smokers up to 382.8°C and diffuse venting. The chemosynthetic ecosystems hosted by these vents are dominated by a new yeti crab (Kiwa n. sp., stalked barnacles, limpets, peltospiroid gastropods, anemones, and a predatory sea star. Taxa abundant in vent ecosystems in other oceans, including polychaete worms (Siboglinidae, bathymodiolid mussels, and alvinocaridid shrimps, are absent from the ESR vents. These groups, except the Siboglinidae, possess planktotrophic larvae, rare in Antarctic marine invertebrates, suggesting that the environmental conditions of the Southern Ocean may act as a dispersal filter for vent taxa. Evidence from the distinctive fauna, the unique community structure, and multivariate analyses suggest that the Antarctic vent ecosystems represent a new vent biogeographic province. However, multivariate analyses of species present at the ESR and at other deep-sea hydrothermal vents globally indicate that vent biogeography is more

  9. Spatial differences in East scotia ridge hydrothermal vent food webs: influences of chemistry, microbiology and predation on trophodynamics.

    Directory of Open Access Journals (Sweden)

    William D K Reid

    Full Text Available The hydrothermal vents on the East Scotia Ridge are the first to be explored in the Antarctic and are dominated by large peltospiroid gastropods, stalked barnacles (Vulcanolepas sp. and anomuran crabs (Kiwa sp. but their food webs are unknown. Vent fluid and macroconsumer samples were collected at three vent sites (E2, E9N and E9S at distances of tens of metres to hundreds of kilometres apart with contrasting vent fluid chemistries to describe trophic interactions and identify potential carbon fixation pathways using stable isotopes. δ(13C of dissolved inorganic carbon from vent fluids ranged from -4.6‰ to 0.8‰ at E2 and from -4.4‰ to 1.5‰ at E9. The lowest macroconsumer δ(13C was observed in peltospiroid gastropods (-30.0‰ to -31.1‰ and indicated carbon fixation via the Calvin-Benson-Bassham (CBB cycle by endosymbiotic gamma-Proteobacteria. Highest δ(13C occurred in Kiwa sp. (-19.0‰ to -10.5‰, similar to that of the epibionts sampled from their ventral setae. Kiwa sp. δ(13C differed among sites, which were attributed to spatial differences in the epibiont community and the relative contribution of carbon fixed via the reductive tricarboxylic acid (rTCA and CBB cycles assimilated by Kiwa sp. Site differences in carbon fixation pathways were traced into higher trophic levels e.g. a stichasterid asteroid that predates on Kiwa sp. Sponges and anemones at the periphery of E2 assimilated a proportion of epipelagic photosynthetic primary production but this was not observed at E9N. Differences in the δ(13C and δ(34S values of vent macroconsumers between E2 and E9 sites suggest the relative contributions of photosynthetic and chemoautotrophic carbon fixation (rTCA v CBB entering the hydrothermal vent food webs vary between the sites.

  10. Massive asphalt deposits, oil seepage, and gas venting support abundant chemosynthetic communities at the Campeche Knolls, southern Gulf of Mexico

    Science.gov (United States)

    Sahling, Heiko; Borowski, Christian; Escobar-Briones, Elva; Gaytán-Caballero, Adriana; Hsu, Chieh-Wei; Loher, Markus; MacDonald, Ian; Marcon, Yann; Pape, Thomas; Römer, Miriam; Rubin-Blum, Maxim; Schubotz, Florence; Smrzka, Daniel; Wegener, Gunter; Bohrmann, Gerhard

    2016-08-01

    Hydrocarbon seepage is a widespread process at the continental margins of the Gulf of Mexico. We used a multidisciplinary approach, including multibeam mapping and visual seafloor observations with different underwater vehicles to study the extent and character of complex hydrocarbon seepage in the Bay of Campeche, southern Gulf of Mexico. Our observations showed that seafloor asphalt deposits previously only known from the Chapopote Knoll also occur at numerous other knolls and ridges in water depths from 1230 to 3150 m. In particular the deeper sites (Chapopopte and Mictlan knolls) were characterized by asphalt deposits accompanied by extrusion of liquid oil in form of whips or sheets, and in some places (Tsanyao Yang, Mictlan, and Chapopote knolls) by gas emission and the presence of gas hydrates in addition. Molecular and stable carbon isotopic compositions of gaseous hydrocarbons suggest their primarily thermogenic origin. Relatively fresh asphalt structures were settled by chemosynthetic communities including bacterial mats and vestimentiferan tube worms, whereas older flows appeared largely inert and devoid of corals and anemones at the deep sites. The gas hydrates at Tsanyao Yang and Mictlan Knolls were covered by a 5-to-10 cm-thick reaction zone composed of authigenic carbonates, detritus, and microbial mats, and were densely colonized by 1-2 m-long tube worms, bivalves, snails, and shrimps. This study increased knowledge on the occurrences and dimensions of asphalt fields and associated gas hydrates at the Campeche Knolls. The extent of all discovered seepage structure areas indicates that emission of complex hydrocarbons is a widespread, thus important feature of the southern Gulf of Mexico.

  11. Moytirra: Discovery of the first known deep-sea hydrothermal vent field on the slow-spreading Mid-Atlantic Ridge north of the Azores

    Science.gov (United States)

    Wheeler, A. J.; Murton, B.; Copley, J.; Lim, A.; Carlsson, J.; Collins, P.; Dorschel, B.; Green, D.; Judge, M.; Nye, V.; Benzie, J.; Antoniacomi, A.; Coughlan, M.; Morris, K.

    2013-10-01

    Geological, biological, morphological, and hydrochemical data are presented for the newly discovered Moytirra vent field at 45oN. This is the only high temperature hydrothermal vent known between the Azores and Iceland, in the North Atlantic and is located on a slow to ultraslow-spreading mid-ocean ridge uniquely situated on the 300 m high fault scarp of the eastern axial wall, 3.5 km from the axial volcanic ridge crest. Furthermore, the Moytirra vent field is, unusually for tectonically controlled hydrothermal vents systems, basalt hosted and perched midway up on the median valley wall and presumably heated by an off-axis magma chamber. The Moytirra vent field consists of an alignment of four sites of venting, three actively emitting "black smoke," producing a complex of chimneys and beehive diffusers. The largest chimney is 18 m tall and vigorously venting. The vent fauna described here are the only ones documented for the North Atlantic (Azores to Reykjanes Ridge) and significantly expands our knowledge of North Atlantic biodiversity. The surfaces of the vent chimneys are occupied by aggregations of gastropods (Peltospira sp.) and populations of alvinocaridid shrimp (Mirocaris sp. with Rimicaris sp. also present). Other fauna present include bythograeid crabs (Segonzacia sp.) and zoarcid fish (Pachycara sp.), but bathymodiolin mussels and actinostolid anemones were not observed in the vent field. The discovery of the Moytirra vent field therefore expands the known latitudinal distributions of several vent-endemic genera in the north Atlantic, and reveals faunal affinities with vents south of the Azores rather than north of Iceland.

  12. Modelling climate change effects on benthos: Distributional shifts in the North Sea from 2001 to 2099

    Science.gov (United States)

    Weinert, Michael; Mathis, Moritz; Kröncke, Ingrid; Neumann, Hermann; Pohlmann, Thomas; Reiss, Henning

    2016-06-01

    In the marine realm, climate change can affect a variety of physico-chemical properties with wide-ranging biological effects, but the knowledge of how climate change affects benthic distributions is limited and mainly restricted to coastal environments. To project the response of benthic species of a shelf sea (North Sea) to the expected climate change, the distributions of 75 marine benthic species were modelled and the spatial changes in distribution were projected for 2099 based on modelled bottom temperature and salinity changes using the IPCC scenario A1B. Mean bottom temperature was projected to increase between 0.15 and 5.4 °C, while mean bottom salinity was projected to moderately increase by 1.7. The spatial changes in species distribution were modelled with Maxent and the direction and extent of these changes were assessed. The results showed a latitudinal northward shift for 64% of the species (maximum 109 km; brittle star Ophiothrix fragilis) and a southward shift for 36% (maximum 101 km; hermit crab Pagurus prideaux and the associated cloak anemone Adamsia carciniopados; 105 km). The relatively low rates of distributional shifts compared to fish or plankton species were probably influenced by the regional topography. The environmental gradients in the central North Sea along the 50 m depth contour might act as a 'barrier', possibly resulting in a compression of distribution range and hampering further shifts to the north. For 49 species this resulted in a habitat loss up to 100%, while only 11 species could benefit from the warming in terms of habitat gain. Particularly the benthic communities of the southern North Sea, where the strongest temperature increase was projected, would be strongly affected by the distributional changes, since key species showed northward shifts and high rates of habitat loss, with potential ramifications for the functioning of the ecosystem.

  13. Breeding and mass scale rearing of clownfish Amphiprion percula: feeding and rearing in brackishwater

    Institute of Scientific and Technical Information of China (English)

    DHANEESH Kottila Veettil; AJITH KUMAR Thipramalai Thankappan; SWAGAT Ghosh; BALASUBRAMANIAN Thangavel

    2012-01-01

    Breeding and mass scale larval rearing of clownfish Amphiprion percula is very limited in brackishwater.We designed an indoor program of A.percula culture in brackishwater with a salinity of 24±1,during which the impacts of feed type,water temperature,and light intensity,on the efficiency of its reproduction,were revealed.The fish were accommodated along with sea anemones in fibre glass tanks to determine the influence of brooder diet on breeding efficiency.Higher reproductive efficiency [number of eggs laid (276±22.3 eggs)] was observed when fish were fed live Acetes sp.rather than clam (204±16.4eggs),trash fish (155±12 eggs) and formulated feed (110±10 eggs).The spawning rate was increased during September and October (water temperature,28.74±0.55℃) on average of 2.4 spawning per month; and low spawning rate was in January (water temperature,24.55±0.45℃) on average of 1 spawning per month.Among three light intensities (100,500,and 900 Ix) set to evaluate larval survival rate,larvae showed the highest survival rate (65.5%) at 900 Ix.The breeding method specifically in brackishwater developed in the present study is a new approach,will help the people from the regions of estuary and backwater to enhance their livelihood and it will lead to reduce the exploitation from the wild habitat.

  14. Gene discovery in the threatened elkhorn coral: 454 sequencing of the Acropora palmata transcriptome.

    Directory of Open Access Journals (Sweden)

    Nicholas R Polato

    Full Text Available BACKGROUND: Cnidarians, including corals and anemones, offer unique insights into metazoan evolution because they harbor genetic similarities with vertebrates beyond that found in model invertebrates and retain genes known only from non-metazoans. Cataloging genes expressed in Acropora palmata, a foundation-species of reefs in the Caribbean and western Atlantic, will advance our understanding of the genetic basis of ecologically important traits in corals and comes at a time when sequencing efforts in other cnidarians allow for multi-species comparisons. RESULTS: A cDNA library from a sample enriched for symbiont free larval tissue was sequenced on the 454 GS-FLX platform. Over 960,000 reads were obtained and assembled into 42,630 contigs. Annotation data was acquired for 57% of the assembled sequences. Analysis of the assembled sequences indicated that 83-100% of all A. palmata transcripts were tagged, and provided a rough estimate of the total number genes expressed in our samples (~18,000-20,000. The coral annotation data contained many of the same molecular components as in the Bilateria, particularly in pathways associated with oxidative stress and DNA damage repair, and provided evidence that homologs of p53, a key player in DNA repair pathways, has experienced selection along the branch separating Cnidaria and Bilateria. Transcriptome wide screens of paralog groups and transition/transversion ratios highlighted genes including: green fluorescent proteins, carbonic anhydrase, and oxidative stress proteins; and functional groups involved in protein and nucleic acid metabolism, and the formation of structural molecules. These results provide a starting point for study of adaptive evolution in corals. CONCLUSIONS: Currently available transcriptome data now make comparative studies of the mechanisms underlying coral's evolutionary success possible. Here we identified candidate genes that enable corals to maintain genomic integrity despite

  15. Extraction systems for isolating esterases having interfacial adsorption

    Directory of Open Access Journals (Sweden)

    Alberto del Monte Martínez

    2009-06-01

    Full Text Available Resumen: En el presente trabajo se optimizaron las condiciones de extracción de esterasas con actividad en interfaces, a partir de la anémona marina Stichodactyla helianthus y del camarón peneido Litopenaeus vannamei. Las esterasas interfaciales, cuya presencia en estas especies había sido informada previamente, presentan características funcionales que las hacen muy atractivas para su empleo industrial. Los homogenados de los animales se trataron con los detergentes Tritón X-100, Tween 20 y Tween 80 en dos concentraciones cada uno: la Concentración Micelar Crítica (CMC y la mitad de ésta. Además se empleó NaCl 0,5 mol/L y n-butanol a las proporciones 5, 10 y 20%. Cada variante fue comparada con el método tradicional de extracción con agua destilada, que fue tomado como control. Los mejores resultados se obtuvieron empleando n-butanol al 20%, para recuperar las actividades esterasa y fosfolipasa, y al 10%, en el aislamiento de la actividad lipasa. La efectividad de este solvente en el aislamiento de estas enzimas con afinidad por las interfaces lípido/agua, pudiera estar dada por su capacidad para romper los agregados entre estas moléculas y causar la desorción de las mismas a los restos de membrana y tejidos presentes en la preparación.Palabras clave: activación interfacial, esterasas interfaciales, lipasas, Stichodactyla helianthus, Litopenaeus vannamei.interfacial activation, interfacial esterase, lipase, Stichodactyla helianthus, Litopenaeus vannamei.Abstract: Interfacial esterases present great functional versatility, making them very attractive molecules for industrial applications. The conditions for extracting interfacial esterases previously detected in the sea anemone Stichodactyla helianthus and the shrimp Litopenaeus vannamei were optimised in this work. Animal homogenates were treated with Triton X-100, Tween 20 and Tween 80 detergents at two different concentrations: critical micellar concentration (CMC and half

  16. Sediment Burial Intolerance of Marine Macroinvertebrates.

    Science.gov (United States)

    Hendrick, Vicki J; Hutchison, Zoë L; Last, Kim S

    2016-01-01

    The marine environment contains suspended particulate matter which originates from natural and anthropogenic sources. Settlement of this material can leave benthic organisms susceptible to smothering, especially if burial is sudden i.e. following storms or activities such as dredging. Their survival will depend on their tolerance to, and their ability to escape from burial. Here we present data from a multi-factorial experiment measuring burial responses incorporating duration, sediment fraction and depth. Six macroinvertebrates commonly found in sediment rich environments were selected for their commercial and/or conservation importance. Assessments revealed that the brittle star (Ophiura ophiura), the queen scallop (Aequipecten opercularis) and the sea squirt (Ciona intestinalis) were all highly intolerant to burial whilst the green urchin (Psammichinus miliaris) and the anemone (Sagartiogeton laceratus), showed intermediate and low intolerance respectively, to burial. The least intolerant, with very high survival was the Ross worm (Sabellaria spinulosa). With the exception of C. intestinalis, increasing duration and depth of burial with finer sediment fractions resulted in increased mortality for all species assessed. For C. intestinalis depth of burial and sediment fraction were found to be inconsequential since there was complete mortality of all specimens buried for more than one day. When burial emergence was assessed O. ophiura emerged most frequently, followed by P. miliaris. The former emerged most frequently from the medium and fine sediments whereas P. miliaris emerged more frequently from coarse sediment. Both A. opercularis and S. laceratus showed similar emergence responses over time, with A. opercularis emerging more frequently under coarse sediments. The frequency of emergence of S. laceratus increased with progressively finer sediment and C. intestinalis did not emerge from burial irrespective of sediment fraction or depth. Finally, and perhaps

  17. Sediment Burial Intolerance of Marine Macroinvertebrates.

    Directory of Open Access Journals (Sweden)

    Vicki J Hendrick

    Full Text Available The marine environment contains suspended particulate matter which originates from natural and anthropogenic sources. Settlement of this material can leave benthic organisms susceptible to smothering, especially if burial is sudden i.e. following storms or activities such as dredging. Their survival will depend on their tolerance to, and their ability to escape from burial. Here we present data from a multi-factorial experiment measuring burial responses incorporating duration, sediment fraction and depth. Six macroinvertebrates commonly found in sediment rich environments were selected for their commercial and/or conservation importance. Assessments revealed that the brittle star (Ophiura ophiura, the queen scallop (Aequipecten opercularis and the sea squirt (Ciona intestinalis were all highly intolerant to burial whilst the green urchin (Psammichinus miliaris and the anemone (Sagartiogeton laceratus, showed intermediate and low intolerance respectively, to burial. The least intolerant, with very high survival was the Ross worm (Sabellaria spinulosa. With the exception of C. intestinalis, increasing duration and depth of burial with finer sediment fractions resulted in increased mortality for all species assessed. For C. intestinalis depth of burial and sediment fraction were found to be inconsequential since there was complete mortality of all specimens buried for more than one day. When burial emergence was assessed O. ophiura emerged most frequently, followed by P. miliaris. The former emerged most frequently from the medium and fine sediments whereas P. miliaris emerged more frequently from coarse sediment. Both A. opercularis and S. laceratus showed similar emergence responses over time, with A. opercularis emerging more frequently under coarse sediments. The frequency of emergence of S. laceratus increased with progressively finer sediment and C. intestinalis did not emerge from burial irrespective of sediment fraction or depth. Finally

  18. Development and field application of a 6-bottle serial gas-tight fluid sampler for collecting seafloor cold seep and hydrothermal vent fluids with autonomous operation capability

    Science.gov (United States)

    Wu, S.; Ding, K.; Yang, C.; Seyfried, W. E., Jr.; Tan, C.; Schaen, A. T.; Luhmann, A. J.

    2014-12-01

    A 6-bottle serial gas-tight sampler (so-called "six-shooter") was developed for application with deep-sea vent fluids. The new device is composed of a custom-made 6-channel valve manifold and six sampling bottles which are circularly distributed around the valve manifold. Each valve channel consists of a high-pressure titanium cartridge valve and a motor-driven actuator. A sampling snorkel is connected to the inlet of the manifold that delivers the incoming fluid to different bottles. Each sampling bottle has a 160 ml-volume chamber and an accumulator chamber inside where compressed nitrogen is used to maintain the sample at near in-situ pressure. An electronics chamber that is located at the center of the sampler is used to carry out all sampling operations, autonomously, if desired. The sampler is of a compact circular configuration with a diameter of 26 cm and a length of 54 cm. During the SVC cruise AT 26-12, the sampler was deployed by DSV2 Alvin at a cold seep site MC036 with a depth of 1090 m in the Gulf of Mexico. The sampler collected fluid samples automatically following the tidal cycle to monitor the potential impact of the tide cycle on the fluid chemistry of cold seep in a period of two day. During the cruise AT 26-17, the sampler was used with newly upgraded DSV2 Alvin three times at the hydrothermal vent sites along Axial Seamount and Main Endeavor Field on Juan de Fuca Ridge. During a 4-day deployment at Anemone diffuse site (Axial Caldera), the sampler was set to work in an autonomous mode to collect fluid samples according to the preset interval. During other dives, the sampler was manually controlled via ICL (Inductively Coupled Link) communication through the hull. Gas-tight fluid samples were collected from different hydrothermal vents with temperatures between 267 ℃ and 335 ℃ at the depth up to 2200 m. The field results indicate unique advantages of the design. It can be deployed in extended time period with remote operation or working

  19. Comparative sensitivity of the cnidarian Exaiptasia pallida and a standard toxicity test suite: testing whole effluents intended for ocean disposal.

    Science.gov (United States)

    Howe, P L; Reichelt-Brushett, A J; Krassoi, R; Micevska, T

    2015-09-01

    The sea anemone Exaiptasia pallida (formally Aiptasia pulchella) has been identified as a valuable test species for tropical marine ecotoxicology. Here, the sensitivities of newly developed endpoints for E. pallida to two unidentified whole effluents were compared to a standard suite of temperate toxicity test species and endpoints that are commonly used in toxicological risk assessments for tropical marine environments. For whole effluent 1 (WE1), a 96-h lethal concentration 50 % (LC50) of 40 (95 % confidence intervals, 30-54) % v/v and a 12-day LC50 of 12 (9-15) % v/v were estimated for E. pallida, exhibiting a significantly higher sensitivity than standard sub-lethal endpoints in Allorchestes compressa (96-h effective concentration 50 % (EC50) of >100 % v/v for immobilisation) and Hormosira banksii (72-h EC50 of >100 % v/v for germination), and a similar sensitivity to Mytilus edulis galloprovincialis larval development with a 48-h LC50 of 29 (28-30) % v/v. Sub-lethal effects of whole effluent 2 (WE2) on E. pallida pedal lacerate development resulted in an 8-day EC50 of 7 (3-11) % v/v, demonstrating comparable sensitivity of this endpoint to standardised sub-lethal endpoints in H. banksii (72-h EC50 of 11 (10-11) % v/v for germination), M. edulis galloprovincialis (48-h EC50 for larval development of 12 (9-14) % v/v) and Heliocidaris tuberculata (1-h EC50 of 13 (12-14) % v/v for fertilisation; 72-h EC50 of 26 (25-27) % v/v for larval development) and a significantly higher sensitivity than A. compressa immobilisation (96-h EC50 of >100 % v/v). The sensitivity of E. pallida compared to a standard test species suite highlights the value in standardising the newly developed toxicity test methods for inclusion in routine toxicological risk assessment of complex whole effluents. Importantly, this species provides an additional taxonomic group to the test species that are currently available for tropical marine ecotoxicology and

  20. Sustainable Seas Student Intertidal Monitoring Project, Duxbury Reef, Bolinas, CA

    Science.gov (United States)

    Soave, K.; Dean, A.; Prescutti, K.; Ball, O.; Chang, E.; Darakananda, K.; Jessup, K.; Poutian, J.; Schwalbe, H.; Storm, E.

    2008-12-01

    The Sustainable Seas Student Monitoring Project at the Branson School in Ross, CA has monitored Duxbury Reef in Bolinas, CA since 1999, in cooperation with the Farallones Marine Sanctuary Association and the Gulf of Farallones National Marine Sanctuary. Goals of the project include: 1) To monitor the rocky intertidal habitat and develop a baseline database of invertebrates and algal density and abundance; 2) To contribute to the conservation of the rocky intertidal habitat through education of students and visitors about intertidal species and requirements for maintaining a healthy, diverse intertidal ecosystem; 3) To increase stewardship in the Gulf of the Farallones National Marine Sanctuary; and 4) To contribute abundance and population data on key algae and invertebrate species to the national database, LiMPETS (Long Term Monitoring Program and Experiential Training for Students). Student volunteers complete an intensive training course on the natural history of intertidal invertebrates and algae, identification of key species, rocky intertidal ecology, interpretation and monitoring techniques, and history of the sanctuary. Students identify and count key invertebrate and algae species along two permanent transects (A and B), and using randomly determined points within a permanent 100 m2 area, three times per year (fall, winter, and late spring). Using the data collected since 2004, we will analyze the population densities of aggregating anemones, Anthopleura elegantissima, for seasonal abundance variations as well as long-term population trends. We will also follow the seasonal and long-term population fluctuations of red algal turf, Endocladia muricata and Gelidium coulteri, and black turban snails, Tegula funebralis. Comparing populations of turf algae and the herbivorous black turban snails gathered before and after the November 7, 2007 San Francisco Bay oil spill shows very little impact on the Duxbury Reef intertidal inhabitants. Future analyses will

  1. Effect of hypoxia and anoxia on invertebrate behaviour: ecological perspectives from species to community level

    Directory of Open Access Journals (Sweden)

    B. Riedel

    2013-08-01

    Full Text Available Coastal hypoxia and anoxia have become a global key stressor to marine ecosystems, with almost 500 dead zones recorded wordwide. By triggering cascading effects from the individual organism to the community and ecosystem-level, oxygen depletions threat marine biodiversity and can alter ecosystem structure and function. By integrating both physiological function and ecological processes, animal behaviour is ideal for assessing the stress state of benthic macrofauna to low dissolved oxygen. The initial response of organisms can serve as an early-warning signal, while the successive behavioural reactions of key species indicate hypoxia levels and help assess community degradation. Here we document the behavioural responses of a representative spectrum of benthic macrofauna in the natural setting in the Northern Adriatic Sea, Mediterranean. We experimentally induced small-scale anoxia with a benthic chamber in 24 m depth to overcome the difficulties in predicting the onset of hypoxia, which often hinders full documentation in the field. The behavioural reactions were documented with a time-lapse camera. Oxygen depletion elicited significant and repeatable changes in general (visibility, locomotion, body movement and posture, location and species-specific reactions in virtually all organisms (302 individuals from 32 species and 2 species groups. Most atypical (stress behaviours were associated with specific oxygen thresholds: arm-tipping in the ophiuroid Ophiothrix quinquemaculata, for example, with the onset of mild hypoxia (2 L−1, the emergence of polychates on the sediment surface with moderate hypoxia (2 L−1, the emergence of the infaunal sea urchin Schizaster canaliferus on the sediment with severe hypoxia (2 L−1 and heavy body rotations in sea anemones with anoxia. Other species changed their activity patterns, i.e. circadian rhythm in the hermit crab Paguristes eremita or the bioherm-associated crab Pisidia longimana. Intra- and

  2. Baseline seabed habitat and biotope mapping for a proposed marine reserve.

    Science.gov (United States)

    Lee, Sonny T M; Kelly, Michelle; Langlois, Tim J; Costello, Mark J

    2015-01-01

    Seabed mapping can quantify the extent of benthic habitats that comprise marine ecosystems, and assess the impact of fisheries on an ecosystem. In this study, the distribution of seabed habitats in a proposed no-take Marine Reserve along the northeast coast of Great Barrier Island, New Zealand, was mapped using underwater video combined with bathymetry and substratum data. As a result of the boundary extending to the 12 nautical mile Territorial Limit, it would have been the largest coastal Marine Reserve in the country. Recreational and commercial fisheries occur in the region and would be expected to affect species' abundance. The seabed of the study area and adjacent coastal waters has been trawled up to five times per year. Benthic communities were grouped by multivariate cluster analysis into four biotope classes; namely (1) shallow water macroalgae Ecklonia sp. and Ulva sp. on rocky substrata (Eck.Ulv); and deeper (2) diverse epifauna of sponges and bryozoans on rocky substrata (Por.Bry), (3) brittle star Amphiura sp. and sea anemone Edwardsia sp. on muddy sand (Amph.Edw), and (4) hydroids on mud (Hyd). In biotopes Por.Bry, Amph.Edw and Hyd, there where boulders and rocks were present, and diverse sponge, bryozoan and coral communities. Fifty species were recorded in the deep water survey including significant numbers of the shallow-water hexactinellid glass sponges Symplectella rowi Dendy, 1924 and Rossella ijimai Dendy, 1924, the giant pipe demosponge Isodictya cavicornuta Dendy, 1924, black corals, and locally endemic gorgonians. The habitats identified in the waters to the northeast of Great Barrier Island are likely to be representative of similar depth ranges in northeast New Zealand. This study provides a baseline of the benthic habitats so that should the area become a Marine Reserve, any habitat change might be related to protection from fishing activities and impacts, such as recovery of epifauna following cessation of trawling. The habitat map may

  3. Evaluation of selected wild plants flowering season 1991 - 2009 (1991 - 2000 & 2001 - 2009)

    Science.gov (United States)

    Hajkova, L.; Nekovar, J.; Novak, M.; Richterova, D.

    2009-09-01

    The subsequent wild plants are observed by volunteer observers at CHMI phenological network: CALTHA palustris L., ANEMONE nemorosa L., HEPATICA nobilis Mill., RANUNCULUS acer L., FRAGARIA vesca L., TRIFOLIUM repens L., HYPERICUM perforatum L., CHAMAENERION angustifolium L. Holub, VACCINIUM myrtillus L., LAMIUM album L., CHRYSANTHEMUM leucanthemum L., TUSSILAGO farfara L., PETASITES albus (L.) Gaert., PETASITES hybridus (L.) G. M. Sch., CONVALLARIA majalis L., GALANTHUS nivalis L., DACTYLIS glomerata L., ALOPECURUS pratensis L. and others. Some of them start to blossom in early spring, some others in the summer. Part of them belong to very important allergens, part of them have medicinal effects. Phenophases first leaves (FL - BBCH11), inflorescence emergence (IE - BBCH 51), beginning and end of flowering (BF - BBCH 61, EF - BBCH 69) are observed by these species. Statistical parameters (average, median, lower quartile, upper quartile, minimum, maximum, standard deviation, variation range and variation coefficient) of phenophase onset are computed from all of phenological stations in Czechia for the period 1991 - 2009. The phenophase onset and phenophase duration depend not only on genetic base but also on external effects such as weather. We have compiled dynamics of temperature to phenophase onset according CHMI meteorological stations for the same period 1991 - 2009 (especially sums of active temperatures above biological minimum 5°C and progression of extreme temperatures). We have also compared results between two periods (1991 - 2000, 2001 - 2009). Phenological stations are at different altitude. At this case study were used results from 4 phenological stations at altitude ( 500 m asl). GALANTHUS nivalis L. Station: Lednice (165 m n. m.) Period: 1991 - 2000 Statistical parameter/phenophase BBCH 61 BBCH 69 Average 62 94 Median 60 97 Lower quartile 57 86 Upper quartile 66 101 Minimum 51 70 Maximum 79 116 Variation range 28 46 Standard deviation 8,6 12

  4. Discovery of a distinct superfamily of Kunitz-type toxin (KTT from tarantulas.

    Directory of Open Access Journals (Sweden)

    Chun-Hua Yuan

    Full Text Available BACKGROUND: Kuntiz-type toxins (KTTs have been found in the venom of animals such as snake, cone snail and sea anemone. The main ancestral function of Kunitz-type proteins was the inhibition of a diverse array of serine proteases, while toxic activities (such as ion-channel blocking were developed under a variety of Darwinian selection pressures. How new functions were grafted onto an old protein scaffold and what effect Darwinian selection pressures had on KTT evolution remains a puzzle. PRINCIPAL FINDINGS: Here we report the presence of a new superfamily of ktts in spiders (TARANTULAS: Ornithoctonus huwena and Ornithoctonus hainana, which share low sequence similarity to known KTTs and is clustered in a distinct clade in the phylogenetic tree of KTT evolution. The representative molecule of spider KTTs, HWTX-XI, purified from the venom of O. huwena, is a bi-functional protein which is a very potent trypsin inhibitor (about 30-fold more strong than BPTI as well as a weak Kv1.1 potassium channel blocker. Structural analysis of HWTX-XI in 3-D by NMR together with comparative function analysis of 18 expressed mutants of this toxin revealed two separate sites, corresponding to these two activities, located on the two ends of the cone-shape molecule of HWTX-XI. Comparison of non-synonymous/synonymous mutation ratios (omega for each site in spider and snake KTTs, as well as PBTI like body Kunitz proteins revealed high Darwinian selection pressure on the binding sites for Kv channels and serine proteases in snake, while only on the proteases in spider and none detected in body proteins, suggesting different rates and patterns of evolution among them. The results also revealed a series of key events in the history of spider KTT evolution, including the formation of a novel KTT family (named sub-Kuntiz-type toxins derived from the ancestral native KTTs with the loss of the second disulfide bridge accompanied by several dramatic sequence modifications

  5. Specific retention of the protostome-specific PsGEF may parallel with the evolution of mushroom bodies in insect and lophotrochozoan brains

    Directory of Open Access Journals (Sweden)

    Kohno Keigo

    2009-05-01

    Full Text Available Abstract Background Gene gain and subsequent retention or loss during evolution may be one of the underlying mechanisms involved in generating the diversity of metazoan nervous systems. However, the causal relationships acting therein have not been studied extensively. Results We identified the gene PsGEF (protostome-specific GEF, which is present in all the sequenced genomes of insects and limpet but absent in those of sea anemones, deuterostomes, and nematodes. In Drosophila melanogaster, PsGEF encodes a short version of a protein with the C2 and PDZ domains, as well as a long version with the C2, PDZ, and RhoGEF domains through alternative splicing. Intriguingly, the exons encoding the RhoGEF domain are specifically deleted in the Daphnia pulex genome, suggesting that Daphnia PsGEF contains only the C2 and PDZ domains. Thus, the distribution of PsGEF containing the C2, PDZ, and RhoGEF domains among metazoans appears to coincide with the presence of mushroom bodies. Mushroom bodies are prominent neuropils involved in the processing of multiple sensory inputs as well as associative learning in the insect, platyhelminth, and annelid brains. In the adult Drosophila brain, PsGEF is expressed in mushroom bodies, antennal lobe, and optic lobe, where it is necessary for the correct axon branch formation of alpha/beta neurons in mushroom bodies. PsGEF genetically interacts with Rac1 but not other Rho family members, and the RhoGEF domain of PsGEF induces actin polymerization in the membrane, thus resulting in the membrane ruffling that is observed in cultured cells with activated forms of Rac. Conclusion The specific acquisition of PsGEF by the last common ancestor of protostomes followed by its retention or loss in specific animal species during evolution demonstrates that there are some structural and/or functional features common between insect and lophotrochozoan nervous systems (for example, mushroom bodies, which are absent in all deuterostomes

  6. Biofouling community pattern on various metallic surfaces in the coastal waters of Kalpakkam, Southwestern Bay of Bengal

    International Nuclear Information System (INIS)

    . 100 cm-2. The major fouling organisms such as, barnacle, green mussel and ascidian constituted ∼ 70-80% of the total fouling. In the present study, sequence of fouling succession was as follows, barnacle - hydroid - sea anemone - ascidian and finally green mussel (Perna viridis Linn. 1758). The paper also discusses species diversity indices (diversity, richness and evenness) in detail. (author)

  7. How do plant communities and flower visitors relate? A case study of semi-natural xerothermic grasslands

    Directory of Open Access Journals (Sweden)

    Damian Chmura

    2013-06-01

    Full Text Available The paper examines the relationships between the species composition of flower visitors and plants in the semi-natural xerothermic grasslands in southern and central Poland. Thirty 10 × 10 m permanent plots were laid out in total, mainly in nature reserves. The vegetation units studied were classified according to the Braun-Blanquet system; these were phytocoenoses of the Festuco-Brometea classes Inuletum ensifoliae, Adonido-Brachypodietum pinnati and the transitional plant community. Entomological research was performed using the Pollard method within the same plots. A particular site was visited only once and different sites were studied between April and August 2008. We applied, among others, co-correspondence-analysis Co-CA, detrended correspondence analysis (DCA and redundancy analysis (RDA to investigate the co-occurrence patterns of plants and flower visitors and their biotopic requirements. We found that the species composition of flower visitors cannot be predicted by floristic composition when the duration of the study is restricted to one day (but under similar weather conditions; however, there is a positive relationship between the species richness of insects and plants and a positive relationship between the number of plant species and the abundance of flower visitors. The Ellenberg moisture index and the cover of meadow species significantly explained the species composition of insects. The three various vegetation units and five dominant xerothermic species, i.e. Adonis vernalis, Anemone sylvestris, Inula ensifolia, Linum hirsutum and Carlina onopordifolia that were studied across time differed in the species richness of insects. Our results demonstrate that possible patterns in the species composition and the assembly rules of flower visitors are not apparent when the Pollard method is applied. Based on the data obtained using this method, the flower visiting assemblages seem not to be driven by competition and they primarily

  8. [Essentials of pharmacophylogeny: knowledge pedigree, epistemology and paradigm shift].

    Science.gov (United States)

    Hao, Da-cheng; Xiao, Pei-gen; Liu, Li-wei; Peng, Yong; He, Chun-nian

    2015-09-01

    Chinese materia medica resource (CMM resource) is the foundation of the development of traditional Chinese medicine. In the study of sustainable utilization of CMM resource, adopting innovative theory and method to find new CMM resource is one of hotspots and always highlighted. Pharmacophylogeny interrogates the phylogenetic relationship of medicinal organisms (especially medicinal plants), as well as the intrinsic correlation of morphological taxonomy, molecular phylogeny, chemical constituents, and therapeutic efficacy (ethnopharmacology and pharmacological activity). This new discipline may have the power to change the way we utilize medicinal plant resources and develop plant-based drugs. Phylogenomics is the crossing of evolutionary biology and genomics, in which genome data are utilized for evolutionary reconstructions. Phylogenomics can be integrated into the flow chart of drug discovery and development, and extends the field of pharmacophylogeny at the omic level, thus the concept of pharmacophylogenomics could be redefined in the context of plant pharmaceutical resources. This contribution gives a brief discourse of knowledge pedigree of pharmacophylogeny, epistemology and paradigm shift, highlighting the theoretical and practical values of pharmacophylogenomics. Many medicinally important tribes and genera, such as Clematis, Pulsatilla, Anemone, Cimicifugeae, Nigella, Delphinieae, Adonideae, Aquilegia, Thalictrum, and Coptis, belong to Ranunculaceae family. Compared to other plant families, Ranunculaceae has the most species that are recorded in China Pharmacopoeia (CP) 2010. However, many Ranunculaceae species, e. g., those that are closely related to CP species, as well as those endemic to China, have not been investigated in depth, and their phylogenetic relationship and potential in medicinal use remain elusive. As such, it is proposed to select Ranunculaceae to exemplify the utility of pharmacophylogenomics and to elaborate the new concept

  9. Ancestral gene and "complementary" antibody dominate early ontogeny.

    Science.gov (United States)

    Arend, Peter

    2013-05-01

    According to N.K. Jerne the somatic generation of immune recognition occurs in conjunction with germ cell evolution and precedes the formation of the zygote, i.e. operates before clonal selection. We propose that it is based on interspecies inherent, ancestral forces maintaining the lineage. Murine oogenesis may be offered as a model. So in C57BL/10BL sera an anti-A reactive, mercapto-ethanol sensitive glycoprotein of up to now unknown cellular origin, but exhibiting immunoglobulin M character, presents itself "complementary" to a syngeneic epitope, which encoded by histocompatibility gene A or meanwhile accepted ancestor of the ABO gene family, arises predominantly in ovarian tissue and was detected statistically significant exclusively in polar glycolipids. Reports either on loss, pronounced expressions or de novo appearances of A-type structures in various conditions of accelerated growth like germ cell evolution, wound healing, inflammation and tumor proliferation in man and ABO related animals might show the dynamics of ancestral functions guarantying stem cell fidelity in maturation and tissue renewal processes. Procedures vice versa generating pluripotent stem cells for therapeutical reasons may indicate, that any artificially started growth should somehow pass through the germ line from the beginning, where according to growing knowledge exclusively the oocyte's genome provides a completely channeling ancestral information. In predatory animals such as the modern-day sea anemone, ancestral proteins, particularly those of the p53 gene family govern the reproduction processes, and are active up to the current mammalian female germ line. Lectins, providing the dual function of growth promotion and defense in higher plants, are suggested to represent the evolutionary precursors of the mammalian immunoglobulin M molecules, or protein moiety implying the greatest functional diversity in nature. And apart from any established mammalian genetic tree, a common vetch

  10. Reef flattening effects on total richness and species responses in the Caribbean.

    Science.gov (United States)

    Newman, Steven P; Meesters, Erik H; Dryden, Charlie S; Williams, Stacey M; Sanchez, Cristina; Mumby, Peter J; Polunin, Nicholas V C

    2015-11-01

    There has been ongoing flattening of Caribbean coral reefs with the loss of habitat having severe implications for these systems. Complexity and its structural components are important to fish species richness and community composition, but little is known about its role for other taxa or species-specific responses. This study reveals the importance of reef habitat complexity and structural components to different taxa of macrofauna, total species richness, and individual coral and fish species in the Caribbean. Species presence and richness of different taxa were visually quantified in one hundred 25-m(2) plots in three marine reserves in the Caribbean. Sampling was evenly distributed across five levels of visually estimated reef complexity, with five structural components also recorded: the number of corals, number of large corals, slope angle, maximum sponge and maximum octocoral height. Taking advantage of natural heterogeneity in structural complexity within a particular coral reef habitat (Orbicella reefs) and discrete environmental envelope, thus minimizing other sources of variability, the relative importance of reef complexity and structural components was quantified for different taxa and individual fish and coral species on Caribbean coral reefs using boosted regression trees (BRTs). Boosted regression tree models performed very well when explaining variability in total (82·3%), coral (80·6%) and fish species richness (77·3%), for which the greatest declines in richness occurred below intermediate reef complexity levels. Complexity accounted for very little of the variability in octocorals, sponges, arthropods, annelids or anemones. BRTs revealed species-specific variability and importance for reef complexity and structural components. Coral and fish species occupancy generally declined at low complexity levels, with the exception of two coral species (Pseudodiploria strigosa and Porites divaricata) and four fish species (Halichoeres bivittatus, H

  11. Investigation into extremely acidic hydrothermal fluids off Kueishan Tao, Taiwan, China

    Institute of Scientific and Technical Information of China (English)

    CHEN Chentung A; WANG Bingjye; HUANG Jungfu; LOU Jiannyuh; KUO Fuwen; TU Yuehyuan; TSAI Hsienshiow

    2005-01-01

    Kueishan Tao (24°51'N, 121 °55′E) is located at a tectonic junction of the fault system extension of Taiwan and the southern rifting end of the Okinawa Trough. A cluster of over 30 vents, at a water depth of about 10~20 m off the eastern tip of the tao emits hydrothermal fluids and volcanic gases such as H2S. A sulfur chimney or mound, formed by condensation of the sulfur contained in the hydrothermal fluid, can usually be seen around the vents. The tallest chimney reaches 6 m. Vents discharging a yellowish fluid have temperatures between 92 and 116 ℃ and flow rates as high as 158 t/h; vents discharging a whitish fluid have lower temperatures of between 48 and 62 ℃ and lower flow rates of about 7.0 t/h. These world-record, breaking low pH (as low as 1.52) fluids are totally different from those found in the black and white-chimneys of the mid-ocean ridges. Magnesium and SiO2 data indicate that these hydrothermal fluids probably originate from a depth of 915~1 350 m below the surface.While the ratios of major ions relative to the sodium of these hydrothermal fluids are quite similar to open ocean water, the ratios of SO4 and chloride to sodium seem to be higher for some of the vents. It is suggested that the volcanic gases contribute SO4 and ohlorine to the fluids, hence increasing their ratios relative to sodium. Some hydrothermal fluids, however, are found to be depleted of the major elements which can have been caused by phase separation. The concentrations of iron and manganese in the fluids are much lower than those found in the mid-ocean ridges, while the aluminium content is higher. Four species of benthos (Xenograpsus testudinatus, a snail, a sea anemone, and a Sipuncala), 1 species of algae (Corallinaceae), and 1 species of fish (Siganus fusescens) were recorded near the hydrothermal vents. A mitoehondria DNA sequence comparison of Xenograpsus testudinatus with 6 other decapod species shows the greatest number of nitrogen base differences in the

  12. A tarantula-venom peptide that antagonises the TRPA1 nociceptor ion channel by binding to the S1-S4 gating domain

    Science.gov (United States)

    Gui, Junhong; Liu, Boyi; Cao, Guan; Lipchik, Andrew M.; Perez, Minervo; Dekan, Zoltan; Mobli, Mehdi; Daly, Norelle L.; Alewood, Paul F.; Parker, Laurie L.; King, Glenn F.; Zhou, Yufeng; Jordt, Sven-Eric; Nitabach, Michael N.

    2014-01-01

    Background The venoms of predators such as spiders, scorpions, cone snails, sea anemones, and snakes, have been an excellent source of pharmacological diversity for drug discovery and as pharmacological tools for elucidating the structure, function, and physiological properties of ion channels. Here we describe the first known peptide antagonist of the nociceptor ion channel transient receptor potential ankyrin 1 (TRPA1). Results We constructed a recombinant cDNA library encoding ∼100 diverse GPI-anchored peptide toxins (t-toxins) derived from spider venoms and screened this library by co-expression in Xenopus oocytes with TRPA1. This screen resulted in identification of protoxin-I (ProTx-I), a 35-residue peptide from the venom of the Peruvian green-velvet tarantula, Thrixopelma pruriens, as the first known high-affinity peptide TRPA1 antagonist. Interestingly, ProTx-I was previously identified as an antagonist of voltage-gated sodium (NaV) channels. To identify the surfaces of ProTx-I by which it binds to these distinct ion channel types, we constructed a t-toxin library of ProTx-I alanine-scanning mutants and screened this library against NaV1.2 and TRPA1. This revealed distinct partially overlapping surfaces of ProTx-I by which it binds to these two ion channels, and whose specific chemical features explain its higher affinity for NaV1.2 than for TRPA1. Importantly, this mutagenesis yielded two novel ProTx-I variants that are only active against either TRPA1or NaV1.2, but not both. By testing its activity against chimeric channels, we identified the extracellular loops of the TRPA1 S1-S4 gating domain as the ProTx-I binding site. Conclusions These studies establish screening of t-toxin libraries of native and mutated toxins, which we term “toxineering”, as a generally applicable method for isolation of novel ion channel modifiers and for design of ion channel modifiers with altered target selectivity. They also suggest that ProTx-I will be a valuable

  13. The Genome of Aiptasia and the Role of MicroRNAs in Cnidarian-Dinoflagellate Endosymbiosis

    KAUST Repository

    Baumgarten, Sebastian

    2016-02-01

    Coral reefs form marine-biodiversity hotspots of enormous ecological, economic, and aesthetic importance that rely energetically on a functional symbiosis between the coral animal and a photosynthetic alga. The ongoing decline of corals worldwide due to anthropogenic influences heightens the need for an experimentally tractable model system to elucidate the molecular and cellular biology underlying the symbiosis and its susceptibility or resilience to stress. The small sea anemone Aiptasia is such a model organism and the main aims of this dissertation were 1) to assemble and analyze its genome as a foundational resource for research in this area and 2) to investigate the role of miRNAs in modulating gene expression during the onset and maintenance of symbiosis. The genome analysis has revealed numerous features of interest in relation to the symbiotic lifestyle, including the evolution of transposable elements and taxonomically restricted genes, linkage of host and symbiont metabolism pathways, a novel family of putative pattern-recognition receptors that might function in host-microbe interactions and evidence for horizontal gene transfer within the animal-alga pair as well as with the associated prokaryotic microbiome. The new genomic resource was used to annotate the Aiptasia miRNA repertoire to illuminate the role of post-transcriptional regulatory mechanisms in regulating endosymbiosis. Aiptasia encodes a majority of species-specific miRNAs and first evidence is presented that even evolutionary conserved miRNAs are undergoing recent differentiations within the Aiptasia genome. The analysis of miRNA expression between different states of Symbiodinium infection further revealed that species-specific and conserved miRNAs are symbiotically regulated. In order to detect functional miRNA-mRNA interactions and to investigate the downstream effects of such miRNA action, a protocol for cross-linking immunoprecipitations of Argonaute, the central protein of the mi

  14. Influence of Overstory on Seasonal Variability of Understory Herbs in Primary Broad-leaved Korean Pine Forest of Changbai Mountain%长白山原始阔叶红松林林下草本植物多样性格局及其影响因素

    Institute of Scientific and Technical Information of China (English)

    夏富才; 潘春芳2; 赵秀海2; 何海燕3; 周海城3

    2012-01-01

    于2009年生长季(5~9月份)对布置在1.0 hm2的原始阔叶红松林样地内的100个草本样方(1m×1 m)进行物种及其植株高度、盖度以及土壤因子、光照环境进行调查,分析不同层片与土壤因子、光照环境的相关性以及乔木层、灌木层、土壤因子、光照环境对草本层多样性格局的影响,以阐明长白山阔叶红松林林下草本层多样性格局及其影响因素.结果表明:(1)阔叶红松林下的草本植物存在明显的季节动态变化,其中,5月份黑水银莲花(Anemone amurensis)、延胡索(Corydalis ambigua)等早春短命植物占优势,6月份部分早春短命植物和早夏植物、晚夏植物同时出现,物种丰富度最高,7月份是夏季植物的生长旺季,物种多样性最高,8~9月份草本植物逐渐枯萎.(2)灌木层的多样性与草本层的多样性呈极显著正相关,灌木层的株数密度与不同月份的草本层盖度呈正相关、与草本层多样性呈负相关,而乔木层对草本层盖度和多样性的影响均不显著.(3)土壤速效钾、光照和土壤水分是关联乔木层和草本层的重要环境因子.研究认为,阔叶红松林下的乔木层通过影响光照、降水及枯落物的含量而间接影响草本层的多样性格局.%The relationships among the vertical layers (tree-, shrub- and herb-layer) of a temperate forest and the power of environmental and spatial factors were investigated to explain the variation in two attributes of herb-layer;cover and diversity. In the 1. 0 hm2 study site,a total of 100 1-m2 sub-plots (each 20 mX 20 m has 4 1-m2 sub-plots) were monitored monthly from May to September in 2009. Among the environmental factors, tree-and shrub-layer related factors (density, canopy cover and Shannon-diversity) , soil attributes (soil organic matter, available nitrogen, available phosphorus, available potassium, soil water and pH) and light regime (LAI,PPFD and canopy presence) were studied. The results

  15. Macroepizoísmo em Libinia ferreirae (Crustacea, Brachyura, Majidae Macroepizoites on Libinia ferreirae (Crustacea, Brachyura, Majidae

    Directory of Open Access Journals (Sweden)

    Vanessa C. Winter

    2006-06-01

    of Gammaridea (Crustacea. The sea anemone C. tricolor was the most frequent species and probably it is used as a mechanism of camouflage by crabs. Macroepizoites on L. ferreirae are related to its age or size, therefore, bigger or older crabs had greater incidence of macroepizoites. However, the density of macroepizoites is about three per crab. There is not a relationship between macroepizoism and sex of the host, but ovigerous females use this resource more frequently than non-ovigerous ones. Due to larger setting area, macroepizoites colonize mainly the carapace of the host; bryozoans predominate in hosts' pereiopods.

  16. Previously unsuspected dietary habits of hydrothermal vent fauna: the bactivorous shrimp Rimicaris hybisae can be carnivorous or even cannibalistic

    Science.gov (United States)

    Versteegh, Emma; Van Dover, Cindy; Coleman, Max

    2014-05-01

    Most hydrothermal vents support productive communities, with chemosynthetic bacteria at the base of the food web. They form a potentially important link in global geochemical cycles. However, few data yet exist on their significance in ocean biogeochemistry and related ecological processes. We present results on the structure of part of the food web around hydrothermal vents of the Mid-Cayman Rise (MCR), revealing previously unknown life-history traits of the alvinocarid shrimp species Rimicaris hybisae. We also demonstrate that stable carbon isotope ratios (δ13C values) are an excellent tracer of trophic positions in these ecosystems, in spite of recent findings arguing otherwise. Two hydrothermal vent fields have been described at the ultra-slow spreading ridge of the MCR. These include the world's deepest hydrothermal vents (Piccard field ~4985 m), which support a food web, which includes bactivorous shrimp and carnivorous anemones. The nearby Von Damm vent field (~2300 m) supports a more complex food web, with more primary producers, and probably some influx of photosynthetically produced carbon. Rimicaris hybisae is abundant at both known MCR vent fields and shows a high degree of spatial variability in population structure and reproductive features. In previous work it has been considered bactivorous. Large variations in tissue δ13C values remained largely unexplained, and it has been argued that δ13C values are not a good food web tracer in hydrothermal vent ecosystems. We observed that shrimp tended to be either in dense aggregations on active chimneys or more sparsely distributed, peripheral shrimp in ambient or near-ambient temperatures. With the hypothesis that varying δ13C values show real differences in food sources between individuals and that shrimp in different locales might have different diets, we collected shrimp from both environments at the Von Damm site during E/V Nautilus (NA034, August 2013) and examined their gut contents. Stomach

  17. Floral reward in Ranunculaceae species

    Directory of Open Access Journals (Sweden)

    Bożena Denisow

    2016-04-01

    on meadows. Nectaries are secretory structures that synthesize and release nectar, a multi-component carbohydrate-rich aqueous solution. The relative location of nectaries within a flower is under pressure to maximize relations with pollinators, and hence to ensure the deposition of pollen on the stigma by pollinators. Nectaries are common in Ranunculaceae. Location, morphology and structure of the floral nectaries differ among Ranunculaceae representatives. Nectaries are tubular in Helleborus spp. or situated in nectary spurs (Aconitum, Aquilegia. Nectaries consist of an external epidermis, a photosynthesizing parenchyma, large branches of vascular tissue, a nectar-producing parenchyma, and an internal epidermis (Vesprini et al. 2008. Nectar production is generally associated with mutualistic relations with animals that rely on sugar secretions in their nutrition. Interspecies differences in the amount of nectar produced and nectar chemistry are noted among Ranunculaceae species. Significant variations in nectar carbohydrate composition between male and female sexual phases occur both in the protandrous and protogynous flowers. In Aconitum carmichaelii, male-phase flowers produced 2.4-fold more nectar than femalephase flowers. Nectar sugar composition can differ between species within genera. The nectar can be sucrose-dominant, e.g. in Aconitum carmichaelii or sucrose-rich and lacking glucose in A. lycoctonum (Antoń & Denisow 2014. Variability in nectar production and/or carbohydrate composition in an individual plant may be considered to be evolutionarily significant. It can modify insect movements between flowers and plants, impact on visitation rates, reduce geitonogamy and thus increase plant fitness by cross-pollination. The floral morphology and the type of the floral attractant in Anemone sylvestris is an example of the inbetween form from entomophily to anemophily (lack of nectar, papillous stigma, dense hairs situated between single carpels, small pollen

  18. Benthic survey of natural and artificial reefs off Mar del Plata, Argentina, southwestern Atlantic Estudios del bentos de arrecifes naturales y artificiales de Mar del Plata, Argentina, Atlántico sudoccidental

    Directory of Open Access Journals (Sweden)

    Gabriel Genzano

    2011-11-01

    Full Text Available This study describes the macrofaunal assemblages of subtidal rocky reefs off Mar del Plata in order to compare the macro invertebrate assemblages settled on shipwrecks with those of nearby reef sand to characterize the fish fauna associated with natural (NR and artificial (AR reefs. Topographic characterizations and surveys of invertebrates and fishes were performed in November and December 2005, using SCUBA diving. A non-parametric multivariate analysis was used to analyze the environmental and biological data. The reefs were mainly distinguished by their depth and the position of the substrate. The red calcareous algae, Corallina officinalis, dominated the shallowest NR, whereas conspicuous mytilid assemblages of Mytilus platensis were present at depths over 3 m, sea anemones, Anthothoe chilensis, were more abundant between 6 and 10 m, and the soft coral, Tripalea clavaria, was found at nearly 20 m depth. No differences were found between horizontal ARs and the adjacent NRs. The greatest differences were found between the communities of vertical and horizontal substrates, both in NRs and ARs. Fifteen fish species were recorded in the analyzed area. Species having strong site fidelity, e.g., Acanthistius brasilianus and Pseudopercis semifasciata, were clearly more abundant and/or frequent in ARs (shipwrecks than in NRs. This pioneer study in the surveyed area showed that reef sallow the settlement of diverse benthic assemblages. ARs also provide refuge for fishes. As sport fishing and diving are activities being carried out in Mar del Plata, where tourism is one of the main economic resources, the protection of such areas should be considered in conservation plans.Se describió la macrofauna de los arrecifes rocosos sublitorales, frente a Mar del Plata, para comparar las asociaciones de macro-invertebrados de los pecios con las de los arrecifes aledaños y caracterizar la fauna de peces tanto en los arrecifes naturales (NR como artificiales (AR

  19. 青岛海鸥浮码头冬季污损生物调查分析%Investigation and Analysis of Fouling Organisms in Qingdao Seagulls Floating Dock

    Institute of Scientific and Technical Information of China (English)

    马士德; 王在东; 刘会莲; 赵君; 段继周; 许健平; 韩文; 王静; 刘传安

    2015-01-01

    [Objective]In order to investigate the ecological change of Qingdao Port,and find basic bio-fouling information for the evaluation of ecological change in Jiaozhou Bay,an inves-tigation of “Seagulls”floating dock is taken during its 5.5 years’service period in Qingdao Zhonggang Port.[Methods]This paper analyzed and identified the stable community struc-ture and distribution of fouling organisms in winter.[Results]Through comparing the current and 50 years ago data,it shows that the basic structure of stable community in winter is fixed type organisms.The bottom layer,which contains Ostrea gigas thun b erg and Balanus sp.,is attached by Pyrosomella verticilliata ,Mytilidae and Bryozoa .The upper layer is filled with carpet type organisms.Except Balanus sp., Ostrea gigas thun b erg and Mytilidae , the maximum weight of the floating dock per unit area during the 5.5 years is 1.0 kg/m2 .[Conclu-sion]The structure of stable winter fouling com-munity and adhesion quantities have significantly changed over 50 years,suggesting the research of fouling organisms in Jiaozhou Bay need to be employed in the Jiaozhou Bay ecological research of marine ecosystems.%【目的】为给胶州湾生态评价提供污损生物的基本信息,调查青岛中港服役5.5年海鸥浮码头水中钢结构的生物污损状况。【方法】分析鉴定该浮码头冬季污损生物的稳定群落结构及其分布,并与50年前的调查结果进行对比。【结果】青岛中港冬季稳定群落基本结构为多年生固着生物,牡蛎(Ostrea gigas thun berg )和藤壶(Balanus sp.)为底层,其上为附着型的海鞘(Pyrosomella verticilliata )、贻贝(Mytilidae )和苔藓虫(Bryozoa ),表层为地毯式复海鞘、苔藓虫、海绵(Reniclona sp.)、水螅(Hydra )和海葵(Sea anemone )等;去除多年生固着生物(藤壶、牡蛎)及附着型的扇贝,服役5.5年浮码头最大单位面积污损重量不足1.0 kg/m2。【结论】相比50年前,青岛中