WorldWideScience

Sample records for americium 241 target

  1. Investigation of americium-241 metal alloys for target applications

    International Nuclear Information System (INIS)

    Conner, W.V.; Rockwell International Corp., Golden, CO

    1982-01-01

    Several 241 Am metal alloys have been investigated for possible use in the Lawrence Livermore National Laboratory Radiochemical Diagnostic Tracer Program. Several properties were desired for an alloy to be useful for tracer program applications. A suitable alloy would have a fairly high density, be ductile, homogeneous and easy to prepare. Alloys investigated have included uranium-americium, aluminium-americium, and cerium-americium. Uranium-americium alloys with the desired properties proved to be difficult to prepare, and work with this alloy was discontinued. Aluminium-americium alloys were much easier to prepare, but the alloy consisted of an aluminium-americium intermetallic compound (AmAl 4 ) in an aluminum matrix. This alloy could be cast and formed into shapes, but the low density of aluminum, and other problems, made the alloy unsuitable for the intended application. Americium metal was found to have a high solid solubility in cerium and alloys prepared from these two elements exhibited all of the properties desired for the tracer program application. Cerium-americium alloys containing up to 34 wt% americium have been prepared using both co-melting and co-reduction techniques. The latter technique involves co-reduction of cerium tetrafluoride and americium tetrafluoride with calcium metal in a sealed reduction vessel. Casting techniques have been developed for preparing up to eight 2.2 cm (0.87 in) diameter disks in a single casting, and cerium-americium metal alloy disks containing from 10 to 25 wt% 241 Am have been prepared using these techniques. (orig.)

  2. Americium-241 - ED 4308

    International Nuclear Information System (INIS)

    Ammerich, M.; Frot, P.; Gambini, D.; Gauron, C.; Moureaux, P.; Herbelet, G.; Lahaye, T.; Le Guen, B.; Pihet, P.; Rannou, A.; Vidal, E.

    2012-12-01

    This sheet presents the characteristics of Americium-241, its origin, and its radio-physical and biological properties. It briefly describes its use in nuclear medicine. It indicates its dosimetric parameters for external exposure, cutaneous contamination, and internal exposure due to acute contamination or to chronic contamination. It indicates and comments the various exposure control techniques: ambient dose rate measurement, surface contamination measurement, atmosphere contamination. It addresses the means of protection: premise design, protection against external exposure and against internal exposure. It describes how areas are delimited and controlled within the premises: regulatory areas, controls to be performed. It addresses the personnel classification, training and medical survey. It addresses the issue of wastes and effluents. It briefly recalls the administrative procedures related to the authorization and declaration of possession and use of sealed and unsealed sources. It indicates regulatory aspects related to the road transport of Americium-241, describes what is to be done in case of incident or accident (for the different types of contamination or exposure)

  3. Metabolism of americium-241 in dairy animals

    International Nuclear Information System (INIS)

    Sutton, W.W.; Patzer, R.G.; Mullen, A.A.; Hahn, P.B.; Potter, G.D.

    1978-10-01

    Groups of lactating cows and goats were used to examine americium-241 metabolism in dairy animals. Following either single oral or intravenous nuclide doses, samples of milk, urine, blood, and feces were taken over a 168-hr collection period and the americium concentrations were determined by gamma counting. Gastrointestinal uptake of americium by both cows and goats was estimated to be 0.014% of the respective oral doses. The cumulative percentage of oral dose transported to milk and urine was 4.4 x 10 -4 and 1.1 x 10 -3 respectively for cows and 4.4 x 10 -3 and 1.2 x 10 -3 respectively for goats. The relatively high americium concentrations noted in caprine milk following the oral doses are discussed. Plasma concentrations of americium decreased rapidly following all intravenous injections. The average percentage of injected americium transferred to milk, urine, and feces was 3, 6, and 2% respectively for cows and 2, 4, and 2% respectively for goats. In both intravenously dosed groups, approximately 30% of all americium released from the body was found in the urine during the first 24 hrs after injection. All animals were sacrificed 8 to 9 days after dosing. Bovine bone retained the greatest fraction of the administered dose followed by the liver. However, liver retained the greatest amount of americium in the goats following both oral and intravenous doses. Comparisons are presented between americium-241 and plutonium-238 transport in dairy cows

  4. Effect of 241-americium on bone marrow stroma

    International Nuclear Information System (INIS)

    Heuvel, R. van den

    1990-01-01

    The regulation of haemopoiesis occurs via complex interactions between the stroma and the haemopoietic cells. An attempt to further clarifying the mechanisms and the exact role of the stroma in the regulation was made in a study. Results revealed that the murine bone marrow stromal cells are highly radiosensitive after injection with 241-americium and can thus be considered as a target population after internal contamination. In addition, observations are made which may be important for risk estimation for the developing animal and during pregnancy. Contamination in utero and by lactation shows persistent damage up to 1 year after contamination at an average annual dose of 5 cGy. (author)

  5. Effect of americium-241 on luminous bacteria. Role of peroxides

    Energy Technology Data Exchange (ETDEWEB)

    Alexandrova, M., E-mail: maka-alexandrova@rambler.r [Siberian Federal University, Svobodny 79, 660041 Krasnoyarsk (Russian Federation); Rozhko, T. [Siberian Federal University, Svobodny 79, 660041 Krasnoyarsk (Russian Federation); Vydryakova, G. [Institute of Biophysics SB RAS, Akademgorodok 50, 660036 Krasnoyarsk (Russian Federation); Kudryasheva, N. [Siberian Federal University, Svobodny 79, 660041 Krasnoyarsk (Russian Federation); Institute of Biophysics SB RAS, Akademgorodok 50, 660036 Krasnoyarsk (Russian Federation)

    2011-04-15

    The effect of americium-241 ({sup 241}Am), an alpha-emitting radionuclide of high specific activity, on luminous bacteria Photobacterium phosphoreum was studied. Traces of {sup 241}Am in nutrient media (0.16-6.67 kBq/L) suppressed the growth of bacteria, but enhanced luminescence intensity and quantum yield at room temperature. Lower temperature (4 {sup o}C) increased the time of bacterial luminescence and revealed a stage of bioluminescence inhibition after 150 h of bioluminescence registration start. The role of conditions of exposure the bacterial cells to the {sup 241}Am is discussed. The effect of {sup 241}Am on luminous bacteria was attributed to peroxide compounds generated in water solutions as secondary products of radioactive decay. Increase of peroxide concentration in {sup 241}Am solutions was demonstrated; and the similarity of {sup 241}Am and hydrogen peroxide effects on bacterial luminescence was revealed. The study provides a scientific basis for elaboration of bioluminescence-based assay to monitor radiotoxicity of alpha-emitting radionuclides in aquatic solutions. - Highlights: {yields} Am-241 in water solutions (A = 0.16-6.7 kBq/L) suppresses bacterial growth.{yields} Am-241 (A = 0.16-6.7 kBq/L) stimulate bacterial luminescence. {yields} Peroxides, secondary radiolysis products, cause increase of bacterial luminescence.

  6. Evaluation of neutron data for americium-241

    Energy Technology Data Exchange (ETDEWEB)

    Maslov, V.M.; Sukhovitskij, E.Sh.; Porodzinskij, Yu.V.; Klepatskij, A.B.; Morogovskij, G.B. [Radiation Physics and Chemistry Problems Inst., Minsk-Sosny (Belarus)

    1997-03-01

    The evaluation of neutron data for {sup 241}Am is made in the energy region from 10{sup -5} eV up to 20 MeV. The results of the evaluation are compiled in the ENDF/B-VI format. This work is performed under the Project Agreement CIS-03-95 with the International Science and Technology Center (Moscow). The Financing Party for the Project is Japan. The evaluation was requested by Y. Kikuchi (JAERI). (author). 60 refs.

  7. Airborne plutonium-239 and americium-241 concentrations measured from the 125-meter Hanford Meteorological Tower

    International Nuclear Information System (INIS)

    Sehmel, G.A.

    1978-01-01

    Airborne plutonium-239 and americium-241 concentrations and fluxes were measured at six heights from 1.9 to 122 m on the Hanford meteorological tower. The data show that plutonium-239 was transported on nonrespirable and small particles at all heights. Airborne americium-241 concentrations on small particles were maximum at the 91 m height

  8. Solubility of americium-241 in in vitro bovine ruminal-gastrointestinal fluids and predicted tissue retention and milk secretion of field-ingested americium-241

    International Nuclear Information System (INIS)

    Barth, J.

    1978-01-01

    The alimentary solubility and behavior of americium-241 were studied in an artificial rumen and simulated bovine gastrointestinal fluids. Rumen juice was augmented with americium-241 nitrate solution and incubated for 24 hours. This juice was successively converted by the addition of bile and enzymes and adjustment of the pH to simulate the digestive stages of the abomasum, duodenum, jejunum, and lower small intestine. Fluid samples were collected from each of these digestive stages and radioanalyzed for soluble americium-241. Shortly after the addition of americium-241 to rumen juice, an average of 15.3% remained soluble while 7.2% remained soluble following the incubation period. The solubility decreased to 5.3% following the abomasal period and increased to 11.6% and 20.0% when maintained at pH 4.0 and 5.0, respectively, in the duodenal phase. The solubility increased to 52% during the jejunal incubation period and was reduced to 44.8% during the lower intestinal incubation period. The sharp rise in americium-241 solubility during the jejunal incubation perid was found to be due mainly to the action of bile. Predictions of tissue retention and milk secretion of americium-241 ingested by grazing cattle at Area 13 of the Nevada Test Site are included

  9. Recovery of Americium-241 from lightning rod by the method of chemical treatment

    International Nuclear Information System (INIS)

    Cruz, W.H.

    2013-01-01

    About 95% of the lightning rods installed in the Peruvian territory have set in their structures, pose small amounts of radioactive sources such as Americium-241 ( 241 Am), fewer and Radium 226 ( 226 Ra) these are alpha emitters and have a half life of 432 years and 1600 years respectively. In this paper describes the recovery of radioactive sources of 241 Am radioactive lightning rods using the conventional chemical treatment method using agents and acids to break down the slides. The 241 Am recovered was as excitation source and alpha particle generator for analysing samples by X Ray Fluorescence, for fixing the stainless steel 241 Am technique was used electrodeposition. (author)

  10. Accumulation of americium-241 in the biomass of aquatic plants of the Yenisei river: experimental study

    Energy Technology Data Exchange (ETDEWEB)

    Zotina, T.A.; Bolsunovsky, A.Y.A.; Bondareva, L.G. [Institute of Biophysics SB RAS, Akademgorodok, Krasnoyarsk (Russian Federation)

    2004-07-01

    Due to the operation of the Mining-and-Chemical Combine (Krasnoyarsk-26), which has been manufacturing weapons-grade plutonium for several decades, the Yenisei River is contaminated with transuranic elements (including {sup 241}Am). {sup 241}Am was found in the riverside soil, sediment and in the biomass of aquatic plants (Bolsunovsky et al., 1999, 2002). Aquatic plants are an important link in the migration of radionuclides in an aquatic ecosystem. In laboratory experiments, we investigated accumulation of {sup 241}Am by the submerged macrophyte from the Yenisei River: the pond weed (Elodea canadensis) and the aquatic moss (Fontinalis antipyretica), and release of {sup 241}Am from the biomass. The content of {sup 241}Am was measured on a Canberra (USA) gamma-spectrometer. The experiments showed that specific accumulation and concentration factors of {sup 241}Am in the plants were in inverse proportion to their biomass. We obtained new data on release of {sup 241}Am from the biomass of macrophyte. Americium-241 was more firmly fixed in the biomass of the aquatic moss. In 12 months, the biomass of the aquatic moss released about 30% of the initial americium activity into the water. To compare, the biomass of the pond weed released into the water medium up to 64% of the initial {sup 241}Am activity in 1.5 4 months. The release rate was dependent on the decomposition rate of the plant biomass. The experiments showed that submerged macrophyte of the Yenisei River can accumulate considerable activities of {sup 241}Am and retain americium for long periods of time in biomass. (author)

  11. Americium-241: the most useful isotope of the actinide elements

    International Nuclear Information System (INIS)

    Navratil, J.D.

    1984-01-01

    Used extensively in nuclear gauges and in many other areas, this man-made element (Atomic Number 95) was first isolated in weighable amounts during World War II. Americium is now a very useful by-product of the nuclear industry and is produced in kilogram amounts by appropriate recovery, separation and purification processes. A review will be presented of its discovery, nuclear and chemical properties, and uses, with emphasis on its production process and separations chemistry

  12. Biosorption of americium-241 by immobilized Rhizopus arrihizus

    International Nuclear Information System (INIS)

    Liao Jiali; Yang Yuanyou; Luo Shunzhong; Liu Ning; Jin Jiannan; Zhang Taiming; Zhao Pengji

    2004-01-01

    Rhizopus arrihizus (R. arrihizus), a fungus, which in previous experiments had shown encouraging ability to remove 241 Am from solutions, was immobilized by calcium alginate and other reagents. The various factors affecting 241 Am biosorption by the immobilized R. arrihizus were investigated. The results showed that not only can immobilized R. arrihizus adsorb 241 Am as efficiently as free R. arrihizus, but that also can be used repeatedly or continuously. The biosorption equilibrium was achieved within 2 h, and more than 94% of 241 Am was removed from 241 Am solutions of 1.08 MBq/l by immobilized R. arrihizu in the pH range 1-7. Temperature did not affect the adsorption on immobilized R. arrihizus in the range 15-45 deg. C. After repeated adsorption for 8 times, the immobilized R. arrihizus still adsorbed more than 97% of 241 Am. At this time, the total adsorption of 241 Am was more than 88.6 KBq/g, and had not yet reached saturation. Ninety-five percent of the adsorbed 241 Am was desorbed by saturated EDTA solution and 98% by 2 mol/l HNO 3

  13. Biosorption of americium-241 by immobilized Rhizopus arrihizus

    Energy Technology Data Exchange (ETDEWEB)

    Liao Jiali E-mail: liaojiali@163.com; Yang Yuanyou; Luo Shunzhong; Liu Ning; Jin Jiannan; Zhang Taiming; Zhao Pengji

    2004-01-01

    Rhizopus arrihizus (R. arrihizus), a fungus, which in previous experiments had shown encouraging ability to remove {sup 241}Am from solutions, was immobilized by calcium alginate and other reagents. The various factors affecting {sup 241}Am biosorption by the immobilized R. arrihizus were investigated. The results showed that not only can immobilized R. arrihizus adsorb {sup 241}Am as efficiently as free R. arrihizus, but that also can be used repeatedly or continuously. The biosorption equilibrium was achieved within 2 h, and more than 94% of {sup 241}Am was removed from {sup 241}Am solutions of 1.08 MBq/l by immobilized R. arrihizu in the pH range 1-7. Temperature did not affect the adsorption on immobilized R. arrihizus in the range 15-45 deg. C. After repeated adsorption for 8 times, the immobilized R. arrihizus still adsorbed more than 97% of {sup 241}Am. At this time, the total adsorption of {sup 241}Am was more than 88.6 KBq/g, and had not yet reached saturation. Ninety-five percent of the adsorbed {sup 241}Am was desorbed by saturated EDTA solution and 98% by 2 mol/l HNO{sub 3}.

  14. Feasibility of the fabrication of americium targets

    International Nuclear Information System (INIS)

    Haas, D.; Somers, J.

    1999-01-01

    The paper compares the processes used at ITU for the fabrication of americium targets for transmutation: powder mixing process, sol-gel method and the infiltration by an active solution of inactive pellets. The advantages of the latter process, related mainly to the lower level of dust formation, are stressed. Moreover, the radiological constraints on the fabrication as a function of Am content and of selected fabrication process are evaluated. As conclusion, the feasibility of Am target fabrication has been demonstrated on a laboratory scale, based on experimental results evaluation. The penalties due to radiological constraints in a semi-industrial process are acceptable. The future developments consist in the construction of a laboratory fully dedicated to minor actinides fuel pins or targets fabrication. (author)

  15. Speciation and bioavailability of Americium-241 in the fresh water environment

    International Nuclear Information System (INIS)

    Bierkens, J.

    1986-01-01

    Due to its anthropogenic origin, the transuranic americium 241 confronts physiologists with the intriguing question, which mechanisms are involved in the incorporation or elimination of such artificial elements in biological cycles. The investigations on the speciation and bioavailability of 241 Am in the freshwater environment aim to establish a relation between the behavior of 241 Am in freshwater ecosystems and its availability for biota. In the limnic environment, most often characterized by a high organic load and a low conductivity, the effect of complexation of 241 Am with humic acids and competition with trivalent cations such as A1 and Fe, were proven to be significant on the speciation of 241 Am. Based on the registration of the 241 Am uptake by a large number of freshwater organisms, the crayfish Astacus leptodactylus Eschscholtz was chosen to study the whole-body uptake of 241 Am, its corresponding organ distribution and its retention in the animal. The share of external fixation and ingestion in the global uptake, and the effect of speciation on it, were studied more carefully. Other aspects in this physiological part were: the kinetics of 241 Am in the hemolymph and the hepatopancreas, and its subcellular distribution in the digestive gland. Finally, by comparing the physiology of 241 Am with some other metals ( 240 Pu, 64 Cu, 198 Au) with analogous or contradictional properties, we tried to find out whether the behavior of 241 Am in organisms can be explained from its chemical characteristics

  16. Uptake of americium-241 by plants from contaminated Chernobyl exclusive zone test site soils

    International Nuclear Information System (INIS)

    Rashydov, N.M.

    2002-01-01

    Americium-241 was found to accumulate in soils and biological objects of the environment. Its concentration has increased many times after the Chernobyl disaster and can be expected to increase about 40 times in the future. This research concentrated on the contaminated exclusive Chernobyl zone polluted by trace radionuclides, their behavior and accumulation by various plant species. Special attention is devoted to the bioavailability of 241 Am to the plants Galium rivale, G. tinctorium, G. aparine, G. intermedium, Berteroa incana, Artemisia absinthium, A. vulgaris, Centaurea borysthenica, C. arenaria, Cirsium arvense, Succissa pratensis, Solidago virgaurea, Linaria vulgaris, Lepidium ruderale, Stenactis annua, Veronica maxima, Verbascum lychnitis, Euphorbia cyparissias, Genista tinctoria, Erigeron canadensis, Oenothera biennis, Betula pendula and Quercus robur, which were collected from the Chernobyl, Kopachi, and Yanov districts. The plant samples of Oenothera biennis, Betula pendula and Quercus robur were collected from the Yanov district, where the soil contamination by 241 Am and 137 Cs was at the level of 660 and 27 MBq/m 2 , respectively. Gamma spectroscopy and radiochemical methods were used to estimate the activity concentration of 137 Cs, 90 Sr, 238 Pu, 239+240 Pu, 241 Am. The radionuclides were measured in the dry green mass of the plant samples and in the dry soils. The contamination of the Oenothera biennis, Betula pendula and Quercus robur samples by 137 Cs was (5.8±1,5)x10 6 , (7.4±1.1)x10 5 , and (2.6±0.2)x10 6 Bq/kg dry mass, respectively, and contamination by 241 Am was 47±5, 45±3 and 3.2±0.2 Bq/kg, respectively. The soil-to-plant transfer ratio for 137 Cs ranged lay within the interval of 0.2 to 0.03 Bq/kg : Bq/m 2 , the the transfer ratio for 241 Am did not exceed 7x10 -5 Bq/kg : Bq/m 2 . The coefficient of the relative contents of the 241 Am/ 239+240 Pu radionuclides in the various plant samples varied from 3.2 to 8.3, while for soil from

  17. Recovery of Americium-241 from lightning rod by the method of chemical treatment; Recuperacion del Americio-241 provenientes de los pararrayos por el metodo de tratamiento quimico

    Energy Technology Data Exchange (ETDEWEB)

    Cruz, W.H., E-mail: wcruz@ipen.gob.pe [Instituto Peruano de Energia Nuclear (GRRA/IPEN), Lima (Peru). Division de Gestion de Residuos Radiactivos

    2013-07-01

    About 95% of the lightning rods installed in the Peruvian territory have set in their structures, pose small amounts of radioactive sources such as Americium-241 ({sup 241}Am), fewer and Radium 226 ({sup 226}Ra) these are alpha emitters and have a half life of 432 years and 1600 years respectively. In this paper describes the recovery of radioactive sources of {sup 241}Am radioactive lightning rods using the conventional chemical treatment method using agents and acids to break down the slides. The {sup 241}Am recovered was as excitation source and alpha particle generator for analysing samples by X Ray Fluorescence, for fixing the stainless steel {sup 241}Am technique was used electrodeposition. (author)

  18. Adsorption-desorption characteristics of plutonium and americium with sediment particles in the estuarine environment: studies using plutonium-237 and americium-241

    International Nuclear Information System (INIS)

    Murray, C.N.; Fukai, R.

    1975-01-01

    The particle formation of plutonium and americium, their adsorption onto fresh water sediments and the desorption from the sediments in sea water were studied in the Laboratory under simulated river-estuary conditions, using γ-emitting plutonium-237 and americium-241. The results of the experiments show that the particle formation of plutonium depends on its valence states, on pH and on the salinity of the medium. For river water at pH4, some 25%, 20% and 30% of the added 237 Pu was in particulate form, larger than 0.45 μm, for Pu (III), Pu (IV) and Pu (VI), respectively, while 65%, 90% and 50% of the respective valence states was associated with particles at pH 8. In sea water the general pattern remains similar, although Pu (VI) is more soluble in sea water owing to higher ligand concentrations for carbonate and bicarbonate complexes. The pH-dependency of particle formation of Am (III) is more steep than that of plutonium and seems to be influenced by colloidal substances occurring in the experimental media. The adsorption-desorption characteristics of plutonium and americium with the sediment in river water as well as sea water reflect the characteristics of their particle formation, being dependent upon such properties as valence states, the pH and salinity of the medium. A sewage effluent added to the media has small but measurable effects on the adsorption-desorption processes of plutonium. (author)

  19. Assessment of radiation doses from residential smoke detectors that contain americium-241

    International Nuclear Information System (INIS)

    O'Donnell, F.R.; Etnier, E.L.; Holton, G.A.; Travis, C.C.

    1981-10-01

    External dose equivalents and internal dose commitments were estimated for individuals and populations from annual distribution, use, and disposal of 10 million ionization chamber smoke detectors that contain 110 kBq (3 μCi) americium-241 each. Under exposure scenarios developed for normal distribution, use, and disposal using the best available information, annual external dose equivalents to average individuals were estimated to range from 4 fSv (0.4 prem) to 20 nSv (2 μrem) for total body and from 7 fSv to 40 nSv for bone. Internal dose commitments to individuals under post disposal scenarios were estimated to range from 0.006 to 80 μSv (0.0006 to 8 mrem) to total body and from 0.06 to 800 μSv to bone. The total collective dose (the sum of external dose equivalents and 50-year internal dose commitments) for all individuals involved with distribution, use, or disposal of 10 million smoke detectors was estimated

  20. Study of biosorbents application on the treatment of radioactive liquid wastes with americium-241

    International Nuclear Information System (INIS)

    Borba, Tania Regina de

    2010-01-01

    The use of nuclear energy for many different purposes has been intensified and highlighted by the benefits that it provides. Medical diagnosis and therapy, agriculture, industry and electricity generation are examples of its application. However, nuclear energy generates radioactive wastes that require suitable treatment ensuring life and environmental safety. Biosorption and bioaccumulation represent an emergent alternative for the treatment of radioactive liquid wastes, providing volume reduction and physical state change. This work aimed to study biosorbents for the treatment of radioactive liquid wastes contaminated with americium-241 in order to reduce the volume and change the physical state from liquid to solid. The biosorbents evaluated were Saccharomyces cerevisiae immobilized in calcium alginate beads, inactivated and free cells of Saccharomyces cerevisiae, calcium alginate beads, Bacillus subtilis, Cupriavidus metallidurans and Ochrobactrum anthropi. The results were quite satisfactory, achieving 100% in some cases. The technique presented in this work may be useful and viable for implementing at the Waste Management Laboratory of IPEN - CNEN/SP in short term, since it is an easy and low cost method. (author)

  1. Investigation of the retention and distribution of americium-241 in the baboon and the enhanced removal of americium-241 from the body by diethylenetriaminepentaacetic acid (DTPA)

    International Nuclear Information System (INIS)

    Guilmette, R.A.; Cohen, N.; Wrenn, M.E.

    1975-01-01

    Experiments were performed to study the metabolism and distribution of intravenously administered 241 Am in the adult and juvenile baboon; in addition, decorporation therapy using Na 3 -CaDTPA was performed on selected baboons to assess the efficacy of this drug in removing systemic burdens of 241 Am from this primate species. Determination of the kinetics of 241 Am was accomplished principally by in vivo methodologies and by radiochemical analysis of 241 Am activity of biological material. The use of Na 3 -CaDTPA as a therapeutic agent for the removal of 241 Am from the body proved to be an effective form of treatment in the case of early administration. (U.S.)

  2. Safe handling of kilogram amounts of fuel-grade plutonium and of gram amounts of plutonium-238, americium-241 and curium-244

    International Nuclear Information System (INIS)

    Louwrier, K.P.; Richter, K.

    1976-01-01

    During the past 10 years about 600 glove-boxes have been installed at the Institute for Transuranium Elements at Karlsruhe. About 80% of these glove-boxes have been designed and equipped for handling 100-g to 1-kg amounts of 239 Pu containing 8-12% 240 Pu (low-exposure plutonium). A small proportion of the glove-boxes is equipped with additional shielding in the form of lead sheet or lead glass for work with recycled plutonium. In these glove-boxes gram-amounts of 241 Am have also been handled for preparation of Al-Am targets using tongs and additional shielding inside the glove-boxes themselves. Water- and lead-shielded glove-boxes equipped with telemanipulators have been installed for routine work with gram-amounts of 241 Am, 243 Am and 244 Cm. A prediction of the expected radiation dose for the personnel is difficult and only valid for a preparation procedure with well-defined preparation steps, owing to the fact that gamma dose-rates depend strongly upon proximity and source seize. Gamma radiation dose measurements during non-routine work for 241 Am target preparation showed that handling of gram amounts leads to a rather high irradiation dose for the personnel, despite lead or steel glove-box shielding and shielding within the glove-boxes. A direct glove-hand to americium contact must be avoided. For all glove-handling of materials with gamma radiation an irradiation control of the forearms of the personnel by, for example, thermoluminescence dosimeters is necessary. Routine handling of americium and curium should be executed with master-slave equipment behind neutron and gamma shielding. (author)

  3. Osteosarcoma induction by plutonium-239, americium-241 and neptunium-237 : the problem of deriving risk estimates for man

    International Nuclear Information System (INIS)

    Taylor, D.M.

    1988-01-01

    Spontaneous bone cancer (osteosarcoma) represents only about 0.3% of all human cancers, but is well known to be inducible in humans by internal contamination with radium-226 and radium-224. plutonium-239, americium-241 and neptunium-237 form, or will form, the principal long-lived alpha particle emitting components of high activity waste and burnt-up nuclear fuel elements. These three nuclides deposit extensively in human bone and although, fortunately, no case of a human osteosarcoma induced by any of these nuclides is known, evidence from animal studies suggests that all three are more effective than radium-226 in inducing osteosarcoma. The assumption that the ratio of the risk factors, the number of osteosarcoma expected per 10000 person/animal Gy, for radium-226 and any other bone-seeking alpha-emitter will be independent of animal species has formed the basis of all the important studies of the radiotoxicity of actinide nuclides in experimental animals. The aim of this communication is to review the risk factors which may be calculated from the various animal studies carried out over the last thirty years with plutonium-237, americium-241 and neptunium-237 and to consider the problems which may arise in extrapolating these risk factors to homo sapiens

  4. Moessbauer spectroscopy of 237Np created by α-decay of 241Am in some compounds of americium

    International Nuclear Information System (INIS)

    Rebizant, Jean.

    1977-01-01

    The Moessbauer emission spectra of 237 Np impurities fed by α decay of 241 Am were measured in the following compounds: Am metal, AmPtsub(x) (x=1, 3, 5), AmAs, AmBi, Am 2 O 3 , AmO 2 , Lisub(x)AmOsub(x+1) (x=1, 2, 3, 4) and Li 6 AmO 6 . The studies concerned the consequences of the recoil and ionization effects, associated with the α-decay of 241 Am in the solid phase; these are analysed in situ and on a time scale of about 100 ns after the α emission; the dependence of these effects on the physico-chemical nature of the host and on the temperature; information about the electronic, magnetic and structural properties and, also, about the vibrational properties of the Np impurity in the investigated solid matrice as far as the previous effects do not hamper such conclusions. The existence itself of the Moessbauer effect shows that the Np ions are stabilized in well-defined lattice locations at the time of emission of the 59.5keV γ quanta (approximately 100ns), once this level is reached after the 241 Am decay. In Am metal and AmPtsub(x) alloys, the observation of a single charge state for neptunium indicates that the electronic effects associated with the α-decay are recovered in less than 100ns. In the americium oxide compounds and the monopnictides AmAs and AmBi, several charge states of neptunium recoil ions are observed; this shows unambiguously the importance of the ionization effects caused by the α-decay. Some informations about magnetic and electronic properties of the americium host matrices were obtained. The vibration modes of 237 Np impurities in the lattice of Am metal are described by means of the Debye model with a characteristic temperature thetasub(D)=115K [fr

  5. The uptake of plutonium-239, 240, americium-241, strontium-90 into plants

    International Nuclear Information System (INIS)

    Popplewell, D.S.; Ham, G.J.; Johnson, T.E.

    1984-01-01

    This report describes the results of measurements on the uptake of plutonium, americium, strontium-90 and caesium-137 into peas, beet, oats, sweet corn, tomatoes and vegetable marrow grown in tubs containing radioactively-contaminated silts. The silts had been taken from an area of West Cumbria commonly referred to as the Ravenglass estuary. The experiments are categorised as being carried out under non-standard conditions because of the manner in which the radioactivity came to be incorporated into the growth medium. The growth medium was representative of conditions which could arise when the estuarine silt moves inland under the influence of wind and tide and mixes with the adjacent farm land. The silt had been contaminated by radioactive effluents from the nuclear fuels reprocessing plant at Sellafield and this contamination had been brought about by natural means. (Auth.)

  6. Production of americium isotopes in France

    International Nuclear Information System (INIS)

    Koehly, G.; Bourges, J.; Madic, C.; Nguyen, T.H.; Lecomte, M.

    1984-12-01

    The program of productions of americium 241 and 243 isotopes is based respectively on the retreatment of aged plutonium alloys or plutonium dioxide and on the treatment of plutonium targets irradiated either in CELESTIN reactors for Pu-Al alloys or OSIRIS reactor for plutonium 242 dioxide. All the operations, including americium final purifications, are carried out in hot cells equipped with remote manipulators. The chemical processes are based on the use of extraction chromatography with hydrophobic SiO 2 impregnated with extracting agents. Plutonium targets and aged plutonium alloys are dissolved in nitric acid using conventional techniques while plutonium dioxide dissolutions are performed routine at 300 grams scale with electrogenerated silver II in 4M HNO 3 at room temperature. The separation between plutonium and americium is performed by extraction of Pu(IV) either on TBP/SiO 2 or TOAHNO 3 /SiO 2 column. Americium recovery from waste streams rid of plutonium is realized by chromatographic extraction of Am(III) using mainly TBP and episodically DHDECMP as extractant. The final purification of both americium isotopes uses the selective extraction of Am(VI) on HDDiBMP/SiO 2 column at 60 grams scale. Using the overall process a total amount of 1000 grams of americium 241 and 100 grams of americium 243 has been produced nowadays and the AmO 2 final product indicates a purity better than 98.5%

  7. Inspection report of unauthorized possession and use of unsealed americium-241 and subsequent confiscation, J.C. Haynes Company, Newark, Ohio

    International Nuclear Information System (INIS)

    1985-11-01

    This US Nuclear Regulatory Commission report documents the circumstances surrounding the March 26, 1985, confiscation and subsequent decontamination activities related to the use of unauthorized quantities of americium-241 at the John C. Haynes Company (licensee) of Newark, Ohio. It focuses on the period from early February to July 26, 1985. The incident started when NRC Region III recieved information that John C. Haynes possessed unauthorized quantities of americium-241 and was conducting unauthorized activities (diamond irradiation). By July 26, 1985, the decontamination activities at the licensee's laboratory were concluded. The licensee's actions with diamond irradiation resulted in contamination in restricted and unrestricted areas of the facility. The confiscation and decontamination activities required the combined efforts of NRC, Federal Bureau of Investigation, US Department of Energy, Oak Ridge Associated Universities, the State of Ohio, and the US Environmental Protection Agency. The report describes the factual information and significant findings associated with the confiscation and decontamination activities

  8. Criteria Considered in Selecting Feed Items for Americium-241 Oxide Production Operations

    Energy Technology Data Exchange (ETDEWEB)

    Schulte, Louis D. [Los Alamos National Lab. (LANL), Los Alamos, NM (United States)

    2015-01-30

    The analysis in this document serves the purpose of defining a number of attributes in selection of feed items to be utilized in recovery/recycle of Pu and also production operations of 241AmO2 material intended to meet specification requirements. This document was written in response to a specific request on the part of the 2014 annual program review which took place over the dates of October 28-29, 2014. A number of feed attributes are noted including: (1) Non-interference with existing Pu recovery operations; (2) Content of sufficient 241Am to allow process efficiency in recovery operations; (3) Absence of indications that 243Am might be mixed in with the Pu/241Am material; (4) Absence of indications that Cm might be mixed in with the Pu/241Am material; (5) Absence of indications of other chemical elements that would present difficulty in chemical separation from 241Am; (6) Feed material not expected to present difficulty in dissolution; (7) Dose issues; (8) Process efficiency; (9) Size; (10) Hazard associated with items and package configuration in the vault; (11) Within existing NEPA documentation. The analysis in this document provides a baseline of attributes considered for feed materials, but does not presume to replace the need for technical expertise and judgment on the part of individuals responsible for selecting the material feed to be processed. This document is not comprehensive as regards all attributes that could prove to be important. The value of placing a formal QA hold point on accepting feed items versus more informal management of feed items is discussed in the summation of this analysis. The existing planned QA hold points on 241AmO2 products produced and packaged may be adequate as the entire project is based on QA of the product rather than QA of the process. The probability of introduction of items that would inherently cause the241

  9. Treatment of selected primary gynecologic and pelvic malignancies with 241Americium

    International Nuclear Information System (INIS)

    Chung, Joyce Y.; Peschel, Richard E.; Kacinski, Barry; Nath, Ravinder; Pourang, Rauman; Roberts, Kenneth; Fischer, Diana; Chambers, Joseph; Schwartz, Peter E.; Wilson, Lynn

    1995-01-01

    Purpose: To evaluate the efficacy of encapsulated 241 Am in the treatment of primary gynecological malignancies and in previously irradiated patients with recurrent disease in the pelvis. Materials and Methods: Encapsulated 241 Am primarily emits 60keV photons which are effectively shielded by thin layers of high atomic number materials. Dose distributions in water are similar to those produced by Cs-137 photons but with a half-value layer that is considerably less. Cases of 28 patients (12-primary, 16-recurrent) who have been treated with 241 Am at the Yale University School of Medicine since 1986 were retrospectively reviewed. Data concerning dosimetry, disease site, prior treatment, recurrence, disease-free survival, overall survival, and complications were evaluated. Results: Median follow up for the 12 patients with primary gynecological tumors was 19 months (7mo-51mo). There were 6 vulvar, 3 vaginal, 2 cervical and 1 endometrial carcinomas. Median surface dose of 241 Am was 42.2 Gy (23.3Gy-106.6Gy). As part of their initial therapy 11 received pelvic external beam radiation therapy, 6 underwent surgery and 2 received other forms of intracavitary brachytherapy. Of these 12 patients, 11 achieved a complete response (CR) with the duration of CR ranging from 7 to 51 months. Actuarial disease-free survival at 3 years was 66% (S.E.=.16) and actuarial overall survival at 3 years was 91% (S.E.=.08). Median follow up for the 16 patients with recurrent pelvic malignancies was 72 months (20mo-99mo). There were 9 cases of endometrial, 3 vulvar, 3 colorectal, and 1 cervical carinomas. Fifteen of 16 received some form of surgery and radiotherapy prior to their treatment with 241 Am. Median surface dose of 241 Am was 40.3 (17.6Gy-141.7Gy). Of these 16 patients, 10 achieved a CR with the duration of CR ranging from 3 to 88 months. Actuarial disease-free survival at 5 years was 51% (S.E.=.16) and actuarial overall survival at 5 years was 43% (S.E.=.14). Complications were

  10. Experimental study of Americium-241 biokinetics in Homarus Gammarus lobster. Analysis of the accumulation and detoxication mechanisms at the sub-cellular level

    International Nuclear Information System (INIS)

    Paquet, F.

    1991-12-01

    The Americium 241 radioelement accumulation and elimination rate and mechanisms in the lobster organism have been experimentally studied; incorporation and detoxification capacities of each organ are evaluated. The existence of various biological compartments is shown; the major role of the digestive gland in accumulation of the radioelement, its distribution towards the various organs, and its resorption is comprehensively described, with an analysis at the subcellular and molecular levels. 401 p., 65 fig., 43 tab., 428 ref

  11. Study of biosorbents application on the treatment of radioactive liquid wastes with americium-241; Estudo da aplicacao de biossorventes no tratamento de rejeitos radioativos liquidos contendo americio-241

    Energy Technology Data Exchange (ETDEWEB)

    Borba, Tania Regina de

    2010-07-01

    The use of nuclear energy for many different purposes has been intensified and highlighted by the benefits that it provides. Medical diagnosis and therapy, agriculture, industry and electricity generation are examples of its application. However, nuclear energy generates radioactive wastes that require suitable treatment ensuring life and environmental safety. Biosorption and bioaccumulation represent an emergent alternative for the treatment of radioactive liquid wastes, providing volume reduction and physical state change. This work aimed to study biosorbents for the treatment of radioactive liquid wastes contaminated with americium-241 in order to reduce the volume and change the physical state from liquid to solid. The biosorbents evaluated were Saccharomyces cerevisiae immobilized in calcium alginate beads, inactivated and free cells of Saccharomyces cerevisiae, calcium alginate beads, Bacillus subtilis, Cupriavidus metallidurans and Ochrobactrum anthropi. The results were quite satisfactory, achieving 100% in some cases. The technique presented in this work may be useful and viable for implementing at the Waste Management Laboratory of IPEN - CNEN/SP in short term, since it is an easy and low cost method. (author)

  12. Standard test method for the radiochemical determination of americium-241 in soil by alpha spectrometry

    CERN Document Server

    American Society for Testing and Materials. Philadelphia

    2007-01-01

    1.1 This method covers the determination of americium–241 in soil by means of chemical separations and alpha spectrometry. It is designed to analyze up to ten grams of soil or other sample matrices that contain up to 30 mg of combined rare earths. This method allows the determination of americium–241 concentrations from ambient levels to applicable standards. The values stated in SI units are to be regarded as standard. 1.2 This standard does not purport to address all of the safety concerns, if any, associated with its use. It is the responsibility of the user of this standard to establish appropriate safety and health practices and determine the applicability of regulatory limitations prior to use. For specific precaution statements, see Section 10.

  13. An experimental study of americium-241 biokinetics in the Lobster Homarus Gammarus. Analysis of the accumulation/storage and detoxification processes at the subcellular level

    International Nuclear Information System (INIS)

    Paquet, F.

    1993-01-01

    An experimental study of americium-241 kinetics has been conducted in the lobster Homarus gammmarus. The investigations were conducted at all the levels from the whole body to the subcellular and molecular levels. The animals were contaminated by a single or chronic ingestion of 241 Am labelled mussels. Assessments of accumulation, elimination and distribution of the radionuclide were established on organisms kept in the laboratory; they made it possible to demonstrate the importance of the digestive gland in the radionuclide transfer pathways. The preliminary results led to structural then ultrastructural investigations of the digestive gland in association with radioautographic studies and cellular extractions methods. Four cellular types were demonstrated, only two of them being implied in the radionuclide retention, the former being responsible for americium intake and the latter for its long-term retention. By means of biochemical techniques, subcellular accumulation was studied and the organelles implied in the nuclide retention were specified. Finally, a method of cellular nuclei dissociation was developed; it made it possible to analyse the molecular nature of americium ligands and to demonstrate the function of the protein nuclear matrix in the nuclide retention

  14. The distribution of plutonium-239 and americium-241 in the Syrian hamster following its intravenous administration as citrate

    International Nuclear Information System (INIS)

    Rodwell, P.; Stather, J.W.

    1978-01-01

    Actinide distribution in various tissues and the skeleton of hamsters by liquid scintillation counting or isotope dilution. For plutonium 57% of activity was concentrated in the skeleton and more than 90% in the liver and skeleton after seven days. For americium the liver retained more than 50% of total activity and 25% was excreted in urine within seven days. (U.K.)

  15. Theoretical and experimental study of the bio-geochemical behaviour of americium 241 in simplified rhizosphere conditions. Application to a calcareous agricultural soil; Etude theorique et experimentale du comportement biogeochimique de l'americium-241 en conditions rhizospheriques simplifiees. Application dans un sol agricole calcaire

    Energy Technology Data Exchange (ETDEWEB)

    Perrier, T

    2004-06-01

    Americium 241, is one of the most radio-toxic contaminant produced during the nuclear fuel cycle. It can be found in all environmental compartments, in particular the soils. The main goals of this study are to identify, quantify and model the effect of the main factors controlling the mobility of {sup 241}Am in the rhizosphere and the agricultural soils. The physico-chemical parameters of the soil and of the soil solution, the potential role of microorganisms on the sorption-desorption processes, and the speciation of americium in solution have been more particularly studied. {sup 241}Am remobilization has been studied at the laboratory using leaching experiments performed in controlled conditions on reworked calcareous soils artificially contaminated with {sup 241}Am. The soil samples have been washed out in different hydrodynamic conditions by solutions with various compositions. The eluted solution has been analyzed (pH, conductivity, ionic composition, Fe{sub tot}, organic acids, {sup 241}Am) and its bacterial biomass content too. The overall results indicate that {sup 241}Am remobilization is contrasted and strongly linked with the condition under study (pH, ionic strength, glucose and/or citrate concentration). Therefore, a solution in equilibrium with the soil or containing small exudate concentrations (10{sup -4} M) re-mobilizes only a very small part of the americium fixed on the solid phase. The desorption of {sup 241}Am corresponds to a solid/liquid coefficient of partition (K{sub d}) of about 10{sup 5} L.kg{sup -1}. A significant addition of glucose induces an important dissolution of soil carbonates by the indirect action of microorganisms, but does not significantly favor the {sup 241}Am remobilization. On the other hand, the presence of strong citrate concentrations ({>=} 10{sup -2} M) allows 300 to 10000 time greater re-mobilizations by the complexing of {sup 241}Am released after the dissolution of the carrying phases. Finally, the colloidal

  16. Studies on the binding and transport processes of americium-241 hydroxide polymers in rat lung and bovine alveolar macrophages

    International Nuclear Information System (INIS)

    Taya, A.

    1986-03-01

    The binding of Am-241 hydroxide polymers to the cell components of rat lung was investigated using differential centrifugation, density gradient centrifugation with different media, gel chromatography, free flow electrophoresis and electron microscopic autoradiography with Pu-241. The bovine alveolar macrophage cultures were introduced as an in vitro test system for Am-241 uptake. Form the biochemical and electron microscopic studies it can be concluded that Am-241 is taken up by pulmonary macrophages, where its first storage site is probably the lysosome. Then the Am-241 seems to be solubilized in the lysosomes and to be bound to the cytosolic ferritin of macrophages. Am-241 might be released from the cells and crosses the alveolar membranes as bound to transferrin or as low molecular weight form. (orig.) [de

  17. Preliminary application of 241-Americium calcaneus bone mineral density measurement in osteoporosis. Comparison with double X-ray densitometry of the lumber spine

    International Nuclear Information System (INIS)

    Guan Liang; Zhu Chengmo; Li Peiyong; Wang Hui; Pu Mingfang; Qiu Jigao

    2001-01-01

    Bone mineral density (BMD) of calcaneus in 54 normals, 45 Osteoporosis, 25 suspected osteoporosis and 16 other non-osteoporosis patients, a total of 140 cases were measured by HUAKE (HK-1) 241-Americium BMD absorpmetry, among them 43 were compared with that of lumber spine (L2 - L4) measured by Lunar Corporation's Expert-XL absorpmeter. BMD of normal group of calcaneus was (409.8 +- 79.4) mg/cm 2 . The BMD were decreased slowly with the increasing age. The BMD of osteoporosis, suspected osteoporosis and non-osteoporosis group were 230.3 +- 62.3, 395.7 +- 57.4 and 363.3 +- 51.9 mg/cm 2 respectively. The BMD of osteoporosis group was much lower than that of normal group, and also lower than that of the other two groups, among 26 patients (57.78%) had bone fracture, all was in accordance with the clinical diagnosis of osteoporosis. The BMD of suspected osteoporosis and non-osteoporosis had no significant difference with normal group. The coefficient variation (CV) of BMD in repeated measurement in calcaneus of 4 participants was less than 1.2%. The correlative coefficient (r) between BMD of calcaneus and lumber spine (L2 - L4) group was 0.6824. The correlative coefficient of normal young adult-matched percentage and T value in 2 groups were 0.6863 and 0.6755 respectively, whereas aged-matched percentage, Z value were 0.4614 and 0.5009 respectively. In conclusion 241-Americium calcaneus BMD absorpmetry has the advantage of low price, easy to operate, reliable and valuable in diagnosis osteoporosis. The correlations of calcaneus and lumber spine BMD, normal young adult-matched percentage and T value were rather good

  18. Americium-241 integral radiative capture cross section in over-moderated neutron spectrum from pile oscillator measurements in the Minerve reactor

    Directory of Open Access Journals (Sweden)

    Geslot Benoit

    2017-01-01

    Full Text Available An experimental program, called AMSTRAMGRAM, was recently conducted in the Minerve low power reactor operated by CEA Cadarache within the frame of the CHANDA initiative (Solving CHAllenges in Nuclear Data. Its aim was to measure the integral capture cross section of 241Am in the thermal domain. Motivation of this work is driven by large differences in this actinide thermal point reported by major nuclear data libraries. The AMSTRAMGRAM experiment, that made use of well characterized EC-JRC americium samples, was based on the oscillation technique commonly implemented in the Minerve reactor. First results are presented and discussed in this article. A preliminary calculation scheme was used to compare measured and calculated results. It is shown that this work confirms a bias previously observed with JEFF-3.1.1 (C/E-1 = −10.5 ± 2%. On the opposite, the experiment is in close agreement with 241Am thermal point reported in JEFF-3.2 (C/E-1 = 0.5 ± 2%.

  19. Americium in water and sediments

    International Nuclear Information System (INIS)

    Coughtrey, P.J.; Jackson, D.; Jones, C.H.; Thorne, M.C.

    1984-01-01

    Data for americium 241 in aquatic environments are presented derived from areas contaminated solely by global fallout, and also from areas contaminated by radioactive waste discharges. For several water bodies, in particular the Mediterranean, comprehensive data are given characterising the inputs, distribution, geochemical behaviour and biological availability of americium. Many data are also reported for concentrations of americium in North European coastal waters (e.g. English Channel, North Sea, Irish Sea, Baltic Sea, Barents Sea and the Eastern Atlantic). Much of the discussion in this section is in terms of the behaviour of americium relative to plutonium. (Auth.)

  20. Design of Alpha Voltaic Power Source Using Americium 241 (241Am) and Diamond with a Power Density of 10 mW/cm3

    Science.gov (United States)

    2017-10-19

    detectors) is one of the most widely available and affordable sources of alpha radiation. 241Am has a half-life of 432 years, enabling long- lived ...mobility. The next step will be to fabricate a diamond vertical or quasi-vertical diode and irradiate it. This experiment will give important insights for...distribution is unlimited. NOTICES Disclaimers The findings in this report are not to be construed as an official Department of the Army

  1. Solubility of plutonium and americium-241 from rumen contents of cattle grazing on plutonium-contaminated desert vegetation in in vitro bovine gastrointestinal fluids - August 1975 to January 1977

    International Nuclear Information System (INIS)

    Barth, J.; Giles, K.R.; Brown, K.W.

    1985-01-01

    The alimentary solubility of plutonium and americium-241 ingested by cattle grazing at Area 13 of the Nevada Test Site and the Clean Slate II site on the Tonopah Test Range in Nevada was studied in a series of experiments. For each experiment, or trial, rumen contents collected from a fistulated steer or a normal animals at the time of sacrifice were incubated in simulated bovine gastrointestinal fluids, and the solubility of plutonium and americium was analyzed following the abomasal, duodenal, jejunal, and lower intestinal digestive states. For Area 13, the peak plutonium-238 solubilities ranged from 1.09 to 9.60 percent for animals grazing in the inner enclosure that surrounds ground zero (GZ); for animals grazing in the outer enclosure, the peaks ranged from 1.86 to 18.46%. The peak plutonium-239 solubilities ranged from 0.71 to 4.81% for animals from the inner enclosure and from 0.71 to 3.61% for animals from the outer enclosure. Plutonium-238 was generally more soluble than plutonium-239. Plutonium ingested by cattle grazing in the outer enclosure was usually more soluble than plutonium ingested by cattle grazing in the inner enclosure. The highest concentrations of plutonium in the rumen contents of cattle grazing in the inner enclosure were found in trials conducted during August and November 1975 and January 1976. These concentrations decreased during the February, May, and July 1976 trials. The decrease was followed by an increase in plutonium concentration during the November 1976 trial. The concentration of americium-241 followed the same trend. 13 references, 13 tables

  2. Preparation of americium source for smoke detector

    International Nuclear Information System (INIS)

    Ramaswami, A.; Singh, R.J.; Manohar, S.B.

    1994-01-01

    This report describes the method developed for the preparation of 241 Am source for smoke detector. Americium was electrodeposited from iso-propyl alcohol medium on silver backing. Thin layer of gold (few hundred micro gram thick) was plated on the americium source to make it safe for handling. The thickness of plated gold was such that the alpha radiations from the 241 Am source could escape out of the gold layer and cause ionisation in the surrounding air. The performance of the prepared sources were checked in a smoke detector and was found to be satisfactory and comparable to the imported sources. (author). 1 refs., 2 figs., 1 tab

  3. Fabrication of targets for transmutation of americium : synthesis of inertial matrix by sol-gel method. Procedure study on the infiltration of a radioactive solutions

    International Nuclear Information System (INIS)

    Fernandez Carretero, A.

    2002-01-01

    Transmutation and incineration are innovative options in the management and disposal of fission products and actinides. nevertheless, the fabrication of targets for transmutation and incineration of actinides and fission products require a reconsideration of conventional processes (mechanical blending) and the development of new procedures compatible with the high activity of these materials. This work presents th R and D of a new fabrication method called INRAM (Infiltration of Radioactive Materials) based on the infiltration of an actinide solution in a porous non radiotoxic material in the form of a pellet (up to 12% An), or beads (up to 40% An) produced by sol-gel. The first method have been used for the fabrication of spinel (MgAl 2 O 4 ) targets containing 11% Am, which have been irradiated in HFR-Petten (358.4 full power days). Post-test burn-up calculations showed that at the end of the irradiation the initial Am-241 concentration was reduced to 4%. The fraction of the initial americum atoms that have been fissioned is 28%. The main advantage of the INRAM method is that matrices with low or zero activity can be fabricated and formed into the required shape in an unshielded facility. This method offers other advantages over conventional ones, such as the active wastes are reduced, is easy to automate, adoptable to telemanipulation and dust free, which facilitate operator intervention and minimise radiation exposure to the personal. In addition, the infiltrant needs only be present in liquid form, i. e. it could be transferred directly from the reprocessing plant for fabrication into targets without conversion into-solid form. In order to optimise the infiltration process in depth investigations of all important process parameters, e. g. infiltration kinetics and metal (pu, Am) concentration in the feed solution, and also on extensive study or powder metallurgy parameters for the preparation of high quality fuel pellets with a high density, have been made. In

  4. 1976 Hanford americium exposure incident: psychological aspects

    International Nuclear Information System (INIS)

    Brown, W.R.

    1982-01-01

    Accidents involving exposure to radiation or radioactive materials may involve an unusual degree of emotional trauma. Methods that may be employed in dealing with such trauma are discussed in relation to a specific accident in which a radiation worker was injured and seriously contaminated with americium-241

  5. Simulation of loading conditions for a type A package containing Americium-241 involved in an airplane crash at Detroit Metro Airport in January 1983

    International Nuclear Information System (INIS)

    Maxfield, B.W.; Woo, H.H.

    1983-10-01

    On January 11, 1983, a United Airlines DC-8F cargo aircraft crashed shortly after takeoff from Detroit Metro Airport. A lower rear cargo pit had a type A package containing 10,000 241 Am solid-form sources, each of 1.5-μCi strength, used in smoke detectors. Although burned and somewhat battered, the 1-gal metal can holding all these sources was recovered completely intact with no release of radioactive material to the environment or loss of any sources. This report describes Lawrence Livermore National Laboratory's attempt to reconstruct, as closely as practical, the mechanical and thermal environments experienced by this can during and immediately after the accident. Mechanical loading of the metal can in a shipping carton was simulated by impacts from a 16-lb pendulum mass falling through vertical displacements of up to 6 ft. Internal damage ranged from imperceptible to sufficient to demolish internal plastic jars and to produce major deformation of the metal can. The thermal environment was best reproduced by the simple burning of the outer shipping carton. 6 references, 27 figures

  6. Formation of americium and europium humate complexes

    International Nuclear Information System (INIS)

    Minai, Y.; Tominaga, T.; Meguro, Y.

    1991-01-01

    Binding constants of americium and europium with a humic acid were determined to study if complex formation of trivalent actinide-humates affects dissolved species of the actinides in hydrosphere. The purified humic acid was characterized by means of UV-vis, IR, and pH titration, indicating high carboxylate capacity and low aromaticity. Binding constants of americium and europium humates were determined at pH 4.6 and 6.0 by solvent extraction using 241 Am or 152 Eu as a tracer. The binding constants for americium-humate obtained preliminarily suggest that complexes with humic acid are not negligible in speciation of trivalent actinides in hydrosphere. The obtained binding constants were nearly identical with those determined previously by the same procedures, but with humic acids of different origin and compositions. (author)

  7. Biosorption of americium by alginate beads

    International Nuclear Information System (INIS)

    Borba, Tania Regina de; Marumo, Julio Takehiro; Goes, Marcos Maciel de; Ferreira, Rafael Vicente de Padua; Sakata, Solange Kazumi

    2009-01-01

    The use of biotechnology to remove heavy metals from wastes plays great potential in treatment of radioactive wastes and therefore the aim of this study was to evaluate the biosorption of americium by alginate beads. Biosorption has been defined as the property of certain biomolecules to bind and remove selected ions or other molecules from aqueous solutions. The calcium alginate beads as biosorbent were prepared and analyzed for americium uptaking. The experiments were performed in different solution activity concentrations, pH and exposure time. The results suggest that biosorption process is more efficient at pH 4 and for 75, 150, 300 Bq/mL and 120 minutes were necessary to remove almost 100% of the americium-241 from the solution. (author)

  8. 1976 Hanford americium-exposure incident: external decontamination procedures

    International Nuclear Information System (INIS)

    Jech, J.J.; Berry, J.R.; Breitenstein, B.D.

    1982-01-01

    An accident resulted in the deposition on an injured workman's skin surfaces, in acid-burned areas and in lacerations, of something in excess of 6 mCi americium-241. The external decontamination procedures used, the change in americium content of the skin during the course of treatment, and some of the unusual problems encountered from the extrusion of foreign material and flaking of skin and scar tissue are described

  9. Preparation of americium metal of high purity and determination of the heat of formation of the hydrated trivalent americium ion

    International Nuclear Information System (INIS)

    Spirlet, J.C.

    1975-10-01

    In order to redetermine some physical and chemical properties of americium metal, several grams of Am-241 have been prepared by two independent methods: lanthanum reduction of the oxide and thermal dissociation of the intermetallic compound Pt 5 Am. After its separation from excess lanthanum or alloy constituent by evaporation, americium metal was further purified by sublimation at 1100 deg C and 10 -6 Torr. Irrespective of the method of preparation, the americium samples displayed the same d.h.c.p. crystal structure. As determined by vacuum hot extraction, the oxygen, nitrogen and hydrogen contents are equal to or smaller than 250, 50 and 20 ppm, respectively. The heats of solution of americium metal (d.c.h.p. structure) in aqueous hydrochloric acid solutions have been measured at 298.15+-0.05K. The standard enthalpy of formation of Am 3+ (aq) is obtained as -616.7+-1.2 kJ mol -1 [fr

  10. Study of the properties of the Am-O system in view of the transmutation of Am 241 in fast reactors; Etude des proprietes du systeme Am-O en vue de la transmutation de l`americium 241 en reacteur a neutrons rapides

    Energy Technology Data Exchange (ETDEWEB)

    Casalta, S.

    1996-04-01

    To reduce the long term toxicity of Am 241 it was considered to transmute this isotope in fast reactor. The first part of this thesis is an introduction at this problem. In the second part we give the experimental techniques used for the realisation of an AmO{sub 2}-MgO target (powder metallurgy under inert, oxidizing or reducing atmosphere). The properties of the Am-O system has been analyzed by X diffraction, thermodynamic and ceramography, in the Am{sub 2}O{sub 3}-AmO{sub 2} field. In the third part we study the external exposure risk created by the manufacturing of this target and in the last part the behavior of this target in a fast reactor. 66 refs., 28 figs., 25 tabs., 1 append.

  11. The ingestion of plutonium and americium by range cattle

    International Nuclear Information System (INIS)

    Blincoe, C.; Bohman, V.R.; Smith, D.D.

    1981-01-01

    The intake of plutonium and americium in the diet of cattle grazing on plutonium contaminated desert range was determined. Daily feed intake of the grazing animals was also determined so that the amount of nuclides ingested daily could be ascertained. Soil ingested by range cattle constituted the principal and possibly only source of ingested plutonium and americium and resulted in a daily intake of 3600-6600 pCi 238 Pu, 85,000-400,000 pCi 239 Pu, and 11,000-31,000 pCi 241 Am daily. Determining transuranic intake by direct measurement and from the composition and contamination of the diet gave identical results. (author)

  12. 241Am (n,gamma) isomer ratio measurement

    Energy Technology Data Exchange (ETDEWEB)

    Bond, Evelyn M [Los Alamos National Laboratory; Vieira, David J [Los Alamos National Laboratory; Moody, Walter A [Los Alamos National Laboratory; Slemmons, Alice K [Los Alamos National Laboratory

    2011-01-05

    The objective of this project is to improve the accuracy of the {sup 242}Cm/{sup 241}Am radiochemistry ratio. We have performed an activation experiment to measure the {sup 241}Am(n,{gamma}) cross section leading to either the ground state of {sup 242g}Am (t{sub 1/2} = 16 hr) which decays to {sup 242}Cm (t{sub 1/2} = 163 d) or the long-lived isomer {sup 242m}Am (t{sub 1/2} = 141 yr). This experiment will develop a new set of americium cross section evaluations that can be used with a measured {sup 242}Cm/{sup 241}Am radiochemical measurement for nuclear forensic purposes. This measurement is necessary to interpret the {sup 242}Cm/{sup 241}Am ratio because a good measurement of this neutron capture isomer ratio for {sup 241}Am does not exist. The targets were prepared in 2007 from {sup 241}Am purified from LANL stocks. Gold was added to the purified {sup 241}Am as an internal neutron fluence monitor. These targets were placed into a holder, packaged, and shipped to Forschungszentrum Karlsruhe, where they were irradiated at their Van de Graff facility in February 2008. One target was irradiated with {approx}25 keV quasimonoenergetic neutrons produced by the {sup 7}Li(p,n) reaction for 3 days and a second target was also irradiated for 3 days with {approx}500 keV neutrons. Because it will be necessary to separate the {sup 242}Cm from the {sup 241}Am in order to measure the amount of {sup 242}Cm by alpha spectrometry, research into methods for americium/curium separations were conducted concurrently. We found that anion exchange chromatography in methanol/nitric acid solutions produced good separations that could be completed in one day resulting in a sample with no residue. The samples were returned from Germany in July 2009 and were counted by gamma spectrometry. Chemical separations have commenced on the blank sample. Each sample will be spiked with {sup 244}Cm, dissolved and digested in nitric acid solutions. One third of each sample will be processed at a time

  13. 1976 Hanford americium accident

    International Nuclear Information System (INIS)

    Heid, K.R.; Breitenstein, B.D.; Palmer, H.E.; McMurray, B.J.; Wald, N.

    1979-01-01

    This report presents the 2.5-year medical course of a 64-year-old Hanford nuclear chemical operator who was involved in an accident in an americium recovery facility in August 1976. He was heavily externally contaminated with americium, sustained a substantial internal deposition of this isotope, and was burned with concentrated nitric acid and injured by flying debris about the face and neck. The medical care given the patient, including the decontamination efforts and clinical laboratory studies, are discussed. In-vivo measurements were used to estimate the dose rates and the accumulated doses to body organs. Urinary and fecal excreta were collected and analyzed for americium content. Interpretation of these data was complicated by the fact that the intake resulted both from inhalation and from solubilization of the americium embedded in facial tissues. A total of 1100 μCi was excreted in urine and feces during the first 2 years following the accident. The long-term use of diethylenetriaminepentate (DTPA), used principally as the zinc salt, is discussed including the method, route of administration, and effectiveness. To date, the patient has apparently experienced no complications attributable to this extensive course of therapy, even though he has been given approximately 560 grams of DTPA. 4 figures, 1 table

  14. Chemistry of americium

    Energy Technology Data Exchange (ETDEWEB)

    Schulz, W.W.

    1976-01-01

    Essential features of the descriptive chemistry of americium are reviewed. Chapter titles are: discovery, atomic and nuclear properties, collateral reading, production and uses, chemistry in aqueous solution, metal, alloys, and compounds, and, recovery, separation, purification. Author and subject indexes are included. (JCB)

  15. The EFTTRA experiment on irradiation of Am targets

    Energy Technology Data Exchange (ETDEWEB)

    Babelot, J.-F. [Commission of the European Communities, Karlsruhe (Germany). European Inst. for Transuranium Elements; Conrad, R. [European Commission, Joint Research Centre, Institute for Advanced Materials, P.O. Box 2, 1755 ZG Petten (Netherlands); Konings, R.J.M. [Netherlands Energy Research Foundation ECN, P.O. Box 1, 1755 ZG Petten (Netherlands); Muehling, G. [Forschungszentrum Karlsruhe, Projekt Nukleare Sicherheitsforschung, Postfach 3640, 76021 Karlsruhe (Germany); Salvatores, M. [CEA, DRN, CE/Cadarache, 13108 Saint-Paul-Lez-Durance Cedex (France); Vambenepe, G. [EDF/SEPTEN, 12-14, avenue Dutrievoz, 69628 Villeurbanne Cedex (France)

    1998-06-12

    The EFTTRA European collaboration (experimental feasibility of targets for transmutation), started in 1992, analyzes material problems related to the possibility of transmuting long-lived radioactive nuclides. One of the EFTTRA activities concerns the development of targets for the transmutation of americium in a matrix (heterogeneous cycle). The irradiation in the HFR of a sample of americium oxide embedded in a spinel matrix, the EFTTRA-T4 experiment, containing 11.2 wt.% of Am-241, was started in September 1996. (orig.) 4 refs.

  16. Applicability of insoluble tannin to treatment of waste containing americium

    International Nuclear Information System (INIS)

    Matsumura, T.; Usuda, S.

    1998-01-01

    The applicability of insoluble tannin adsorbent to the treatment of aqueous waste contaminated with americium has been investigated. Insoluble tannin is considered highly applicable because it consists of only carbon, hydrogen and oxygen and so its volume can be easily reduced by incineration. This report describes measurements of the americium distribution coefficient in low concentration nitric acid. The americium distribution coefficients were found to decrease with increasing concentration of nitric acid and sodium nitrate, and with increasing temperature. At 25 C in 2.0 x 10 -3 M HNO 3 , the distribution coefficient was found to be 2000 ml g -1 . The adsorption capacity was determined by column experiments using europium as a simulant of americium, and found to be 7 x 10 -3 mmol g -1 -dried tannin in 0.01 M HNO 3 at 25 C, which corresponds to approximately 1.7 mg- 241 Am/g-adsorbent(dried). The prospect of applying the adsorbent to the treatment of aqueous waste contaminated with americium appears promising. (orig.)

  17. 1976 Hanford americium-exposure incident: decontamination and treatment facility

    International Nuclear Information System (INIS)

    Berry, J.R.; McMurray, B.J.; Jech, J.J.; Breitenstein, B.D.; Quigley, E.J.

    1982-01-01

    An injured worker, contaminated with over 6 mCi of americium-241, required special treatment and housing for 4 months. This paper is a description of the design and management of the facility in which most of the treatment and housing occurred. The problems associated with contamination control, waste handling, supplies, and radiological concerns during the two-stage transfer of the patient from a controlled situation to his normal living environment are discussed in detail

  18. Inhaled americium dioxide

    International Nuclear Information System (INIS)

    Park, J.F.

    1982-01-01

    This project includes experiments to determine the effects of Zn-DTPA therapy on the retention, translocation and biological effects of inhaled 241 AmO 2 . Beagle dogs that received inhalation exposure to 241 AmO 2 developed leukopenia, clincial chemistry changes associated with hepatocellular damage, and were euthanized due to respiratory insufficiency caused by radiation pneumonitis 120 to 131 days after pulmonary deposition of 22 to 65 μCi 241 Am. Another group of dogs that received inhalation exposure to 241 AmO 2 and were treated daily with Zn-DTPA had initial pulmonary deposition of 19 to 26 μCi 241 Am. These dogs did not develop respiratory insufficiency, and hematologic and clinical chemistry changes were less severe than in the non-DTPA-treated dogs

  19. Self-irradiation and oxidation effects on americium sesquioxide and Raman spectroscopy studies of americium oxides

    Energy Technology Data Exchange (ETDEWEB)

    Horlait, Denis [CEA, DEN, DTEC/SDTC/LEMA, F-30207 Bagnols-sur-Cèze Cedex (France); Caraballo, Richard [CEA, DEN, DTCD/SECM/LMPA, F-30207 Bagnols-sur-Cèze Cedex (France); Lebreton, Florent [CEA, DEN, DTEC/SDTC/LEMA, F-30207 Bagnols-sur-Cèze Cedex (France); Jégou, Christophe [CEA, DEN, DTCD/SECM/LMPA, F-30207 Bagnols-sur-Cèze Cedex (France); Roussel, Pascal [Unité de Catalyse et Chimie du Solide, UMR 8012 CNRS, Ecole Nationale Supérieure de Chimie de Lille BP 90108, 59652 Villeneuve d’Ascq Cedex (France); Delahaye, Thibaud, E-mail: thibaud.delahaye@cea.fr [CEA, DEN, DTEC/SDTC/LEMA, F-30207 Bagnols-sur-Cèze Cedex (France)

    2014-09-15

    Americium oxides samples were characterized by X-ray diffraction (XRD) and Raman spectroscopy, with an emphasis on their structural behavior under oxidation and self-irradiation. Raman spectra of americium dioxide (AmO{sub 2}) and sesquioxide (Am{sub 2}O{sub 3}) were obtained for the first time. With the help of literature data on isostructural oxides, Raman signatures of Ia-3 C-type Am{sub 2}O{sub 3} and P-3m1 A-type Am{sub 2}O{sub 3} are identified. For AmO{sub 2,} a clear band is noted at 390 cm{sup −1}. Its nature is compared to that of the other actinide dioxides. Am{sub 2}O{sub 3} evolution under ambient conditions and against {sup 241}Am α self-irradiation was monitored by powder XRD. The sample, initially composed of A-type Am{sub 2}O{sub 3} as major phase as well as C2/m B-type and C-type structures as minor phases, progressively oxidizes to Fm-3m AmO{sub 2−δ} over a few months. On the basis of diffractogram refinements, evolutions of unit cell volumes caused by self-irradiation are also determined and discussed. - Graphical abstract: The evolution of americium oxide under ambient conditions was monitored using XRD (X-ray diffraction) and Raman spectroscopy. After a thermal treatment under reducing conditions, a polyphasic sample mainly composed of A- and C-type americium sesquioxides is evidenced by XRD and Raman spectroscopy. The sample then evolves through two processes: oxidation and self-irradiation. The first one provokes the progressive appearance of F-type americium dioxide while the initial phases disappear, whereas the main effect of the second is a structural swelling with time. - Highlights: • The first Raman spectroscopy measurements on americium oxides were performed. • Observed Am{sub 2}O{sub 3} Raman bands were identified thanks to data on analogue compounds. • AmO{sub 2} assumed T{sub 2g} band presents a shift compared to the actinide dioxide series. • Am{sub 2}O{sub 3} evolution under self-irradiation and oxidation was also

  20. Recycling of americium

    International Nuclear Information System (INIS)

    Hagstroem, Ingela

    1999-12-01

    Separation of actinides from spent nuclear fuel is a part of the process of recycling fissile material. Extracting agents for partitioning the high level liquid waste (HLLW) from conventional PUREX reprocessing is studied. The CTH-process is based on three consecutive extraction cycles. In the first cycle protactinium, uranium, neptunium and plutonium are removed by extraction with di-2-ethylhexyl-phosphoric acid (HDEHP) from a 6 M nitric acid HLLW solution. Distribution ratios for actinides, fission products and corrosion products between HLLW and 1 M HDEHP in an aliphatic diluent have been investigated. To avoid addition of chemicals the acidity is reduced by a tributylphosphate (TBP) extraction cycle. The distribution ratios of elements present in HLLW have been measured between 50 % TBP in an aliphatic diluent and synthetic HLLW in range 0.1-6 M nitric acid. In the third extraction cycle americium and curium are extracted. To separate trivalent actinides from lanthanides a method based on selective stripping of the actinides from 1 M HDEHP is proposed. The aqueous phase containing ammonia, diethylenetriaminepentaacetic acid (DTPA) and lactic acid is recycled in a closed loop after reextraction of the actinides into a second organic phase also containing 1 M HDEHP. Distribution ratios for americium and neodymium have been measured at varying DTPA and lactic acid concentrations and at varying pH. Nitrogen-donor reagents have been shown to have a potential to separate trivalent actinides from lanthanides. 2,2':6,2''-terpyridine as extractant follows the CHON-principle and can in synergy with 2-bromodecanoic acid separate americium from europium. Distribution ratios for americium and europium, in the range of 0.02-0.12 M nitric acid, between nitric acid and 0.02 M terpyridine with 1 M 2-bromodecanoic acid in tert-butylbenzene (TBB) was investigated. Comparison with other nitrogen-donor reagents show that increasing lipophilicity of the molecule, by substitution of

  1. Biochemical fractionation and cellular distribution of americium and plutonium in the biomass of freshwater macrophytes

    International Nuclear Information System (INIS)

    Zotina, T.A.; Kalacheva, G.S.; Bolsunovsky, A.Ya.

    2011-01-01

    Accumulation of americium ( 241 Am) and plutonium ( 238,242 Pu) and their distribution in cell compartments and biochemical components of the biomass of freshwater aquatic plants Elodea canadensis, Ceratophyllum demersum and Myrioplyllum spicatum and aquatic moss Fontinalis antipyretica have been investigated in laboratory experiments. Americium and plutonium taken up from water by Elodea canadensis apical shoots were mainly absorbed by structural components of plant cells (90% for 241 Am; 89% for 238 Pu and 82-87% for 242 Pu). About 10-18% of isotope activity was recorded in the cytosol fraction. The major concentration (76-92%) of americium was bound to cell wall cellulose-like polysaccharides of Elodea canadensis, Myriophyllum spicatum, Ceratophyllum demersum and Fontinalis antipyretica, 8-24% of americium activity was registered in the fraction of proteins and carbohydrates, and just a minor concentration (<1%) in the lipid fraction. The distribution of plutonium in the biomass fractions of Elodea was similar to that of americium. Hence, americium and plutonium had the highest affinity to cellulose-like polysaccharides of cell walls of freshwater submerged macrophytes. (author)

  2. Rare earth elements during diagenesis of abyssal sediments: analogies with a transuranic element americium

    International Nuclear Information System (INIS)

    Boust, D.

    1987-03-01

    One of the possibilities for the storage of high-level radioactive wastes consists in burying them into abyssal sediments, the sediments being supposed to barrier out radionuclides migration. The objective of the work was to estimate the efficiency of sediment barrier with respect to americium. As there is no americium in abyssal sediments, an indirect approach was used: the behaviour of the rare earth elements, the best natural analogs of americium. They were analysed in a 15 m long core, from the Cap Verde abyssal plateau. The terrigenous phase derived from the African continent was modified by short-term processes (1-1000 years); the intermediate rare earth elements were dissolved. Mineral coatings, enriched in rare earth appeared. After burial, the evolution continued at a much slower rate (10 5 - 10 6 years). The rare elements of the mineral coatings derived from the dissolution of the terrigenous phase and from an additional source, deeper in the sediment column. The fluxes of rare earth elements from sediment to water column were estimated. In suboxic sediments, the dissolved particulate equilibrium was related to redox conditions. The short-term reactivity of americium was studied in laboratory experiments. Simple americium migration models showed that the sediments barrier was totally efficient with respect to americium. In the conditions, neptunium 237 a daughter product of americium 241 could induce fluxes of 10 16 atoms per year per ton of stored waste (10 -8 Ci y-1), during millions years, towards the water column [fr

  3. Determination of 241Am in reindeer bone

    International Nuclear Information System (INIS)

    Tahtinen, P.; Hakanen, M.; Jaakkola, T.; Nikula, A.

    1978-01-01

    The purpose of this work was to develop a procedure to separate americium from other alpha active nuclides present in reindeer bone samples, especially 228 Th and its daughter nuclides. The 241 Am-spectrum of a reindeer bone sample analyzed using the proposed method is given. The α-spectrum was measured one week after electrodeposition. The absence of the alpha peak of 224 Ra, the daughter nuclide of 228 Th, indicates that no 228 Th was electrodeposited onto the platinum disc. Four reindeer bone samples were analyzed for 241 Am using the method developed. The 241 Am/ 239 240 Pu activity ratio in reindeer bone was 0.9 :- 0.4. These results indicate that compared to plutonium, americium is accumulated in reindeer bone more heavily than in liver. All 241 Am values presented are concentrations at the time of radioassay, and no correction has been made for the ingrowth of 241 Am formed by the decay of 241 Pu during stockpilling. However, all 241 Am determinations were made 1 to 3 yrs after sample collection, and thus the corrections due to the ingrowth can be considered slight. About 60% of plutonium body burden is located in liver and 20% in skeleton. The activity ratio 241 Am/ 239 240 Pu in these animals was about 0.2 and 1.0 in liver and skeleton, respectively. This indicates that about 60% of the 241 Am body burden is located in skeleton and about 30% in liver. It can be roughly estimated that the whole-body activity of 241 Am is thus about 40% of the 239 240 Pu body burden

  4. Plutonium and americium separation from salts

    International Nuclear Information System (INIS)

    Hagan, P.G.; Miner, F.J.

    1976-01-01

    Salts or materials containing plutonium and americium are dissolved in hydrochloric acid, heated, and contacted with an alkali metal carbonate solution to precipitate plutonium and americium carbonates which are thereafter readily separable from the solution

  5. Distribution of uranium, americium and plutonium in the biomass of freshwater macrophytes

    International Nuclear Information System (INIS)

    Zotina, T.A.; Kalacheva, G.S.; Bolsunovsky, A.YA.

    2010-01-01

    Accumulation of uranium ( 238 U), americium ( 241 Am) and plutonium ( 242 Pu) and their distribution in cell compartments and biochemical components of the biomass of aquatic plants Elodea canadensis, Ceratophyllum demersum, Myrioplyllum spicatum and aquatic moss Fontinalis antipyretica have been investigated in laboratory batch experiments. Isotopes of uranium, americium and plutonium taken up from the water by Elodea canadensis apical shoots were mainly absorbed by cell walls, plasmalemma and organelles. A small portion of isotopes (about 6-13 %) could be dissolved in cytoplasm. The major portion (76-92 %) of americium was bound to cell wall cellulose-like polysaccharides of Elodea canadensis, Myriophyllum spicatum, Ceratophyllum demersum and Fontinalis antipyretica, 8-23 % of americium activity was registered in the fraction of proteins and carbohydrates, and just a small portion (< 1%) in lipid fraction. The distribution of plutonium in the biomass fraction of Elodea was similar to that of americium. Hence, americium and plutonium had the highest affinity to cellulose-like polysaccharides in Elodea biomass. Distribution of uranium in the biomass of Elodea differed essentially from that of transuranium elements: a considerable portion of uranium was recorded in the fraction of protein and carbohydrates (51 %). From our data we can assume that uranium has higher affinity to carbohydrates than proteins. (authors)

  6. Distribution of uranium, americium and plutonium in the biomass of freshwater macrophytes

    Energy Technology Data Exchange (ETDEWEB)

    Zotina, T.A.; Kalacheva, G.S.; Bolsunovsky, A.YA. [Institute of Biophysics SB RAS, Akademgorodok, Krasnoyarsk (Russian Federation)

    2010-07-01

    Accumulation of uranium ({sup 238}U), americium ({sup 241}Am) and plutonium ({sup 242}Pu) and their distribution in cell compartments and biochemical components of the biomass of aquatic plants Elodea canadensis, Ceratophyllum demersum, Myrioplyllum spicatum and aquatic moss Fontinalis antipyretica have been investigated in laboratory batch experiments. Isotopes of uranium, americium and plutonium taken up from the water by Elodea canadensis apical shoots were mainly absorbed by cell walls, plasmalemma and organelles. A small portion of isotopes (about 6-13 %) could be dissolved in cytoplasm. The major portion (76-92 %) of americium was bound to cell wall cellulose-like polysaccharides of Elodea canadensis, Myriophyllum spicatum, Ceratophyllum demersum and Fontinalis antipyretica, 8-23 % of americium activity was registered in the fraction of proteins and carbohydrates, and just a small portion (< 1%) in lipid fraction. The distribution of plutonium in the biomass fraction of Elodea was similar to that of americium. Hence, americium and plutonium had the highest affinity to cellulose-like polysaccharides in Elodea biomass. Distribution of uranium in the biomass of Elodea differed essentially from that of transuranium elements: a considerable portion of uranium was recorded in the fraction of protein and carbohydrates (51 %). From our data we can assume that uranium has higher affinity to carbohydrates than proteins. (authors)

  7. Fabrication of targets for transmutation of americium : synthesis of inertial matrix by sol-gel method. Procedure study on the infiltration of a radioactive solutions; Fabricacion de blancos para la transmutacion de americio: sintesis de matrices inertes por el metodo sol-gel. Estudio del procedimiento de infiltracion de disoluciones radiactivas

    Energy Technology Data Exchange (ETDEWEB)

    Fernandez Carretero, A. [Universidad Complutense de Madrid (Spain)

    2002-07-01

    Transmutation and incineration are innovative options in the management and disposal of fission products and actinides. nevertheless, the fabrication of targets for transmutation and incineration of actinides and fission products require a reconsideration of conventional processes (mechanical blending) and the development of new procedures compatible with the high activity of these materials. This work presents th R and D of a new fabrication method called INRAM (Infiltration of Radioactive Materials) based on the infiltration of an actinide solution in a porous non radiotoxic material in the form of a pellet (up to 12% An), or beads (up to 40% An) produced by sol-gel. The first method have been used for the fabrication of spinel (MgAl{sub 2}O{sub 4}) targets containing 11% Am, which have been irradiated in HFR-Petten (358.4 full power days). Post-test burn-up calculations showed that at the end of the irradiation the initial Am-241 concentration was reduced to 4%. The fraction of the initial americum atoms that have been fissioned is 28%. The main advantage of the INRAM method is that matrices with low or zero activity can be fabricated and formed into the required shape in an unshielded facility. This method offers other advantages over conventional ones, such as the active wastes are reduced, is easy to automate, adoptable to telemanipulation and dust free, which facilitate operator intervention and minimise radiation exposure to the personal. In addition, the infiltrant needs only be present in liquid form, i. e. it could be transferred directly from the reprocessing plant for fabrication into targets without conversion into-solid form. In order to optimise the infiltration process in depth investigations of all important process parameters, e. g. infiltration kinetics and metal (pu, Am) concentration in the feed solution, and also on extensive study or powder metallurgy parameters for the preparation of high quality fuel pellets with a high density, have been

  8. Medical management after contamination and incorporation of americium in occupational exposure. Medizinische Massnahmen nach Kontamination und Inkorporation von Americium bei beruflicher Strahlenexposition

    Energy Technology Data Exchange (ETDEWEB)

    Gensicke, F.; Stopp, G.; Scheler, R.; Klucke, H.; Czarwinski, R.; Naumann, M.; Hoelzer, F.; Ott, R.; Schmidt, I. (Staatliches Amt fuer Atomsicherheit und Strahlenschutz, Berlin (Germany, F.R.). Abt. Strahlenschutzmedizin)

    1990-10-01

    In handling with an ampule of {sup 241}Am-nitrate solution one person received an contamination of the body surface, especially the face and the hairs, and an internal contamination of americium. The paper presents the results obtained in medical management to reduced the contamination of the skin and of the incorporated radionuclide. The radioactivity of the body surface could be reduced up to small local areas. After treatment with DTPA (Ditripentat) the internal exposure decrease about 83%. (orig.).

  9. Plutonium and americium in the foodchain lichen-reindeer-man

    International Nuclear Information System (INIS)

    Jaakkola, T.; Hakanen, M.; Keinonen, M.; Mussalo, H.; Miettinen, J.K.

    1977-01-01

    The atmospheric nuclear tests have produced a worldwide fallout of transuranium elements. In addition to plutonium measurable concentrations of americium are to be found in terrestrial and aquatic environments. The metabolism of plutonium in reindeer was investigated by analyzing plutonium in liver, bone, and lung collected during 1963-1976. To determine the distribution of plutonium in reindeer all tissues of four animals of different ages were analyzed. To estimate the uptake of plutonium from the gastrointestinal tract in reindeer, the tissue samples of elk were also analyzed. Elk which is of the same genus as reindeer does not feed on lichen but mainly on deciduous plants, buds, young twigs, and leaves of trees and bushes. The composition of its feed corresponds fairly well to that of reindeer during the summer. Studies on behaviour of americium along the foodchain lichen-reindeer-man were started by determining the Am-241 concentrations in lichen and reindeer liver. The Am-241 results were compared with those of Pu-239,240. The plutonium contents of the southern Finns, whose diet does not contain reindeer tissues, were determined by analyzing autopsy tissue samples (liver, lung, and bone). The southern Finns form a control group to the Lapps consuming reindeer tissues. Plutonium analyses of the placenta, blood, and tooth samples of the Lapps were performed

  10. Transmutation of Americium in Fast Neutron Facilities

    OpenAIRE

    Zhang, Youpeng

    2011-01-01

    In this thesis, the feasibility to use a medium sized sodium cooled fast reactor fully loaded with MOX fuel for efficient transmutation of americium is investigated by simulating the safety performance of a BN600-type fast reactor loaded with different fractions of americium in the fuel, using the safety parameters obtained with the SERPENT Monte Carlo code. The focus is on americium mainly due to its long-term contribution to the radiotoxicity of spent nuclear fuel and its deterioration on c...

  11. Plutonium and americium in arctic waters, the North Sea and Scottish and Irish coastal zones

    DEFF Research Database (Denmark)

    Hallstadius, L.; Aarkrog, Asker; Dahlgaard, Henning

    1986-01-01

    of the Irish Sea) to Spitsbergen. 241Am found in Arctic waters probably originates from the decay of fallout 241Pu and, like Pu, tentatively has a residence time of the order of several years. Americium from Sellafield has an estimated mean residence time of 4–6 months in Scottish waters.......Plutonium and americium have been measured in surface waters of the Greenland and Barents Seas and in the northern North Sea from 1980 through 1984. Measurements in water and biota, Fucus, Mytilus and Patella, were carried out in North-English and Scottish waters in 1982 and Fucus samples were...... collected from the Irish coast in 1983. Fallout is found to dominate as a source of 239+240Pu north of latitude 65°N, while for 238Pu a substantial fraction originates from European nuclear fuel reprocessing facilities. The 238Pu/239+240Pu isotope ratio provides clear evidence of the transport of effluent...

  12. Medical management after contamination and incorporation of americium in occupational exposure

    International Nuclear Information System (INIS)

    Gensicke, F.; Stopp, G.; Scheler, R.; Klucke, H.; Czarwinski, R.; Naumann, M.; Hoelzer, F.; Ott, R.; Schmidt, I.

    1990-01-01

    In handling with an ampule of 241 Am-nitrate solution one person received an contamination of the body surface, especially the face and the hairs, and an internal contamination of americium. The paper presents the results obtained in medical management to reduced the contamination of the skin and of the incorporated radionuclide. The radioactivity of the body surface could be reduced up to small local areas. After treatment with DTPA (Ditripentat) the internal exposure decrease about 83%. (orig.) [de

  13. Plutonium and americium in arctic waters, the North Sea and Scottish and Irish coastal zones

    DEFF Research Database (Denmark)

    Hallstadius, L.; Aarkrog, Asker; Dahlgaard, Henning

    1986-01-01

    collected from the Irish coast in 1983. Fallout is found to dominate as a source of 239+240Pu north of latitude 65°N, while for 238Pu a substantial fraction originates from European nuclear fuel reprocessing facilities. The 238Pu/239+240Pu isotope ratio provides clear evidence of the transport of effluent...... of the Irish Sea) to Spitsbergen. 241Am found in Arctic waters probably originates from the decay of fallout 241Pu and, like Pu, tentatively has a residence time of the order of several years. Americium from Sellafield has an estimated mean residence time of 4–6 months in Scottish waters....

  14. The EFTTRA-T4 experiment on americium transmutation

    CERN Document Server

    Konings, R J M; Dassel, G; Pijlgroms, B J; Somers, J; Toscano, E

    2000-01-01

    In the EFTTRA-T4 experiment the irradiation behaviour of a target containing americium dispersed in MgAl sub 2 O sub 4 was studied. Pellets containing 10-12 wt% sup 2 sup 4 sup 1 Am were fabricated by the infiltration method. However, it was found that the americium, intended to be present as AmO sub 2 sub - sub x , formed a compound, probably AmAlO sub 3 , during sintering. The T4 target was irradiated in the High Flux Reactor (HFR) Petten from August 1996 to January 1998 (358.4 fpd's). Post-test burn-up calculations indicated that the sup 2 sup 4 sup 1 Am concentration is reduced to 4% of the initial value at the end of the irradiation. The fraction of the initial americium atoms that were fissioned is 28%. Non-destructive and destructive examinations of the target indicated that swelling of the target pellets occurred. This is attributed to accumulation of helium, produced by alpha decay of sup 2 sup 4 sup 2 Cm that occurs in the transmutation scheme of sup 2 sup 4 sup 1 Am.

  15. Extraction separation of americium and curium. A review

    International Nuclear Information System (INIS)

    Petrzilova, H.

    1976-11-01

    A survey is given of extraction systems suitable for transplutonium element separation and preparation as well as for the practical application of their nuclear properties. Methods are discussed in detail of separating the actinide and the lanthanide fractions from fission and corrosion products and of separating americium from curium. The description is completed with flowsheets showing the separation of transplutonium elements from irradiated targets and waste solutions after spent fuel reprocessing. (L.K.)

  16. Americium behaviour in plastic vessels

    Energy Technology Data Exchange (ETDEWEB)

    Legarda, F.; Herranz, M. [Departamento de Ingenieria Nuclear y Mecanica de Fluidos, Escuela Tecnica Superior de Ingenieria de Bilbao, Universidad del Pais Vasco (UPV/EHU), Alameda de Urquijo s/n, 48013 Bilbao (Spain); Idoeta, R., E-mail: raquel.idoeta@ehu.e [Departamento de Ingenieria Nuclear y Mecanica de Fluidos, Escuela Tecnica Superior de Ingenieria de Bilbao, Universidad del Pais Vasco (UPV/EHU), Alameda de Urquijo s/n, 48013 Bilbao (Spain); Abelairas, A. [Departamento de Ingenieria Nuclear y Mecanica de Fluidos, Escuela Tecnica Superior de Ingenieria de Bilbao, Universidad del Pais Vasco (UPV/EHU), Alameda de Urquijo s/n, 48013 Bilbao (Spain)

    2010-07-15

    The adsorption of {sup 241}Am dissolved in water in different plastic storage vessels was determined. Three different plastics were investigated with natural and distilled waters and the retention of {sup 241}Am by these plastics was studied. The same was done by varying vessel agitation time, vessel agitation speed, surface/volume ratio of water in the vessels and water pH. Adsorptions were measured to be between 0% and 70%. The adsorption of {sup 241}Am is minimized with no water agitation, with PET or PVC plastics, and by water acidification.

  17. Americium behaviour in plastic vessels

    International Nuclear Information System (INIS)

    Legarda, F.; Herranz, M.; Idoeta, R.; Abelairas, A.

    2010-01-01

    The adsorption of 241 Am dissolved in water in different plastic storage vessels was determined. Three different plastics were investigated with natural and distilled waters and the retention of 241 Am by these plastics was studied. The same was done by varying vessel agitation time, vessel agitation speed, surface/volume ratio of water in the vessels and water pH. Adsorptions were measured to be between 0% and 70%. The adsorption of 241 Am is minimized with no water agitation, with PET or PVC plastics, and by water acidification.

  18. Hanford Single-Shell Tank Leak Causes and Locations - 241-BY and 241-TY Farm

    Energy Technology Data Exchange (ETDEWEB)

    Girardot, Crystal L.; Harlow, Donald G.

    2014-09-04

    This document identifies 241-BY Tank Farm (BY Farm) and 241-TY Tank Farm (TY Farm) lead causes and locations for the 100 series leaking tanks (241-BY-103, 241-TY-103, 241-TY-104, 241-TY-105 and 241-TY-106) identified in RPP-RPT-43704, Hanford BY Farm Leak Assessments Report, and in RPP-RPT-42296, Hanford TY Farm Leak Assessments Report. This document satisfies the BY and TY Farm portion of the target (T04) in the Hanford Federal Facility Agreement and Consent Order milestone M-045-91F.

  19. Hanford Single-Shell Tank Leak Causes and Locations - 241-BY and 241-TY Farm

    Energy Technology Data Exchange (ETDEWEB)

    Girardot, Crystal L.; Harlow, Donald G.

    2013-11-19

    This document identifies 241-BY Tank Farm (BY Farm) and 241-TY Tank Farm (TY Farm) leak causes and locations for the 100 series leaking tanks (241-BY-103, 241-TY-103, 241-TY-104, 241-TY-105, and 241-TY-106) identified in RPP-RPT-43704, Hanford BY Farm Leak Assessments Report, and in RPP-RPT-42296, Hanford TY Farm Leak Assessments Report. This document satisfies the BY and TY Farm portion of the target (T04) in Hanford Federal Facility Agreement and Consent Order milestone M-045-91F.

  20. On the structure of thorium and americium adenosine triphosphate complexes

    International Nuclear Information System (INIS)

    Mostapha, Sarah; Berton, Laurence; Boubals, Nathalie; Zorz, Nicole; Charbonnel, Marie-Christine; Fontaine-Vive, Fabien; Den Auwer, Christophe; Solari, Pier Lorenzo

    2014-01-01

    The actinides are chemical poisons and radiological hazards. One challenge to better appraise their toxicity and develop countermeasures in case of exposure of living organisms is to better assess pathways of contamination. Because of the high chemical affinity of those actinide elements for phosphate groups and the ubiquity of such chemical functions in biochemistry, nucleotides and in particular adenosine triphosphate nucleotide (ATP) may be considered critical target building blocks for actinides. Combinations of spectroscopic techniques (Fourier transformed Infra Red [FTIR], Electro-spray Ionization Mass Spectrometry [ESI-MS], and Extended X-ray Absorption Fine Structure [EXAFS]) with quantum chemical calculations have been implemented in order to assess the actinides coordination arrangement with ATP. We describe and compare herein the interaction of ATP with thorium and americium; thorium(IV) as a representative of actinide(IV) like plutonium(IV) and americium(III) as a representative of all heavier actinides. In the case of thorium, an insoluble complex is readily formed. In the case of americium, a behavior identical to that described previously for lutetium has been observed with insoluble and soluble complexes. The comparative study of ATP complexation with Th(IV) and Am(III) shows their ability to form insoluble complexes for which a structural model has been proposed by analogy with previously described Lu(III) complexes. (authors)

  1. On the structure of thorium and americium adenosine triphosphate complexes.

    Science.gov (United States)

    Mostapha, Sarah; Fontaine-Vive, Fabien; Berthon, Laurence; Boubals, Nathalie; Zorz, Nicole; Solari, Pier Lorenzo; Charbonnel, Marie Christine; Den Auwer, Christophe

    2014-11-01

    The actinides are chemical poisons and radiological hazards. One challenge to better appraise their toxicity and develop countermeasures in case of exposure of living organisms is to better assess pathways of contamination. Because of the high chemical affinity of those actinide elements for phosphate groups and the ubiquity of such chemical functions in biochemistry, nucleotides and in particular adenosine triphosphate nucleotide (ATP) may be considered critical target building blocks for actinides. Combinations of spectroscopic techniques (Fourier transformed Infra Red [FTIR], Electrospray Ionization Mass Spectrometry [ESI-MS], and Extended X-ray Absorption Fine Structure [EXAFS]) with quantum chemical calculations have been implemented in order to assess the actinides coordination arrangement with ATP. We describe and compare herein the interaction of ATP with thorium and americium; thorium(IV) as a representative of actinide(IV) like plutonium(IV) and americium(III) as a representative of all heavier actinides. In the case of thorium, an insoluble complex is readily formed. In the case of americium, a behavior identical to that described previously for lutetium has been observed with insoluble and soluble complexes. The comparative study of ATP complexation with Th(IV) and Am(III) shows their ability to form insoluble complexes for which a structural model has been proposed by analogy with previously described Lu(III) complexes.

  2. Standard practice for The separation of americium from plutonium by ion exchange

    CERN Document Server

    American Society for Testing and Materials. Philadelphia

    2001-01-01

    1.1 This practice describes the use of an ion exchange technique to separate plutonium from solutions containing low concentrations of americium prior to measurement of the 241Am by gamma counting. 1.2 This practice covers the removal of plutonium, but not all the other radioactive isotopes that may interfere in the determination of 241Am. 1.3 This practice can be used when 241Am is to be determined in samples in which the plutonium is in the form of metal, oxide, or other solid provided that the solid is appropriately sampled and dissolved (See Test Methods C758, C759, and C1168). 1.4 This standard does not purport to address all of the safety concerns, if any, associated with its use. It is the responsibility of the user of this standard to establish appropriate safety and health practices and determine the applicability of regulatory limitations prior to use.

  3. Migration ability of plutonium and americium in the soils of Polessie State Radiation-Ecological Reserve

    International Nuclear Information System (INIS)

    Svetlana Ovsiannikova; Maryna Papenia; Katsiaryna Voinikava; Galina Sokolik; Sergey Svirschevsky; Justin Brown; Lindys Skipperud

    2010-01-01

    The physicochemical forms of radionuclides in soils determine the processes of their entry into the soil solutions, redistribution in the soil profile, soil-plant and soil-ground or surface waters transfer as well as spreading outside the contaminated area. The vertical distribution of plutonium and americium and their physicochemical forms in soils of Polessie State Radiation-Ecological Reserve (PSRER) were studied with the aim of establishing the potential for radionuclide migration. Samples of alluvial soddy-podzolic and peaty soils with a low (1-3%) and relatively high (∼80% of dry sample mass) content of organic matter have been selected for investigation. A method employing sequential selective extraction has been used for analysis of radionuclide physicochemical forms in the soils. Activity concentrations of 238 Pu, 239,240 Pu and 241 Am in the samples were determined via radiochemical analysis with alpha-spectrometric identification of radionuclides. The results indicate that the main proportion of plutonium and americium remains in the 0-20 cm soil layer. The inventories of mobile and biologically available forms of plutonium and americium, expressed as a percentage of the total radionuclide content in soil, lie in the ranges of 1.1-9.4 and 2.7-29% respectively. Greater proportions of mobile and biologically available forms of radionuclides appear to be associated with mineral soil as compared to organic soil. In both mineral and organic soils, the portion of mobile americium is higher than plutonium. The inventories of mobile forms of plutonium and americium increase with the depth of soils. (author)

  4. Aqueous Chloride Operations Overview: Plutonium and Americium Purification/Recovery

    Energy Technology Data Exchange (ETDEWEB)

    Kimball, David Bryan [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Skidmore, Bradley Evan [Los Alamos National Lab. (LANL), Los Alamos, NM (United States)

    2016-06-22

    Acqueous Chloride mission is to recover plutonium and americium from pyrochemical residues (undesirable form for utilization and storage) and generate plutonium oxide and americium oxide. Plutonium oxide is recycled into Pu metal production flowsheet. It is suitable for storage. Americium oxide is a valuable product, sold through the DOE-OS isotope sales program.

  5. Recovery of americium from slag and crucible wastes and its purification

    International Nuclear Information System (INIS)

    Michael, K.M.; Dabholkar, G.M.; Vijayan, K.; Ramamoorthy, N.; Narayanan, C.V.; Jambunathan, U.; Kapoor, S.C.

    1990-01-01

    A method of recovery and purification of americium-241 from slag waste streams is described. Extraction of Am from slag solution of 0.16 M HNO 3 was carried out by tri-n-butyl phosphate. After stripping with acetic acid, Am was precipitated at pH 1. This was followed by metathesis to remove Ca. Final separation of Pu from Am solution was achieved by anion exchange method using Dowex 1x4 anion exchange resin. Details of large scale recovery of Am from slag are also described. (author). 12 refs., 11 tabs., 1 fig

  6. Distribution coefficients for plutonium and americium on particulates in aquatic environments

    International Nuclear Information System (INIS)

    Sanchez, A.L.; Schell, W.R.; Sibley, T.H.

    1982-01-01

    The distribution coefficients of two transuranic elements, plutonium and americium, were measured experimentally in laboratory systems of selected freshwater, estuarine, and marine environments. Gamma-ray emitting isotopes of these radionuclides, 237 Pu and 241 Am, were significantly greater than the sorption Ksub(d) values, suggesting some irreversibility in the sorption of these radionuclides onto sediments. The effects of pH and of sediment concentration on the distribution coefficients were also investigated. There were significant changes in the Ksub(d) values as these parameters were varied. Experiments using sterilized and nonsterilized samples for some of the sediment/water systems indicate possible bacterial effects on Ksub(d) values. (author)

  7. New Fecal Method for Plutonium and Americium

    International Nuclear Information System (INIS)

    Maxwell, S.L. III

    2000-01-01

    A new fecal analysis method that dissolves plutonium oxide was developed at the Westinghouse Savannah River Site. Diphonix Resin (Eichrom Industries), is used to pre-concentrate the actinides from digested fecal samples. A rapid microwave digestion technique is used to remove the actinides from the Diphonix Resin, which effectively extracts plutonium and americium from acidic solutions containing hydrofluoric acid. After resin digestion, the plutonium and americium are recovered in a small volume of nitric acid that is loaded onto small extraction chromatography columns, TEVA Resin and TRU Resin (Eichrom Industries). The method enables complete dissolution of plutonium oxide and provides high recovery of plutonium and americium with good removal of thorium isotopes such as thorium-228

  8. New fecal method for plutonium and americium

    International Nuclear Information System (INIS)

    Maxwell, S.L.; Fauth, D.J.; Nichols, S.T.

    2001-01-01

    A new fecal analysis method that dissolves plutonium oxide was developed at the Westinghouse Savannah River Site. Diphonix Resin R (Eichrom Technologies), is used to pre-concentrate the actinides from digested fecal samples. A rapid microwave digestion technique is used to remove the actinides from the Diphonix Resin R , which effectively extracts plutonium and americium from acidic solutions containing hydrofluoric acid. After resin digestion, the plutonium and americium are recovered in a small volume of nitric acid that is loaded onto small extraction chromatography columns, TEVA Resin and TRU Resin (Eichrom Technologies). The method enables complete dissolution of plutonium oxide and provides high recovery of plutonium and americium with good removal of thorium isotopes such as 228 Th. (author)

  9. Transmutation of Americium in Fast Neutron Facilities

    International Nuclear Information System (INIS)

    Zhang, Youpeng

    2011-01-01

    In this thesis, the feasibility to use a medium sized sodium cooled fast reactor fully loaded with MOX fuel for efficient transmutation of americium is investigated by simulating the safety performance of a BN600-type fast reactor loaded with different fractions of americium in the fuel, using the safety parameters obtained with the SERPENT Monte Carlo code. The focus is on americium mainly due to its long-term contribution to the radiotoxicity of spent nuclear fuel and its deterioration on core's safety parameters. Applying the SAS4A/SASSYS transient analysis code, it is demonstrated that the power rating needs to be reduced by 6% for each percent additional americium introduction into the reference MOX fuel, maintaining 100 K margin to fuel melting, which is the most limiting failure mechanism. Safety analysis of a new Accelerator Driven System design with a smaller pin pitch-to-diameter ratio comparing to the reference EFIT-400 design, aiming at improving neutron source efficiency, was also performed by simulating performance for unprotected loss of flow, unprotected transient overpower, and protected loss-of-heat-sink transients, using neutronic parameters obtained from MCNP calculations. Thanks to the introduction of the austenitic 15/15Ti stainless steel with enhanced creep rupture resistance and acceptable irradiation swelling rate, the suggested ADS design loaded with nitride fuel and cooled by lead-bismuth eutectic could survive the full set of transients, preserving a margin of 130 K to cladding rupture during the most limiting transient. The thesis concludes that efficient transmutation of americium in a medium sized sodium cooled fast reactor loaded with MOX fuel is possible but leads to a severe power penalty. Instead, preserving transmutation rates of minor actinides up to 42 kg/TWh th , the suggested ADS design with enhanced proton source efficiency appears like a better option for americium transmutation

  10. Redox chemistry of americium in nitric acid media

    International Nuclear Information System (INIS)

    Picart, S.; Jobelin, I.; Armengol, G.; Adnet, JM.

    2004-01-01

    The redox properties of the actinides are very important parameters for speciation studies and spent nuclear fuel reprocessing based on liquid-liquid extraction of actinides at different oxidation states (as in the Purex or Sesame process). They are also very useful for developing analytical tools including coulometry and redox titration. This study addressed the americium(IV)/americium(III) and americium(VI)/americium(V) redox couples, focusing on exhaustive acquisition of the thermodynamic and kinetic parameters of americium oxidation at an electrode in a complexing nitric acid medium. (authors)

  11. Adsorption-Desorption Characteristics of Plutonium and Americium with Sediment Particles in the Estuarine Environment

    International Nuclear Information System (INIS)

    Murray, C.N.; Fukai, R.

    1976-01-01

    The particle formation of plutonium and americium, their adsorption onto fresh water sediments and the desorption from the sediments in sea water were studied in the Laboratory under simulated river-estuary conditions, using γ-emitting plutonium-237 and americium-241. The results of the experiments show that the particle formation of plutonium depends on its valence states, on pH and on the salinity of the medium. For river water at pH4, some 25%, 20% and 30% of the added 237 Pu was in particulate form, larger than 0.45pm, for Pu (III), Pu (IV) and Pu (VI), respectively, while 65%, 90% and 50% of the respective valence states was associated with particles at pH 8. In sea water the general pattern remains similar, although Pu (VI) is more soluble in sea water owing to higher ligand concentrations for carbonate and bicarbonate complexes. The pH-dependency of particle formation of Am (III) is more steep than that of plutonium and seems to be influenced by colloidal substances occurring in the experimental media. The adsorption-desorption characteristics of plutonium and americium with the sediment in river water as well as sea water reflect the characteristics of their particle formation, being dependent upon such properties as valence states, the pH and salinity of the medium. A sewage effluent added to the media has small but measurable effects on the adsorption-desorption processes of plutonium. (author)

  12. Final Radiological Assessment of External Exposure for CLEAR-Line Americium Recovery Operations

    Energy Technology Data Exchange (ETDEWEB)

    Davis, Adam C. [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Belooussova, Olga N. [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Hetrick, Lucas Duane [Los Alamos National Lab. (LANL), Los Alamos, NM (United States)

    2014-11-12

    Los Alamos National Laboratory is currently planning to implement an americium recovery program. The americium, ordinarily isotopically pure 241Am, would be extracted from existing Pu materials, converted to an oxide and shipped to support fabrication of americium oxide-beryllium neutron sources. These operations would occur in the currently proposed Chloride Extraction and Actinide Recovery (CLEAR) line of glove boxes. This glove box line would be collocated with the currently-operational Experimental Chloride Extraction Line (EXCEL). The focus of this document is to provide an in-depth assessment of the currently planned radiation protection measures and to determine whether or not further design work is required to satisfy design-goal and ALARA requirements. Further, this document presents a history of americium recovery operations in the Department of Energy and high-level descriptions of the CLEAR line operations to provide a basis of comparison. Under the working assumptions adopted by this study, it was found that the evaluated design appears to mitigate doses to a level that satisfies the ALARA-in-design requirements of 10 CFR 835 as implemented by the Los Alamos National Laboratory procedure P121. The analyses indicate that extremity doses would also meet design requirements. Dose-rate calculations were performed using the radiation transport code MCNP5 and doses were estimated using a time-motion study developed in consort with the subject matter expert. A copy of this report and all supporting documentation are located on the Radiological Engineering server at Y:\\Rad Engineering\\2013 PROJECTS\\TA-55 Clear Line.

  13. Separation of neptunium, plutonium, americium and curium from uranium with di-(2-ethylhexyl)-phosphoric acid (HDEHP) for radiometric and ICP-MS analysis

    International Nuclear Information System (INIS)

    Ramebaeck, H.; Skaalberg, M.

    1998-01-01

    The possibility of using di-(2-ethylhexyl)-phosphoric acid (HDEHP) in solvent extraction for the separation of neptunium, plutonium, americium and curium from large amounts of uranium was studied. Neptunium, plutonium, americium and curium (as well as uranium) were extracted from HNO 3 , whereafter americium and curium were back-extracted with 5M HNO 3 . Thereafter was neptunium back-extracted in 1M HNO 3 containing hydroxylamine hydronitrate. Finally, plutonium was back-extracted in 3M HCl containing Ti(III). The method separates 238 Pu from 241 Am for α-spectroscopy. For ICP-MS analysis, the interferences from 238 U are eliminated: tailing from 238 U, for analysis of 237 Np, and the interference of 238 UH + for analysis of 239 Pu. The method has been used for the analysis of actinides in samples from a spent nuclear fuel leaching and radionuclide transport experiment. (author)

  14. Speciation of americium in seawater and accumulation in the marine sponge Aplysina cavernicola.

    Science.gov (United States)

    Maloubier, Melody; Michel, Hervé; Solari, Pier Lorenzo; Moisy, Philippe; Tribalat, Marie-Aude; Oberhaensli, François R; Dechraoui Bottein, Marie Yasmine; Thomas, Olivier P; Monfort, Marguerite; Moulin, Christophe; Den Auwer, Christophe

    2015-12-21

    The fate of radionuclides in the environment is a cause of great concern for modern society, seen especially in 2011 after the Fukushima accident. Among the environmental compartments, seawater covers most of the earth's surface and may be directly or indirectly impacted. The interaction between radionuclides and the marine compartment is therefore essential for better understanding the transfer mechanisms from the hydrosphere to the biosphere. This information allows for the evaluation of the impact on humans via our interaction with the biotope that has been largely undocumented up to now. In this report, we attempt to make a link between the speciation of heavy elements in natural seawater and their uptake by a model marine organism. More specifically, because the interaction of actinides with marine invertebrates has been poorly studied, the accumulation in a representative member of the Mediterranean coralligenous habitat, the sponge Aplysina cavernicola, was investigated and its uptake curve exposed to a radiotracer (241)Am was estimated using a high-purity Ge gamma spectrometer. But in order to go beyond the phenomenological accumulation rate, the speciation of americium(III) in seawater must be assessed. The speciation of (241)Am (and natural europium as its chemically stable surrogate) in seawater was determined using a combination of different techniques: Time-Resolved Laser-Induced Fluorescence (TRLIF), Extended X-ray Absorption Fine Structure (EXAFS) at the LIII edge, Attenuated Total Reflectance Fourier Transform Infrared (ATR-FTIR) spectroscopy and Scanning Electron Microscopy (SEM) and the resulting data were compared with the speciation modeling. In seawater, the americium(III) complex (as well as the corresponding europium complex, although with conformational differences) was identified as a ternary sodium biscarbonato complex, whose formula can be tentatively written as NaAm(CO3)2·nH2O. It is therefore this chemical form of americium that is

  15. Interaction and diffusion transport of americium in soils

    Energy Technology Data Exchange (ETDEWEB)

    Ramirez-Guinart, Oriol; Rigol, Anna; Vidal, Miquel [Analytical Chemistry department, Faculty of Chemistry, University of Barcelona, Marti i Franques 1-11, 08028, Barcelona (Spain)

    2014-07-01

    The final disposal of High Level Radioactive Wastes (HLRW) is based on its long-term storage in underground facilities located in geological stable sites with a multi-barrier system, the so called Deep Geological Repositories (DGR), that will keep HLRW confined for >10.000 years. After this period of time, leachates rich in long-live radioisotopes might escape from DGR and start to transport towards the biosphere. There is still a lack of information concerning the interaction and transport in soils of some radionuclides present in HLRW, especially for radionuclides that present a high sorption, such as americium (Am). Having reliable information about the mobility of radionuclides in soils is crucial in order to develop risk assessment models and to take proper decisions in case of soil contamination. The aim of the present work was, by means of laboratory scale experiments, to study the interaction and, for first time, to evaluate the diffusion transport of {sup 241}Am in soils. The {sup 241}Am interaction in soils was assessed by applying sorption batch assays to 20 soil samples with contrasted edaphic properties which allowed us to quantify the solid-liquid distribution coefficient (K{sub d}) and desorption percentage. K{sub d} (Am) values ranged from 10{sup 3} to 10{sup 5} L kg{sup -1} and desorption percentages were always less than 2% which denoted a high capacity of the soil to incorporate the Am and a low reversibility of the sorption process. The influence of soil properties in {sup 241}Am interaction was studied by means of multiple linear and multivariate regressions. Although a single correlation between K{sub d} (Am) values and a soil property was not found, the main properties affecting {sup 241}Am interaction in soils were soil pH, carbonate and organic matter contents in the soil. Finally, additional batch assays at different controlled pH were done to study Am sorption as a function of the contact solution pH. A variation of the Am sorption

  16. Americium migration in basalt and implications to repository risk analysis

    International Nuclear Information System (INIS)

    Rickert, P.G.

    1980-01-01

    Experiments were performed with americium as a minor component in groundwater. Batch adsorption, migration through column, and filtration experiments were performed. It was determined in batch experiments that americium is strongly adsorbed from solution. It was determined with filtration experiments that large percentages of the americium concentrations suspended by the contact solutions in batch experiments and suspended by the infiltrating groundwater in migration experiments were associated with particulate. Filtration was determined to be the primary mode of removal of americium from infiltrating groundwater in a column of granulated basalt (20 to 50 mesh) and an intact core of permeable basalt. Fractionally, 0.46 and 0.22 of the americium component in the infiltrating groundwater was transported through the column and core respectively. In view of these filtration and migration experiment results, the concept of K/sub d/ in the chromatographic sense is meaningless for predicting americium migration in bedrock by groundwater transport at near neutral pH

  17. Procedure for the analysis of americium in complex matrices

    International Nuclear Information System (INIS)

    Knab, D.

    1978-02-01

    A radioanalytical procedure for the analysis of americium in complex matrices has been developed. Clean separations of americium can be obtained from up to 100 g of sample ash, regardless of the starting material. The ability to analyze large masses of material provides the increased sensitivity necessary to detect americium in many environmental samples. The procedure adequately decontaminates from rare earth elements and natural radioactive nuclides that interfere with the alpha spectrometric measurements

  18. Hanford Single-Shell Tank Leak Causes and Locations - 241-SX Farm

    Energy Technology Data Exchange (ETDEWEB)

    Girardot, Crystal L. [Washington River Protection Solutions (United States); Harlow, Donald G. [Washington River Protection Solutions (United States)

    2014-01-08

    This document identifies 241-SX Tank Farm (SX Farm) leak causes and locations for the 100 series leaking tanks (241-SX-107, 241-SX-108, 241-SX-109, 241-SX-111, 241-SX-112, 241-SX-113, 241-SX-114, and 241-SX-115) identified in RPP-ENV-39658, Rev. 0, Hanford SX-Farm Leak Assessments Report. This document satisfies the SX Farm portion of the target (T04) in the Hanford Federal Facility Agreement and Consent Order milestone M-045-91F.

  19. The relative physiological and toxicological properties of americium and plutonium

    Energy Technology Data Exchange (ETDEWEB)

    Carter, R.E.; Busch, E.; Johnson, O. [and others

    1951-11-15

    The relative physiological and toxicological properties of americium and plutonium have been studied following their intravenous administration to rats. The urinary and fecal excretion of americium was similar to that of plutonium administered as Pu(N0{sub 3}){sub 4}. The deposition of americium the tissues and organs of the rat was also similar to that observed for plutonium. The liver and the skeleton were the major sites of deposition. Zirconium citrate administered 15 minutes after injection of americium increased the urinary excretion of americium and decreased the amount found in the liver and the skeleton at 4 and 16 days. LD{sub 30}{sup 50} studies showed americium was slightly less toxic when given in the acute toxic range than was plutonium. The difference was, however, too slight to be important in establishing a larger tolerance does for americium. Survival studies, hematological observations, bone marrow observations, comparison of tumor incidence and the incidence of skeletal abnormalities indicated that americium and plutonium have essentially the same chronic toxicity when given on an equal {mu}c. basis. These studies support the conclusion that the tolerance values for americium should be essentially the same as those for Plutonium.

  20. Pretreatment of americium/curium solutions for vitrification

    International Nuclear Information System (INIS)

    Rudisill, T.S.

    1996-01-01

    Vitrification will be used to stabilize an americium/curium (Am/Cm) solution presently stored in F-Canyon for eventual transport to the heavy isotope programs at Oak Ridge National Laboratory. Prior to vitrification, an in-tank oxalate precipitation and a series of oxalic/nitric acid washes will be used to separate these elements and lanthanide fission products from the bulk of the uranium and metal impurities present in the solution. Pretreatment development experiments were performed to understand the behavior of the lanthanides and the metal impurities during the oxalate precipitation and properties of the precipitate slurry. The results of these experiments will be used to refine the target glass composition allowing optimization of the primary processing parameters and design of the solution transfer equipment

  1. Analysis procedure for americium in environmental samples

    International Nuclear Information System (INIS)

    Holloway, R.W.; Hayes, D.W.

    1982-01-01

    Several methods for the analysis of 241 Am in environmental samples were evaluated and a preferred method was selected. This method was modified and used to determine the 241 Am content in sediments, biota, and water. The advantages and limitations of the method are discussed. The method is also suitable for 244 Cm analysis

  2. Surface complexation modeling of americium sorption onto volcanic tuff.

    Science.gov (United States)

    Ding, M; Kelkar, S; Meijer, A

    2014-10-01

    Results of a surface complexation model (SCM) for americium sorption on volcanic rocks (devitrified and zeolitic tuff) are presented. The model was developed using PHREEQC and based on laboratory data for americium sorption on quartz. Available data for sorption of americium on quartz as a function of pH in dilute groundwater can be modeled with two surface reactions involving an americium sulfate and an americium carbonate complex. It was assumed in applying the model to volcanic rocks from Yucca Mountain, that the surface properties of volcanic rocks can be represented by a quartz surface. Using groundwaters compositionally representative of Yucca Mountain, americium sorption distribution coefficient (Kd, L/Kg) values were calculated as function of pH. These Kd values are close to the experimentally determined Kd values for americium sorption on volcanic rocks, decreasing with increasing pH in the pH range from 7 to 9. The surface complexation constants, derived in this study, allow prediction of sorption of americium in a natural complex system, taking into account the inherent uncertainty associated with geochemical conditions that occur along transport pathways. Published by Elsevier Ltd.

  3. Accumulation of {sup 241}Am by suspended matter, diatoms and aquatic weeds of the Yenisei River

    Energy Technology Data Exchange (ETDEWEB)

    Zotina, T.A., E-mail: t_zotina@ibp.r [Institute of Biophysics SB RAS, Akademgorodok, Krasnoyarsk 660036 (Russian Federation); Bolsunovsky, A.Ya.; Bondareva, L.G. [Institute of Biophysics SB RAS, Akademgorodok, Krasnoyarsk 660036 (Russian Federation)

    2010-02-15

    In this work we experimentally estimated the capacities of the key components of the Yenisei River (Russia): particulate suspended matter (seston), diatom microalgae, and submerged macrophytes for accumulating {sup 241}Am from water. In our experiments large particles of seston (>8 mum), comparable in size with diatoms, took up most of americium from water. The accumulation of americium by isolated diatom algae (Asterionella formosa and Diatoma vulgare) was lower than by total seston. The concentration factors (CFs) of {sup 241}Am for seston of the Yenisei River in our experiments were (2.8-6.9).10{sup 5}; for diatoms - (1.5-4.2).10{sup 4}. The CFs for aquatic plant Elodea canadensis were within the same order of magnitude as those for diatoms. Activity concentration and CFs of {sup 241}Am were nearly the same in experiments under dark and light conditions. This is indicative of an energy independent mechanism of americium uptake from the water by diatoms and submerged macrophytes.

  4. Uptake of plutonium and americium by barley from two contaminated Nevada Test Site soils

    International Nuclear Information System (INIS)

    Schulz, R.K.; Tompkins, G.A.; Leventhal, L.; Babcock, K.L.

    1976-01-01

    Barley (Hordeum vulgare, Var. Atlas 68) plant uptake of Pu 239 , Pu 240 , and Am 241 was studied using two soil samples collected from widely separated areas of the Nevada Test Site. Each area had been previously contaminated with plutonium and americium as a result of a separate high explosive (nonnuclear) detonation of a device containing plutonium. The plants were grown on 3-kg soil samples in a controlled environment chamber. The plutonium concentration ratio (plutonium concentration in dry plant tissue/plutonium concentration in dry soil) was in the order of 10 -5 for plant vegetative material. The plutonium concentration ratio for the grain was 20 to 100 times lower than that in the vegetative material. Concentration ratios for americium were in the order of 10 -4 for vegetative growth and 25 to 75 times lower for the grain. These results imply that americium is more available to plants than plutonium. Plutonium-bearing particles were identified in a soil sample using an autoradiographic technique and then separated from the soil samples. The Pu 239 oxide equivalent diameters of plutonium-bearing particles could be described by a log-normal distribution function in the range of 0.2 to 0.7 μm. The actual diameters of the particles were 2 to 3 times the PuO 2 equivalent diameter. Microprobe analyses of the surface region of particles greater than 2 μm showed the following order of abundance: U, Pu is greater than O is greater than Al is greater than Si is greater than Fe is greater than Mg. Photographs obtained with a scanning electron microscope revealed that some of the particles are quite irregular and have large specific surface areas which might enhance solubility and plant uptake

  5. Concentration and vertical distribution of plutonium and americium in Italian mosses and lichens

    International Nuclear Information System (INIS)

    Jia, G.; Desideri, D.; Guerra, F.; Meli, M.A.; Testa, C.

    1997-01-01

    The plutonium and americium concentration and vertical distribution in some Italian mosses and lichens have been determined. The 239,240 Pu, 238 Pu and 241 Am concentration ranges in tree trunk lichens 0.83-1.87, 0.052-0.154 and 0.180-0.770 Bq/kg, respectively. The corresponding values in tree mosses are higher and more scattered ranging from 0.321 to 4.96, from 0.029 to 0.171 and from 0.200 to 1.93 Bq/kg. The mean 238 Pu/ 239,240 Pu and 241 Am/ 239,240 Pu ratios are 0.088±0.037 and 0.38 ± 0.13 in lichens and 0.091±0.072 and 0.54±0.16 in tree mosses. The Pu and Am concentrations are relatively low in terrestrial mosses. The 239,240 Pu, 238 Pu and 241 Am vertical distributions in a terrestrial moss core (Neckera Crispa) collected near Urbino (central Italy) show an exponential decrease with the height. On the contrary the 241 Am vertical distribution in another terrestrial moss core (Sphagnum Compactum) collected in the Alps (northern Italy) shows an interesting peak at 16 cm which corresponds to the deposition of fallout from the nuclear weapon tests in 1960's. The 241 Am movement upward and downward in the moss core is also studied. The results show once again that both mosses and lichens are very effective accumulators of Pu and Am and that they can be used as good biological indicators of the radionuclide airborne pollution from nuclear facilities and nuclear weapon tests. They can play a very important role in cycling naturally or artificially enhanced radionuclides in the atmosphere over long time scales. (author)

  6. Behavior of 241Am in fast reactor systems - a safeguards perspective

    International Nuclear Information System (INIS)

    Beddingfield, David H.; Lafleur, Adrienne M.

    2009-01-01

    Advanced fuel-cycle developments around the world currently under development are exploring the possibility of disposing of 241 Am from spent fuel recycle processes by burning this material in fast reactors. For safeguards practitioners, this approach could potentially complicate both fresh- and spent-fuel safeguards measurements. The increased (α,n) production in oxide fuels from the 241 Am increases the uncertainty in coincidence assay of Pu in MOX assemblies and will require additional information to make use of totals-based neutron assay of these assemblies. We have studied the behavior of 241 Am-bearing MOX fuel in the fast reactor system and the effect on neutron and gamma-ray source-terms for safeguards measurements. In this paper, we will present the results of simulations of the behavior of 241 Am in a fast breeder reactor system. Because of the increased use of MOX fuel in thermal reactors and advances in fuel-cycle designs aimed at americium disposal in fast reactors, we have undertaken a brief study of the behavior of americium in these systems to better understand the safeguards impacts of these new approaches. In this paper we will examine the behavior of 241 Am in a variety of nuclear systems to provide insight into the safeguards implications of proposed Am disposition schemes.

  7. Plutonium and americium concentrations and vertical profiles in some Italian mosses used as bioindicators

    International Nuclear Information System (INIS)

    Testa, C.; Desideri, D.; Meli, M.A.; Guerra, F.; Degetto, S.; Jia, G.; Gerdol, R.

    1998-01-01

    We have examined the uptake of actinide elements Am and Pu by different species of lichen and moss collected in two locations (Urbino, Central Italy; Alps region, North-east Italy). Plutonium and americium were separated and determined by extraction chromatography, electrodeposition and alpha-spectrometry. This paper summarizes our results with a special emphasis on the vertical profiles of these actinides in two different species of mosses. Several 1-2 cm depth sections were obtained and dated by 210 Pb method. A typical peak for 239,240 Pu and 241 Am was found in the very old moss species ('Sphagnum Compactum') at a depth corresponding to the period 1960-1970 which was the period characterized by the maximum nuclear weapon tests. In a younger moss species ('Neckeria Crispa') no peak was observed and the regression curves showed that Am is more mobile than 239,240 Pu and 238 Pu. (author)

  8. Laboratory investigation of the role of desorption kinetics on americium transport associated with bentonite colloids.

    Science.gov (United States)

    Dittrich, Timothy Mark; Boukhalfa, Hakim; Ware, Stuart Douglas; Reimus, Paul William

    2015-10-01

    Understanding the parameters that control colloid-mediated transport of radionuclides is important for the safe disposal of used nuclear fuel. We report an experimental and reactive transport modeling examination of americium transport in a groundwater-bentonite-fracture fill material system. A series of batch sorption and column transport experiments were conducted to determine the role of desorption kinetics from bentonite colloids in the transport of americium through fracture materials. We used fracture fill material from a shear zone in altered granodiorite collected from the Grimsel Test Site (GTS) in Switzerland and colloidal suspensions generated from FEBEX bentonite, a potential repository backfill material. The colloidal suspension (100 mg L(-1)) was prepared in synthetic groundwater that matched the natural water chemistry at GTS and was spiked with 5.5 × 10(-10) M (241)Am. Batch characterizations indicated that 97% of the americium in the stock suspension was adsorbed to the colloids. Breakthrough experiments conducted by injecting the americium colloidal suspension through three identical columns in series, each with mean residence times of 6 h, show that more than 95% of the bentonite colloids were transported through each of the columns, with modeled colloid filtration rates (k(f)) of 0.01-0.02 h(-1). Am recoveries in each column were 55-60%, and Am desorption rate constants from the colloids, determined from 1-D transport modeling, were 0.96, 0.98, and 0.91 h(-1) in the three columns, respectively. The consistency in Am recoveries and desorption rate constants in each column indicates that the Am was not associated with binding sites of widely-varying strengths on the colloids, as one binding site with fast kinetics represented the system accurately for all three sequential columns. Our data suggest that colloid-mediated transport of Am in a bentonite-fracture fill material system is unlikely to result in transport over long distance scales because

  9. Molten salt extraction (MSE) of americium from plutonium metal in CaCl2-KCl-PuCl3 and CaCl2-PuCl3 salt systems

    International Nuclear Information System (INIS)

    Dodson, K.E.

    1992-01-01

    Molten salt extraction (MSE) of americium-241 from reactor-grade plutonium has been developed using plutonium trichloride salt in stationary furnaces. Batch runs with oxidized and oxide-free metal have been conducted at temperature ranges between 750 and 945C, and plutonium trichloride concentrations from one to one hundred mole percent. Salt-to-metal ratios of 0.10, 0.15, and 0 30 were examined. The solvent salt was either eutectic 74 mole percent CaCl 2 endash 26 mole percent KCl or pure CaCl 2 . Evidence of trivalent product americium, and effects of temperature, salt-to-metal ratio, and oxide contamination on the americium extraction efficiency are given. 24 refs, 20 figs, 13 tabs

  10. Higher Americium Oxidation State Research Roadmap

    Energy Technology Data Exchange (ETDEWEB)

    Mincher, Bruce J. [Idaho National Lab. (INL), Idaho Falls, ID (United States); Law, Jack D. [Idaho National Lab. (INL), Idaho Falls, ID (United States); Goff, George S. [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Moyer, Bruce A. [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Burns, Jon D. [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Lumetta, Gregg J. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Sinkov, Sergey I. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Shehee, Thomas C. [Savannah River Site (SRS), Aiken, SC (United States). Savannah River National Lab. (SRNL); Hobbs, David T. [Savannah River Site (SRS), Aiken, SC (United States). Savannah River National Lab. (SRNL)

    2015-12-18

    The partitioning of hexavalent Am from dissolved nuclear fuel requires the ability to efficiently oxidize Am(III) to Am(VI) and to maintain that oxidation state for a length of time sufficient to perform the separation. Several oxidants have been, or are being developed. Chemical oxidants include Ag-catalyzed ozone, Ag-catalyzed peroxydisulfate, Cu(III) periodate, and sodium bismuthate. Hexavalent americium has also now successfully been prepared by electrolysis, using functionalized electrodes. So-called auto-reduction rates of Am(VI) are sufficiently slow to allow for separations. However, for separations based on solvent extraction or ion exchange using organic resins, the high valence state must be maintained under the reducing conditions of the organic phase contact, and a holding oxidant is probably necessary. Until now, only Cu(III) periodate and sodium bismuthate oxidation have been successfully combined with solvent extraction separations. Bismuthate oxidation provided the higher DAm, since it acts as its own holding oxidant, and a successful hot test using centrifugal contactors was performed. For the other oxidants, Ag-catalyzed peroxydisulfate will not oxidize americium in nitric acid concentrations above 0.3 M, and it is not being further investigated. Peroxydisulfate in the absence of Ag catalysis is being used to prepare Am(V) in ion exchange work, discussed below. Preliminary work with Ag-catalyzed ozone has been unsuccessful for extractions of Am(VI) from 6.5 M HNO3, and only one attempt at extraction, also from 6.5 M HNO3, using the electrolytic oxidation has been attempted. However, this high acid concentration was based on the highest Am extraction efficiency using the bismuthate oxidant; which is only sparingly soluble, and thus the oxidation yield is based on bismuthate solubility. Lower acid concentrations may be sufficient with alternative oxidants and work with Ag-ozone, Cu(III) and electrolysis is on-going. Two non

  11. Americium/Curium Disposition Life Cycle Planning Study

    International Nuclear Information System (INIS)

    Jackson, W.N.; Krupa, J.; Stutts, P.; Nester, S.; Raimesch, R.

    1998-01-01

    At the request of the Department of Energy Savannah River Office (DOE- SR), Westinghouse Savannah River Company (WSRC) evaluated concepts to complete disposition of Americium and Curium (Am/Cm) bearing materials currently located at the Savannah River Site (SRS)

  12. Plutonium and Americium Geochemistry at Hanford: A Site Wide Review

    Energy Technology Data Exchange (ETDEWEB)

    Cantrell, Kirk J.; Felmy, Andrew R.

    2012-08-23

    This report was produced to provide a systematic review of the state-of-knowledge of plutonium and americium geochemistry at the Hanford Site. The report integrates existing knowledge of the subsurface migration behavior of plutonium and americium at the Hanford Site with available information in the scientific literature regarding the geochemistry of plutonium and americium in systems that are environmentally relevant to the Hanford Site. As a part of the report, key research needs are identified and prioritized, with the ultimate goal of developing a science-based capability to quantitatively assess risk at sites contaminated with plutonium and americium at the Hanford Site and the impact of remediation technologies and closure strategies.

  13. Americium/Curium Disposition Life Cycle Planning Study

    Energy Technology Data Exchange (ETDEWEB)

    Jackson, W.N. [Westinghouse Savannah River Company, AIKEN, SC (United States); Krupa, J.; Stutts, P.; Nester, S.; Raimesch, R.

    1998-04-30

    At the request of the Department of Energy Savannah River Office (DOE- SR), Westinghouse Savannah River Company (WSRC) evaluated concepts to complete disposition of Americium and Curium (Am/Cm) bearing materials currently located at the Savannah River Site (SRS).

  14. PROCESS FOR SEPARATING AMERICIUM AND CURIUM FROM RARE EARTH ELEMENTS

    Science.gov (United States)

    Baybarz, R.D.; Lloyd, M.H.

    1963-02-26

    This invention relates to methods of separating americium and curium values from rare earth values. In accordance with the invention americium, curium, and rare earth values are sorbed on an anion exchange resin. A major portion of the rare earth values are selectively stripped from the resin with a concentrated aqueous solution of lithium chloride, and americium, curium, and a minor portion of rare earth values are then stripped from the resin with a dilute aqueous solution of lithium chloride. The americium and curium values are further purified by increasing the concentration of lithium chloride in the solution to at least 8 molar and selectively extracting rare earth values from the resulting solution with a monoalkylphosphoric acid. (AEC)

  15. Aqueous Chloride Operations Overview: Plutonium and Americium Purification/Recovery

    Energy Technology Data Exchange (ETDEWEB)

    Gardner, Kyle Shelton [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Kimball, David Bryan [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Skidmore, Bradley Evan [Los Alamos National Lab. (LANL), Los Alamos, NM (United States)

    2016-09-28

    These are a set of slides intended for an information session as part of recruiting activities at Brigham Young University. It gives an overview of aqueous chloride operations, specifically on plutonium and americium purification/recovery. This presentation details the steps taken perform these processes, from plutonium size reduction, dissolution, solvent extraction, oxalate precipitation, to calcination. For americium recovery, it details the CLEAR (chloride extraction and actinide recovery) Line, oxalate precipitation and calcination.

  16. Decorporation of 241Am in beagles by DTPA

    International Nuclear Information System (INIS)

    Lloyd, R.D.; McFarland, S.S.; Taylor, G.N.; Williams, J.L.; Mays, C.W.

    1975-01-01

    Chelation treatments using daily subcutaneous injections of ZnNa 3 -DTPA were begun 2 wk after the intravenous administration of 0.3 μCi/kg 241 Am citrate to six female beagles averaging 505 days of age. Retention of americium in the liver and in non-liver tissue (mainly skeleton) was followed serially in the living dogs by a combination of total-body and partial-body counting. During the first 13 mo of DTPA therapy, the removal of 241 Am from two dogs given one DTPA injection each day of 0.027 or 0.034 mmole/kg was similar to the fraction removed from two other dogs given a similar total of 0.035 or 0.037 mmole/kg/day in five fractionated injections each day. Increasing the daily amount of DTPA to 0.36 and 5.0 mmole/kg/day in the two remaining dogs only slightly increased the removal of 241 Am. At the beginning of chelation therapy, all six dogs averaged 43 percent of the injected 241 Am in the liver and 46 percent in nonliver tissue. 241 Am retention in liver at 2 mo of therapy was about 2 percent of pretreatment liver retention, decreased to roughly 1 percent of pretreatment retention by 5 mo of DTPA administration, and was undetectable at 13 months. Nonliver retention at 2 mo was 53 percent of pretreatment retention in nonliver tissue, at 5 mo averaged about 40 percent, and had decreased to 27 percent of pretreatment values by 13 mo of chelation therapy. In contrast, for beagles of our colony not treated with DTPA, 241 Am in the liver and in nonliver tissue exhibited a biological half-time in the order of 10 yr. (U.S.)

  17. Hanford Single-Shell Tank Leak Causes and Locations - 241-U Farm

    Energy Technology Data Exchange (ETDEWEB)

    Girardot, Crystal L.; Harlow, Donald G.

    2013-12-02

    This document identifies 241-U Tank Farm (U Farm) leak causes and locations for the 100 series leaking tanks (241-U-104, 241-U-110, and 241-U-112) identified in RPP-RPT-50097, Rev. 0, Hanford 241-U Farm Leak Inventory Assessment Report. This document satisfies the U-Farm portion of the target (T04) in the Hanford Federal Facility Agreement and Consent Order milestone M-045-91F.

  18. Americium and plutonium in water, biota, and sediment from the central Oregon coast

    Energy Technology Data Exchange (ETDEWEB)

    Nielsen, Reinald Dreas [Oregon State Univ., Corvallis, OR (United States)

    1982-06-01

    Plutonium-239, 240 and americium-241 were measured in the mussel Mytilus californianus from the region of Coos Bay, OR. The flesh of this species has a plutonium concentration of about 90 fCi/kg, and an Am-241/Pu-239, 240 ratio that is high relative to mixed fallout, ranging between two and three. Transuranic concentrations in sediment, unfiltered water, and filterable particulates were also measured; none of these materials has an Am/Pu ratio as greatly elevated as the mussels, and there is no apparent difference in the Am/Pu ratio of terrestrial runoff and coastal water. Sediment core profiles do not allow accumulation rates or depositional histories to be identified, but it does not appear that material characterized by a high Am/Pu ratio has ever been introduced to this estuary. Other bivalves (Tresus capax and Macoma nasuta) and a polychaete (Abarenicola sp.) do not have an elevated Am/Pu ratio, although the absolute activity of plutonium in the infaunal bivalves is roughly four times that in the mussels.

  19. Americium and plutonium in water, biota, and sediment from the central Oregon coast

    International Nuclear Information System (INIS)

    Nielsen, R.D.

    1982-06-01

    Plutonium-239, 240 and americium-241 were measured in the mussel Mytilus californianus from the region of Coos Bay, OR. The flesh of this species has a plutonium concentration of about 90 fCi/kg, and an Am-241/Pu-239, 240 ratio that is high relative to mixed fallout, ranging between two and three. Transuranic concentrations in sediment, unfiltered water, and filterable particulates were also measured; none of these materials has an Am/Pu ratio as greatly elevated as the mussels, and there is no apparent difference in the Am/Pu ratio of terrestrial runoff and coastal water. Sediment core profiles do not allow accumulation rates or depositional histories to be identified, but it does not appear that material characterized by a high Am/Pu ratio has ever been introduced to this estuary. Other bivalves (Tresus capax and Macoma nasuta) and a polychaete (Abarenicola sp.) do not have an elevated Am/Pu ratio, although the absolute activity of plutonium in the infaunal bivalves is roughly four times that in the mussels

  20. Validation of Am-241 measurement in ion chamber type smoke detector by using gamma spectrometry system

    International Nuclear Information System (INIS)

    Yii Mei Wo; Khairul Nizam Razali

    2005-01-01

    Smoke detectors are useful devices in modern days that able to save many lives. Even though, the use of ion chamber type smoke detector (usually contain Americium-241) was exempted in Malaysia, but the trading of this device was controlled by regulation, under the Atomic Energy Licensing Act (Act 304). The activity of the Am-241 can be measured by using the Gamma Spectrometry System since it was much easier, compared to Alpha Spectrometry System. To do so, the system was first need to be calibrated using the standard reference source to find the efficiency of the germanium detector. The method used for the measurement was first validated for several relevant parameters, which include specificity, precision (repeatability), bias (accuracy), linearity, working range, detection limit, robustness and ruggedness to ensure it was fit for the purpose. The measured Am-241 activity inside the smoke detector will be reported together with a reasonable expanded uncertainty arise from the measurement. (Author)

  1. Liver cancer induction by 241Am and thorotrast in deer mice and grasshopper mice

    International Nuclear Information System (INIS)

    Taylor, G.N.; Mays, C.W.; Lloyd, R.D.; Jones, C.W.; Rojas, J.; Wrenn, M.E.; Ayoroa, G.; Kaul, A.; Riedel, W.

    1986-01-01

    The carcinogenicity of 241 Am, relative to thorotrast, has been determined in two species of mice: the grasshopper mouse (Onychomys leucogaster) and the deer mouse (Peromyscus maniculatus). These species were used since both have high uptakes of Pu and Am and, unlike conventional mice and rats, both retain relatively high concentrations of plutonium and americium in their livers. The study indicated that the liver carcinogenicity of comparable rad doses of 241 Am or thorotrast is approximately equal. The toxicity ratio ( 241 Am/thorotrast) for liver cancer induction approximated 1.2 with a range of about 0.6 to 1.6. This suggested that nonradiation factors of thorotrast were not significant in liver tumor induction. (orig.)

  2. Physics of plutonium and americium recycling in PWR using advanced fuel concepts

    International Nuclear Information System (INIS)

    Hourcade, E.

    2004-01-01

    PWR waste inventory management is considered in many countries including Frances as one of the main current issues. Pu and Am are the 2 main contents both in term of volume and long term radio-toxicity. Waiting for the Generation IV systems implementation (2035-2050), one of the mid-term solutions for their transmutation involves the use of advanced fuels in Pressurized Water Reactors (PWR). These have to require as little modification as possible of the core internals, the cooling system and fuel cycle facilities (fabrication and reprocessing). The first part of this paper deals with some neutronic characteristics of Pu and/or Am recycling. In a second part, 2 technical solutions MOX-HMR and APA-DUPLEX-84 are presented and the third part is devoted to the study of a few global strategies. The main neutronic parameters to be considered for Pu and Am recycling in PWR are void coefficient, Doppler coefficient, fraction of delayed neutrons and power distribution (especially for heterogeneous configurations). The modification of the moderation ratio, the opportunity to use inert matrices (targets), the optimisation of Uranium, Plutonium and Americium contents are the key parameters to play with. One of the solutions (APA-DUPLEX-84) presented here is a heterogeneous assembly with regular moderation ratio composed with both target fuel rods (Pu and Am embedded in an inert matrix) and standard UO 2 fuel rods. An EPR (European Pressurised Reactor) type reactor, loaded only with assemblies containing 84 peripheral targets, can reach an Americium consumption rate of (4.4; 23 kg/TWh) depending on the assembly concept. For Pu and Am inventories stabilisation, the theoretical fraction of reactors loaded with Pu + Am or Pu assemblies is about 60%. For Americium inventory stabilisation, the fraction decreases down to 16%, but Pu is produced at a rate of 18.5 Kg/TWh (-25% compared to one through UOX cycle)

  3. Citric complexes, neodymium citrate and americium citrate

    International Nuclear Information System (INIS)

    Bouhlassa, Saidati.

    1981-06-01

    The behaviour of neodymium and americium has been studied in citric aqueous medium by two methods: solvent extraction of elements at tracer scale as chelates and by potentiometry. So range of pH and concentrations of elements and citric acid never reached before have been explored: 10 -7 -1 M, 10 -10 -3 , Csub(H3 Cit) -1 M, 1 2 O; AmCit, xH 2 O; NdCit 2 Co(NH 3 ) 6 , 8H 2 O; AmCit 2 Co(NH 3 ) 6 , xH 2 O and Nd 3 (OH) 4 (Cit) 4 NH 4 (Co(NH 3 ) 6 ) 2 , 18H 2 O. Their spectroscopic and crystallographic characteristics have been listed and studied. The nephelauxetic effect has been estimated from citric complexes as well as from citrates of these elements. The structure of the complexes in solution has been discussed on the basis of analysis of hypersensitive transition in different complexes [fr

  4. Routine radiochemical method for the determination of 90Sr, 238Pu, 239+240Pu, 241Am and 244Cm in environmental samples

    International Nuclear Information System (INIS)

    Ageyev, V.A.; Sajeniouk, A.D.

    2005-01-01

    Routine analytical procedures have been developed for the reliable simultaneous determination of 90 Sr, 238 Pu, 239+240 Pu, 241 Am and 242-244 Cm, Chernobyl derived radioisotopes and fallout after nuclear weapon tests in a wide range of environmental samples: soil (100-200 g), sediments, aerosols, water and vegetation. This procedure has been applied to thousands of soil and sediment samples and hundreds of biological and water samples taken in the exclusive zone of Chernobyl NPP and different regions of Ukraine from 1989 to the present. After the sample has been properly prepared and isotopic tracers added, plutonium, americium and curium are precipitated with calcium oxalate and then lanthanum fluoride. Plutonium is separated from americium and curium by anion-exchange. Americium and curium are separated from rare earths by cation-exchange with gradient elute α-hydroxy-iso-butyric acid. During projects by AQCS IAEA 'Evaluation of Methods for 90 Sr in a Mineral Matrix' and 'Proficiency Test for 239 Pu, 241 Pu and 241 Am Measurement in a Mineral Matrix' accuracy and precision for 90 Sr, 239 Pu and 241 Am by present procedure was evaluated. Advantages, difficulties and limitations of the method are discussed. (author)

  5. A process for the recovery of americium from analytical wastes

    International Nuclear Information System (INIS)

    Brossard, P.; Kwinta, J.; Schwander, Y.

    1984-12-01

    The object of the present work is to define a procedure for the extraction of americium contained in hundreds of liters of liquid analytical wastes. The main objective is to produce wastes for which the americium concentration is lower than 0,5 mg/l, the operations being carried out in glove boxes. Dihexyl N, N-diethylcarbamylmethylene phosphonate (DHDECMP) is used for the extraction of americium. Experimental laboratory results and procedure design are described. Distribution coefficient, DHDECMP concentration, addition of TBP, influence of PH and temperature are studied. A bank of mixer-settlers appears to be the most appropriate laboratory equipment to handle large volume of solution with a good efficiency

  6. The selective extraction of americium from high level liquid wastes

    Energy Technology Data Exchange (ETDEWEB)

    Adnet, J.M.; Donnet, L.; Brossard, P.; Bourges, J.

    1996-12-31

    One of the possible ways selected by CEA for the partitioning of minor actinides from solutions containing fission products is the selective extraction of the oxidized species. This papers deals with the latest developments in the electrochemical oxidation of americium in nitric media to the oxidation states (IV) and (VI). Oxidized americium is generated and stabilized through the use of poly anionic ligands such as the phospho tungstate. With in view the use of such ligands in the treatment of real liquid wastes, the complexation of several metallic ions has been investigated A first experiment done with a real liquid waste to prove the possibility to selectively extract the oxidized americium is presented. (authors). 8 refs.

  7. Synergistic extraction behaviour of americium from simulated acidic waste solutions

    International Nuclear Information System (INIS)

    Pathak, P.N.; Veeraraghavan, R.; Mohapatra, P.K.; Manchanda, V.K.

    1998-01-01

    The extraction behaviour of americium has been investigated with mixtures of 3-phenyl-4-benzoyl-5-isoxazolone (PBI) and oxodonors viz. tri-n-butyl phosphate (TBP), tri-n-octyl phosphine oxide (TOPO) and di-n-butyl octanamide (DBOA) using dodecane as the diluent from 1-6 M HNO 3 media. It is observed that D Am remains unaltered with PBI concentration (in the range 0.06-0.1 M) at 1.47 M TBP in the entire range of HNO 3 concentration. PBI and TBP in combination appears more promising compared to other synergistic systems. The possibility of using this mixture for americium removal from high level liquid waste solution has been explored. Extraction studies indicated that prior removal of uranium by 20% TBP in dodecane is helpful in the quantitative recovery of americium in three contacts. Effect of lanthanides on D Am is found to be marginal. (orig.)

  8. Covalency in Americium(III) Hexachloride.

    Science.gov (United States)

    Cross, Justin N; Su, Jing; Batista, Enrique R; Cary, Samantha K; Evans, William J; Kozimor, Stosh A; Mocko, Veronika; Scott, Brian L; Stein, Benjamin W; Windorff, Cory J; Yang, Ping

    2017-06-28

    Developing a better understanding of covalency (or orbital mixing) is of fundamental importance. Covalency occupies a central role in directing chemical and physical properties for almost any given compound or material. Hence, the concept of covalency has potential to generate broad and substantial scientific advances, ranging from biological applications to condensed matter physics. Given the importance of orbital mixing combined with the difficultly in measuring covalency, estimating or inferring covalency often leads to fiery debate. Consider the 60-year controversy sparked by Seaborg and co-workers ( Diamond, R. M.; Street, K., Jr.; Seaborg, G. T. J. Am. Chem. Soc. 1954 , 76 , 1461 ) when it was proposed that covalency from 5f-orbitals contributed to the unique behavior of americium in chloride matrixes. Herein, we describe the use of ligand K-edge X-ray absorption spectroscopy (XAS) and electronic structure calculations to quantify the extent of covalent bonding in-arguably-one of the most difficult systems to study, the Am-Cl interaction within AmCl 6 3- . We observed both 5f- and 6d-orbital mixing with the Cl-3p orbitals; however, contributions from the 6d-orbitals were more substantial. Comparisons with the isoelectronic EuCl 6 3- indicated that the amount of Cl 3p-mixing with Eu III 5d-orbitals was similar to that observed with the Am III 6d-orbitals. Meanwhile, the results confirmed Seaborg's 1954 hypothesis that Am III 5f-orbital covalency was more substantial than 4f-orbital mixing for Eu III .

  9. Fabrication of uranium–americium mixed oxide pellet from microsphere precursors: Application of CRMP process

    Energy Technology Data Exchange (ETDEWEB)

    Remy, E. [Radiochemistry and Processes Department, CEA, Nuclear Energy Division, F-30207 Bagnols-sur-Cèze (France); Picart, S., E-mail: sebastien.picart@cea.fr [Radiochemistry and Processes Department, CEA, Nuclear Energy Division, F-30207 Bagnols-sur-Cèze (France); Delahaye, T. [Fuel Cycle Technology Department, CEA, Nuclear Energy Division, F-30207 Bagnols-sur-Cèze (France); Jobelin, I. [Radiochemistry and Processes Department, CEA, Nuclear Energy Division, F-30207 Bagnols-sur-Cèze (France); Lebreton, F.; Horlait, D. [Fuel Cycle Technology Department, CEA, Nuclear Energy Division, F-30207 Bagnols-sur-Cèze (France); Bisel, I. [Radiochemistry and Processes Department, CEA, Nuclear Energy Division, F-30207 Bagnols-sur-Cèze (France); Blanchart, P. [Heterogeneous Materials Research Group, Centre Européen de la Céramique, F-87068 Limoges (France); Ayral, A. [Institut Européen des Membranes, CNRS-ENSCM-UM2, CC47, University Montpellier 2, F-34095 Montpellier cedex 5 (France)

    2014-10-15

    Highlights: • Dust free process for (U,Am)O{sub 2} transmutation target fabrication. • Synthesis of U{sub 0.9}Am{sub 0.1}O{sub 2} mixed oxide microspheres from ion exchange resin. • Fabrication of dense U{sub 0.9}Am{sub 0.1}O{sub 2} pellet with 95% TD from mixed oxide microspheres. - Abstract: Mixed uranium–americium oxides are one of the materials envisaged for Americium Bearing Blankets dedicated to transmutation in fast neutron reactors. Recently, several processes have been developed in order to validate fabrication flowchart in terms of material specifications such as density and homogeneity but also to suggest simplifications for lowering industrial costs and hazards linked to dust generation of highly contaminating and irradiating compounds. This study deals with the application of an innovative route using mixed oxide microspheres obtained from metal loaded resin bead calcination, called Calcined Resin Microsphere Pelletization (CRMP). The synthesis of mixed oxide microsphere precursor of U{sub 0.9}Am{sub 0.1}O{sub 2±δ} is described as well as its characterisation. The use of this free-flowing precursor allows the pressing and sintering of one pellet of U{sub 0.9}Am{sub 0.1}O{sub 2±δ}. The ceramic obtained was characterised and results showed that its microstructure is dense and homogeneous and its density attains 95% of the theoretical density. This study validates the scientific feasibility of the CRMP process applied to the fabrication of uranium and americium-containing materials.

  10. Test plan for headspace gas concentration measurement and headspace ventilation rate measurement for DCRTs 241-A-244, 241-BX-244, 241-S-244, 241-TX-244

    International Nuclear Information System (INIS)

    Bauer, R.E.

    1998-01-01

    This test plan provides the directions to characterize the headspace gas concentrations and the headspace ventilation rate for double contained receiver tanks 241-A-244, 241-BX-244, 241-S-244, and 241-TX-244

  11. 1976 Hanford americium exposure incident: overview and perspective

    International Nuclear Information System (INIS)

    Thompson, R.C.

    1982-01-01

    Salient features of the 1976 Hanford americium exposure incident are discussed. Comparisons are made with previous human and animal exposure data, and conclusions drawn relative to the injured workman, to health physics practices, and to the adequacy of current exposure limits

  12. Determination of plutonium, americium and curium in the marine environment

    International Nuclear Information System (INIS)

    Grenaut, CLaude; Germain, Pierre; Miramand, Pierre.

    1982-01-01

    The method used in the Laboratory for plutonium, americium and curium determination in marine samples (water, sediments, animals, plants) is presented. It is a modification of a procedure based on adsorption on ion exchange resins developed by other authors. The preliminary preparation of the samples, the radiochemical procedures and electrodeposition are described so as to be used as a practical handbook [fr

  13. Hanford Single-Shell Tank Leak Causes and Locations - 241-T Farm

    Energy Technology Data Exchange (ETDEWEB)

    Girardot, Crystal L.; Harlow, Donald G.

    2014-05-15

    This document identifies 241-T Tank Farm (T Farm) leak causes and locations for the 100 series leaking tanks (241-T-106 and 241-T-111) identified in RPP-RPT-55084, Rev. 0, Hanford 241-T Farm Leak Inventory Assessment Report. This document satisfies the T Farm portion of the target (T04) in the Hanford Federal Facility Agreement and Consent Order milestone M-045-91F.

  14. Hanford Single Shell Tank Leak Causes and Locations - 241-TX Farm

    Energy Technology Data Exchange (ETDEWEB)

    Girardot, C. L.; Harlow, D> G.

    2014-07-22

    This document identifies 241-TX Tank Farm (TX Farm) leak causes and locations for the 100 series leaking tanks (241-TX-107 and 241-TX-114) identified in RPP-RPT-50870, Rev. 0, Hanford 241-TX Farm Leak Inventory Assessment Report. This document satisfies the TX Farm portion of the target (T04) in the Hanford Federal Facility Agreement and Consent Order milestone M-045-91F.

  15. Reduction Rates for Higher Americium Oxidation States in Nitric Acid

    Energy Technology Data Exchange (ETDEWEB)

    Grimes, Travis Shane [Idaho National Lab. (INL), Idaho Falls, ID (United States); Mincher, Bruce Jay [Idaho National Lab. (INL), Idaho Falls, ID (United States); Schmitt, Nicholas C [Idaho National Lab. (INL), Idaho Falls, ID (United States)

    2015-09-30

    The stability of hexavalent americium was measured using multiple americium concentrations and nitric acid concentrations after contact with the strong oxidant sodium bismuthate. Contrary to our hypotheses Am(VI) was not reduced faster at higher americium concentrations, and the reduction was only zero-order at short time scales. Attempts to model the reduction kinetics using zero order kinetic models showed Am(VI) reduction in nitric acid is more complex than the autoreduction processes reported by others in perchloric acid. The classical zero-order reduction of Am(VI) was found here only for short times on the order of a few hours. We did show that the rate of Am(V) production was less than the rate of Am(VI) reduction, indicating that some Am(VI) undergoes two electron-reduction to Am(IV). We also monitored the Am(VI) reduction in contact with the organic diluent dodecane. A direct comparison of these results with those in the absence of the organic diluent showed the reduction rates for Am(VI) were not statistically different for both systems. Additional americium oxidations conducted in the presence of Ce(IV)/Ce(III) ions showed that Am(VI) is reduced without the typical growth of Am(V) observed in the systems sans Ce ion. This was an interesting result which suggests a potential new reduction/oxidation pathway for Am in the presence of Ce; however, these results were very preliminary, and will require additional experiments to understand the mechanism by which this occurs. Overall, these studies have shown that hexavalent americium is fundamentally stable enough in nitric acid to run a separations process. However, the complicated nature of the reduction pathways based on the system components is far from being rigorously understood.

  16. Kinetics and mechanism of oxidation of americium(III) to americium(VI) in dilute phosphoric acid solutions

    International Nuclear Information System (INIS)

    Milyukova, M.S.; Litvina, M.N.; Myasoedov, B.F.

    1980-01-01

    The reaction between trivalent americium and a mixture of silver with ammonium persulfate in 0.1-3M H 3 PO 4 solutions was studied. Hexavalent americium was found to be the product of interaction under these conditions. Americium oxidation is described with a first order equation with rate constants k=18.7 hr -1 and k=8.74 hr -1 for 0.1-0.5M and 1M H 3 PO 4 , respectively. The activation energy calculated from the temperature dependence of the rate of americium oxidation by a mixture of Ag 3 PO 4 with (NH 4 ) 2 S 2 O 8 is 9.1 kcal/mole. The stability of Am(VI) in 0.1-1M H 3 PO 4 was studied. No reduction of Am(VI) over a period of 30-40 hrs was observed; after that the reduction of Am(VI) follows a zero order law with the apparent rate constant k=0.0036 hr -1 . The mechanism of Am(III) oxidation with a mixture of silver and ammonium persulfate is discussed. (author)

  17. Observations on the redistribution of plutonium and americium in the Irish Sea sediments, 1978 to 1996: concentrations and inventories

    International Nuclear Information System (INIS)

    Kershaw, P.J.; Denoon, D.C.; Woodhead, D.S.

    1999-01-01

    The distribution of plutonium and americium in the sub-tidal sediments of the Irish Sea is described following major surveys in 1978, 1983, 1988 and 1995. Concentrations in surface sediments have declined near the source at Sellafield since 1988. Time-series of inter-tidal surface sediment concentrations are presented from 1977 onwards, revealing the importance of sediment reworking and transport in controlling the evolution of the environmental signal. The surface and near-surface sediments, in the eastern Irish Sea 'mud-patch', are generally well mixed with respect to Pu (α) and 241 Am distributions but show increasing variability with depth - up to 4 orders of magnitude in concentration. The inventories of 239,240 Pu and 241 Am in the sub-tidal sediments have been estimated and compared with the reported decay-corrected discharges. These amounted to 360 and 545 TBq respectively, in 1995, about 60% of the total decay-corrected discharge. Part of the unaccounted fraction may be due to unrepresentative sampling of the seabed. It is speculated that some tens of TBq of plutonium and 241 Am reside undetected in the large volumes of coarse-grained, sub-tidal and inter-tidal sediment which characterise much of the Irish Sea. This has been due to the inability of the available corers to penetrate to the base of contamination in these mobile sediments. Further observations are needed to verify and quantify the missing amount. A budget of plutonium-α and 241 Am has been estimated based on published observations in the three main compartments: water column, sub-tidal and inter-tidal sediments. This amounts to 460-540 TBq and 575-586 TBq respectively, or 64-75% and 60-61%, of the decay-corrected reported discharge. (Copyright (c) 1999 Elsevier Science B.V., Amsterdam. All rights reserved.)

  18. 1976 Hanford Americium exposure incident: hematologic effects

    International Nuclear Information System (INIS)

    Ragan, H.A.; Mahaffey, J.A.; Breitenstein, B.D.

    1982-05-01

    Hematologic evaluation of an individual with an initial systemic body burden of approx. 200 μCi 241 Am revealed a significant (P < 0.01) reduction of total leukocytes, neutrophils, and lymphocytes. This effect on total leukocytes and neutrophils was evident approx. 30 days after exposure, appeared to stabilize at about 3 months after exposure, and remained at this lower level thorugh a 52-months observation period. The effect on lymphocytes was apparent by 3 days after exposure, stabilizing at approx. 50% of pre-exposure values for about 7 months, with a return to pre-exposure levels in the following 4 y. There was a progressive and significant (P < 0.001) decline in platelet counts during the 52-months postexposure period. The pattern of response in erythrocyte parameters was complex. Immediately after the accident, these values were less than the pre-exposure mean level; they gradually increased (P < 0.001) for approx. 2 y and then began a progressive decline (P < 0.001)

  19. Americium extraction by alkylpyrocatechin from alkaline salt solutions

    International Nuclear Information System (INIS)

    Karalova, Z.K.; Rodionova, L.M.; Myasoedov, B.F.

    1984-01-01

    Effect of iron, aluminium, calcium, and sodium nitrates on americium extraction by 0.1 mol/l DOP solution [4-(α-α dioctylethyl) pyrocatechin] in toluene from a mixture of 2 mol/l NaOH with 0.1 mol/l EDTA has been investigated. It has been shown that americium extraction does not change essen-- tially in the presence of salts that permits to use DOP for Am extraction from alkaline solutions in the presence of outside salts. Verification of the above method of extraction of radioactive isotopes has been carried out. According to the data obtained double extraction provides a preparation of alkaline solutions practically free from radioactive isotopes. DOP application for Am extraction from alkaline salt solutions allows one to carry out repeated Am concentration and separation from accompanying elements. Conditions, under which Fe(3)-Am(3) pair separation coefficient achieves nx10 2 -10 4 , have been found out

  20. Contribution to the study of higher valency states of americium

    International Nuclear Information System (INIS)

    Langlet, Jean.

    1976-01-01

    Study of the chemistry of the higher valencies of americium in aqueous solutions and especially the autoreduction phenomenon. First a purification method of americium solutions is studied by precipitation, solvent extraction and ion exchange chromatography. Studies of higher valency states chemical properties are disturbed by the autoreduction phenomenon changing Am VI and Am V in Am III more stable. Stabilization of higher valency states, characterized by a steady concentration of Am VI in solution, can be done by complexation of Am VI and Am V ions or by a protecting effect of foreign ions. The original medium used has a complexing effect by SO 4 2- ions and a protecting effect by the system S 2 O 8 2- -Ag + consuming H 2 O 2 main reducing agent produced by water radiolysis. These effects are shown by the study of Am VI in acid and basic solutions. A mechanism of the stabilization effect is given [fr

  1. Method for removal of plutonium impurity from americium oxides and fluorides

    Science.gov (United States)

    FitzPatrick, J.R.; Dunn, J.G.; Avens, L.R.

    1987-02-13

    Method for removal of plutonium impurity from americium oxides and fluorides. AmF/sub 4/ is not further oxidized to AmF/sub 6/ by the application of O/sub 2/F at room temperature thereto, while plutonium compounds present in the americium sample are fluorinated to volatile PuF/sub 6/, which can readily be separated therefrom, leaving the purified americium oxides and/or fluorides as the solid tetrafluoride thereof.

  2. Research program on development of advanced treatment technology for americium-containing aqueous waste in NUCEF

    International Nuclear Information System (INIS)

    Mineo, Hideaki; Matsumura, Tatsuro; Tsubata, Yasuhiro

    1996-10-01

    A research program was prepared on the development of an advanced treatment process for the americium-containing concentrated aqueous waste in NUCEF, than allows americium recovery for the reuse and the reduction of TRU waste generation. A preliminary analysis was conducted on the separation requirements based on the components estimated for the waste. An R and D strategy was proposed from the view to reduce TRU waste generated in the processing that the highest priority is given on the control of TRU leakage such as americium into the effluent stream after americium recovery and the minimization of salt used in the separation over the decontamination of impurities from americium. The extraction chromatographic method was selected as a candidate technology for americium separation under the principle to use reagents that are functional in acidic conditions such as bidentate extractants of DHEDECMP, CMPO or diamides, considering the larger flexibilities in process modification and possible multi-component separation with compact equipment and the past achievements on the recovery of kg quantities of americium. Major R and D items extracted are screening and evaluation of extractants for americium and plutonium, optimization of separation conditions, selection of denitration method, equipment developments and development of solidification methods of discarded americium after reuse and of various kinds of separation residues. In order to cope these items, four steps of R and D program were proposed, i.e., fundamental experiment in beaker-scale on screening and evaluation of extractants, flowsheet study in bench-scale using simulated and small amount of americium aqueous waste solution to evaluate candidate process, americium recovery test in iron-shielded cell to be installed in NUCEF. It is objected to make recovery of 100g orders of americium used for research on fundamental TRU fuel properties. (J.P.N.)

  3. Ingestion Pathway Transfer Factors for Plutonium and Americium

    Energy Technology Data Exchange (ETDEWEB)

    Blanchard, A.

    1999-07-28

    Overall transfer factors for major ingestion pathways are derived for plutonium and americium. These transfer factors relate the radionuclide concentration in a given foodstuff to deposition on the soil. Equations describing basic relationships consistent with Regulatory Guide 1.109 are followed. Updated values and coefficients from IAEA Technical Reports Series No. 364 are used when a available. Preference is given to using factors specific to the Savannah River Site.

  4. Ingestion Pathway Transfer Factors for Plutonium and Americium

    International Nuclear Information System (INIS)

    Blanchard, A.

    1999-01-01

    Overall transfer factors for major ingestion pathways are derived for plutonium and americium. These transfer factors relate the radionuclide concentration in a given foodstuff to deposition on the soil. Equations describing basic relationships consistent with Regulatory Guide 1.109 are followed. Updated values and coefficients from IAEA Technical Reports Series No. 364 are used when a available. Preference is given to using factors specific to the Savannah River Site

  5. Gut uptake factors for plutonium, americium and curium

    International Nuclear Information System (INIS)

    Harrison, J.D.

    1982-01-01

    Data on estimates of the absorption of plutonium, americium and curium from the human gut based on measurements of uptake in other mammalian species are reviewed. It is proposed that for all adult members of the public ingesting low concentrations of plutonium in food and water, 0.05% would be an appropriate value of absorption except when the conditions of exposure are known and a lower value can be justified. For dietary intakes of americium and curium, the available data do not warrant a change from the ICRP value of 0.05%. For newborn children ingesting americium, curium and soluble forms of plutonium, a value of 1% absorption is proposed for the first 3 months of life during which the infant is maintained on a milk diet. It is proposed that a value of 0.5% should be used for the first year of life to take account of the gradual maturation of the gut. In considering the ingestion of insoluble oxides of plutonium by infants, it is proposed that absorption is taken as 0.1% for the first 3 months and 0.05% for the first year. (author)

  6. Gastrointestinal absorption of americium in rats: effect of citrate concentration

    International Nuclear Information System (INIS)

    Inaba, J.; Ishigure, N.; Oghiso, Y.; Sato, H.

    1994-01-01

    The gastrointestinal absorption of 241 Am was studied in relation to the amount of sodium citrate administered with it. Fasted Wistar strain female rats received 241 Am orally in sodium citrate solution of various concentrations and 5 days after administration animals were sacrificed and the retention and distribution of 241 Am was studied. The results indicated that the f 1 value was very high at about 10% of administered activity when 241 Am was given to fasted rats with a large amount of sodium citrate. (author)

  7. Chemical compatibility of tank wastes in tanks 241-C-106, 241-AY-101, and 241-AY-102. Revision 1

    Energy Technology Data Exchange (ETDEWEB)

    Sederburg, J.P.

    1994-05-04

    This report documents the chemical compatibility of waste types within tanks 241-C-106, 241-AY-101, and 241-AY-102. This information was compiled to facilitate the transfer of tank 241-C-106 waste to tank 241-AY-102 utilizing supernatant from tank 241-AY-101 as the sluicing medium. This document justifies that no chemical compatibility safety issues currently understood, or theorized from thermodynamic modeling, will result from the intended sluice transfer operation.

  8. Extraction of pentavalent americium by di(2-ethylhexyl)phosphoric acid

    International Nuclear Information System (INIS)

    Molochnikova, N.P.; Myasoedov, B.F.; Frenkel, V.Ya.

    1983-01-01

    Conditions have been found for the extraction of americium(V) by HDEHP in octane from acetate buffer solutions at pH 4.5-5.0 in the presence of ammonium persulphate which was necessary to stabilize oxidized americium under these conditions. The effect of the nature of a solvent on the extraction coefficient of americium(V) was studied. Macroamounts of americium(V) were extracted by 0.5M HDEHP in octane. The absorption spectrum of americium(V) in the extract has been recorded. The stability of americium(V) in the organic phase was evaluated. The absence of interfering influence of the anions of phosphotungstic acids on the extraction of americium(V) by 0.5M HDEHP in octane makes it possible to separate americium(V) from trivalent actinides during one extraction from acetate solutions at pH 4.5-5.0 in the presence of 10 -3 M potassium phosphotungstate; the separation factor is about 10 3 . (author)

  9. Robotic sample preparation for radiochemical plutonium and americium analyses

    International Nuclear Information System (INIS)

    Stalnaker, N.; Beugelsdijk, T.; Thurston, A.; Quintana, J.

    1985-01-01

    A Zymate robotic system has been assembled and programmed to prepare samples for plutonium and americium analyses by radioactivity counting. The system performs two procedures: a simple dilution procedure and a TTA (xylene) extraction of plutonium. To perform the procedures, the robotic system executes 11 unit operations such as weighing, pipetting, mixing, etc. Approximately 150 programs, which require 64 kilobytes of memory, control the system. The system is now being tested with high-purity plutonium metal and plutonium oxide samples. Our studies indicate that the system can give results that agree within 5% at the 95% confidence level with determinations performed manually. 1 ref., 1 fig., 1 tab

  10. Implications of plutonium and americium recycling on MOX fuel fabrication

    International Nuclear Information System (INIS)

    Renard, A.; Pilate, S.; Maldague, Th.; La Fuente, A.; Evrard, G.

    1995-01-01

    The impact of the multiple recycling of plutonium in power reactors on the radiation dose rates is analyzed for the most critical stage in a MOX fuel fabrication plant. The limitation of the number of Pu recycling in light water reactors would rather stem from reactor core physics features. The case of recovering americium with plutonium is also considered and the necessary additions of shielding are evaluated. A comparison between the recycling of Pu in fast reactors and in light water reactors is presented. (author)

  11. Hanford Single-Shell Tank Leak Causes and Locations - 241-C Farm

    Energy Technology Data Exchange (ETDEWEB)

    Girardot, Crystal L.; Harlow, Donald G.

    2013-07-30

    This document identifies 241-C Tank Farm (C Farm) leak causes and locations for the 100 series leaking tanks (241-C-101 and 241-C-105) identified in RPP-RPT-33418, Rev. 2, Hanford C-Farm Leak Inventory Assessments Report. This document satisfies the C Farm portion of the target (T04) in the Hanford Federal Facility Agreement and Consent Order milestone M-045-91F.

  12. Hanford Single-Shell Tank Leak Causes and Locations - 241-A Farm

    Energy Technology Data Exchange (ETDEWEB)

    Girardot, Crystal L.; Harlow, Donald G.

    2013-09-10

    This document identifies 241-A Tank Farm (A Farm) leak causes and locations for the 100 series leaking tanks (241-A-104 and 241-A-105) identified in RPP-ENV-37956, Hanford A and AX Farm Leak Assessment Report. This document satisfies the A Farm portion of the target (T04) in the Hanford Federal Facility Agreement and Consent Order milestone M-045-91F.

  13. Analysis of americium, plutonium and technetium solubility in groundwater

    Energy Technology Data Exchange (ETDEWEB)

    Takeda, Seiji [Japan Atomic Energy Research Inst., Tokai, Ibaraki (Japan). Tokai Research Establishment

    1999-08-01

    Safety assessments for geologic disposal of radioactive waste generally use solubilities of radioactive elements as the parameter restricting the dissolution of the elements from a waste matrix. This study evaluated americium, plutonium and technetium solubilities under a variety of geochemical conditions using the geochemical model EQ3/6. Thermodynamic data of elements used in the analysis were provided in the JAERI-data base. Chemical properties of both natural groundwater and interstitial water in buffer materials (bentonite and concrete) were investigated to determine the variations in Eh, pH and ligand concentrations (CO{sub 3}{sup 2-}, F{sup -}, PO{sub 4}{sup 3-}, SO{sub 4}{sup 2-}, NO{sub 3}{sup -} and NH{sub 4}{sup +}). These properties can play an important role in the complexation of radioactive elements. Effect of the groundwater chemical properties on the solubility and formation of chemical species for americium, plutonium and technetium was predicted based on the solubility analyses under a variety of geochemical conditions. The solubility and speciation of the radioactive elements were estimated, taking into account the possible range of chemical compositions determined from the groundwater investigation. (author)

  14. Uptake and recovery of americium and uranium by Anacystis biomass

    International Nuclear Information System (INIS)

    Liu, H.H.; Jiunntzong Wu

    1993-01-01

    The optimum conditions for the uptake of americium and uranium from wastewater solutions by Anacystis nidulans cells, and the recovery of these radionuclides were studied. The optimum pH range for both actinides was in the acidic region between 3.0 and 5.0. In a pH 3.5 solution with an algal biomass of 70 μg/mL, up to 95% of the Am and U were taken up by the cells. However, the uptake levels were lowered considerably when ethylene dinitrilotetraacetic acid (EDTA) or iron or calcium ions were present in the solutions. Most of the radionuclides taken up by the cells could also be desorbed by washing with salt solutions. Of nine salt solutions tested, ammonium carbonate was the most effective. Our experiments using algal biomass to remove radionuclides from wastewater showed that about 92% of americium and 85% of uranium in wastewater could be taken up by algal biomass, from which about 46% of the Am and 82% of the U originally present in the wastewater could be recovered by elution with a salt solution. 17 refs., 7 figs., 2 tabs

  15. Extraction of americium of different oxidation states in two-phase aqueous system based on polyethylene glycol

    International Nuclear Information System (INIS)

    Molochnikova, N.P.; Frenkel', V.Ya.; Myasoedov, B.F.; Shkinev, V.M.; Spivakov, B.Ya.; Zolotov, Yu.A.

    1987-01-01

    Americium extraction in different oxidation states in two-phase aqueous system based on polyethylene glycol is investigated. Conditions for quantitative extraction of americium (3) and americium (5) from ammonium sulfate solutions within pH=3-5 interval in the presence of arsenazo 3 are found. Composition of the produced americium complexes with reagent is determined; americium (3) interacts with arsenazo 3 in ammonium sulfate solutions with the formation of MeR and Me 2 R composition complexes. Absorption spectrum characteristics of americium (3) and- (5) complexes with arsenazo 3 in ammonium sulfate solutions and extracts based polyethylene glycol aqueous solutions are given. Molar extinction coefficients of americium complexes with arsenazo (3) in these solutions are determined

  16. A radiochemical procedure for a low-level measurement of ''241Am in environmental samples using a supported functional organo phosphorus extractant

    International Nuclear Information System (INIS)

    Gasco, C.; Anton, M. P.; Alvarez, A.; Navarro, N.; Salvador, S.

    1994-01-01

    The transuranides analysis in environmental samples is carried out by CIEMAT using standardized methods based on sequential separation with ionic-exchange resins. The americium fraction is purified through a two-layer ion exchange column and lately in an anion-exchange column in nitric acid methanol medium. The technique is time consuming and the results are not completely satisfactory (low recovery and loss of a-resolution) for some samples. The chemical compound CMPO (octyl(phenyl)-N,N-diisobutyl carbomoylmethyiphosphine oxide) dissolved in TPB (tributyl phosphate) and supported on an inert substrate has been tested directly for ''241Am analysis by a large number of laboratories. A new method that combines both procedures has been developed. The details of the improved procedure are described in this paper. The advantages of its application to environmental samples (urine, faeces and sediments) are discussed. The utilization of standard samples, with americium certified concentrations confirms the reliability of our measurements. (Author) 8 refs

  17. A radiochemical procedure for a low-level measurement of ''241 Am in environmental samples using a supported functional organo phosphorus extractant

    International Nuclear Information System (INIS)

    Gasco, C.; Anton, M.A.; Alvarez, A.; Navarro, N.; Salvador, S.

    1994-01-01

    The transuranides analysis in environmental samples is carried out by CIEMAT using standardized methods based on sequential separation with ionic-exchange resins. The americium fraction is purified through a two-layer ion exchange column and lately in an anion-exchange column in nitric acid methanol medium. The technique is time-consuming and the results are not completely satisfactory (low recovery and loss of alpha-resolution) for some samples. The chemical compound CMPO (octyl(phenyl).N,N-diisobutyl carbomoylmethyiphosphine oxide) dissolved in TPB (tributyl phosphate) and supported on an inert substrate has been tested directly for ''241 Am analysis by a large number of laboratories. A new method that combines both procedures has been developed. The details of the improved procedure are described in this paper. The advantages of its application to environmental samples (urine, faeces and sediments) are discussed. The utilization of standard, with americium certified concentrations confirms the reliability of our measurements

  18. Critical mass calculations for 241Am, 242mAm and 243Am

    International Nuclear Information System (INIS)

    Dias, Hemanth; Tancock, Nigel; Clayton, Angela

    2003-01-01

    Criticality mass calculations are reported for 241 Am, 242m Am and 243 Am using the MONK and MCNP computer codes with the UKNDL, JEF-2.2, ENDF/B-VI and JENDL-3.2 nuclear data libraries. Results are reported for spheres of americium metal and dioxide in bare, water reflected and steel reflected systems. Comparison of results led to the identification of a serious inconsistency in the 241 Am ENDF/B-VI DICE library used by MONK - this demonstrates the importance of using different codes to verify critical mass calculations. The 241 Am critical mass estimates obtained using UKNDL and ENDF/B-VI show good agreement with experimentally inferred data, whilst both JEF-2.2 and JENDL-3.2 produce higher estimates of critical mass. The computed critical mass estimates for 242m Am obtained using ENDF/B-VI are lower than the results produced using the other nuclear data libraries - the ENDF/B-VI fission cross-section for 242m Am is significantly higher than the other evaluations in the fast region and is not supported by recent experimental data. There is wide variation in the computed 243 Am critical mass estimates suggesting that there is still considerable uncertainty in the 243 Am nuclear data. (author)

  19. Twelve years of follow up of cases with old 241Am internal contamination.

    Science.gov (United States)

    Malátová, Irena; Vrba, Tomás; Becková, Vera; Pospísilová, Helena

    2010-10-01

    A group of workers internally contaminated with Am have been followed for about 12 years. The source of contamination was AmO2 powder used for production of AmBe neutron sources and other applications. The production of some radionuclide sources included chemical treatment of the original material, which transformed the americium into the nitrate, but mostly powder metallurgy was used for production of sources for smoke detectors. In vivo measurement of the workers was performed with two LEGe detectors placed near the head of the measured person. Calibration was performed with four different physical skull phantoms of different origin and a voxel phantom with Monte Carlo simulation, which was developed to fit the head sizes of individual persons. Samples of urine and feces were analyzed by means of radiochemical separation followed by alpha-spectrometry. Separation of 241Am from mineralized excreta was performed by combined anion exchange and extraction chromatographic techniques. As a tracer, 243Am was used. When the measured data (83 data on skeletal activity, activity in 389 bioassay samples) were compared with International Commission on Radiological Protection's and Leggett's biokinetic models of americium, it was found that in most cases, after more than 15 y since the intake, the excretion rate was lower (or skeletal activity higher) than predicted. On the other hand, the ratio of excreted activity in urine and feces agrees well with model predictions.

  20. Hanford Single-Shell Tank Leak Causes and Locations - 241-B Farm

    Energy Technology Data Exchange (ETDEWEB)

    Girardot, Crystal L. [Washington River Protection Systems, Richland, WA (United States); Harlow, Donald G. [Washington River Protection Systems, Richland, WA (United States)

    2013-07-11

    This document identifies 241-B Tank Farm (B Farm) leak cause and locations for the 100 series leaking tank (241-B-107) identified in RPP-RPT-49089, Hanford B-Farm Leak Inventory Assessments Report. This document satisfies the B Farm portion of the target (T04) in the Hanford Federal Facility Agreement and Consent Order milestone M-045-91F.

  1. Hanford Single-Shell Tank Leak Causes and Locations - 241-B Farm

    International Nuclear Information System (INIS)

    Girardot, Crystal L.; Harlow, Donald G.

    2013-01-01

    This document identifies 241-B Tank Farm (B Farm) leak cause and locations for the 100 series leaking tank (241-B-107) identified in RPP-RPT-49089, Hanford B-Farm Leak Inventory Assessments Report. This document satisfies the B Farm portion of the target (T04) in the Hanford Federal Facility Agreement and Consent Order milestone M-045-91F

  2. In situ determination of 241Am on Enewetak Atoll. Date of survey: July 1977-December 1979

    International Nuclear Information System (INIS)

    Tipton, W.J.; Fritzsche, A.E.; Jaffe, R.J.; Villaire, A.E.

    1981-11-01

    An in situ gamma ray spectrometer system was operated at Enewetak Atoll from July 1977 to December 1979 in support of the Enewetak Cleanup Project. The system employed a high purity germanium planar detector suspended at a height of 7.4 m above ground. Conversion factors were established to relate measured photopeak count rate data to source concentration in the soil. Data obtained for 241 Am, together with plutonium-to-americium ratios obtained from soil sample analyses, were used to establish area-averaged surface (0 to 3 cm) transuranic concentration values. In areas which exceeded cleanup criteria, measurements were made in an iterative fashion to guide soil removal until levels were reduced below the cleanup criteria. Final measurements made after soil removal had been completed were used to document remaining surface transuranic concentration values and to establish external exposure rate levels due to 137 Cs and 60 Co

  3. Analysis of biological samples for americium and curium

    International Nuclear Information System (INIS)

    Miglio, J.J.

    1976-01-01

    A method of analyzing biological materials by liquid scintillation counting for americium and curium which greatly reduces the contribution from 40 K is described. The method employs an extractant liquid scintillation cocktail using N,N,N-trioctyl-N-methyl-ammonium chloride as the extractant. Instrument as well as tissue backgrounds are reduced. The lowered backgrounds allow picocurie level samples to be analyzed by liquid scintillation counting instead of alpha pulse height analysis. The samples are reduced to a carbon-free ash and then dissolved in 8M LiNo 3 which is also 10 -2 M in HNO 3 . An aliquot is placed in a liquid scintillation vial along with the extractant-scintillator, shaken and counted

  4. Vertical transport of particulate-associated plutonium and americium in the upper water column of the Northeast Pacific

    International Nuclear Information System (INIS)

    Fowler, S.W.; Ballestra, S.; La Rosa, J.; Fukai, R.

    1983-01-01

    Concentrations of plutonium (Pu) and americium (Am) were determined in seawater, suspended particulate matter, sediment trap samples, and biogenic material collected at the VERTEX I site in the North Pacific off central California. From a vertical profile taken over the upper 1500 m, the presence of sub-surface maxima of sup(239+240)Pu and 241 Am were identified between 100 to 750 m and 250 to 750 m, respectively. A large fraction (32%) of the filterable sup(239+240)Pu in surface waters was associated with cells during a phytoplankton bloom; Pu:Am activity ratios in surface water and the suspended particles indicated that Pu was concentrated by the cells to a greater degree than Am. However, similar measurements beneath the surface layer showed an overall enrichment of Am over Pu on fine suspended particles with depth. Freshly produced zooplankton fecal pellets and large, fast sinking particles collected in PITS contained relatively high concentrations of Pu and Am. Both transuranic concentrations in trapped particles and transuranic flux tended to increase with depth down to 750 m, suggesting that their scavenging is in the upper water column. Am appeared to be scavenged by sinking biogenic particles to a greater extent than Pu. The results are discussed. (author)

  5. Determination of the oxygen-metal-ratio of uranium-americium mixed oxides

    International Nuclear Information System (INIS)

    Bartscher, W.

    1982-01-01

    During the dissolution of uranium-americium mixed oxides in phosphoric acid under nitrogen tetravalent uranium is oxidized by tetravalent americium. The obtained hexavalent uranium is determined by constant potential coulometry. The coulombs measured are equivalent to the oxygen in excess of the minimum composition of UO 2 x AmO 1 . 5 . The total uranium content of the sample is determined in a subsequent coulometric titration. The oxygen-metal ratio of the sample can be calculated for a given uranium-americium ratio. An excess of uranium dioxide is necessary in order to suppress the oxidation of water by tetravalent americium. The standard deviation of the method is 0.0017 O/M units. (orig.) [de

  6. Progress in transmutation targets from Efttra

    International Nuclear Information System (INIS)

    Haas, D.; Fernandez, A.; Warin, D.; Bonnerot, J.M.; Garzenne, C.; Scaffidi-Argentina, F.; Maschek, W.; Schram, R.; Klaassen, F.

    2007-01-01

    Since 15 years, the EFTTRA partners have organised programmes to demonstrate the feasibility of the transmutation of americium in uranium-free targets. In the related transmutation scenario, the targets are introduced in a thermal neutron zone of a fast reactor, to maximize the efficiency of transmutation. Amongst these programmes, those carried out in the HFR reactor in Petten have led to important conclusions and are still at the core of the research in that field. The analysis of the EFTTRA T4 and T4bis irradiation experiments, carried out with targets of MgAl 2 O 4 +11 wt% 241 Am, showed that the release/trapping of helium is the key issue for target design, and also demonstrated a lack of technical benefits of this material, due to a unsatisfactory in-pile behaviour in terms of irradiation damage and chemical stability. A new irradiation experiment called HELIOS is currently under fabrication and will be carried out in HFR. The in-pile behaviour of U-free fuels and targets such as (Am,Zr)O 2 , (Pu,Am,Zr)O 2 , CERCER (MgO) or CERMET (Mo) will be examined. The irradiation temperature will be high enough in some of the pins to be able to tune the release of a significant fraction of helium produced so that the material swelling can be minimized as much as reasonably possible. The HELIOS irradiation experiment is planned to be carried out in the HFR core and shall last 300 full power days starting in 2007. (authors)

  7. In-line measurement of plutonium and americium in mixed solutions

    International Nuclear Information System (INIS)

    Li, T.K.

    1981-01-01

    A solution assay instrument (SAI) has been developed at the Los Alamos National Laboratory and installed in the plutonium purification and americium recovery process area in the Los Alamos Plutonium Processing Facility. The instrument is designed for accurate, timely, and simultaneous nondestructive analysis of plutonium and americium in process solutions that have a wide range of concentrations and Am/Pu ratios. For a 25-mL sample, the assay precision is 5 g/L within a 2000-s count time

  8. 10 CFR 600.241 - Financial reporting.

    Science.gov (United States)

    2010-01-01

    ... 10 Energy 4 2010-01-01 2010-01-01 false Financial reporting. 600.241 Section 600.241 Energy DEPARTMENT OF ENERGY (CONTINUED) ASSISTANCE REGULATIONS FINANCIAL ASSISTANCE RULES Uniform Administrative....241 Financial reporting. (a) General. (1) Except as provided in paragraphs (a) (2) and (5) of this...

  9. 42 CFR 413.241 - Pharmacy arrangements.

    Science.gov (United States)

    2010-10-01

    ... 42 Public Health 2 2010-10-01 2010-10-01 false Pharmacy arrangements. 413.241 Section 413.241... Disease (ESRD) Services and Organ Procurement Costs § 413.241 Pharmacy arrangements. Effective January 1, 2011, an ESRD facility that enters into an arrangement with a pharmacy to furnish renal dialysis...

  10. 33 CFR 241.3 - References.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 3 2010-07-01 2010-07-01 false References. 241.3 Section 241.3... CONTROL COST-SHARING REQUIREMENTS UNDER THE ABILITY TO PAY PROVISION § 241.3 References. References cited..., Hyattsville, MD 20781-1102. References cited in paragraphs (d) and (e) may be obtained from the National...

  11. 24 CFR 241.1105 - Late charges.

    Science.gov (United States)

    2010-04-01

    ... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Late charges. 241.1105 Section 241...-Eligibility Requirements § 241.1105 Late charges. The note and security instrument may provide for the lender's collection of a late charge, not to exceed 2 cents for each dollar of each payment to interest or...

  12. 49 CFR 241.17 - Preemptive effect.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 4 2010-10-01 2010-10-01 false Preemptive effect. 241.17 Section 241.17 Transportation Other Regulations Relating to Transportation (Continued) FEDERAL RAILROAD ADMINISTRATION... OPERATIONS § 241.17 Preemptive effect. Under 49 U.S.C. 20106, the regulations in this part preempt any State...

  13. 46 CFR 108.241 - Visual aids.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 4 2010-10-01 2010-10-01 false Visual aids. 108.241 Section 108.241 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) A-MOBILE OFFSHORE DRILLING UNITS DESIGN AND EQUIPMENT Construction and Arrangement Helicopter Facilities § 108.241 Visual aids. (a) Each helicopter deck must— (1...

  14. 33 CFR 117.241 - Mispillion River.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Mispillion River. 117.241 Section 117.241 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY BRIDGES DRAWBRIDGE OPERATION REGULATIONS Specific Requirements Delaware § 117.241 Mispillion River. The draw of the...

  15. 46 CFR 169.241 - Machinery.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 7 2010-10-01 2010-10-01 false Machinery. 169.241 Section 169.241 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) NAUTICAL SCHOOLS SAILING SCHOOL VESSELS Inspection and Certification Inspections § 169.241 Machinery. (a) At each inspection for certification and periodic inspection, the marine inspector will examine an...

  16. 49 CFR 241.19 - Information collection.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 4 2010-10-01 2010-10-01 false Information collection. 241.19 Section 241.19... OPERATIONS § 241.19 Information collection. (a) The information collection requirements of this part are... (44 U.S.C. 3501 et seq.). (b) The information collection requirements are found in the following...

  17. 24 CFR 241.1235 - Cross default.

    Science.gov (United States)

    2010-04-01

    ... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Cross default. 241.1235 Section 241... Rights and Obligations § 241.1235 Cross default. In the event the borrower commits a default under a prior recorded insured mortgage and the holder thereof initiates a foreclosure proceeding, said default...

  18. 7 CFR 1220.241 - Reports.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 10 2010-01-01 2010-01-01 false Reports. 1220.241 Section 1220.241 Agriculture... CONSUMER INFORMATION Soybean Promotion and Research Order Reports, Books, and Records § 1220.241 Reports... to report to the Board periodically such information as may be required by the regulations...

  19. 12 CFR 335.241 - Unlisted trading.

    Science.gov (United States)

    2010-01-01

    ... 12 Banks and Banking 4 2010-01-01 2010-01-01 false Unlisted trading. 335.241 Section 335.241 Banks and Banking FEDERAL DEPOSIT INSURANCE CORPORATION REGULATIONS AND STATEMENTS OF GENERAL POLICY SECURITIES OF NONMEMBER INSURED BANKS § 335.241 Unlisted trading. The provisions of the applicable and...

  20. The bioavailability of the transuranic elements 237Pu and 241Am for the pond snail, Lymnaea stagnalis L., and their behaviour in selected natural surface waters

    International Nuclear Information System (INIS)

    Thiels, G.M.

    1983-01-01

    An attempt was made to characterise the bioavailability of 237 Pu and 241 Am for the pond snail Lymnaea stagnalis L. in selected surface waters. The uptake, distribution and retention patterns were studied through the contamination route water-snail. The effects of a number of parameters, such as seasonal variation, water type (pH, conductivity, ionic composition) and presence of food, on the bioavailability of the transuranics were evaluated. Finally, an assessment was made concerning the chemical speciation of plutonium and americium in the selected freshwaters

  1. Selective dissolution of americium by ferricyanide ions in basic aqueous solutions

    International Nuclear Information System (INIS)

    Meyer, D.; Fouchard, S.; Simoni, E.

    2000-01-01

    Americium exhibits a soluble form in aqueous alkaline media under oxidizing conditions which is not the case for the other Transplutonium Elements (TPE). This property can be exploited for High Level Liquid Waste (HLLW) treatment to extract Am, one of the main radionuclides responsible for the long term radiotoxicity of nuclear waste. The Soluble Am compound can be obtained by adding a concentrated basic solution of ferricyanide ions (Fe(CN) 6 3- ) to a trivalent americium hydroxide precipitate. The method allows complete and rapid extraction of americium via its soluble form in alkaline solutions. Under these conditions, other TPE and lanthanides remain in the solid state as precipitates of highly insoluble trivalent hydroxides. In the case of dissolution involving large amounts of americium, the formation of the soluble americium species is followed by the appearance of a reddish precipitate in the basic solution. Dissolution of the reddish solid in NaOH or NaOH/Fe(CN) 6 3- media demonstrated the existence of a media dependent solubility of the precipitate, and therefore the existence of at least two forms of soluble Am. Spectroscopic studies (UV-visible, EXAFS-XANES) of this reddish solid led to the determination of an Am oxidation state (pentavalent americium) and its possible formula (Na 2 AmVO 2 (OH) 3 .nH 2 O). Electrochemical studies show that the only possible oxidation reaction of trivalent americium in the working media yields the pentavalent form, and that the hexavalent state is unattainable. Stoichiometric and spectroscopic studies show that not all the ferricyanide ions required for complete dissolution of Am remain in the free Fe(CN) 6 3- form. This observation supports the view that this dissolution of Am(III) solid compound is much more complex than a simple oxidation by the ferricyanide ions. The existence of a molecular interaction between Am(V)O 2 + and ferricyanide ions is highly probable. This work demonstrates that the selective dissolution

  2. Americium, plutonium and uranium contamination and speciation in well waters, streams and atomic lakes in the Sarzhal region of the Semipalatinsk Nuclear Test Site, Kazakhstan.

    Science.gov (United States)

    León Vintró, L; Mitchell, P I; Omarova, A; Burkitbayev, M; Jiménez Nápoles, H; Priest, N D

    2009-04-01

    New data are reported on the concentrations, isotopic composition and speciation of americium, plutonium and uranium in surface and ground waters in the Sarzhal region of the Semipalatinsk Test Site, and an adjacent area including the settlement of Sarzhal. The data relate to filtered water and suspended particulate from (a) streams originating in the Degelen Mountains, (b) the Tel'kem 1 and Tel'kem 2 atomic craters, and (c) wells on farms located within the study area and at Sarzhal. The measurements show that (241)Am, (239,240)Pu and (238)U concentrations in well waters within the study area are in the range 0.04-87mBq dm(-3), 0.7-99mBq dm(-3), and 74-213mBq dm(-3), respectively, and for (241)Am and (239,240)Pu are elevated above the levels expected solely on the basis of global fallout. Concentrations in streams sourced in the Degelen Mountains are similar, while concentrations in the two water-filled atomic craters are somewhat higher. Suspended particulate concentrations in well waters vary considerably, though median values are very low, at 0.01mBq dm(-3), 0.08mBq dm(-3) and 0.32mBq dm(-3) for (241)Am, (239,240)Pu and (238)U, respectively. The (235)U/(238)U isotopic ratio in almost all well and stream waters is slightly elevated above the 'best estimate' value for natural uranium worldwide, suggesting that some of the uranium in these waters is of test-site provenance. Redox analysis shows that on average most of the plutonium present in the microfiltered fraction of these waters is in a chemically reduced form (mean 69%; 95% confidence interval 53-85%). In the case of the atomic craters, the proportion is even higher. As expected, all of the americium present appears to be in a reduced form. Calculations suggest that annual committed effective doses to individual adults arising from the daily ingestion of these well waters are in the range 11-42microSv (mean 21microSv). Presently, the ground water feeding these wells would not appear to be contaminated with

  3. Americium, plutonium and uranium contamination and speciation in well waters, streams and atomic lakes in the Sarzhal region of the Semipalatinsk Nuclear Test Site, Kazakhstan

    Energy Technology Data Exchange (ETDEWEB)

    Leon Vintro, L. [School of Physics, University College Dublin, Belfield, Dublin 4 (Ireland)], E-mail: luis.leon@ucd.ie; Mitchell, P.I.; Omarova, A. [School of Physics, University College Dublin, Belfield, Dublin 4 (Ireland); Burkitbayev, M. [Department of Inorganic Chemistry, Al-Faraby Kazakh National University, Almaty (Kazakhstan); Jimenez Napoles, H. [School of Physics, University College Dublin, Belfield, Dublin 4 (Ireland); Priest, N.D. [School of Health and Social Sciences, Middlesex University, Enfield, EN3 4SA (United Kingdom)

    2009-04-15

    New data are reported on the concentrations, isotopic composition and speciation of americium, plutonium and uranium in surface and ground waters in the Sarzhal region of the Semipalatinsk Test Site, and an adjacent area including the settlement of Sarzhal. The data relate to filtered water and suspended particulate from (a) streams originating in the Degelen Mountains, (b) the Tel'kem 1 and Tel'kem 2 atomic craters, and (c) wells on farms located within the study area and at Sarzhal. The measurements show that {sup 241}Am, {sup 239,240}Pu and {sup 238}U concentrations in well waters within the study area are in the range 0.04-87 mBq dm{sup -3}, 0.7-99 mBq dm{sup -3}, and 74-213 mBq dm{sup -3}, respectively, and for {sup 241}Am and {sup 239,240}Pu are elevated above the levels expected solely on the basis of global fallout. Concentrations in streams sourced in the Degelen Mountains are similar, while concentrations in the two water-filled atomic craters are somewhat higher. Suspended particulate concentrations in well waters vary considerably, though median values are very low, at 0.01 mBq dm{sup -3}, 0.08 mBq dm{sup -3} and 0.32 mBq dm{sup -3} for {sup 241}Am, {sup 239,240}Pu and {sup 238}U, respectively. The {sup 235}U/{sup 238}U isotopic ratio in almost all well and stream waters is slightly elevated above the 'best estimate' value for natural uranium worldwide, suggesting that some of the uranium in these waters is of test-site provenance. Redox analysis shows that on average most of the plutonium present in the microfiltered fraction of these waters is in a chemically reduced form (mean 69%; 95% confidence interval 53-85%). In the case of the atomic craters, the proportion is even higher. As expected, all of the americium present appears to be in a reduced form. Calculations suggest that annual committed effective doses to individual adults arising from the daily ingestion of these well waters are in the range 11-42 {mu}Sv (mean 21 {mu

  4. Uptake of plutonium and americium by plants from soils

    International Nuclear Information System (INIS)

    Schulz, R.K.; Tompkins, G.A.; Babcock, K.L.

    1975-01-01

    Plant uptake of 239 , 240 Pu and 241 Am was studied on two soil samples collected on the Nevada Test Site. These soils had each been previously contaminated with the radionuclides by high explosive detonation of devices containing plutonium. The 239 PuO 2 equivalent diameters of plutonium bearing particles present in the soil samples were determined and found to be log-normal in the range of 0.2 to 0.7 μm. Particles were examined by electronmicroscopy and found to be 2 to 3 times larger than the 239 PuO 2 equivalent diameter. Electron microprobe analysis showed that these particles consisted primarily of Pu, U, and O, with Al, Si, Fe and Mg present in much smaller amounts. The plutonium distribution ratio (D. R. = nuclide concentration in plant/nuclide concentration in soil) was in the order of 10 -5 for barley plant vegetation and was 20 to 100 times lower for barley grain. The D. R. for 241 Am was in the order of 10 -4 for vegetative growth and 25-75 times lower for the grain. In other uptake experiments three different soils were utilized: slightly acid forest soil, neutral valley soil, and calcareous alkaline soil. The 239 240 Pu and 241 Am were added to the soil as nitrate or chloride solution to facilitate the addition of Pu to soil in different oxidation states. Where Pu in the higher oxidation states (nitrate) was added to the alkaline calcareous soil, the highest plant uptake was observed. In uptake experiments with wheat the plutonium distribution ratio of the grain ranged from about 4 x 10 -8 to 4 x 10 -6 . The 241 Am D. R.'s ranged from 3 x 10 -7 to 3 x 10 -5 . (U.S.)

  5. Americium/Curium Melter 2A Pilot Tests

    International Nuclear Information System (INIS)

    Smith, M.E.; Fellinger, A.P.; Jones, T.M.; Miller, C.B.; Miller, D.H.; Snyder, T.K.; Stone, M.E.; Witt, D.C.

    1998-05-01

    Isotopes of americium (Am) and curium (Cm) were produced in the past at the Savannah River Site (SRS) for research, medical, and radiological applications. These highly radioactive and valuable isotopes have been stored in an SRS reprocessing facility for a number of years. Vitrification of this solution will allow the material to be more safely stored until it is transported to the DOE Oak Ridge Reservation for use in research and medical applications. To this end, the Am/Cm Melter 2A pilot system, a full-scale non- radioactive pilot plant of the system to be installed at the reprocessing facility, was designed, constructed and tested. The full- scale pilot system has a frit and aqueous feed delivery system, a dual zone bushing melter, and an off-gas treatment system. The main items which were tested included the dual zone bushing melter, the drain tube with dual heating and cooling zones, glass compositions, and the off-gas system which used for the first time a film cooler/lower melter plenum. Most of the process and equipment were proven to function properly, but several problems were found which will need further work. A system description and a discussion of test results will be given

  6. Density of simulated americium/curium melter feed solution

    Energy Technology Data Exchange (ETDEWEB)

    Rudisill, T.S.

    1997-09-22

    Vitrification will be used to stabilize an americium/curium (Am/Cm) solution presently stored in F-Canyon for eventual transport to Oak Ridge National Laboratory and use in heavy isotope production programs. Prior to vitrification, a series of in-tank oxalate precipitation and nitric/oxalic acid washes will be used to separate these elements and lanthanide fission products from the bulk of the uranium and metal impurities present in the solution. Following nitric acid dissolution and oxalate destruction, the solution will be denitrated and evaporated to a dissolved solids concentration of approximately 100 g/l (on an oxide basis). During the Am/Cm vitrification, an airlift will be used to supply the concentrated feed solution to a constant head tank which drains through a filter and an in-line orifice to the melter. Since the delivery system is sensitive to the physical properties of the feed, a simulated solution was prepared and used to measure the density as a function of temperature between 20 to 70{degrees} C. The measured density decreased linearly at a rate of 0.0007 g/cm3/{degree} C from an average value of 1.2326 g/cm{sup 3} at 20{degrees} C to an average value of 1.1973g/cm{sup 3} at 70{degrees} C.

  7. Density of simulated americium/curium melter feed solution

    International Nuclear Information System (INIS)

    Rudisill, T.S.

    1997-01-01

    Vitrification will be used to stabilize an americium/curium (Am/Cm) solution presently stored in F-Canyon for eventual transport to Oak Ridge National Laboratory and use in heavy isotope production programs. Prior to vitrification, a series of in-tank oxalate precipitation and nitric/oxalic acid washes will be used to separate these elements and lanthanide fission products from the bulk of the uranium and metal impurities present in the solution. Following nitric acid dissolution and oxalate destruction, the solution will be denitrated and evaporated to a dissolved solids concentration of approximately 100 g/l (on an oxide basis). During the Am/Cm vitrification, an airlift will be used to supply the concentrated feed solution to a constant head tank which drains through a filter and an in-line orifice to the melter. Since the delivery system is sensitive to the physical properties of the feed, a simulated solution was prepared and used to measure the density as a function of temperature between 20 to 70 degrees C. The measured density decreased linearly at a rate of 0.0007 g/cm3/degree C from an average value of 1.2326 g/cm 3 at 20 degrees C to an average value of 1.1973g/cm 3 at 70 degrees C

  8. Americium adsorption on the surface of macrophytic algae

    Energy Technology Data Exchange (ETDEWEB)

    Carvalho, F.P.; Fowler, S.W.

    1985-01-01

    Data are presented on the rates at which americium (Am) deposits upon blade surfaces of three benthic algal species (Ulva rigida, Fucus vesiculosus and Gigartina stellata) following short-term exposures (1-6 h). Am is taken up in direct proportion to the ambient radionuclide concentration in sea water. Uptake by the green alga was 3 to 5 times greater than that for the brown and red species. Experimental evidence indicated that Am accumulation is a passive process and that adsorption takes place mainly on the thin outer organic coating of the seaweed. The Am transport coefficients are quite similar to that previously found for the naturally occurring ..cap alpha..-emitter /sup 210/Po, but are an order of magnitude lower than a plutonium transport coefficient reported in the literature. Release of labelled extracellular products associated with the algal surface coating is considered to be responsible for the rapid loss of Am observed previously in macroalgae and may in fact serve as a mechanism for transferring Am to filter feeding zooplankton. (author).

  9. Americium adsorption on the surface of macrophytic algae

    International Nuclear Information System (INIS)

    Carvalho, F.P.; Fowler, S.W.

    1985-01-01

    Data are presented on the rates at which americium (Am) deposits upon blade surfaces of three benthic algal species (Ulva rigida, Fucus vesiculosus and Gigartina stellata) following short-term exposures (1-6 h). Am is taken up in direct proportion to the ambient radionuclide concentration in sea water. Uptake by the green alga was 3 to 5 times greater than that for the brown and red species. Experimental evidence indicated that Am accumulation is a passive process and that adsorption takes place mainly on the thin outer organic coating of the seaweed. The Am transport coefficients are quite similar to that previously found for the naturally occurring α-emitter 210 Po, but are an order of magnitude lower than a plutonium transport coefficient reported in the literature. Release of labelled extracellular products associated with the algal surface coating is considered to be responsible for the rapid loss of Am observed previously in macroalgae and may in fact serve as a mechanism for transferring Am to filter feeding zooplankton. (author)

  10. Plutonium and americium behavior in coral atoll environments

    International Nuclear Information System (INIS)

    Noshkin, V.E.; Wong, K.M.; Jokela, T.A.; Brunk, J.L.; Eagle, R.J.

    1984-01-01

    Inventories of 239+240 Pu and 241 Am greatly in excess of global fallout levels persist in the benthic environments of Bikini and Enewetak Atolls. Quantities of 239+240 Pu and lesser amounts of 241 Am are continuously mobilizing from these sedimentary reservoirs. The amount of 239+240 Pu mobilized to solution at any time represents 0.08 to 0.09% of the sediment inventories to a depth of 16 cm. The mobilized 239+240 Pu has solute-like characteristics and different valence states coexist in solution - the largest fraction of the soluble plutonium is in an oxidized form (+V,VI). The adsorption of plutonium to sediments is not completely reversible because of changes that occur in the relative amounts of the mixed oxidation states in solution with time. Further, any characteristics of 239+240 Pu described at one location may not necessarily be relevant in describing its behavior elsewhere following mobilization and migration. The relative amounts of 241 Am to 239+240 Pu in the sedimentary deposits at Enewetak and Bikini may be altered in future years because of mobilization and radiological decay. Mobilization of 239+240 Pu is not a process unique to these atolls, and quantities in solution derived from sedimentary deposits can be found at other global sites. These studies in the equatorial Pacific have significance in assessing the long-term behavior of the transuranics in any marine environment. 22 references, 1 figure, 13 tables

  11. Ecological behavior of plutonium and americium in a freshwater pond

    International Nuclear Information System (INIS)

    Emery, R.M.; Klopfer, D.C.; Garland, T.R.; Weimer, W.C.

    1975-03-01

    A Pu processing waste pond on the Hanford Reservation has been studied since mid-1973 to characterize the pond's limnology and determine the ecological behavior in this ecosystem. About 8.1 kg of Pu was reported to have been discharged into waste trenches leading to the pond. Mean ratios of isotopes in the sediments are 0.85 for 238 Pu to 239 240 Pu, 0.61 for 241 Am to 238 Pu, and 0.49 for 241 Am to 239 240 Pu. Levels of Pu and Am in the interstitial water range from 0.5 to 13 pCi/g (dry wt. of sediment). For 238 Pu in pond water the mean concentration is 0.007 pCi/l, for 239 240 Pu it is 0.002 pCi/l, and for 241 Am it is 1.08 pCi/l. The remaining biota had Pu and Am levels which were generally well below those of the sediments. (U.S.)

  12. Rapid determination of 239,240Pu, 238Pu, 241Am and 90Sr in high contaminated samples waste using combined SPE sorbents AnaLigR Pu-02, AnaLigR Sr-01 and DGAR Resin

    International Nuclear Information System (INIS)

    Silvia Dulanska; Igor Antalik; Miroslav Labaska; Boris Remenec; Andrej Matel

    2013-01-01

    A rapid separation method has been developed which allows measurement of plutonium, americium and strontium isotopes in the high active sample from CBRN Training and Testing Centre in Zemianske Kostolany (Slovakia) with high chemical recoveries and effective removal of matrix interferences. This method uses different commercial products stacked AnaLig R Pu-02, AnaLig R Sr-01 and DGA R Resin cartridges from IBC Advanced Technologies and Eichrom Technologies. The method allows rapid separation of plutonium, strontium and americium using a single multi-stage column in the vacuum box (cartridge technology) with rapid flow rates to minimize sample separation time. The 239,240 Pu, 23 8Pu and 241 Am were determined by alpha spectroscopy, 90 Sr was counted on TRICARB 2900 TR by Cherenkov counting of its progeny 90 Y. (author)

  13. Am-241 buildup in nematode organisms

    International Nuclear Information System (INIS)

    Martyushov, V.Z.; Tarasov, O.V.

    1990-01-01

    The process of Am-241 intake into earthworm organisms from chernozem leached in their presence in soil contaminated with this radionuclide is studied. The data on Am-241 buildup values during long-time radionuclide intake into earthworm organisms from soil are given. It s shown that Am-241 buildup in earthworm organisms do not exceed its concentration in soil for the whole observation period (as Am-241 presents in soil in state unavailable for animals). Intensive extraction of the radionuclide from the organisms is observed when earthworm contacts with soil are stopped

  14. Test Results for Caustic Demand Measurements on Tank 241-AX-101 and Tank 241-AX-103 Archive Samples

    International Nuclear Information System (INIS)

    Doll, Stephanie R.; Bolling, Stacie D.

    2016-01-01

    Caustic demand testing is used to determine the necessary amount of caustic required to neutralize species present in the Hanford tank waste and obtain a target molarity of free hydroxide for tank corrosion control. The presence and quantity of hydroxide-consuming analytes are just as important in determining the caustic demand as is the amount of free hydroxide present. No single data point can accurately predict whether a satisfactory hydroxide level is being met, as it is dependent on multiple factors (e.g., free hydroxide, buffers, amphoteric metal hydroxides, bicarbonate, etc.). This enclosure contains the caustic demand, scanning electron microscopy (SEM), polarized light microscopy (PLM), and X-ray diffraction (XRD) analysis for the tank 241-AX-101 (AX-101) and 241-AX-103 (AX-103) samples. The work was completed to fulfill a customer request outlined in the test plan, WRPS-1505529, ''Test Plan and Procedure for Caustic Demand Testing on Tank 241-AX-101 and Tank 241-AX-103 Archive Samples.'' The work results will provide a baseline to support planned retrieval of AX-101 and AX-103.

  15. Test Results for Caustic Demand Measurements on Tank 241-AX-101 and Tank 241-AX-103 Archive Samples

    Energy Technology Data Exchange (ETDEWEB)

    Doll, Stephanie R. [Washington River Protection Solutions, Richland, WA (United States); Bolling, Stacie D. [Washington River Protection Solutions, Richland, WA (United States)

    2016-07-14

    Caustic demand testing is used to determine the necessary amount of caustic required to neutralize species present in the Hanford tank waste and obtain a target molarity of free hydroxide for tank corrosion control. The presence and quantity of hydroxide-consuming analytes are just as important in determining the caustic demand as is the amount of free hydroxide present. No single data point can accurately predict whether a satisfactory hydroxide level is being met, as it is dependent on multiple factors (e.g., free hydroxide, buffers, amphoteric metal hydroxides, bicarbonate, etc.). This enclosure contains the caustic demand, scanning electron microscopy (SEM), polarized light microscopy (PLM), and X-ray diffraction (XRD) analysis for the tank 241-AX-101 (AX-101) and 241-AX-103 (AX-103) samples. The work was completed to fulfill a customer request outlined in the test plan, WRPS-1505529, “Test Plan and Procedure for Caustic Demand Testing on Tank 241-AX-101 and Tank 241-AX-103 Archive Samples.” The work results will provide a baseline to support planned retrieval of AX-101 and AX-103.

  16. The rapid determination of americium curium, and uranium in urine by ultrafiltration

    International Nuclear Information System (INIS)

    Stradling, G.N.; Popplewell, D.S.; Ham, G.J.; Griffin, R.

    1975-01-01

    The rapid ultrafiltration method developed for the assay of plutonium has been extended to the determination of americium, curium and uranium in urine. The limits of detection for americium and curium, and uranium are 0.09 and 0.12 dm -1 l -1 respectively, and the analysis time excluding counting less than 2 hours. The method can therefor be effectively used as a rapid screening procedure. When the reference level for plutonium is exceeded, the α activity may require to be characterised. The single ultrafiltration technique must be modified for turbid urine samples. The method is inappropriate, except for uranium, when the urine contains DTPA. (author)

  17. 14 CFR 29.241 - Ground resonance.

    Science.gov (United States)

    2010-01-01

    ... 14 Aeronautics and Space 1 2010-01-01 2010-01-01 false Ground resonance. 29.241 Section 29.241 Aeronautics and Space FEDERAL AVIATION ADMINISTRATION, DEPARTMENT OF TRANSPORTATION AIRCRAFT AIRWORTHINESS... resonance. The rotorcraft may have no dangerous tendency to oscillate on the ground with the rotor turning...

  18. 14 CFR 27.241 - Ground resonance.

    Science.gov (United States)

    2010-01-01

    ... 14 Aeronautics and Space 1 2010-01-01 2010-01-01 false Ground resonance. 27.241 Section 27.241 Aeronautics and Space FEDERAL AVIATION ADMINISTRATION, DEPARTMENT OF TRANSPORTATION AIRCRAFT AIRWORTHINESS... resonance. The rotorcraft may have no dangerous tendency to oscillate on the ground with the rotor turning...

  19. 24 CFR 241.1069 - Escrow requirements.

    Science.gov (United States)

    2010-04-01

    ... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Escrow requirements. 241.1069...-Eligibility Requirements § 241.1069 Escrow requirements. (a) An equity loan provided in connection with a plan... behalf of the borrower, 10 percent of the loan amount in an escrow account, controlled by the...

  20. 40 CFR 86.241-94 - [Reserved

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 18 2010-07-01 2010-07-01 false [Reserved] 86.241-94 Section 86.241-94 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) AIR PROGRAMS (CONTINUED) CONTROL OF... Year Gasoline-Fueled New Light-Duty Vehicles, New Light-Duty Trucks and New Medium-Duty Passenger...

  1. Thermal modeling of tanks 241-AW-101 and 241-AN-104 with the TEMPEST code

    International Nuclear Information System (INIS)

    Antoniak, Z.I.; Recknagle, K.P.

    1995-07-01

    The TEMPEST code was exercised in a preliminary study of double-shell Tanks 241 -AW-101 and 241-AN-104 thermal behavior. The two-dimensional model used is derived from our earlier studies on heat transfer from Tank 241-SY-101. Several changes were made to the model to simulate the waste and conditions in 241-AW-101 and 241-AN-104. The nonconvective waste layer was assumed to be 254 cm (100 in.) thick for Tank 241-AW-101, and 381 cm (150 in.) in Tank 241-AN-104. The remaining waste was assumed, for each tank, to consist of a convective layer with a 7.6-cm (3-inch) crust on top. The waste heat loads for 241-AW-101 and 241-AN-104 were taken to be 10 kW (3.4E4 Btu/hr) and 12 kW (4.0E4 Btu/hr), respectively. Present model predictions of maximum and convecting waste temperatures are within 1.7 degrees C (3 degrees F) of those measured in Tanks 241-AW-101 and 241-AN-104. The difference between the predicted and measured temperature is comparable to the uncertainty of the measurement equipment. These models, therefore, are suitable for estimating the temperatures within the tanks in the event of changing air flows, waste levels, and/or waste configurations

  2. Total and Compound Formation Cross Sections for Americium Nuclei: Recommendations for Coupled-Channels Calculations

    Energy Technology Data Exchange (ETDEWEB)

    Escher, J. E. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States)

    2017-04-11

    Calculations for total cross sections and compound-nucleus (CN) formation cross sections for americium isotopes are described, for use in the 2017 NA-22 evaluation effort. The code ECIS 2006 was used in conjunction with Frank Dietrich's wrapper `runtemplate'.

  3. Evaluation of the readsorption of plutonium and americium in dynamic fractionations of environmental solid samples

    DEFF Research Database (Denmark)

    Petersen, Roongrat; Hou, Xiaolin; Hansen, Elo Harald

    2008-01-01

    extractions. The degree of readsorption in dynamic and conventional batch extraction systems are compared and evaluated by using a double-spiking technique. A high degree of readsorption of plutonium and americium (>75%) was observed in both systems, and they also exhibited similar distribution patterns...

  4. ELECTROCHEMICAL CORROSION TESTING OF TANKS 241-AN-102 & 241-AP-107 & 241-AP-108 IN SUPPORT OF ULTRASONIC TESTING

    Energy Technology Data Exchange (ETDEWEB)

    WYRWAS RB; DUNCAN JB

    2008-11-20

    This report presents the results of the corrosion rates that were measured using electrochemical methods for tanks 241-AN-102 (AN-102), 241-AP-107 (AP 107), and 241-AP-108 (AP-108) performed under test plant RPP-PLAN-38215. The steel used as materials of construction for AN and AP tank farms was A537 Class 1. Test coupons of A537 Class 1 carbon steel were used for corrosion testing in the AN-107, AP-107, and AP-108 tank waste. Supernate will be tested from AN-102, AP-107, and Ap-108. Saltcake testing was performed on AP-108 only.

  5. Radiotoxicological analyses of {sup 239+240}Pu and {sup 241}Am in biological samples by anion-exchange and extraction chromatography: a preliminary study for internal contamination evaluations

    Energy Technology Data Exchange (ETDEWEB)

    Ridone, S.; Arginelli, D.; Bortoluzzi, S.; Canuto, G.; Montalto, M.; Nocente, M.; Vegro, M. [Italian National Agency for New Technologies, Energy and the Environment (ENEA), Research Centre of Saluggia, Radiation Protection Institute, Saluggia, VC (Italy)

    2006-07-01

    Many biological samples (urines and faeces) have been analysed by means of chromatographic extraction columns, utilising two different resins (AG 1-X2 resin chloride and T.R.U.), in order to detect the possible internal contamination of {sup 239{sup +}}{sup 240}Pu and {sup 241}Am, for some workers of a reprocessing nuclear plant in the decommissioning phase. The results obtained show on one hand the great suitability of the first resin for the determination of plutonium, and on the other the great selectivity of the second one for the determination of americium.

  6. Tank 241-C-103 headspace flammability

    International Nuclear Information System (INIS)

    Huckaby, J.L.

    1994-01-01

    Information regarding flammable vapors, gases, and aerosols is presented for the purpose of resolving the tank 241-C-103 headspace flammability issue. Analyses of recent vapor and liquid samples, as well as visual inspections of the tank headspace, are discussed in the context of tank dynamics. This document is restricted to issues regarding the flammability of gases, vapors, and an aerosol that may exist in the headspace of tank 241-C-103. While discussing certain information about the organic liquid present in tank 241-C-103, this document addresses neither the potential for, nor consequences of, a pool fire involving this organic liquid; they will be discussed in a separate report

  7. Tank 241-C-103 headspace flammability

    Energy Technology Data Exchange (ETDEWEB)

    Huckaby, J.L.

    1994-01-01

    Information regarding flammable vapors, gases, and aerosols is presented for the purpose of resolving the tank 241-C-103 headspace flammability issue. Analyses of recent vapor and liquid samples, as well as visual inspections of the tank headspace, are discussed in the context of tank dynamics. This document is restricted to issues regarding the flammability of gases, vapors, and an aerosol that may exist in the headspace of tank 241-C-103. While discussing certain information about the organic liquid present in tank 241-C-103, this document addresses neither the potential for, nor consequences of, a pool fire involving this organic liquid; they will be discussed in a separate report.

  8. Synthesis of zirconia sol stabilized by trivalent cations (yttrium and neodymium or americium): a precursor for Am-bearing cubic stabilized zirconia.

    Science.gov (United States)

    Lemonnier, Stephane; Grandjean, Stephane; Robisson, Anne-Charlotte; Jolivet, Jean-Pierre

    2010-03-07

    Recent concepts for nuclear fuel and targets for transmuting long-lived radionuclides (minor actinides) and for the development of innovative Gen-IV nuclear fuel cycles imply fabricating host phases for actinide or mixed actinide compounds. Cubic stabilized zirconia (Zr, Y, Am)O(2-x) is one of the mixed phases tested in transmutation experiments. Wet chemical routes as an alternative to the powder metallurgy are being investigated to obtain the required phases while minimizing the handling of contaminating radioactive powder. Hydrolysis of zirconium, neodymium (a typical surrogate for americium) and yttrium in aqueous media in the presence of acetylacetone was firstly investigated. Progressive hydrolysis of zirconium acetylacetonate and sorption of trivalent cations and acacH on the zirconia particles led to a stable dispersion of nanoparticles (5-7 nm) in the 6-7 pH range. This sol gels with time or with temperature. The application to americium-containing solutions was then successfully tested: a stable sol was synthesized, characterized and used to prepare cubic stabilized zirconia (Zr, Y, Am)O(2-x).

  9. Human bones obtained from routine joint replacement surgery as a tool for studies of plutonium, americium and {sup 90}Sr body-burden in general public

    Energy Technology Data Exchange (ETDEWEB)

    Mietelski, Jerzy W., E-mail: jerzy.mietelski@ifj.edu.pl [Henryk Niewodniczanski Institute of Nuclear Physics, Polish Academy of Sciences, Radzikowskiego 152, 31-342 Cracow (Poland); Golec, Edward B. [Traumatology and Orthopaedic Clinic, 5th Military Clinical Hospital and Polyclinic, Independent Public Healthcare Facility, Wroclawska 1-3, 30-901 Cracow (Poland); Orthopaedic Rehabilitation Department, Chair of Clinical Rehabilitation, Faculty of Motor of the Bronislaw Czech' s Academy of Physical Education, Cracow (Poland); Department of Physical Therapy Basics, Faculty of Physical Therapy, Administration College, Bielsko-Biala (Poland); Tomankiewicz, Ewa [Henryk Niewodniczanski Institute of Nuclear Physics, Polish Academy of Sciences, Radzikowskiego 152, 31-342 Cracow (Poland); Golec, Joanna [Orthopaedic Rehabilitation Department, Chair of Clinical Rehabilitation, Faculty of Motor of the Bronislaw Czech' s Academy of Physical Education, Cracow (Poland); Physical Therapy Department, Institute of Physical Therapy, Faculty of Heath Science, Jagiellonian University, Medical College, Cracow (Poland); Nowak, Sebastian [Traumatology and Orthopaedic Clinic, 5th Military Clinical Hospital and Polyclinic, Independent Public Healthcare Facility, Wroclawska 1-3, 30-901 Cracow (Poland); Orthopaedic Rehabilitation Department, Chair of Clinical Rehabilitation, Faculty of Motor of the Bronislaw Czech' s Academy of Physical Education, Cracow (Poland); Szczygiel, Elzbieta [Physical Therapy Department, Institute of Physical Therapy, Faculty of Heath Science, Jagiellonian University, Medical College, Cracow (Poland); Brudecki, Kamil [Henryk Niewodniczanski Institute of Nuclear Physics, Polish Academy of Sciences, Radzikowskiego 152, 31-342 Cracow (Poland)

    2011-06-15

    The paper presents a new sampling method for studying in-body radioactive contamination by bone-seeking radionuclides such as {sup 90}Sr, {sup 239+240}Pu, {sup 238}Pu, {sup 241}Am and selected gamma-emitters, in human bones. The presented results were obtained for samples retrieved from routine surgeries, namely knee or hip joints replacements with implants, performed on individuals from Southern Poland. This allowed to collect representative sets of general public samples. The applied analytical radiochemical procedure for bone matrix is described in details. Due to low concentrations of {sup 238}Pu the ratio of Pu isotopes which might be used for Pu source identification is obtained only as upper limits other then global fallout (for example Chernobyl) origin of Pu. Calculated concentrations of radioisotopes are comparable to the existing data from post-mortem studies on human bones retrieved from autopsy or exhumations. Human bones removed during knee or hip joint surgery provide a simple and ethical way for obtaining samples for plutonium, americium and {sup 90}Sr in-body contamination studies in general public. - Highlights: > Surgery for joint replacement as novel sampling method for studying in-body radioactive contamination. > Proposed way of sampling is not causing ethic doubts. > It is a convenient way of collecting human bone samples from global population. > The applied analytical radiochemical procedure for bone matrix is described in details. > The opposite patient age correlations trends were found for 90Sr (negative) and Pu, Am (positive).

  10. Tank characterization report: Tank 241-C-109

    Energy Technology Data Exchange (ETDEWEB)

    Simpson, B.C.; Borshiem, G.L.; Jensen, L.

    1993-09-01

    Single-shell tank 241-C-109 is a Hanford Site Ferrocyanide Watch List tank that was most recently sampled in September 1992. Analyses of materials obtained from tank 241-C-109 were conducted to support the resolution of the ferrocyanide unreviewed safety question (USQ) and to support Hanford Federal Facility Agreement and consent Order (Tri- Party Agreement) Milestone M-10-00. This report describes this analysis.

  11. Tank characterization report: Tank 241-C-109

    International Nuclear Information System (INIS)

    Simpson, B.C.; Borshiem, G.L.; Jensen, L.

    1993-09-01

    Single-shell tank 241-C-109 is a Hanford Site Ferrocyanide Watch List tank that was most recently sampled in September 1992. Analyses of materials obtained from tank 241-C-109 were conducted to support the resolution of the ferrocyanide unreviewed safety question (USQ) and to support Hanford Federal Facility Agreement and consent Order (Tri- Party Agreement) Milestone M-10-00. This report describes this analysis

  12. Plant uptake and transport of 241Am

    International Nuclear Information System (INIS)

    Wallace, A.; Romney, E.M.; Mueller, R.T. Sr.; soufi, S.M.

    1981-01-01

    We conducted several experiments with 241 Am to obtain a more complete understanding of how this transuranium element is absorbed and transported in plants. In a plant species (Tamarix pentandra Pall.) that has salt glands in the leaves excreting NaCl and other ions, 241 Am was not pumped through these glands. Cyanide, which forms complexes with any metals, when applied to a calcareous soil, greatly increased the transport of 241 Am into stems and leaves of bush bean plants. Radioactive cyanide ( 14 C) was also transported to leaves and stems. When radish was grown in both calcareous and noncalcareous soils, 241 Am appeared to be fixed on the peel so firmly that it was resistant to removal by HNO 3 washing. The chelating agent DTPA induced increased transport of 241 Am to leaves and into the fleshy roots of the radish. Data for Golden Cross hybrid corn grown in solution culture showed at least seven times as much 241 Am transport to the xylem exudatields are corrected by recovery of added tracers

  13. Structural characterisations and mechanistic investigations of the selective dissolution of americium by the ferricyanide ions in alkaline media. Application for the partitioning americium curium

    International Nuclear Information System (INIS)

    Fouchard, Sebastien

    2000-01-01

    Americium exhibits a high solubility form in basic media under oxidant conditions, unlike the other Transplutonium elements (TPE). This property can be used in the frame of High Level Liquid Waste (HLLW) treatment in order to extract preferentially the americium element, the main responsible of the long term radiotoxicity of the nuclear waste. This soluble compound can be obtained by addition of a concentrated basic solution of Fe(CN) 6 3- ions on Am(OH) 3 precipitates. This technique enables a rapid extraction of Am by the synthesis of this soluble form in alkaline solutions. Under these conditions, the other TPE remain in the solid state as trivalent hydroxide solids, strongly insoluble. In the case of dissolutions involving large amounts of Am(OH) 3 , the formation of the soluble complex is concomitant with the appearance of a reddish precipitate in the basic solution. Dissolution experiments which were carried out on this solid in NaOH/Fe(CN) 6 3- have demonstrated the dependency of the solubility equilibria with the media. Spectroscopic studies (UV Visible, XAS) on the precipitate have enabled the determination of the chemical structure and the oxidation state of the americium in the solid: Na 2 Am(V)O 2 (OH) 3 ,nH 2 O. Electrochemical studies on the americium solution have confirmed that the oxidation of Am(OH) 3 by the Fe(CN) 6 3- ions in basic media could only lead to the pentavalent form. A stoichiometric study carries out between a AmO 2 + ion and one Fe(CN) 6 3- ion and the spectroscopic characterisation of this reaction have demonstrated that the Fe(CN) 6 3- ion didn't remain as an un-complexed form in solution after the alkaline mixing. These results tend to prove that this dissolution of Am(OH) 3 is much more complex than a simple oxidation by the Fe(CN) 6 3- ions. The existence of molecular interactions between AmO 2 + and Fe(CN) 6 3- has been postulated and a mechanistic scheme has been proposed in order to explain the appearance of the soluble

  14. Biochemical behaviour of plutonium and americium and geochemical modelling of the soil solution

    International Nuclear Information System (INIS)

    Bryan, N.D.; Livens, F.R.; Horrill, A.D.

    1994-01-01

    Field observations suggest that plutonium and americium in the environment are present in very different chemical forms in the interstitial waters of an intertidal sediment. Thermodynamic modelling using the PHREEQE code predicts that plutonium is present entirely in oxidation state (V) as the PuO 2 CO 3 - ion, whereas americium is present entirely in oxidation state (III), largely as the uncharged Am(OH)CO 3 species, but with significant concentrations of the Am 3+ and the AmSO 4 + ions. There are, however, differences between these predictions and others published for a very similar system which apparently arise from uncertainties in the thermodynamic data. Field data cannot resolve these differences unambiguously. (author) 29 refs.; 3 tabs

  15. High-purity germanium detection system for the in vivo measurement of americium and plutonium

    International Nuclear Information System (INIS)

    Tyree, W.H.; Falk, R.B.; Wood, C.B.; Liskey, R.W.

    1976-01-01

    A high-purity germanium (HPGe) array, photon-counting system has been developed for the Rocky Flats Plant Body-Counter Medical Facility. The newly improved system provides exceptional resolutions of low-energy X-ray and gamma-ray spectra associated with the in vivo deposition of plutonium and americium. Described are the operational parameters of the system and some qualitative results illustrating detector performance for the photon emissions produced from the decay of plutonium and americium between energy ranges from 10 to 100 kiloelectron volts. Since large amounts of data are easily generated with the system, data storage, analysis, and computer software developments continue to be an essential ingredient for processing spectral data obtained from the detectors. Absence of quantitative data is intentional. The primary concern of the study was to evaluate the effects of the various physical and electronic operational parameters before adding those related entirely to a human subject

  16. Electrodeposition of americium on a liquid cadmium cathode from a molten salt bath

    International Nuclear Information System (INIS)

    Laplace, A.; Lacquement, J.; Maillard, C.; Donner, L.

    2004-01-01

    A high-activity experiment involving the electrode position of americium on a liquid cadmium cathode from a LiCl-KCl eutectic with about 3 g of AmO 2 was conducted in a shielded cell in the ATALANTE complex. After describing the electrolyzer and the experimental conditions, the authors discuss the preparation of the LiCl-KCl-AmCl 3 solution and briefly review its electrochemical properties. It was clearly confirmed that Am(III) reduction on an inert solid cathode occurs in two steps forming Am(II) before Am(0), whereas only one reduction step was observed on liquid cadmium. The main results of this study concern americium electrode position on the liquid cadmium cathode (recovery yields, current densities, problems encountered). The solvent properties of cadmium for actinide/lanthanide separation are discussed. (authors)

  17. Valuation of contamination of Am-241 by smear test and characterization of waste by scintillation liquid medium

    International Nuclear Information System (INIS)

    Cardoso, Gabriella Souza; Santos, Eliane Eugenia dos; Mingote, Raquel Maia; Barbosa, Rugles Cesar

    2011-01-01

    The radioactive lightning rods Interim storage facility receives Midwest Regional Center for Nuclear Science - CRCN-CO, and contains the majority of devices called radioactive lightning rods, and so is our main study object with an interest in be adapt of Interim storage facility (ID) Radiation Protection requirements and management of radioactive waste. The radioactive lightning rods are devices that contain Americium 241 that fall under the categorization of radioactive sources (IAEA-TECDOC-1191) in category 4 (same device category of the static Eliminator type). The handling, transportation, maintenance, segregation and disposal of accessories and devices emitting ionizing radiation in which involve procedures require: special types of packaged, storage techniques, cleaning/hygiene and inventoried and equipment for Radiation Protection. Cleaning and hygiene as well as the disposition criterion of accessories makes it necessary for the introduction of safe cleanup criterion and more specific that the criterion for exemption. The radioactive lightning rods have brackets that represent physical danger in shipping and handling as well as liabilities of contamination as well as in the case of being contaminated, agents in the transfer of contaminants (Am-241) it is necessary to adopt analysis methodologies and procedures and criterion for the management of radioactive and nonradioactive materials. (author)

  18. Valuation of contamination of Am-241 by smear test and characterization of waste by scintillation liquid medium

    Energy Technology Data Exchange (ETDEWEB)

    Cardoso, Gabriella Souza [Pontificia Universidade Catolica de Goias (PUC-GO), Goiania, GO (Brazil). Dept. Matematica, Fisica, Quimica e Engenharia de Alimentos; Santos, Eliane Eugenia dos; Mingote, Raquel Maia; Barbosa, Rugles Cesar, E-mail: esantos@cnen.gov.b, E-mail: mingote@cnen.gov.b, E-mail: rbarbosa@cnen.gov.b [Centro Regional de Ciencias Nucleares do Centro Oeste (CRCN-CO/CNEN-GO), Abadia de Goias, GO (Brazil). Lab. de Radioprotecao

    2011-07-01

    The radioactive lightning rods Interim storage facility receives Midwest Regional Center for Nuclear Science - CRCN-CO, and contains the majority of devices called radioactive lightning rods, and so is our main study object with an interest in be adapt of Interim storage facility (ID) Radiation Protection requirements and management of radioactive waste. The radioactive lightning rods are devices that contain Americium 241 that fall under the categorization of radioactive sources (IAEA-TECDOC-1191) in category 4 (same device category of the static Eliminator type). The handling, transportation, maintenance, segregation and disposal of accessories and devices emitting ionizing radiation in which involve procedures require: special types of packaged, storage techniques, cleaning/hygiene and inventoried and equipment for Radiation Protection. Cleaning and hygiene as well as the disposition criterion of accessories makes it necessary for the introduction of safe cleanup criterion and more specific that the criterion for exemption. The radioactive lightning rods have brackets that represent physical danger in shipping and handling as well as liabilities of contamination as well as in the case of being contaminated, agents in the transfer of contaminants (Am-241) it is necessary to adopt analysis methodologies and procedures and criterion for the management of radioactive and nonradioactive materials. (author)

  19. Production of monodisperse respirable aerosols of 241AmO2 and evaluation of in vitro dissolution

    International Nuclear Information System (INIS)

    Boyd, H.A.; Raabe, O.G.; Peterson, P.K.

    1974-01-01

    A method is described for production of monodisperse (sigma//sub g/ less than 1.2) particles of 241 AmO 2 for use in inhalation experiments with dogs and rodents. The effects of physical and chemical factors on the production of polydisperse aerosols of 241 AmO 2 were studied and evaluated. The best aerosol was achieved when a suspension of americium hydroxide with 2.5 mg Am/ml at pH = 7.3 was aerosolized and passed through two heating columns in succession, the first at 300 0 C and the second at 1050 0 C. The particles were roughly spherical and had densities near 8 gm/cm 3 ; the aerosol AMAD and sigma/sub g/ were about 1.5 μm and 1.7, respectively. Monodisperse particles were separated and collected with the Lovelace Aerosol Particle Separator (LAPS) and subsequently suspended in deionized water with pH adjusted to 10.2 with NH 3 for nebulization to produce monodisperse aerosols for inhalation exposures. Particles collected on filters during inhalation experiments were used for evaluation of in vitro dissolution rates with two systems and various forms of a lung fluid simulant. The important role of phosphate ions in such dissolution systems was demonstrated, suggesting the potential for the equally important role of free phosphate in retarding dissolution of AmO 2 particles in the lung. (U.S.)

  20. Waste Feed Delivery Strategy for Tanks 241-AN-102 and 241-AN-107

    International Nuclear Information System (INIS)

    BLACKER, S.M.

    2000-01-01

    This engineering study establishes the detailed retrieval strategy, equipment requirements, and key parameters for preparing detailed process flowsheets; evaluates the technical and programmatic risks associated with processing, certifying, transferring, and delivering waste from Tanks 241-AN-102 and 241-AN-107 to BNFL; and provides a list of necessary follow-on actions so that program direction from ORP can be successfully implemented

  1. Waste Feed Delivery Strategy for Tanks 241-AN-102 and 241-AN-107

    Energy Technology Data Exchange (ETDEWEB)

    BLACKER, S.M.

    2000-04-13

    This engineering study establishes the detailed retrieval strategy, equipment requirements, and key parameters for preparing detailed process flowsheets; evaluates the technical and programmatic risks associated with processing, certifying, transferring, and delivering waste from Tanks 241-AN-102 and 241-AN-107 to BNFL; and provides a list of necessary follow-on actions so that program direction from ORP can be successfully implemented.

  2. Determination of americium and plutonium in autopsy tissue: methods and problems

    International Nuclear Information System (INIS)

    Boyd, H.A.; Eutsler, B.C.; McInroy, J.F.

    1979-01-01

    The current methods used by the tissue analysis program at LASL for the determination of americium and plutonium in autopsy tissue are described. Problems affecting radiochemical yield are discussed. Included are problems associated with sample preparation, separation of plutonium from large amounts of bone ash, and reagent contamination. The average 242 Pu tracer yield for 1800 Pu determinations is 78 +- 12%. The average 242 Am tracer yield is 85 +- 7% for 40 determinations

  3. Quantitative determination of americium and curium in solutions using potassium tungstophosphate

    International Nuclear Information System (INIS)

    Chistyakov, V.M.; Baranov, A.A.; Erin, E.A.; Timoaeev, G.A.

    1990-01-01

    Two methods of americium (4) and curium (4) titration-replacement and redox ones - have been considered. According to the replacement method thorium nitrate solution was used as a titrant and the final point of titration was determined spectophotometrically. Using the method developed, on the basis of experimental data, the composition of thorium (4) complex with potassium tungstophosphate was determined. In case of the redox titration sodium nitrite was used, and the final titration point was indicated either spectrophotometrically or potentiometrically

  4. Experimental studies to validate model calculations and maximum solubility limits for Plutonium and Americium

    International Nuclear Information System (INIS)

    2017-01-01

    This report focuses on studies of KIT-INE to derive a significantly improved description of the chemical behaviour of Americium and Plutonium in saline NaCl, MgCl 2 and CaCl 2 brine systems. The studies are based on new experimental data and aim at deriving reliable Am and Pu solubility limits for the investigated systems as well as deriving comprehensive thermodynamic model descriptions. Both aspects are of high relevance in the context of potential source term estimations for Americium and Plutonium in aqueous brine systems and related scenarios. Americium and Plutonium are long-lived alpha emitting radionuclides which due to their high radiotoxicity need to be accounted for in a reliable and traceable way. The hydrolysis of trivalent actinides and the effect of highly alkaline pH conditions on the solubility of trivalent actinides in calcium chloride rich brine solutions were investigated and a thermodynamic model derived. The solubility of Plutonium in saline brine systems was studied under reducing and non-reducing conditions and is described within a new thermodynamic model. The influence of dissolved carbonate on Americium and Plutonium solubility in MgCl 2 solutions was investigated and quantitative information on Am and Pu solubility limits in these systems derived. Thermodynamic constants and model parameter derived in this work are implemented in the Thermodynamic Reference Database THEREDA owned by BfS. According to the quality assurance approach in THEREDA, is was necessary to publish parts of this work in peer-reviewed scientific journals. The publications are focused on solubility experiments, spectroscopy of aquatic and solid species and thermodynamic data. (Neck et al., Pure Appl. Chem., Vol. 81, (2009), pp. 1555-1568., Altmaier et al., Radiochimica Acta, 97, (2009), pp. 187-192., Altmaier et al., Actinide Research Quarterly, No 2., (2011), pp. 29-32.).

  5. Solubilization of 241AmO2 in alveolar macrophage cultures

    International Nuclear Information System (INIS)

    Robinson, A.V.; Schneider, R.P.

    1980-01-01

    Cultured rabbit alveolar macrophages were used to study the effect of phagocytosis on the solubilization of 241 AmO 2 . A comparison was made of the solubility of phagocytized AmO 2 and AmO 2 in cell-free media, in the presence and absence of 0.1 mM DTPA. A time-dependent increase of 26% in the soluble (0.1-μm filtrate) intracellular americium fraction was seen in macrophages cultured for 3 days. The addition of 0.1mM DTPA to culture medium resulted in an increase of 36% over the same time period. In contrast, cell-free media without DTPA resulted in less than a 2% increase in solubility after 4 days of incubation, while addition of 0.1mM DTPA resulted in a 5% increase over the same time period. These results indicate cell-mediated solbuilization of phagocytized AmO 2 by macrophages

  6. Acceptance test procedure, 241-SY-101/241-C-106 shot loading system

    International Nuclear Information System (INIS)

    Ostrom, M.J.

    1994-01-01

    This Acceptance Test Procedure is for the 241-SY-101/241-C-106 Shot Loading System. The procedure will test the components of the Shot Loading System and its capability of adequately loading shot into the annular space of the Container. The loaded shot will provide shielding as required for transporting and storage of a contaminated pump after removal from the tank. This test serves as verification that the SLS is acceptable for use in the pump removal operations for Tanks 241-SY-101, 241-C-106 and 241-AY-102. The pump removal operation for these three tanks will be performed by two different organizations with different equipment, but the Shot Loading System will be compatible between the two operations

  7. Bis(2-ethylhexyl)sulfoxide as an extractant for americium(III) from aqueous nitrate media

    International Nuclear Information System (INIS)

    Shukla, J.P.; Kedari, C.S.

    1992-01-01

    Solvent extraction separation of Am(III) from dilute aqueous nitrate media into n-dodecane by bis(2-ethylhexyl)sulfoxide (BESO) has been investigated over a wide range of experimental conditions. Very poor extractability of Am(III) necessitated the use of calcium nitrate as the salting-out agent. Effects of certain variables such as acidity, extractant concentration, salting-out agent concentration, organic diluents on the metal extraction by BESO have been examined in detail. By increasing the concentration of BESO in organic phase or calcium nitrate in aqueous phase, nearly quantitative extraction of americium even from moderate acidity is accomplished. Slope analyses applied to Am(III) distribution experiments from acidic nitrate solutions indicate predominant formation of the trisolvated organic phase complex, Am(NO 3 ) 3 *3BESO for which equilibrium constant is found to be, log K x = 1.99. Extraction behavior of Am(III) has also been evaluated in the presence of several water-miscible polar organic solvents to study their possible synergistic effects on its extraction. Extractability of americium increased 5 to 10-fold with increasing concentration of some of these additives, with maximum enhancement being observed in the presence of acetone or acetonitrile. Recovery of BESO from loaded americium is easily obtained using dilute nitric acid as the strippant. (author) 30 refs.; 2 figs.; 5 tabs

  8. Fabrication of uranium-americium mixed oxide pellet from microsphere precursors: Application of CRMP process

    Science.gov (United States)

    Remy, E.; Picart, S.; Delahaye, T.; Jobelin, I.; Lebreton, F.; Horlait, D.; Bisel, I.; Blanchart, P.; Ayral, A.

    2014-10-01

    Mixed uranium-americium oxides are one of the materials envisaged for Americium Bearing Blankets dedicated to transmutation in fast neutron reactors. Recently, several processes have been developed in order to validate fabrication flowchart in terms of material specifications such as density and homogeneity but also to suggest simplifications for lowering industrial costs and hazards linked to dust generation of highly contaminating and irradiating compounds. This study deals with the application of an innovative route using mixed oxide microspheres obtained from metal loaded resin bead calcination, called Calcined Resin Microsphere Pelletization (CRMP). The synthesis of mixed oxide microsphere precursor of U0.9Am0.1O2±δ is described as well as its characterisation. The use of this free-flowing precursor allows the pressing and sintering of one pellet of U0.9Am0.1O2±δ. The ceramic obtained was characterised and results showed that its microstructure is dense and homogeneous and its density attains 95% of the theoretical density. This study validates the scientific feasibility of the CRMP process applied to the fabrication of uranium and americium-containing materials.

  9. Influence of dissolved organic substances in groundwater on sorption behavior of americium and neptunium

    International Nuclear Information System (INIS)

    Boggs, S. Jr.; Seitz, M.G.

    1984-01-01

    Groundwaters typically contain dissolved organic carbon consisting largely of high molecular weight compounds of humic and fulvic acids. To evaluate whether these dissolved organic substances can enhance the tranport of radionuclides through the groundwater system, experiments were conducted to examine the sorption of americium and neptunium onto crushed basalt in the presence of dissolved humic- and fulvic-acid organic carbon introduced into synthetic groundwater. The partitioning experiments with synthetic groundwater show that increasing the concentration of either humic or fulvic acid in the water has a significant inhibiting effect on sorption of both americium and neptunium. At 22 0 C, adsorption of these radionuclides, as measured by distribution ratios (the ratio of nuclide sorbed onto the solid to nuclide in solution at the end of the experiment), decreased by 25% to 50% by addition of as little as 1 mg/L dissolved organic carbon and by one to two orders of magnitude by addition of 100 to 200 mg/L dissolved organic carbon. Distribution ratios measured in solutions reacted at 90 0 C similarly decreased with the addition of dissolved organic carbon but generally ranged from one to two orders of magnitude higher than those determined in the 22 0 C experiment. These results suggest that organic carbon dissolved in deep groundwaters may significantly enhance the mobility of radionuclides of americium and neptunium. 23 references, 5 figures, 11 tables

  10. Retention and translocation of foliar applied {sup 239,240}Pu and {sup 241}Am, as compared to {sup 137}Cs and {sup 85}Sr, into bean plants (Phaseolus vulgaris)

    Energy Technology Data Exchange (ETDEWEB)

    Henner, P. [Institute for Radioprotection and Nuclear Safety, Environment and Emergency Operations Division, Department for the Study of Radionuclides Behaviour in Ecosystems, Laboratory of Radioecology and Ecotoxicology, IRSN/DPRE/SECRE/LRE, Cadarache Centre, Building 186, BP 3, 13115 Saint-Paul-lez-Durance (France)]. E-mail: pascale.henner@irsn.fr; Colle, C. [Institute for Radioprotection and Nuclear Safety, Environment and Emergency Operations Division, Department for the Study of Radionuclides Behaviour in Ecosystems, Laboratory of Radioecology and Ecotoxicology, IRSN/DPRE/SECRE/LRE, Cadarache Centre, Building 186, BP 3, 13115 Saint-Paul-lez-Durance (France); Morello, M. [Institute for Radioprotection and Nuclear Safety, Environment and Emergency Operations Division, Department for the Study of Radionuclides Behaviour in Ecosystems, Laboratory of Radioecology and Ecotoxicology, IRSN/DPRE/SECRE/LRE, Cadarache Centre, Building 186, BP 3, 13115 Saint-Paul-lez-Durance (France)

    2005-07-01

    Foliar transfer of {sup 241}Am, {sup 239,240}Pu, {sup 137}Cs and {sup 85}Sr was evaluated after contamination of bean plants (Phaseolus vulgaris) at the flowering development stage, by soaking their first two trifoliate leaves into contaminated solutions. Initial retentions of {sup 241}Am (27%) and {sup 239,240}Pu (37%) were higher than those of {sup 137}Cs and {sup 85}Sr (10-15%). Mean fraction of retained activity redistributed among bean organs was higher for {sup 137}Cs (20.3%) than for {sup 239,240}Pu (2.2%), {sup 241}Am (1%) or {sup 85}Sr (0.1%). Mean leaf-to-pod translocation factors (Bq kg{sup -1}dry weight pod/Bq kg{sup -1}dry weight contaminated leaves) were 5.0 x 10{sup -4} for {sup 241}Am, 2.7 x 10{sup -6} for {sup 239,240}Pu, 5.4 x 10{sup -2} for {sup 137}Cs and 3.6 x 10{sup -4} for {sup 85}Sr. Caesium was mainly recovered in pods (12.8%). Americium and strontium were uniformly redistributed among leaves, stems and pods. Plutonium showed preferential redistribution in oldest bean organs, leaves and stems, and very little redistribution in forming pods. Results for americium and plutonium were compared to those of strontium and caesium to evaluate the consistency of the attribution of behaviour of strontium to transuranium elements towards foliar transfer, based on translocation factors, as stated in two radioecological models, ECOSYS-87 and ASTRAL.

  11. Facilities for preparing actinide or fission product-based targets

    CERN Document Server

    Sors, M

    1999-01-01

    Research and development work is currently in progress in France on the feasibility of transmutation of very long-lived radionuclides such as americium, blended with an inert medium such as magnesium oxide and pelletized for irradiation in a fast neutron reactor. The process is primarily designed to produce ceramics for nuclear reactors, but could also be used to produce targets for accelerators. The Actinide Development Laboratory is part of the ATALANTE complex at Marcoule, where the CEA investigates reprocessing, liquid and solid waste treatment and vitrification processes. The laboratory produces radioactive sources; after use, their constituents are recycled, notably through R and D programs requiring such materials. Recovered americium is purified, characterized and transformed for an experiment known as ECRIX, designed to demonstrate the feasibility of fabricating americium-based ceramics and to determine the reactor transmutation coefficients.

  12. Determination of environmental levels of 239240Pu, 241Am, 137Cs, and 90Sr in large volume sea water samples

    International Nuclear Information System (INIS)

    Sutton, D.C.; Calderon, G.; Rosa, W.

    1976-06-01

    A method is reported for the determination of environmental levels of 239 240 Pu and 241 Am in approximately 60-liter size samples of seawater. 137 Cs and 90 Sr were also separated and determined from the same samples. The samples were collected at the sea surface and at various depths in the oceans through the facilities of the Woods Hole Oceanographic Institution. Plutonium and americium were separated from the seawater by iron hydroxide scavenging then treated with a mixture of nitric, hydrochloric, and perchloric acids. A series of anion exchange separations were used to remove interferences and purify plutonium and americium; then each was electroplated on platinum disks and measured by solid state alpha particle spectrometry. The overall chemical yields averaged 62 +- 9 and 69 +- 14 percent for 236 Pu, and 243 Am tracers, respectively. Following the iron hydroxide scavenge of the transuranics, cesium was removed from the acidified seawater matrix by adsorption onto ammonium phosphomolybdate. Cesium carrier and 137 Cs isolation was effected by ion exchange and precipitations were made using chloroplatinic acid. The samples were weighed to determine overall chemical yield then beta counted. Cesium recoveries averaged 75 +- 5 percent. After cesium was removed from the seawater matrix, the samples were neutralized with sodium hydroxide and ammonium carbonate was added to precipitate 85 Sr tracer and the mixed alkaline earth carbonates. Strontium was separated as the nitrate and scavenged by chromate and hydroxide precipitations. Yttrium-90 was allowed to build up for two weeks, then milked and precipitated as the oxalate, weighed, and beta counted. The overall chemical yields of 85 Sr tracer averaged 84 +- 16 percent. The recovery of the yttrium oxalate precipitates averaged 96 +- 3 percent

  13. 90Sr and 239+240Pu 238Pu 241Am in some samples of mushrooms and forest soil from Poland

    International Nuclear Information System (INIS)

    Mietelski, J.W.; LaRosa, J.; Ghods, A.

    1993-01-01

    Strontium-90, plutonium and americium activity concentrations in a few samples of forest soils, some species of mushrooms and fern leaves have been determined. These results are compared with cesium activity concentrations in the same materials obtained in a previous work. Radiochemical procedures are described. The origin of the contamination (Chernobyl accident or nuclear test explosion release) is discussed. The 90 Sr activity concentration ranges from 0.6 Bq/kg (mushroom samples) to 48.4 Bq/kg (fern leaves). For 239+240 Pu, it ranges from not detected above background (mushrooms, fern) to 10.8 Bq/kg (humus layer of forest soil). The maximum concentration of 241 Am is found to be 2.4 Bq/kg (humus sample) and for 238 Pu it is 0.85 Bq/kg (also in the humus sample). (author) 16 refs.; 7 figs.; 3 tabs

  14. 48 CFR 241.101 - Definitions.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Definitions. 241.101... Definitions. As used in this part— Independent regulatory body means the Federal Energy Regulatory Commission... suppliers. Nonindependent regulatory body means a body that regulates a utility supplier which is owned or...

  15. Tank 241-AP-107 tank characterization plan

    International Nuclear Information System (INIS)

    Schreiber, R.D.

    1994-01-01

    This document is a plan which serves as the contractual agreement between the Characterization Program, Sampling Operations, WHC 222-S Laboratory, and PNL 325 Analytical Chemistry Laboratory. The scope of this plan is to provide guidance for the sampling and analysis of samples from tank 241-AP-107

  16. Tank 241-U-111 tank characterization plan

    International Nuclear Information System (INIS)

    Carpenter, B.C.

    1995-01-01

    This document is a plan which serves as the contractual agreement between the Characterization Program, Sampling Operations, Oak Ridge National Laboratory, and PNL tank vapor program. The scope of this plan is to provide guidance for the sampling and analysis of vapor samples from tank 241-U-111

  17. 50 CFR 665.241 - Definitions.

    Science.gov (United States)

    2010-10-01

    ..., DEPARTMENT OF COMMERCE (CONTINUED) FISHERIES IN THE WESTERN PACIFIC Hawaii Fisheries § 665.241 Definitions... following areas: (1) Crustacean Permit Area 1 (Permit Area 1) means the EEZ around the NWHI. (2) Crustacean Permit Area 2 (Permit Area 2) means the EEZ around the MHI. (3) Crustacean Permit Area 1 VMS Subarea...

  18. Tank 241-TY-104 Tank characterization plan

    Energy Technology Data Exchange (ETDEWEB)

    Schreiber, R.D. [Westinghouse Hanford Co., Richland, WA (United States)

    1995-02-15

    This document is a plan which serves as the contractual agreement between the Characterization Program, Sampling Operations, and WHC 222-C Laboratory. The scope of this plan is to provide guidance for the sampling and analysis of samples for tank 241-TY-104.

  19. 27 CFR 25.241 - Production.

    Science.gov (United States)

    2010-04-01

    ... THE TREASURY LIQUORS BEER Cereal Beverage § 25.241 Production. Brewers may produce cereal beverage and... content of the cereal beverage will not increase while in the original container after removal from the brewery. The brewer shall keep cereal beverage separate from beer, and shall measure the quantity of...

  20. Tank 241-TX-105 tank characterization plan

    International Nuclear Information System (INIS)

    Carpenter, B.C.

    1995-01-01

    This document is a plan which serves as the contractual agreement between the Characterization Program, Sampling Operations, WHC 222-S Laboratory, Oak Ridge National Laboratory, and PNL tank vapor program. The scope of this plan is to provide guidance for the sampling and analysis of vapor samples from tank 241-TX-105

  1. Tank 241-AX-102 tank characterization plan

    Energy Technology Data Exchange (ETDEWEB)

    Schreiber, R.D.

    1995-01-24

    This document is a plan which serves as the contractual agreement between the Characterization Program, Sampling Operations, WHC 222-S Laboratory, and PNL 325 Analytical Chemistry Laboratory. The scope of this plan is to provide guidance for the sampling and analysis of samples from tank 241-AX-102.

  2. Determination of 241Am and 244Cm in environmental samples

    International Nuclear Information System (INIS)

    Bonino, N.O.; Grinman, A.D.R.; Serdeiro, N.H.

    1998-01-01

    The present technique describes a method to separate, purify and measure low levels of americium and curium in different environmental samples such as sediments, soils, water, vegetables, and air filters. The determination of radionuclides in theses environmental matrices have analytical problems, since a simple method doesn't exist for the purification, which is indispensable for its later measuring alpha spectrometry. The developed technique consist on taking an aliquot of the sample to analyze, to add tracer as americium 243 and curium 242, and to dissolve the matrix in a such way to have a clear solution. For the isolation of the americium and curium of the other actinides ar used as separation techniques: precipitation with Fe 3+ , anionic and cationic exchange, and extraction with a appropriate organic solvent. The purification of the americium and curium is followed by the electrodeposition habitually used. The measurement is carried out by alpha spectrometry with a detector of implanted ion. The detection limit for this techniques is of 0,002 Bq/l or 0,2 mBq in the case of filters. (author)

  3. 24 CFR 241.860 - Commissioner's right to require acceleration.

    Science.gov (United States)

    2010-04-01

    ... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Commissioner's right to require acceleration. 241.860 Section 241.860 Housing and Urban Development Regulations Relating to Housing and Urban... Insurance § 241.860 Commissioner's right to require acceleration. Upon receipt of notice of the failure of...

  4. 48 CFR 252.241-7001 - Government access.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Government access. 252.241... Clauses 252.241-7001 Government access. As prescribed in 241.501-70(b), use the following clause: Government Access (DEC 1991) Authorized representatives of the Government may have access to the Contractor's...

  5. 27 CFR 24.241 - Decolorizing juice or wine.

    Science.gov (United States)

    2010-04-01

    ... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false Decolorizing juice or wine. 24.241 Section 24.241 Alcohol, Tobacco Products and Firearms ALCOHOL AND TOBACCO TAX AND TRADE BUREAU, DEPARTMENT OF THE TREASURY LIQUORS WINE Storage, Treatment and Finishing of Wine § 24.241 Decolorizing juice or wine. (a) Conditions and...

  6. Comparison of acid leachate and fusion methods to determine plutonium and americium in environmental samples

    International Nuclear Information System (INIS)

    Smith, L.L.; Markun, F.; TenKate, T.

    1992-06-01

    The Analytical Chemistry Laboratory at Argonne National Laboratory performs radiochemical analyses for a wide variety of sites within the Department of Energy complex. Since the chemical history of the samples may vary drastically from site to site, the effectiveness of any analytical technique may also vary. This study compares a potassium fluoride-pyrosulfate fusion technique with an acid leachate method. Both normal and high-fired soils and vegetation samples were analyzed for both americium and plutonium. Results show both methods work well, except for plutonium in high-fired soils. Here the fusion method provides higher accuracy

  7. Influence of biofilms on migration of uranium, americium and europium in the environment

    International Nuclear Information System (INIS)

    Baumann, Nils; Zirnstein, Isabel; Arnold, Thuro

    2015-01-01

    The report on the influence of biofilms on migration of uranium, americium and europium in the environment deals with the contamination problems of uranium mines such as SDAG WISMUT in Saxonia and Thuringia. In mine waters microorganisms form a complex microbiological biocoenosis in spite of low pH values and high heavy metal concentrations including high uranium concentrations. The analyses used microbiological methods like confocal laser scanning microscopy and molecular-biological techniques. The interactions of microorganism with fluorescent radioactive heavy metal ions were performed with TRLFS (time resolved laser-induced fluorescence spectroscopy).

  8. Rad Calc III: Radioanalysis calculation program for plutonium and americium determination

    International Nuclear Information System (INIS)

    Blackadar, J.M.; Wong, A.S.; Stalnaker, N.D.; Willerton, J.R.

    2000-01-01

    The radiochemistry team of the Analytical Chemistry Group has supported nuclear materials production and management programs at Los Alamos National Laboratory since the 1940s. Routinely, plutonium and americium contents in various matrices (such as metals, oxides, process solutions, and waste streams) are determined by direct alpha and gamma analyses. Over the years, analysts have written a number of computer programs to calculate analytical results. In 1999, the program was enhanced and upgraded to produce Rad Calc III. The new program, written in Visual Basic 4.0, corrects limitations of previous versions, offers enhanced features, and incorporates user suggestions to customize the program and make it more user friendly

  9. A radiochemical procedure for a low-level measurement of ''241Am in environmental samples using a supported functional organo phosphorus extractant; Metodo analitico para la determinacion de ''241Am en muestras biologicas y sedimentos marinos mediante uso de una columna con extractante organico

    Energy Technology Data Exchange (ETDEWEB)

    Gasco, C.; Anton, M. P.; Alvarez, A.; Navarro, N.; Salvador, S.

    1994-07-01

    The transuranides analysis in environmental samples is carried out by CIEMAT using standardized methods based on sequential separation with ionic-exchange resins. The americium fraction is purified through a two-layer ion exchange column and lately in an anion-exchange column in nitric acid methanol medium. The technique is time consuming and the results are not completely satisfactory (low recovery and loss of a-resolution) for some samples. The chemical compound CMPO (octyl(phenyl)-N,N-diisobutyl carbomoylmethyiphosphine oxide) dissolved in TPB (tributyl phosphate) and supported on an inert substrate has been tested directly for ''241Am analysis by a large number of laboratories. A new method that combines both procedures has been developed. The details of the improved procedure are described in this paper. The advantages of its application to environmental samples (urine, faeces and sediments) are discussed. The utilization of standard samples, with americium certified concentrations confirms the reliability of our measurements. (Author) 8 refs.

  10. Study of the extraction and the purification of americium and trivalent actinides contained in effluents with supported liquid membranes

    International Nuclear Information System (INIS)

    Guillou, P.

    1990-12-01

    The supported liquid membrane technique is studied and developed for americium recovery from uranium or plutonium matrices and decontamination of liquid radioactive wastes. First tests on uranium-nickel solutions with a flat membrane showed the easiness of the operation and the efficiency of the process. Acid-resistant (10 N), interchangeable elements with hollow fibers, are developed and also a computerized automatic device. The different tests on americium solutions demonstrate the feasibility and the reliability of the system. Influence of various parameters on transfer kinetics is investigated

  11. The construction of TRIGA-TRAP and direct high-precision Penning trap mass measurements on rare-earth elements and americium

    International Nuclear Information System (INIS)

    Ketelaer, Jens

    2010-01-01

    The construction of TRIGA-TRAP and direct high-precision Penning trap mass measurements on rare-earth elements and americium: Nuclear masses are an important quantity to study nuclear structure since they reflect the sum of all nucleonic interactions. Many experimental possibilities exist to precisely measure masses, out of which the Penning trap is the tool to reach the highest precision. Moreover, absolute mass measurements can be performed using carbon, the atomic-mass standard, as a reference. The new double-Penning trap mass spectrometer TRIGA-TRAP has been installed and commissioned within this thesis work, which is the very first experimental setup of this kind located at a nuclear reactor. New technical developments have been carried out such as a reliable non-resonant laser ablation ion source for the production of carbon cluster ions and are still continued, like a non-destructive ion detection technique for single-ion measurements. Neutron-rich fission products will be available by the reactor that are important for nuclear astrophysics, especially the r-process. Prior to the on-line coupling to the reactor, TRIGA-TRAP already performed off-line mass measurements on stable and long-lived isotopes and will continue this program. The main focus within this thesis was on certain rare-earth nuclides in the well-established region of deformation around N ∝ 90. Another field of interest are mass measurements on actinoids to test mass models and to provide direct links to the mass standard. Within this thesis, the mass of 241 Am could be measured directly for the first time. (orig.)

  12. The construction of TRIGA-TRAP and direct high-precision Penning trap mass measurements on rare-earth elements and americium

    Energy Technology Data Exchange (ETDEWEB)

    Ketelaer, Jens

    2010-06-14

    The construction of TRIGA-TRAP and direct high-precision Penning trap mass measurements on rare-earth elements and americium: Nuclear masses are an important quantity to study nuclear structure since they reflect the sum of all nucleonic interactions. Many experimental possibilities exist to precisely measure masses, out of which the Penning trap is the tool to reach the highest precision. Moreover, absolute mass measurements can be performed using carbon, the atomic-mass standard, as a reference. The new double-Penning trap mass spectrometer TRIGA-TRAP has been installed and commissioned within this thesis work, which is the very first experimental setup of this kind located at a nuclear reactor. New technical developments have been carried out such as a reliable non-resonant laser ablation ion source for the production of carbon cluster ions and are still continued, like a non-destructive ion detection technique for single-ion measurements. Neutron-rich fission products will be available by the reactor that are important for nuclear astrophysics, especially the r-process. Prior to the on-line coupling to the reactor, TRIGA-TRAP already performed off-line mass measurements on stable and long-lived isotopes and will continue this program. The main focus within this thesis was on certain rare-earth nuclides in the well-established region of deformation around N {proportional_to} 90. Another field of interest are mass measurements on actinoids to test mass models and to provide direct links to the mass standard. Within this thesis, the mass of {sup 241}Am could be measured directly for the first time. (orig.)

  13. Tank 241-U-203: Tank Characterization Plan

    International Nuclear Information System (INIS)

    Sathyanarayana, P.

    1995-01-01

    The revised Federal Facility Agreement and Consent Order states that a tank characterization plan will be developed for each double-shell tank and single-shell tank using the data quality objective process. The plans are intended to allow users and regulators to ensure their needs will be met and resources are devoted to gaining only necessary information. This document satisfies that requirement for Tank 241-U-203 sampling activities

  14. Tank 241-T-111 characterization report

    International Nuclear Information System (INIS)

    Simpson, B.C.

    1994-09-01

    In late October and early November of 1991, single-shell tank (SST) 241-T-111 (on the Organic Watch List) was sampled and analyses were conducted on the materials obtained to complete Hanford Federal Facility Agreement and Consent Order (Tri-Party Agreement) Milestone M-10-00 to sample and analyze two cores from each tank. Other objectives that these measurements and inventory estimates support are as follows: Obtain estimates of both the concentration and total quantity of key analytes relating to safety issues, such as organics and radionuclides; Provided input to risk assessment-based disposal decisions for the waste; and Implement physical property measurements, such as rheology, bulk density, and particle size. These measurements are necessary for the design and fabrication of retrieval, pretreatment, and vitrification systems. The purpose of the tank characterization report is to describe and characterize the waste in SST 241-T-111, based on information from various sources. This report summarizes the available information regarding the waste in tank 241-T-111, and arranges this information in a format useful to support management and technical decisions concerning this waste tank

  15. Transmutation of americium and curium incorporated in zirconia-based host materials

    Energy Technology Data Exchange (ETDEWEB)

    Raison, P.E. [CEA Cadarache, 13 - Saint-Paul-lez-Durance (France). Dept. d' Etudes des Combustibles; Haire, R.G. [Oak Ridge National Lab., TN (United States)

    2001-07-01

    Presented are studies involving the incorporation of americium and curium in zirconia-based materials. First explored was the pseudo ternary system AmO{sub 2}-ZrO{sub 2}-Y{sub 2}O{sub 3}. It was determined that selected Y-CSZ materials can incorporate significant quantities of americium oxide and remain cubic single-phase. The cell parameters of these fluorite-type products were established to be linear with the AmO{sub 2} content. The Cm{sub 2}O{sub 3}-ZrO{sub 2} system was also investigated. It was found that at 25 mol% of CmO{sub 1.5}, the Cm(III) stabilized zirconia in its cubic form (a = 5.21 {+-}0.01 Angstrom). At higher and lower concentrations, diphasic materials were encountered. At 50 mol% of CmO{sub 1.5}, a pyrochlore oxide - Cm{sub 2}Zr{sub 2}O{sub 7} - is formed (a = 10.63 {+-}0.02 Angstrom). (author)

  16. Fuel cycle covariance of plutonium and americium separations to repository capacity using information theoretic measures

    International Nuclear Information System (INIS)

    Scopatz, Anthony; Schneider, Erich; Li, Jun; Yim, Man-Sung

    2011-01-01

    A light water reactor, fast reactor symbiotic fuel cycle scenario was modeled and parameterized based on thirty independent inputs. Simultaneously and stochastically choosing different values for each of these inputs and performing the associated fuel cycle mass-balance calculation, the fuel cycle itself underwent Monte Carlo simulation. A novel information theoretic metric is postulated as a measure of system-wide covariance. This metric is the coefficient of variation of the set of uncertainty coefficients generated from 2D slices of a 3D contingency table. It is then applied to the fuel cycle, taking fast reactor used fuel plutonium and americium separations as independent variables and the capacity of a fully-loaded tuff repository as the response. This set of parameters is known from prior studies to have a strong covariance. When measured with all 435 other input parameters possible, the fast reactor plutonium and americium separations pair was found to be ranked the second most covariant. This verifies that the coefficient of variation metric captures the desired sensitivity of sensitivity effects in the nuclear fuel cycle. (author)

  17. Contribution to the prediction of americium, plutonium and neptunium behaviour in the geosphere: chemical data

    International Nuclear Information System (INIS)

    Robouch, P.

    1989-01-01

    An exhaustive bibliographic review on hydrolysis of americium gives the stability constants, at zero ionic strength. No evidence of Am(OH) 4 - formation was found by solubility studies up to pH 2 (CO 3 ) 3 characterised by its X-ray diffraction pattern is studied at a high ionic strength. All the published results on Am in carbonate media are reinterpreted using these stability constants (Am-OH-CO 3 complexes are not needed). No evidence of Am(CO 3 ) 4 5- formation was found by spectrophotometry up to 3M. Literature results are used to determine the formal redox potentials at pH = 9.4 and to calculate the formation constants, at zero ionic strength. The formation of complexes between americium and humic materials (purified fulvic and humic acids) has been studied by a spectrophotometric technique. The results are interpreted by the formation of a 1:1 complexe. Solubility of the solid PuO 2 (CO 3 ) is measured in bicarbonate media at high ionic strength, to obtain the solubility product and formation constants of the PuO 2 (CO 3 ) i 2-2i complexes [fr

  18. Production of a square geometry Americium standard source for use with photodiodes

    Energy Technology Data Exchange (ETDEWEB)

    Costa, Priscila; Geraldo, Bianca; Raele, Marcus P.; Marumo, Júlio T.; Vicente, Roberto; Zahn, Guilherme S.; Genezini, Frederico A., E-mail: priscila3.costa@usp.br, E-mail: fredzini@ipen.br [Instituto de Pesquisas Energéticas e Nucleares (IPEN/CNEN-SP), São Paulo, SP (Brazil)

    2017-07-01

    In the development of a thermal neutron detector using a square photodiode and a thin boron film, a radioactive calibration source with the same geometry was needed. An americium-243 standard source was produced by electrodeposition aiming at the calibration of a PIN-type silicon photodiode with a detection area of 10 x 10 mm{sup 2}. To produce the samples two tests were performed. In the first test, a square stainless steel plate (10 x 10 mm{sup 2}) was fixed on the surface of the conventional plate, which was removed after deposition. To reduce the loss of activity of the source, in the second test nail polish was applied on the silver plate leaving only an area of 10 x 10 mm{sup 2} without varnish coating. Once the electrodeposition process was completed, the activity concentration measurement was performed by alpha particle spectrometry. The first method presented a lower activity when compared to the total activity of Am-243 added initially. For the second method, the total activity was concentrate in the exposed square region (without nail polish). The results showed that it is possible to obtain a square geometry source; furthermore, the surrounding nail polish was not contaminated by {sup 243}Am. The comparison of these two approaches indicated that the second method was more efficient as it was possible to concentrate all the americium activity in the delimited square area. (author)

  19. Comparison of Americium-Beryllium neutron spectrum obtained using activation foil detectors and NE-213 spectrometer

    International Nuclear Information System (INIS)

    Sunny, Sunil; Subbaiah, K.V.; Selvakumaran, T.S.

    1999-01-01

    Neutron spectrum of Americium - Beryllium (α,n) source is measured with two different spectrometers vis-a-vis activation foils (foil detectors) and NE-213 organic scintillator. Activity induced in the foils is measured with 4π-β-γ sodium iodide detector by integrating counts under photo peak and the saturation activity is found by correcting to elapsed time before counting. The data on calculated activity is fed into the unfolding code, SAND-II to obtain neutron spectrum. In the case of organic scintillator, the pulse height spectrum is obtained using MCA and this is processed with unfolding code DUST in order to get neutron spectrum. The Americium - Beryllium (α,n) neutron spectrum thus obtained by two different methods is compared. It is inferred that the NE-213 scintillator spectrum is in excellent agreement with the values beyond 1MeV. Neutron spectrum obtained by activation foils depends on initial guess spectrum and is found to be in reasonable agreement with NE-213 spectrum. (author)

  20. Toxicologic evaluation of analytes from Tank 241-C-103

    International Nuclear Information System (INIS)

    Mahlum, D.D.; Young, J.Y.; Weller, R.E.

    1994-11-01

    Westinghouse Hanford Company requested PNL to assemble a toxicology review panel (TRP) to evaluate analytical data compiled by WHC, and provide advice concerning potential health effects associated with exposure to tank-vapor constituents. The team's objectives would be to (1) review procedures used for sampling vapors from tanks, (2) identify constituents in tank-vapor samples that could be related to symptoms reported by workers, (3) evaluate the toxicological implications of those constituents by comparison to establish toxicological databases, (4) provide advice for additional analytical efforts, and (5) support other activities as requested by WHC. The TRP represents a wide range of expertise, including toxicology, industrial hygiene, and occupational medicine. The TRP prepared a list of target analytes that chemists at the Oregon Graduate Institute/Sandia (OGI), Oak Ridge National Laboratory (ORNL), and PNL used to establish validated methods for quantitative analysis of head-space vapors from Tank 241-C-103. this list was used by the analytical laboratories to develop appropriate analytical methods for samples from Tank 241-C-103. Target compounds on the list included acetone, acetonitrile, ammonia, benzene, 1, 3-butadiene, butanal, n-butanol, hexane, 2-hexanone, methylene chloride, nitric oxide, nitrogen dioxide, nitrous oxide, dodecane, tridecane, propane nitrile, sulfur oxide, tributyl phosphate, and vinylidene chloride. The TRP considered constituent concentrations, current exposure limits, reliability of data relative to toxicity, consistency of the analytical data, and whether the material was carcinogenic or teratogenic. A final consideration in the analyte selection process was to include representative chemicals for each class of compounds found

  1. Evaluation of the contamination risk by 241AM from lightning rods disposed at uncontrolled garbage dump

    International Nuclear Information System (INIS)

    Marumo, Julio Takehiro

    2006-01-01

    Radioactive lightning rods were manufactured in Brazil until 1989, when the licenses for using radioactive sources in these products were lifted by the national nuclear authority. Since then, radioactive devices have been replaced by Franklin type one and collected as radioactive waste. However, only 23 percent of the estimated total number of installed rods was delivered to Brazilian Nuclear Commission (Comissao Nacional de Energia Nuclear - CNEN). This situation is of concern as there is a possibility of the rods being discarded as domestic waste, considering that in Brazil, 63.6 percent of the municipal solid waste is disposed at uncontrolled garbage dump, according to Instituto Brasileiro de Geografia e Estatistica (IBGE) in 2000. In addition, americium, the most common employed radionuclide, is classified as a high toxicity element, when ingested or inhaled. In the present study, it was performed migration experiments of Am-241 by lysimeter system in order to evaluate the risk of contamination caused by radioactive lightning rods disposed as a common solid waste. Sources removed from lightning rods were placed inside lysimeters filled with organic waste, collected at the restaurant of Instituto de Pesquisas Energeticas e Nucleares, IPEN-CNEN/SP, and the generated leachate was periodically analyzed to determine its characteristics such as pH, redox potential, solid content and concentration of the radioactive material. Microbial growth was also evaluated by counting the number of colony forming units. The equivalent dose to members of the public has been calculated considering the ingestion of drinking water, the most probable mode of exposure. The final result was about 145 times below the effective dose limit of 1 mSv.year-1 for members of the public, established by the International Commission on Radiological Protection (ICRP), demonstrating that the risk caused by lightning rods disposed at uncontrolled garbage dump is low. (author)

  2. New radiochemical methods for determination of 237Np a 241Pu using extraction chromatography (Presentation)

    International Nuclear Information System (INIS)

    Strisovska, J.

    2013-01-01

    Thesis was focused on the development of a new methodology for the separation of anthropogenic transuranium radionuclides 237 Np a 241 Pu from different kinds of matrices. The analytical methods used in this study were based on extraction chromatography and were optimized according to the sample type. The proposed radiochemical procedure is a combination of two algorithms, which represent the separation of radionuclides by using extraction chromatographic sorbents TEVA resin and TRU resin supplied by Eichrom Technologies LLC. 239 Np a 237 Np were selectively captured on sorbent TEVA resin in oxidation state 4+. TRU resin was used for purification of plutonium fraction from interfering americium radionuclide. 242 Pu and 239 Np radionuclides as tracers have been used to monitor the radiochemical yields of separation. Before every radiochemical separation tracer radionuclide 239 Np was obtained by separation from the parent radionuclide 2 43 Am, which is in radioactive equilibrium to 239 Np. The average yield of chemical separation was 69,3% for 239 Np at 277 keV energy line and 65,9% at 228 keV energy line. The NPL AH-B08069 (2008) samples which consist of the mixture of alpha-radionuclides were used for the modification and optimization of separation method used for separation of Np and Pu in model samples. This method provided high radiochemical yields of 239,240 Pu (95,0 ± 3,5)% and 237 Np (87,9 ± 3,0)%.. Reliability of the method was verified by applying our modified separation procedures on reference materials IAEA-375 and IAEA-414 supplied by International Atomic Energy Agency. A good agreement between the results is obtained by this procedure and the certified values were found. Samples of contaminated soils from the area of Nuclear power plant A-1 Jaslovske Bohunice which is stored temporarily before disposal were analyzed using developed separation procedure. Specific activity of investigated radionuclides was determined in these samples. (author)

  3. New radiochemical methods for determination of 237Np a 241Pu using extraction chromatography

    International Nuclear Information System (INIS)

    Strisovska, J.

    2013-01-01

    Thesis was focused on the development of a new methodology for the separation of anthropogenic transuranium radionuclides 237 Np a 241 Pu from different kinds of matrices. The analytical methods used in this study were based on extraction chromatography and were optimized according to the sample type. The proposed radiochemical procedure is a combination of two algorithms, which represent the separation of radionuclides by using extraction chromatographic sorbents TEVA resin and TRU resin supplied by Eichrom Technologies LLC. 239 Np a 237 Np were selectively captured on sorbent TEVA resin in oxidation state 4+. TRU resin was used for purification of plutonium fraction from interfering americium radionuclide. 242 Pu and 239 Np radionuclides as tracers have been used to monitor the radiochemical yields of separation. Before every radiochemical separation tracer radionuclide 239 Np was obtained by separation from the parent radionuclide 2 43 Am, which is in radioactive equilibrium to 239 Np. The average yield of chemical separation was 69,3% for 239 Np at 277 keV energy line and 65,9% at 228 keV energy line. The NPL AH-B08069 (2008) samples which consist of the mixture of alpha-radionuclides were used for the modification and optimization of separation method used for separation of Np and Pu in model samples. This method provided high radiochemical yields of 239,240 Pu (95,0 ± 3,5)% and 237 Np (87,9 ± 3,0)%.. Reliability of the method was verified by applying our modified separation procedures on reference materials IAEA-375 and IAEA-414 supplied by International Atomic Energy Agency. A good agreement between the results is obtained by this procedure and the certified values were found. Samples of contaminated soils from the area of Nuclear power plant A-1 Jaslovske Bohunice which is stored temporarily before disposal were analyzed using developed separation procedure. Specific activity of investigated radionuclides was determined in these samples. (author)

  4. Tank characterization report for single-shell tanks 241-T-201, 241-T-202, 241-T-203, and 241-T-204

    International Nuclear Information System (INIS)

    Simpson, B.C.

    1998-01-01

    A major function of the Tank Waste Remediation System (TWRS) is to characterize waste in support of waste management and disposal activities at the Hanford Site. Analytical data from sampling and analysis, in addition to other available information about a tank are compiled and maintained in a tank characterization report (TCR). This report and its appendices serve as the TCR for the single-shell tank series consisting of 241-T-201, -T-202, -T-203, and -T-204. The objectives of this report are: (1) to use characterization data in response to technical issues associated with T-200 series tank waste and (2) to provide a standard characterization of this waste in terms of a best-basis inventory estimate. Section 2.0 summarizes the response to technical issues, Section 3.0 shows the best-basis inventory estimate, Section 4.0 makes recommendations about the safety status of the tank and additional sampling needs. The appendices contain supporting data and information. Appendix A contains historical information for 241-T-201 to T-204, including surveillance information, records pertaining to waste transfers and tank operations, and expected tank contents derived from a process knowledge-based computer program. Appendix B summarizes sampling events, sample data obtained before 1989, and the most current sampling results. Appendix C reports the statistical analysis and numerical manipulation of data used in issue resolution. Appendix D contains the evaluation to establish the best-basis for the inventory estimate and the statistical analysis performed for this evaluation. Appendix E is a bibliography that resulted from an in-depth literature search of all known information sources applicable to tanks 241-T-201, -T-202, -T-203, and -T-204. The reports listed in Appendix E are available in the Tank Characterization and Safety Resource Center

  5. Measurement of contamination by 241Am

    International Nuclear Information System (INIS)

    Hemmingsen, L.B.S.

    1991-08-01

    In relation to the fact that four employees at the Danish Isotope Center who had regularly cleaned the smoke detectors used for control measurements were found to be contaminated with 241 Am, the aim was to investigate the suitability of the Phoswich detector system for measurement of contamination of humans by 241 Am. It was also wished to compare this measuring method with other selected ones. The measurement results are presented in detail. It was found that measurements taken on the cranium with the Phoswich detectors were more suitable for measurement of contamination by 241 Am than the use of a Ge detector on the liver, - because of the first-named method's greater degree of measuring efficiency, (0.013 cps/Bq compared with 0.0001 cps/Bq in the case of Ge detector measurement) and lower minimum detectable activity in relation to that activity that was measured on A1 (one of the employees). It was found that Phoswich-detector measurement and measuring of urine samples supplemented each other in a satisfactory way. The Phoswich detector enables a quick measurement of the degree of seriousness of the contamination of a person and a relatively accurate determination of the calculated intake of contamination which has a size of at least twice the annual limit of intake size. Measurements of urine samples enable smaller amounts of contamination to be revealed, but this takes ca. 32 weeks and is less accurate than Phoswich measurement especially if a long time has elapsed after the intake. (AB) (34 refs.)

  6. A Procedure for the Sequential Determination of Radionuclides in Environmental Samples. Liquid Scintillation Counting and Alpha Spectrometry for 90Sr, 241Am and Pu Radioisotopes

    International Nuclear Information System (INIS)

    2014-01-01

    Since 2004, IAEA activities related to the terrestrial environment have aimed at the development of a set of procedures to determine radionuclides in environmental samples. Reliable, comparable and ‘fit for purpose’ results are an essential requirement for any decision based on analytical measurements. For the analyst, tested and validated analytical procedures are extremely important tools for the production of analytical data. For maximum utility, such procedures should be comprehensive, clearly formulated and readily available for reference to both the analyst and the customer. This publication describes a combined procedure for the sequential determination of 90 Sr, 241 Am and Pu radioisotopes in environmental samples. The method is based on the chemical separation of strontium, americium and plutonium using ion exchange chromatography, extraction chromatography and precipitation followed by alpha spectrometric and liquid scintillation counting detection. The method was tested and validated in terms of repeatability and trueness in accordance with International Organization for Standardization (ISO) guidelines using reference materials and proficiency test samples. Reproducibility tests were performed later at the IAEA Terrestrial Environment Laboratory. The calculations of the massic activity, uncertainty budget, decision threshold and detection limit are also described in this publication. The procedure is introduced for the determination of 90 Sr, 241 Am and Pu radioisotopes in environmental samples such as soil, sediment, air filter and vegetation samples. It is expected to be of general use to a wide range of laboratories, including the Analytical Laboratories for the Measurement of Environmental Radioactivity (ALMERA) network for routine environmental monitoring purposes

  7. Characterization of Direct Push Vadose Zone Sediments from the 241-U Single-Shell Tank Farm

    Energy Technology Data Exchange (ETDEWEB)

    Brown, Christopher F.; Valenta, Michelle M.; Serne, R. Jeffrey; Bjornstad, Bruce N.; Lanigan, David C.; Iovin, Cristian; Clayton, Ray E.; Geiszler, Keith N.; Clayton, Eric T.; Kutnyakov, Igor V.; Baum, Steven R.; Lindberg, Michael J.; Orr, Robert D.

    2007-12-20

    The overall goals of the Tank Farm Vadose Zone Project, led by CH2M HILL Hanford Group, Inc., are 1) to define risks from past and future single-shell tank farm activities, 2) to identify and evaluate the efficacy of interim measures, and 3) to aid, via collection of geochemical information and data, the future decisions that must be made by the U.S. Department of Energy (DOE) regarding the near-term operations, future waste retrieval, and final closure activities for the single-shell tank Waste Management Areas (WMAs). For a more complete discussion of the goals of the Tank Farm Vadose Zone Project, see the overall work plan, Phase 1 RCRA Facility Investigation/Corrective Measures Study Work Plan for the Single-Shell Tank Waste Management Areas (DOE 1999). Specific details on the rationale for activities performed at WMA U are found in Crumpler (2003). To meet these goals, CH2M HILL Hanford Group, Inc., asked scientists from Pacific Northwest National Laboratory (PNNL) to perform detailed analyses of vadose zone sediment collected within the U Single-Shell Tank Farm. Specifically, this report contains all the geochemical and selected physical characterization data collected on vadose zone sediment recovered from ten direct push characterization holes emplaced to investigate vadose zone contamination associated with potential leaks within the 241-U Single-Shell Tank Farm. Specific tanks targeted during this characterization campaign included tanks 241-U-104/241-U-105, 241-U-110, and 241-U-112. Additionally, this report compiles data from direct push samples collected north of tank 241-U-201, as well as sediment collected from the background borehole (C3393). After evaluating all the characterization and analytical data, there is no question that the vadose zone in the vicinity of tanks 241-U-104 and 241-U-105 has been contaminated by tank-related waste. This observation is not new, as gamma logging of drywells in the area has identified uranium contamination at the

  8. Worldwide bioassay data resources for plutonium/americium internal dosimetry studies

    International Nuclear Information System (INIS)

    Miller, G.; Bertelli, L.; Little, T.; Guilmette, R.; Riddell, T.; Filipy, R.

    2005-01-01

    Full text: Biokinetic models are the scientific underpinning of internal dosimetry. These models describe how materials of interest taken into the body by various routes (for example inhalation) are transported through the body, allowing the modelling of bioassay measurements and the estimation of radiation dose. The International Commission on Radiation Protection (ICRP) publishes biokinetic models for use in internal dosimetry. These models represent the consensus judgement of a committee of experts, based on human and animal data. Nonetheless, it is important to validate biokinetic models using directly applicable data, in a scientifically transparent manner, especially for internal dosimetry research purposes (as opposed to radiation protection), as in epidemiology studies. Two major goals would be to determine individual variations of model parameters for the purpose of assessing this source of uncertainty in internal dose calculations, and to determine values of workplace specific parameters (such as particle solubility in lung fluids) for different representative workplaces. Furthermore, data on the observed frequency of intakes under various conditions can be used in the interpretation of bioassay data. All of the above may be couched in the terminology of Bayesian statistical analysis and amount to the determination of the Bayesian prior probability distributions needed in a Bayesian interpretation of bioassay data. The authors have direct knowledge of several significant databases of plutonium/americium bioassay data (including autopsy data). The purpose of this paper is to acquaint the worldwide community with these resources and to invite others who may know of other such databases to participate with us in a publication that would document the content, form, and the procedures for seeking access to these databases. These databases represent a tremendous scientific resource in this field. Examples of databases known to the authors include: the

  9. Artificial (Pu {sup 90}Sr, {sup 241}Am) and natural (U) isotopes in human bones from Poland

    Energy Technology Data Exchange (ETDEWEB)

    Mietelski, J.W.; Tomankiewicz, E. [Institute of Nuclear Phyics (Poland); Golec, E.; Golec, J.; Nowak, S.; Szczygiel, E. [The 5th Military Clinical Hospital and Polyclinic (Poland); Kuzma, K. [General Hospital (Poland)

    2014-07-01

    In two papers we have presented results if analyses of artificial isotopes ({sup 238,239,240}Pu, {sup 241}Am and {sup 90}Sr) content in human bones, using samples collected during hip joint replacement surgery. Since the patients were members of general population (not exposed in any particular form to artificial radionuclides) results can be treated as current background level for Poland and perhaps also whole central Europe. During this project the open question appeared - what is the level in human bones of natural alpha emitters like {sup 238}U-, {sup 234}U, for instance. Therefore about 30 human hip joint bone samples are being now analysed for the presence of uranium along with mentioned above artificial radionuclides. Samples are ashen and sequential radiochemical analyse is applied for separation of Pu, Sr and Am isotopes followed by separation of uranium using anion exchange resin. Measurements of plutonium, americium and uranium are performed using alpha spectrometry. That for {sup 90}Sr is done by LSC. Results will be presented during conference. Document available in abstract form only. (authors)

  10. Organic end state analysis of tank 241-S-106

    Energy Technology Data Exchange (ETDEWEB)

    FOWLER, K.D.

    1999-06-24

    This document provides a record of the organic end state analysis of tank 241-S-106. Tank 241-S-106 is one of twelve 22.9-meter (75-feet) diameter single-shell tanks in the 241-S Tank Farm in the 200 West Area of Hanford. This tank was built in 1951 and has a capacity of 2870 kiloliter (kL) (758 kilogallon [kgal]). According to Hanlon (1999), tank 241-S-106 currently contains 1813 kL (479 kgal) of waste comprised of 1613 kL (426 kgal) saltcake, 200 kL (53 kgal) supernatant. Included in those volumes is 719 kL (190 kgal) drainable interstitial liquid. The pumpable volume is estimated at 920 kL (243 kgal). The waste is designated as non-complexed (NCPLX). Tank 241-S-106 is not a Watch List tank. Tank 241-S-106 has not been declared as a leaker.

  11. Investigation of Tank 241-AN-101 Floating Solids

    Energy Technology Data Exchange (ETDEWEB)

    Kraft, Douglas P. [Washington River Protection Solutions, LLC, Richland, VA (United States); Meznarich, H. K. [Washington River Protection Solutions, LLC, Richland, VA (United States)

    2017-10-30

    Tank 241-AN-101 is the receiver tank for retrieval of several C-Farms waste tanks, including Tanks 241-C-102 and 241-C-111. Tank 241 C 111 received first-cycle decontamination waste from the bismuth phosphate process and Plutonium and Uranium Extraction cladding waste, as well as hydraulic fluid. Three grab samples, 1AN-16-01, 1AN-16-01A, and 1AN-16-01B, were collected at the surface of Tank 241-AN-101 on April 25, 2016, after Tank 241-C-111 retrieval was completed. Floating solids were observed in the three grab samples in the 11A hot cell after the samples were received at the 222-S Laboratory. Routine chemical analyses, solid phase characterization on the floating and settled solids, semivolatile organic analysis mainly on the aqueous phase for identification of degradation products of hydraulic fluids were performed. Investigation of the floating solids is reported.

  12. Enhancement of pomalidomide anti-tumor response with ACY-241, a selective HDAC6 inhibitor.

    Directory of Open Access Journals (Sweden)

    Brian J North

    Full Text Available Thalidomide-based Immunomodulatory Drugs (IMiDs®, including lenalidomide and pomalidomide, are effective therapeutics for multiple myeloma. These agents have been approved with, or are under clinical development with, other targeted therapies including proteasome inhibitors, αCD38 monoclonal antibodies, as well as histone deacetylase (HDAC inhibitors for combination therapy. HDAC inhibitors broadly targeting Class I and IIb HDACs have shown potent preclinical efficacy but have frequently demonstrated an undesirable safety profile in combination therapy approaches in clinical studies. Therefore, development of more selective HDAC inhibitors could provide enhanced efficacy with reduced side effects in combination with IMiDs® for the treatment of B-cell malignancies, including multiple myeloma. Here, the second generation selective HDAC6 inhibitor citarinostat (ACY-241, with a more favorable safety profile than non-selective pan-HDAC inhibitors, is shown to synergize with pomalidomide in in vitro assays through promoting greater apoptosis and cell cycle arrest. Furthermore, utilizing a multiple myeloma in vivo murine xenograft model, combination treatment with pomalidomide and ACY-241 leads to increased tumor growth inhibition. At the molecular level, combination treatment with ACY-241 and pomalidomide leads to greater suppression of the pro-survival factors survivin, Myc, and IRF4. The results presented here demonstrate synergy between pomalidomide and ACY-241 in both in vitro and in vivo preclinical models, providing further impetus for clinical development of ACY-241 for use in combination with IMiDs for patients with multiple myeloma and potentially other B-cell malignancies.

  13. Hazard evaluation for transfer of waste from tank 241-SY-101 to tank 241-SY-102

    International Nuclear Information System (INIS)

    Shultz, M.V.

    1999-01-01

    Tank 241-SY-101 waste level growth is an emergent, high priority issue. The purpose of this document is to record the hazards evaluation process and document potential hazardous conditions that could lead to the release of radiological and toxicological material from the proposed transfer of a limited quantity (approximately 100,000 gallons) of waste from Tank 241-SY-101 to Tank 241-SY-102. The results of the hazards evaluation were compared to the current Tank Waste Remediation System (TWRS) Basis for Interim Operation (HNF-SD-WM-BIO-001, 1998, Revision 1) to identify any hazardous conditions where Authorization Basis (AB) controls may not be sufficient or may not exist. Comparison to LA-UR-92-3196, A Safety Assessment for Proposed Pump Mixing Operations to Mitigate Episodic Gas Releases in Tank 241-SY-101, was also made in the case of transfer pump removal activities. Revision 1 of this document deletes hazardous conditions no longer applicable to the current waste transfer design and incorporates hazardous conditions related to the use of an above ground pump pit and overground transfer line. This document is not part of the AB and is not a vehicle for requesting authorization of the activity; it is only intended to provide information about the hazardous conditions associated with this activity. The AB Control Decision process will be used to determine the adequacy of controls and whether the proposed activity is within the AB. This hazard evaluation does not constitute an accident analysis

  14. Waste Analysis Plan for 241-Z

    International Nuclear Information System (INIS)

    HIRZEL, D.R.

    2000-01-01

    The 241-2 waste tanks are used to store, treat, and transfer waste to Tank Farms. The sampling requirements are established to identify the composition of the tank waste. The primary goal is to meet the Tank Farms acceptance criteria. Tank Farms will not accept waste without extensive characterization sample data. Process and lab wastes are sampled for suitability prior to routing to Tk-D8. The samples are helpful in tracking the amount of chemical constituents to determine treatment and are required to maintain Pu inventory and criticality prevention limitations. Likewise, the waste is sampled prior to inter-tank transfers. The revised Waste Analysis Plan for 241-2 (WAP) contains current facility, process and waste descriptions. The WAP lists the Double Shell Tank (DST) system acceptance criteria, sampling parameters and required analyses. The characterization data on historical process wastes was deleted. A section on the Tank Farms waste approval procedural process was added to describe the steps necessary and documentation required to transfer waste to the DST system. Failure to collect proper samples will result in Tank Farms' refusal to accept PFP waste until proper sampling conditions are met. This will use up unnecessary time and resources but not place the plant in a hazardous position

  15. Complex formation of trivalent americium with salicylic acid at very low concentrations

    International Nuclear Information System (INIS)

    Melanie Mueller; Margret Acker; Steffen Taut; Gert Bernhard; Forschungszentrum Dresden-Rossendorf, Dresden

    2010-01-01

    For the first time, the complexation of americium(III) with salicylic acid was studied at trace metal concentrations using a 2.0 m Long Path Flow Cell for UV-vis spectroscopy. The detection limit of Am(III) in aqueous solution at pH 3.0 was found to be 5 x 10 -9 M. Two Am(III)-salicylate complexes were formed at pH 5.0 in 0.1 M NaClO 4 , indicated by a clear red shift of the absorption maximum. The absorption spectra obtained from spectrophotometric titration were analyzed by means of factor analysis and complex stabilities were calculated to be log β 110 = 2.56 ± 0.08 and log β 120 = 3.93 ± 0.19. (author)

  16. Separation of trivalent americium and europium by purified Cyanex 301 immobilized in macro porous polymer

    International Nuclear Information System (INIS)

    Jing Chen; Veltkamp, A.C.; Booij, A.S.

    2002-01-01

    High separation ability of purified Cyanex 301 towards trivalent americium over europium in liquid-liquid extraction is confirmed. Solvent 2-nitrophenyl octyl ether (NPOE) lowered the partitioning of Am 3+ but remained the separation ability over europium. Solvent toluene and 3-octanone lowered the separation factor to ∼ 1000. It is feasible to separate Am 3+ from Eu 3+ by Cyanex 301 which was immobilized in the macro porous polymer (MPP). 3-Octanone is a suitable solvent for dissolving NH 4 OH-saponified Cyanex 301 and MPP is a suitable solid supported material for column operation. A five-step column experiment demonstrated the feasibility to separate Am 3+ from Eu 3+ in column which was packed with Cyanex 301-impregnated MPP. (author)

  17. Spectral properties of americium(III) in silicate matrices. Concentration-dependent up-conversion emission

    International Nuclear Information System (INIS)

    Assefa, Zerihun; Haire, R.G.; Stump, N.

    2002-01-01

    We have been pursuing the spectroscopic properties of actinide ions in silicate matrices. One facet of these studies involves the behavior of Stokes and anti-Stokes emissions exhibited by Am 3+ in these hosts. Several attributes have been found to influence the spectral profile, which include excitation wavelength, laser power, and dopant-concentration. Excitation with the 514.5 nm (19435 cm -1 ) line of argon laser provides anti-Stokes emissions at 21100 and ∼19920 cm -1 in the borosilicate matrices. This up-conversion was found to proceed through a multi-photon scheme, and the efficiency increases with increased dopant concentration. Based on our concentration-dependent studies, the up-conversion is suggested to involve a cross-relaxation process [( 5 D 1' , 7 F 0' ) ( 7 F 6' , 7 F 2' )] between neighboring americium ions. (author)

  18. Magnesium ionophore II as an extraction agent for trivalent europium and americium

    Energy Technology Data Exchange (ETDEWEB)

    Makrlik, Emanuel [Czech Univ. of Life Sciences, Prague (Czech Republic). Faculty of Environmental Sciences; Vanura, Petr [Univ. of Chemistry and Technology, Prague (Czech Republic). Dept. of Analytical Chemistry

    2016-11-01

    Solvent extraction of microamounts of trivalent europium and americium into nitrobenzene by using a mixture of hydrogen dicarbollylcobaltate (H{sup +}B{sup -}) and magnesium ionophore II (L) was studied. The equilibrium data were explained assuming that the species HL{sup +}, HL{sup +}{sub 2}, ML{sup 3+}{sub 2}, and ML{sup 3+}{sub 3} (M{sup 3+} = Eu{sup 3+}, Am{sup 3+}; L=magnesium, ionophore II) are extracted into the nitrobenzene phase. Extraction and stability constants of the cationic complex species in nitrobenzene saturated with water were determined and discussed. From the experimental results it is evident that this effective magnesium ionophore II receptor for the Eu{sup 3+} and Am{sup 3+} cations could be considered as a potential extraction agent for nuclear waste treatment.

  19. Cone Penetrometer Shear Strength Measurements of Sludge Waste in Tanks 241-AN-101 and 241-AN-106

    Energy Technology Data Exchange (ETDEWEB)

    Follett, Jordan R.

    2014-03-06

    This document presents the resulting shear strength profiles for sludge waste in Tanks 241-AN-101 and 241-AN-106, as determined with a full-flow cone penetrometer. Full-flow penetrometer measurements indicate shear strength profiles that increase roughly uniformly with depth. For Tank 241-AN-101, the undrained shear strength was calculated to range from 500 Pa near the sludge surface to roughly 3,300 Pa at 15 inches above the tank bottom. For 241-AN-106, the undrained shear strength was calculated to range from 500 Pa near the sludge surface to roughly 5,000 Pa at 15 inches above the tank bottom.

  20. Vapor characterization of Tank 241-C-103

    International Nuclear Information System (INIS)

    Huckaby, J.L.; Story, M.S.

    1994-06-01

    The Westinghouse Hanford Company Tank Vapor Issue Resolution Program has developed, in cooperation with Northwest Instrument Systems, Inc., Oak Ridge National Laboratory, Oregon Graduate Institute of Science and Technology, Pacific Northwest Laboratory, and Sandia National Laboratory, the equipment and expertise to characterize gases and vapors in the high-level radioactive waste storage tanks at the Hanford Site in south central Washington State. This capability has been demonstrated by the characterization of the tank 241-C-103 headspace. This tank headspace is the first, and for many reasons is expected to be the most problematic, that will be characterized (Osborne 1992). Results from the most recent and comprehensive sampling event, sample job 7B, are presented for the purpose of providing scientific bases for resolution of vapor issues associated with tank 241-C-103. This report is based on the work of Clauss et al. 1994, Jenkins et al. 1994, Ligotke et al. 1994, Mahon et al. 1994, and Rasmussen and Einfeld 1994. No attempt has been made in this report to evaluate the implications of the data presented, such as the potential impact of headspace gases and vapors to tank farm workers health. That and other issues will be addressed elsewhere. Key to the resolution of worker health issues is the quantitation of compounds of toxicological concern. The Toxicology Review Panel, a panel of Pacific Northwest Laboratory experts in various areas, of toxicology, has chosen 19 previously identified compounds as being of potential toxicological concern. During sample job 7B, the sampling and analytical methodology was validated for this preliminary list of compounds of toxicological concern. Validation was performed according to guidance provided by the Tank Vapor Conference Committee, a group of analytical chemists from academic institutions and national laboratories assembled and commissioned by the Tank Vapor Issue Resolution Program

  1. Vapor characterization of Tank 241-C-103

    Energy Technology Data Exchange (ETDEWEB)

    Huckaby, J.L. [Westinghouse Hanford Co., Richland, WA (United States); Story, M.S. [Northwest Instrument Systems, Inc. Richland, WA (United States)

    1994-06-01

    The Westinghouse Hanford Company Tank Vapor Issue Resolution Program has developed, in cooperation with Northwest Instrument Systems, Inc., Oak Ridge National Laboratory, Oregon Graduate Institute of Science and Technology, Pacific Northwest Laboratory, and Sandia National Laboratory, the equipment and expertise to characterize gases and vapors in the high-level radioactive waste storage tanks at the Hanford Site in south central Washington State. This capability has been demonstrated by the characterization of the tank 241-C-103 headspace. This tank headspace is the first, and for many reasons is expected to be the most problematic, that will be characterized (Osborne 1992). Results from the most recent and comprehensive sampling event, sample job 7B, are presented for the purpose of providing scientific bases for resolution of vapor issues associated with tank 241-C-103. This report is based on the work of Clauss et al. 1994, Jenkins et al. 1994, Ligotke et al. 1994, Mahon et al. 1994, and Rasmussen and Einfeld 1994. No attempt has been made in this report to evaluate the implications of the data presented, such as the potential impact of headspace gases and vapors to tank farm workers health. That and other issues will be addressed elsewhere. Key to the resolution of worker health issues is the quantitation of compounds of toxicological concern. The Toxicology Review Panel, a panel of Pacific Northwest Laboratory experts in various areas, of toxicology, has chosen 19 previously identified compounds as being of potential toxicological concern. During sample job 7B, the sampling and analytical methodology was validated for this preliminary list of compounds of toxicological concern. Validation was performed according to guidance provided by the Tank Vapor Conference Committee, a group of analytical chemists from academic institutions and national laboratories assembled and commissioned by the Tank Vapor Issue Resolution Program.

  2. 24 CFR 241.560 - Agreed interest rate.

    Science.gov (United States)

    2010-04-01

    ... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Agreed interest rate. 241.560... § 241.560 Agreed interest rate. (a) The mortgage shall bear interest at the rate agreed upon by the lender and the borrower. (b) Interest shall be payable in monthly installments on the principal amount of...

  3. 24 CFR 241.1070 - Agreed interest rate.

    Science.gov (United States)

    2010-04-01

    ... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Agreed interest rate. 241.1070...-Eligibility Requirements § 241.1070 Agreed interest rate. The equity or acquisition loan shall bear interest at the rate agreed upon by the borrower and the lender. ...

  4. 24 CFR 241.1200 - Cross-references.

    Science.gov (United States)

    2010-04-01

    ... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Cross-references. 241.1200 Section... Rights and Obligations § 241.1200 Cross-references. (a) Projects with a HUD-insured or HUD-held mortgage....254Insurance endorsement. (2) For the purposes of subpart F of this part, all references in part 207 of this...

  5. 47 CFR 90.241 - Radio call box operations.

    Science.gov (United States)

    2010-10-01

    ... box installations in areas where such frequencies are available for fixed system use subject to the... 47 Telecommunication 5 2010-10-01 2010-10-01 false Radio call box operations. 90.241 Section 90... PRIVATE LAND MOBILE RADIO SERVICES Non-Voice and Other Specialized Operations § 90.241 Radio call box...

  6. 24 CFR 241.265 - Insurance of property against flood.

    Science.gov (United States)

    2010-04-01

    ... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Insurance of property against flood. 241.265 Section 241.265 Housing and Urban Development Regulations Relating to Housing and Urban... Insurance of property against flood. The mortgaged property shall be insured against flood as stipulated by...

  7. 5 CFR 531.241 - Retaining and losing GM status.

    Science.gov (United States)

    2010-01-01

    ... 5 Administrative Personnel 1 2010-01-01 2010-01-01 false Retaining and losing GM status. 531.241 Section 531.241 Administrative Personnel OFFICE OF PERSONNEL MANAGEMENT CIVIL SERVICE REGULATIONS PAY... promotion), transferred, demoted, reassigned to a position in which the employee will no longer be a...

  8. 24 CFR 241.890 - Characteristics of debentures.

    Science.gov (United States)

    2010-04-01

    ... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Characteristics of debentures. 241... Insurance § 241.890 Characteristics of debentures. Debentures issued in settlement of insurance claims under this subpart shall have the same characteristics and the same requirements for registration and...

  9. 5 CFR 838.241 - Cost-of-living adjustments.

    Science.gov (United States)

    2010-01-01

    ... 5 Administrative Personnel 2 2010-01-01 2010-01-01 false Cost-of-living adjustments. 838.241... Affecting Employee Annuities Procedures for Computing the Amount Payable § 838.241 Cost-of-living... provide for cost-of-living adjustments on the former spouse's payment from employee annuity, the cost-of...

  10. 7 CFR 58.241 - Packaging, repackaging and storage.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 3 2010-01-01 2010-01-01 false Packaging, repackaging and storage. 58.241 Section 58... Service 1 Operations and Operating Procedures § 58.241 Packaging, repackaging and storage. (a) Containers. Packages or containers used for the packaging of nonfat dry milk or other dry milk products shall be any...

  11. 24 CFR 241.840 - Date of default.

    Science.gov (United States)

    2010-04-01

    ... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Date of default. 241.840 Section... § 241.840 Date of default. In computing loan insurance benefits, the date of default shall be considered... of the lender's acceleration of the debt because of the borrower's default under the first...

  12. 24 CFR 241.850 - Notice of default.

    Science.gov (United States)

    2010-04-01

    ... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Notice of default. 241.850 Section... § 241.850 Notice of default. (a) If the default is not cured within the 30 day grace period, as defined... such default. (b) The lender shall give notice in writing to the Commissioner of the failure of the...

  13. 24 CFR 241.830 - Definition of default.

    Science.gov (United States)

    2010-04-01

    ... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Definition of default. 241.830... § 241.830 Definition of default. (a) If the borrower fails to make any payments due under or provided to be paid by the terms of the note or security instrument, the note shall be considered in default for...

  14. Sorption of 241Am by Aspergillus niger spore and hyphae

    International Nuclear Information System (INIS)

    Yuanyou Yang; Ning Liu; Jiali Liao; Jiannan Jin; Shunzhong Luo; Taiming Zhang; Pengji Zhao

    2004-01-01

    Biosorption of 241 Am by a fungus A. niger, including the spore and hyphae, was investigated. The preliminary results showed that the adsorption of 241 Am by the microorganism was efficient. More than 96% of the total 241 Am could be removed from 241 Am solutions of 5.6-111 MBq/l (C 0 ) by spore and hyphae of A. niger, with adsorbed 241 Am metal (Q) of 7.2-142.4 MBq/g biomass, and 5.2-106.5 MBq/g, respectively. The biosorption equilibrium was achieved within 1 hour and the optimum pH range was pH 1-3. No obvious effects on 241 Am adsorption by the fungus were observed at 10-45 deg C, or in solutions containing Au 3+ or Ag + , even 2000 times above the 241 Am concentration. The 241 Am biosorption by the fungus obeys the Freundlich adsorption equation. There was no significant difference between the adsorption behavior of A. niger spore and hyphae. (author)

  15. Type B Investigation Report for 241-SY-101 Pump Start and 241-C-106 Pit Cleanout

    Energy Technology Data Exchange (ETDEWEB)

    Ewalt, J.R.

    1993-09-01

    In accordance with the direction of the Department of Energy (DOE) Manager, Richland Operations Office, a Type ``B`` investigation in accordance with the DOE Order 5484.1, Environmental Protection, Safety and Health Protection Information Reporting Requirements, has been conducted. The scope of the investigation included two events: The ``Inadvertent Mixer Pump Operation at 241-SY-101`` (RL-WHC-TANK FARM-1993-069); ``Inadequate Work Control Results in Personnel Skin Contamination at 241-C-106, Pit B`` (RL-WHC-TANK FARM-1993-071) events. Additionally, at the request of the President of the WHC, a broader investigation into Waste Tank Farm ``safety practices`` and ``Conduct of Operations`` was also conducted. The review was focused on (1) WHC organizations performing operations, maintenance, and radiological safety tasks; and (2) KEH organizations performing major maintenance tasks.

  16. Software configuration management plan, 241-AY and 241-AZ tank farm MICON automation system

    International Nuclear Information System (INIS)

    Hill, L.F.

    1997-01-01

    This document establishes a Computer Software Configuration Management Plan (CSCM) for controlling software for the MICON Distributed Control System (DCS) located at the 241-AY and 241-AZ Aging Waste Tank Farm facilities in the 200 East Area. The MICON DCS software controls and monitors the instrumentation and equipment associated with plant systems and processes. A CSCM identifies and defines the configuration items in a system (section 3.1), controls the release and change of these items throughout the system life cycle (section 3.2), records and reports the status of configuration items and change requests (section 3.3), and verifies the completeness and correctness of the items (section 3.4). All software development before initial release, or before software is baselined, is considered developmental. This plan does not apply to developmental software. This plan applies to software that has been baselined and released. The MICON software will monitor and control the related instrumentation and equipment of the 241-AY and 241-AZ Tank Farm ventilation systems. Eventually, this software may also assume the monitoring and control of the tank sludge washing equipment and other systems as they are brought on line. This plan applies to the System Cognizant Manager and MICON Cognizant Engineer (who is also referred to herein as the system administrator) responsible for the software/hardware and administration of the MICON system. This document also applies to any other organizations within Tank Farms which are currently active on the system including system cognizant engineers, nuclear operators, technicians, and control room supervisors

  17. Separation of oxidized americium from lanthanides by use of pillared metal(IV) phosphate-phosphonate hybrid materials

    Energy Technology Data Exchange (ETDEWEB)

    Burns, J.D.; Clearfield, A. [Texas A and M Univ., College Station, TX (United States). Dept. of Chemistry; Borkowski, M.; Reed, D.T. [Los Alamos National Laboratory, Carlsbad, NM (United States). Earth and Environmental Sciences Div.

    2012-07-01

    Closing the nuclear fuel cycle in the US poses many challenges, one of which is found in the waste streams, which contain both trivalent lanthanides and actinides. The separation of americium from the raffinate will dramatically reduce the long-term radiotoxicity of the waste. The sorption of americium in both the tri- and pentavalent oxidation states was observed for four M(IV) phosphate-phosphonate ion exchange materials in nitric acid at pH 2. High selectivity was observed for reduced Am(III) with K{sub d} values ca. 6 x 10{sup 5} mL/g, while the K{sub d} values for Am(V) were much lower. A new method of synthesizing and stabilizing AmO{sub 2}{sup +} to yield a lifetime of at least 24 h in acidic media using a combination of sodium persulfate and calcium hypochlorite will be described.

  18. Separation of oxidized americium from lanthanides by use of pillared metal(IV) phosphate-phosphonate hybrid materials

    International Nuclear Information System (INIS)

    Burns, J.D.; Clearfield, A.; Borkowski, M.; Reed, D.T.

    2012-01-01

    Closing the nuclear fuel cycle in the US poses many challenges, one of which is found in the waste streams, which contain both trivalent lanthanides and actinides. The separation of americium from the raffinate will dramatically reduce the long-term radiotoxicity of the waste. The sorption of americium in both the tri- and pentavalent oxidation states was observed for four M(IV) phosphate-phosphonate ion exchange materials in nitric acid at pH 2. High selectivity was observed for reduced Am(III) with K d values ca. 6 x 10 5 mL/g, while the K d values for Am(V) were much lower. A new method of synthesizing and stabilizing AmO 2 + to yield a lifetime of at least 24 h in acidic media using a combination of sodium persulfate and calcium hypochlorite will be described.

  19. Hazard evaluation for transfer of waste from tank 241-SY-101 to tank 241-SY-102

    International Nuclear Information System (INIS)

    SHULTZ, M.V.

    1999-01-01

    Tank 241-SY-101 (SY-101) waste level growth is an emergent, high priority issue. The purpose of this document is to record the hazards evaluation process and document potential hazardous conditions that could lead to the release of radiological and toxicological material from the proposed transfer of a limited quantity (approximately 100,000 gallons) of waste from SY-101 to 241-SY-102 (SY-102). The results of the hazards evaluation will be compared to the current Tank Waste Remediation System (TWRS) Basis for Interim Operation (HNF-SD-WM-BIO-001, 1998, Revision 1) to identify any hazardous conditions where Authorization Basis (AB) controls may not be sufficient or may not exist. Comparison to LA-UR-92-3196, A Safety Assessment for Proposed Pump Mixing Operations to Mitigate Episodic Gas Releases in Tank 241-SY-101, was also made in the case of transfer pump removal activities. This document is not intended to authorize the activity or determine the adequacy of controls; it is only intended to provide information about the hazardous conditions associated with this activity. The Unreviewed Safety Question (USQ) process will be used to determine the adequacy of controls and whether the proposed activity is within the AB. This hazard evaluation does not constitute an accident analysis

  20. Upper limits to americium concentration in large sized sodium-cooled fast reactors loaded with metallic fuel

    International Nuclear Information System (INIS)

    Zhang, Youpeng; Wallenius, Janne

    2014-01-01

    Highlights: • The americium transmutation capability of Integral Fast Reactor was investigated. • The impact from americium introduction was parameterized by applying SERPENT Monte Carlo calculations. • Higher americium content in metallic fuel leads to a power penalty, preserving consistent safety margins. - Abstract: Transient analysis of a large sized sodium-cooled reactor loaded with metallic fuel modified by different fractions of americium have been performed. Unprotected loss-of-offsite power, unprotected loss-of-flow and unprotected transient-over-power accidents were simulated with the SAS4A/SASSYS code based on the geometrical model of an IFR with power rating of 2500 MW th , using safety parameters obtained with the SERPENT Monte Carlo code. The Ti-modified austenitic D9 steel, having higher creep rupture strength, was considered as the cladding and structural material apart from the ferritic/martensitic HT9 steel. For the reference case of U–12Pu–1Am–10Zr fuel at EOEC, the margin to fuel melt during a design basis condition UTOP is about 50 K for a maximum linear rating of 30 kW/m. In order to maintain a margin of 50 K to fuel failure, the linear power rating has to be reduced by ∼3% and 6% for 2 wt.% and 3 wt.% Am introduction into the fuel respectively. Hence, an Am concentration of 2–3 wt.% in the fuel would lead to a power penalty of 3–6%, permitting a consumption rate of 3.0–5.1 kg Am/TW h th . This consumption rate is significantly higher than the one previously obtained for oxide fuelled SFRs

  1. Radiological and toxicological analyses of tank 241-AY-102 and tank 241-C-106 ventilation systems

    International Nuclear Information System (INIS)

    Himes, D.A.

    1998-01-01

    The high heat content solids contained in Tank 241-C-106 are to be removed and transferred to Tank 241-AY-102 by sluicing operations, to be authorized under project W320. While sluicing operations are underway, the state of these tanks will be transformed from unagitated to agitated. This means that the partition fraction which describes the aerosol content of the head space will increase from IE-10 to IE-8 (see WHC-SD-WM-CN062, Rev. 2 for discussion of partition fractions). The head spare will become much more loaded with suspended material. Furthermore, the nature of this suspended material can change significantly: sluicing could bring up radioactive solids which normally would lay under many meters of liquid supernate. It is assumed that the headspace and filter aerosols in Tank 241-AY-102 are a 90/10 liquid/solid split. It is further assumed that the sluicing line, the headspace in Tank 241-C-106, and the filters on Tank 241-C-106 contain aerosols which are a 67/33 liquid/solid split. The bases of these assumptions are discussed in Section 3.0. These waste compositions (referred to as mitigated compositions) were used in Attachments 1 through 4 to calculate survey meter exposure rates per liter of inventory in the various system components. Three accident scenarios are evaluated: a high temperature event which melts or burns the HEPA filters and causes releases from other system components; an overpressure event which crushes and blows out the HEPA filters and causes releases from other system components; and an unfiltered release of tank headspace air. The initiating event for the high temperature release is a fire caused by a heater malfunction inside the exhaust dust or a fire outside the duct. The initiating event for the overpressure event could be a steam bump which over pressurizes the tank and leads to a blowout of the HEPA filters in the ventilation system. The catastrophic destruction of the HEPA filters would release a fraction of the accumulated

  2. Radiological and toxicological analyses of tank 241-AY-102 and tank 241-C-106 ventilation systems

    Energy Technology Data Exchange (ETDEWEB)

    Himes, D.A.

    1998-08-11

    The high heat content solids contained in Tank 241-C-106 are to be removed and transferred to Tank 241-AY-102 by sluicing operations, to be authorized under project W320. While sluicing operations are underway, the state of these tanks will be transformed from unagitated to agitated. This means that the partition fraction which describes the aerosol content of the head space will increase from IE-10 to IE-8 (see WHC-SD-WM-CN062, Rev. 2 for discussion of partition fractions). The head spare will become much more loaded with suspended material. Furthermore, the nature of this suspended material can change significantly: sluicing could bring up radioactive solids which normally would lay under many meters of liquid supernate. It is assumed that the headspace and filter aerosols in Tank 241-AY-102 are a 90/10 liquid/solid split. It is further assumed that the sluicing line, the headspace in Tank 241-C-106, and the filters on Tank 241-C-106 contain aerosols which are a 67/33 liquid/solid split. The bases of these assumptions are discussed in Section 3.0. These waste compositions (referred to as mitigated compositions) were used in Attachments 1 through 4 to calculate survey meter exposure rates per liter of inventory in the various system components. Three accident scenarios are evaluated: a high temperature event which melts or burns the HEPA filters and causes releases from other system components; an overpressure event which crushes and blows out the HEPA filters and causes releases from other system components; and an unfiltered release of tank headspace air. The initiating event for the high temperature release is a fire caused by a heater malfunction inside the exhaust dust or a fire outside the duct. The initiating event for the overpressure event could be a steam bump which over pressurizes the tank and leads to a blowout of the HEPA filters in the ventilation system. The catastrophic destruction of the HEPA filters would release a fraction of the accumulated

  3. 241-SY-101 mixer pump lifetime expectancy. Final report

    International Nuclear Information System (INIS)

    Shaw, C.P.

    1995-01-01

    The purpose of WHC-SD-WM-TI-726, Rev. 0 241-SY-101 Mixer Pump Lifetime Expectancy is to determine a best estimate of the mean lifetime of non-repairable (located in the waste) essential features of the hydrogen mitigation mixer pump presently installed in 101-SY. The estimated mean lifetime is 9.1 years. This report does not demonstrate operation of the entire pump assembly within the Tank Farm ''safety envelope''. It was recognized by the Defense Nuclear Facilities Safety Board (DNFSB) this test pump was not specifically designed for long term service in tank 101-SY. In June 95 the DNFSB visited Hanford and ask the question, ''how long will this test pump last and how will the essential features fail?'' During the 2 day meeting with the DNFSB it was discussed and defined within the meeting just exactly what essential features of the pump must operate. These essential features would allow the pump to operate for the purpose of extending the window for replacement. Operating with only essential features would definitely be outside the operating safety envelope and would require a waiver. There are three essential features: 1. The pump itself (i.e. the impeller and motor) must operate 2. Nozzles and discharges leg must remain unplugged 3. The pump can be re-aimed, new waste targeted, even if manually

  4. Tank 241-AW-101 tank characterization plan

    International Nuclear Information System (INIS)

    Sathyanarayana, P.

    1994-01-01

    The first section gives a summary of the available information for Tank AW-101. Included in the discussion are the process history and recent sampling events for the tank, as well as general information about the tank such as its age and the risers to be used for sampling. Tank 241-AW-101 is one of the 25 tanks on the Flammable Gas Watch List. To resolve the Flammable Gas safety issue, characterization of the tanks, including intrusive tank sampling, must be performed. Prior to sampling, however, the potential for the following scenarios must be evaluated: the potential for ignition of flammable gases such as hydrogen-air and/or hydrogen-nitrous oxide; and the potential for secondary ignition of organic-nitrate/nitrate mixtures in crust layer initiated by the burning of flammable gases or by a mechanical in-tank energy source. The characterization effort applicable to this Tank Characterization Plan is focused on the resolution of the crust burn flammable gas safety issue of Tank AW-101. To evaluate the potential for a crust burn of the waste material, calorimetry tests will be performed on the waste. Differential Scanning Calorimetry (DSC) will be used to determine whether an exothermic reaction exists

  5. 241-Z-361 Sludge Characterization Sampling and Analysis Plan

    Energy Technology Data Exchange (ETDEWEB)

    BANNING, D.L.

    1999-08-05

    This sampling and analysis plan (SAP) identifies the type, quantity, and quality of data needed to support characterization of the sludge that remains in Tank 241-2-361. The procedures described in this SAP are based on the results of the 241-2-361 Sludge Characterization Data Quality Objectives (DQO) (BWHC 1999) process for the tank. The primary objectives of this project are to evaluate the contents of Tank 241-2-361 in order to resolve safety and safeguards issues and to assess alternatives for sludge removal and disposal.

  6. 241-Z-361 Sludge Characterization Sampling and Analysis Plan

    Energy Technology Data Exchange (ETDEWEB)

    BANNING, D.L.

    1999-07-29

    This sampling and analysis plan (SAP) identifies the type, quantity, and quality of data needed to support characterization of the sludge that remains in Tank 241-2-361. The procedures described in this SAP are based on the results of the 241-2-361 Sludge Characterization Data Quality Objectives (DQO) (BWHC 1999) process for the tank. The primary objectives of this project are to evaluate the contents of Tank 241-2-361 in order to resolve safety and safeguards issues and to assess alternatives for sludge removal and disposal.

  7. Contrasts between the marine and freshwater biological interactions of plutonium and americium

    International Nuclear Information System (INIS)

    Livingston, H.D.; Bowen, V.T.

    1975-01-01

    Whether in lakes or the oceans the transuranic elements plutonium and americium are taken up by marine organisms, with concentration factors that would class them as nice, typical heavy metals. There is no evidence for strong, widespread discrimination against the transuranics by either plant or animal absorptive surfaces. In both freshwater and marine situations the major reservoir of Pu and Am soon becomes the sediments, and organisms are more exposed to uptake of these nuclides the closer is their ecological involvement with the sediments. Although there is little evidence that this can be an ionic strength effect, it does appear that Pu may be somewhat more available, biologically, in marine environments, and Am, conversely, in fresh water. We incline to the belief that details of these behaviors are usually controlled by local availability of organic complexers. No compelling evidence exists of increase in Pu concentration at higher levels of food chains; in marine situations this appears true of Am as well, but a few data suggest that in fresh water fish there is a progressive increase, in higher trophic levels, in the ratio Am to Pu. Although marine and fresh water biogeochemistries of transuranics are much more similar than we had expected, it will generally be dangerous to extrapolate from one to the other. In both systems there appears to us no question that we are observing real element biogeochemistry, not the redistribution of inert, labelled, fallout fragments

  8. Multicompartment kinetic models for the metabolism of americium, plutonium and uranium in rats

    International Nuclear Information System (INIS)

    Sontag, W.

    1986-01-01

    To examine the kinetic behaviour of americium, plutonium and uranium in male and female rats, an extended mammillary model has been developed, composed of 10 compartments connected with 17 linear transfer coefficients. The 10 compartments describe the behaviour of the three nuclides in the blood, skeleton, liver and kidney; the remaining activity is assigned to one residual organ. Each organ is divided into two compartments, short- and long-term. In the skeleton the short-term compartment has been assumed to be the bone surface and marrow, and the long-term compartment the deep bone; in the liver, evidence suggests that the short-term compartment is physiologically associated with lysosomes and the long-term compartment identical with telolysosomes. Influence of age, sex and different nuclides on the transfer coefficients and the absorbed radiation dose are discussed. By using the transfer coefficients calculated for intravenous injection, the behaviour of the nuclides in skeleton and liver during continuous intake has been calculated. The behaviour of the three nuclides in skeleton and liver after intravenous injection has also been calculated with the additional assumption that from the fifth day the animals were treated continuously with a chelating agent. (UK)

  9. Development and Testing of an Americium/Lanthanide Separation Flowsheet Using Sodium Bismuthate

    Energy Technology Data Exchange (ETDEWEB)

    Jack Law; Bruce Mincher; Troy Garn; Mitchell Greenhalgh; Nicholas Schmitt; Veronica Rutledge

    2014-04-01

    The separation of Am from the lanthanides and curium is a key step in proposed advanced fuel cycle scenarios. The partitioning and transmutation of Am is desirable to minimize the long-term heat load of material interred in a future high-level waste repository. A separation process amenable to process scale-up remains elusive. Given only subtle chemistry differences within and between the ions of the trivalent actinide and lanthanide series this separation is challenging ; however, higher oxidation states of americium can be prepared using sodium bismuthate and separated via solvent extraction using diamylamylphosphonate (DAAP) extraction. Among the other trivalent metals only Ce is also oxidized and extracted. Due to the long-term instability of Am(VI) , the loaded organic phase is readily selectively stripped to partition the actinide to a new acidic aqueous phase. Batch extraction distribution ratio measurements were used to design a flowsheet to accomplish this separation. Additionally, crossflow filtration was investigated as a method to filter the bismuthate solids from the feed solution prior to extraction. Results of the filtration studies, flowsheet development work and flowsheet performance testing using a centrifugal contactor are detailed.

  10. In Vitro Dissolution Tests of Plutonium and Americium Containing Contamination Originating From ZPPR Fuel Plates

    Energy Technology Data Exchange (ETDEWEB)

    William F. Bauer; Brian K. Schuetz; Gary M. Huestis; Thomas B. Lints; Brian K. Harris; R. Duane Ball; Gracy Elias

    2012-09-01

    Assessing the extent of internal dose is of concern whenever workers are exposed to airborne radionuclides or other contaminants. Internal dose determinations depend upon a reasonable estimate of the expected biological half-life of the contaminants in the respiratory tract. One issue with refractory elements is determining the dissolution rate of the element. Actinides such as plutonium (Pu) and Americium (Am) tend to be very refractory and can have biological half-lives of tens of years. In the event of an exposure, the dissolution rates of the radionuclides of interest needs to be assessed in order to assign the proper internal dose estimates. During the November 2011 incident at the Idaho National Laboratory (INL) involving a ZPPR fuel plate, air filters in a constant air monitor (CAM) and a giraffe filter apparatus captured airborne particulate matter. These filters were used in dissolution rate experiments to determine the apparent dissolution half-life of Pu and Am in simulated biological fluids. This report describes these experiments and the results. The dissolution rates were found to follow a three term exponential decay equation. Differences were noted depending upon the nature of the biological fluid simulant. Overall, greater than 95% of the Pu and 93% of the Am were in a very slow dissolving component with dissolution half-lives of over 10 years.

  11. Removal of plutonium and Americium from hydrochloric acid waste streams using extraction chromatography

    International Nuclear Information System (INIS)

    Schulte, L.D.; FitzPatrick, J.R.; Salazar, R.R.; Schake, B.S.; Martinez, B.T.

    1995-01-01

    Extraction chromatography is under development as a method to lower actinide activity levels in hydrochloric acid (HCl) effluent streams. Successful application of this technique for radioactive liquid waste treatment would provide a low activity feedstream for HCl recycle, reduce the loss of radioactivity to the environment in aqueous effluents, and lower the quantity and improve the form of solid waste generated. The extraction of plutonium and americium from HCl solutions was examined for several commercial and laboratory-produced sorbed resin materials. Polymer beads were coated with n-octyl(phenyl)-N,N-diisobutylcarbamoyl- methylphosphine oxide (CMPO) and either tributyl phosphate (TBP), or diamyl amylphosphonate (DAAP). Distribution coefficients for Pu and Am were measured by contact studies in 1-10 M HCl, while varying REDOX conditions, actinide loading levels, and resin formulations. Flow experiments were run to evaluate actinide loading and elution under varied conditions. Significant differences in the actinide distribution coefficients in contact experiments, and in actinide retention in flow experiments were observed as a function of resin formulation

  12. Cleanex process: a versatile solvent extraction process for recovery and purification of lanthanides, americium, and curium

    International Nuclear Information System (INIS)

    Bigelow, J.E.; Collins, E.D.; King, L.J.

    1979-01-01

    At a concentration of 1 M in straight-chain hydrocarbon diluent, HDEHP will extract americium, curium, and other trivalent actinide and lanthanide elements from dilute acid or salt solutions. The solute is back-extracted with more concentrated acid, either nitric or hydrochloric. The process has been used in the continuous, countercurrent mode, but its greatest advantage arises in batch extractions where the excess acid can be titrated with NaOH to produce a final acidity of about 0.03 M. Under these conditions, 99% recovery can be achieved, usually in one stage. Cleanex was used on the 50-liter scale at the Transuranium Processing Plant at Oak Ridge for 12 years to provide a broad spectrum cleanup to transuranium elements before applying more sophisticated techniques for separating individual products. The process is also used routinely to recover excessive losses of curium and/or californium from plant waste streams. The solvent system is relatively resistant to radiation damage, being usable up to 200 W-h/liter

  13. Tank characterization report for single shell tank 241-SX-108

    Energy Technology Data Exchange (ETDEWEB)

    Eggers, R.F., Westinghouse Hanford

    1996-07-11

    This document summarizes the information on the historical uses, present status, and the sampling and analysis results of waste stored in tank 241-SX-108. This report supports the requirements of Tri-Party Agreement Milestone M-44-09.

  14. Tank characterization report for single shell tank 241-S-107

    Energy Technology Data Exchange (ETDEWEB)

    Simpson, B.C.

    1996-09-19

    This document summarizes the information on the historical uses, present status, and the sampling and analysis results of waste stored in Tank 241-S-107. This report supports the requirements of Tri- Party Agreement Milestone M-44-09.

  15. 24 CFR 241.865 - Election by the lender.

    Science.gov (United States)

    2010-04-01

    ... Without a HUD-Insured or HUD-Held Mortgage Rights and Duties of Lender Under the Contract of Insurance § 241.865 Election by the lender. Where a real estate mortgage, or other security instrument has been...

  16. Photon interaction studies using 241Am γ-rays

    Indian Academy of Sciences (India)

    rays from a 241Am source. These include attenuation studies as well as photoelectric absorption studies in various samples. The attenuation studies have been made using leaf and wood samples, samples like sand, sugar etc., which ...

  17. Tank 241-BY-105 rotary core sampling and analysis plan

    International Nuclear Information System (INIS)

    Sasaki, L.M.

    1995-01-01

    This Sampling and Analysis Plan (SAP) identifies characterization objectives pertaining to sample collection, laboratory analytical evaluation, and reporting requirements for two rotary-mode core samples from tank 241-BY-105 (BY-105)

  18. Acceptance Test Report for 241-U compressed air system

    International Nuclear Information System (INIS)

    Freeman, R.D.

    1994-01-01

    This Acceptance Test Report (ATR) documents the results of acceptance testing of a newly upgraded compressed air system at 241-U Farm. The system was installed and the test successfully performed under work package 2W-92-01027

  19. Compressed air piping, 241-SY-101 hydraulic pump retrieval trailer

    International Nuclear Information System (INIS)

    Wilson, T.R.

    1994-01-01

    The following Design Analysis was prepared by the Westinghouse Hanford Company to determine pressure losses in the compressed air piping installed on the hydraulic trailer for the 241-SY-101 pump retrieval mission

  20. Tank 241-AZ-101 tank characterization plan

    International Nuclear Information System (INIS)

    Schreiber, R.D.

    1995-01-01

    The Defense Nuclear Facilities Safety Board has advised the DOE to concentrate the near-term sampling and analysis activities on identification and resolution of safety issues. The Data Quality Objective (DQO) process was chosen as a tool to be used in the resolution of safety issues. As a result, A revision in the Federal Facilities Agreement and Consent Order (Tri-Party Agreement) milestone M-44 has been made, which states that ''A Tank Characterization Plan (TCP) will also be developed for each double-shell tank (DST) and single-shell tank (SST) using the DQO process. Development of TCPs by the DQO process is intended to allow users to ensure their needs will be met and that resources are devoted to gaining only necessary information''. This document satisfies that requirement for Tank 241-AZ-101 (AZ-101) sampling activities. Tank AZ-101 is currently a non-Watch List tank, so the only DQOs applicable to this tank are the safety screening DQO and the compatibility DQO, as described below. The contents of Tank AZ-101, as of October 31, 1994, consisted of 3,630 kL (960 kgal) of dilute non-complexed waste and aging waste from PUREX (NCAW, neutralized current acid waste). Tank AZ-101 is expected to have two primary layers. The bottom layer is composed of 132 kL of sludge, and the top layer is composed of 3,500 kL of supernatant, with a total tank waste depth of approximately 8.87 meters

  1. Tank 241-AZ-102 tank characterization plan

    International Nuclear Information System (INIS)

    Schreiber, R.D.

    1995-01-01

    The Defense Nuclear Facilities Safety Board has advised the DOE to concentrate the near-term sampling and analysis activities on identification and resolution of safety issues. The Data Quality Objective (DQO) process was chosen as a tool to be used in the resolution of safety issues. As a result, a revision in the Federal Facilities Agreement and Consent Order (Tri-Party Agreement) milestone M-44 has been made, which states that ''A Tank Characterization Plan (TCP) will also be developed for each double-shell tank (DST) and single-shell tank (SST) using the DQO process ... Development of TCPs by the DQO process is intended to allow users to ensure their needs will be met and that resources are devoted to gaining only necessary information''. This document satisfies that requirement for tank 241-AZ-102 (AZ-102) sampling activities. Tank AZ-102 is currently a non-Watch List tank, so the only DQOs applicable to this tank are the safety screening DQO and the compatibility DQO, as described below. The current contents of Tank AZ-102, as of October 31, 1994, consisted of 3,600 kL (950 kgal) of dilute non-complexed waste and aging waste from PUREX (NCAW, neutralized current acid waste). Tank AZ-102 is expected to have two primary layers. The bottom layer is composed of 360 kL of sludge, and the top layer is composed of 3,240 kL of supernatant, with a total tank waste depth of approximately 8.9 meters

  2. Tank 241-A-105 leak assessment

    Energy Technology Data Exchange (ETDEWEB)

    1991-06-01

    Tank 241-A-105 is one of 149 single shell tanks constructed at Hanford to contain and store highly radioactive wastes originating from the processing of spent nuclear reactor fuel. Radiation detection and temperature monitoring devices installed beneath the tank indicate that several episodes of leakage of waste from the tank have occurred. The aim of this study was to evaluate the previous estimates and reanalyze the data to provide a more accurate estimate of leakage from the tank. The principal conclusions of this study are as follows: Earlier investigators estimated leakage prior to August 1968 at 5,000 to 15,000 gallons. Their estimate appears reasonable. Leakage while the tank was being sluiced (8/68--11/70) probably exceeded 5,000 gallons, but probably did not exceed 30,000 gallons. Insufficient data are available to be more precise. Cooling water added to the tank during the sprinkling phase (11/70 -- 12/78) was approximately 610,000 gallons. Sufficient heat was generated in the tank to evaporate most, and perhaps nearly all, of this water. Radionuclides escaping into the soil under the tank cannot be estimated directly because of many uncertainties. Based on a range of leakage from 10,000 to 45,000 gallons, assumed compositions, and decayed to 1/1/91, radioactivity under the tank is expected to be in the range of 85,000--760,000 curies. Measured radiation peaks were nearly all located directly below the perimeter of the tank and, except in rare cases, they showed no tendency to spread horizontally. Moreover, the maximum radiation readings detected are a very small fraction of the radiation reading in the tank. This is the basis for the conclusion that the rate of leakage and, most likely, the quantity leaked, was small. 51 refs., 5 figs., 3 tabs.

  3. Analysis and characterization of double shell tank 241-AP-108

    International Nuclear Information System (INIS)

    Miller, G.L.

    1994-01-01

    This document is the first part of a three-part report describing the analysis and characterization of double shell tank 241-AP-108 which is located at the Hanford Reservation.This document is the analytical laboratory data package entitled 'Analysis and Characterization of Double Shell Tank 241-AP-108' which contains a case sampling history, the sampling protocols, the analytical procedures, sampling and analysis quality assurance and quality control measures, and chemical analysis results for samples obtained from the tank

  4. Test report - 241-AN-274 Caustic Pump Control Building

    International Nuclear Information System (INIS)

    Paintner, G.P.

    1995-05-01

    This Acceptance Test Report documents the test results of test procedure WHC-SD-WM-ATP-135 'Acceptance Test Procedure for the 241-AN- 274 Caustic Pump Control Building.' The objective of the test was to verify that the 241-AN-274 Caustic Pump Control Building functions properly based on design specifications per applicable H-2-85573 drawings and associated ECN's. The objective of the test was met

  5. Dicty_cDB: CHR241 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CH (Link to library) CHR241 (Link to dictyBase) - - - Contig-U10843-1 | Contig-U131... library) Clone ID CHR241 (Link to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U108...43-1 | Contig-U13148-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/C...ilyhtht**KTMATQQQQQQQQQQQQQIKARKDIQIQQ AQSASDILGPPEISETEITTESILGDGSFGTVYKGRCRLKDVAVKVMLKQVDQKTLTDFR KEVAIMSKIFHPNIVLFLGACTSTPGKLMICT...PPEISETEITTESILGDGSFGTVYKGRCRLKDVAVKVMLKQVDQKTLTDFR KEVAIMSKIFHPNIVLFLGACTSTPGKLMICTELMKGNLVSLLLDPMVKLPLITRM

  6. Pismis 24-1: The Stellar Upper Mass Limit Preserved

    Science.gov (United States)

    Maíz Apellániz, J.; Walborn, Nolan R.; Morrell, N. I.; Niemela, V. S.; Nelan, E. P.

    2007-05-01

    Is there a stellar upper mass limit? Recent statistical work seems to indicate that there is and that it is in the vicinity of 150 Msolar. In this paper we use HST and ground-based data to investigate the brightest members of the cluster Pismis 24, one of which (Pismis 24-1) was previously inferred to have a mass greater than 200 Msolar, in apparent disagreement with that limit. We determine that Pismis 24-1 is composed of at least three objects, the resolved Pismis 24-1SW and the unresolved spectroscopic binary Pismis 24-1NE. The evolutionary zero-age masses of Pismis 24-1SW, the unresolved system Pismis 24-1NE, and the nearby star Pismis 24-17 are all ~100 Msolar, very large but under the stellar upper mass limit. This article is based on data gathered with three facilities: the NASA/ESA Hubble Space Telescope (HST), the 6.5 m Magellan Telescopes at Las Campanas Observatory (LCO), and the 2.15 m J. Sahade telescope at Complejo Astronómico El Leoncito (CASLEO). The HST observations are associated with GO program 10602. HST is controlled from the Space Telescope Science Institute, which is operated by the Association of Universities for Research in Astronomy, Inc., under NASA contract NAS 5-26555. CASLEO is operated under agreement between CONICET, SeCyT, and the Universities of La Plata, Córdoba and San Juan, Argentina.

  7. Evaluation of the contamination risk by {sup 241}AM from lightning rods disposed at uncontrolled garbage dump; Avaliacao da contaminacao provocada por para-raios radioativos de americio-241 descartados em lixoes

    Energy Technology Data Exchange (ETDEWEB)

    Marumo, Julio Takehiro

    2006-07-01

    Radioactive lightning rods were manufactured in Brazil until 1989, when the licenses for using radioactive sources in these products were lifted by the national nuclear authority. Since then, radioactive devices have been replaced by Franklin type one and collected as radioactive waste. However, only 23 percent of the estimated total number of installed rods was delivered to Brazilian Nuclear Commission (Comissao Nacional de Energia Nuclear - CNEN). This situation is of concern as there is a possibility of the rods being discarded as domestic waste, considering that in Brazil, 63.6 percent of the municipal solid waste is disposed at uncontrolled garbage dump, according to Instituto Brasileiro de Geografia e Estatistica (IBGE) in 2000. In addition, americium, the most common employed radionuclide, is classified as a high toxicity element, when ingested or inhaled. In the present study, it was performed migration experiments of Am-241 by lysimeter system in order to evaluate the risk of contamination caused by radioactive lightning rods disposed as a common solid waste. Sources removed from lightning rods were placed inside lysimeters filled with organic waste, collected at the restaurant of Instituto de Pesquisas Energeticas e Nucleares, IPEN-CNEN/SP, and the generated leachate was periodically analyzed to determine its characteristics such as pH, redox potential, solid content and concentration of the radioactive material. Microbial growth was also evaluated by counting the number of colony forming units. The equivalent dose to members of the public has been calculated considering the ingestion of drinking water, the most probable mode of exposure. The final result was about 145 times below the effective dose limit of 1 mSv.year-1 for members of the public, established by the International Commission on Radiological Protection (ICRP), demonstrating that the risk caused by lightning rods disposed at uncontrolled garbage dump is low. (author)

  8. Effect of gavaged chemical form of 241Am on its retention in mice

    International Nuclear Information System (INIS)

    Hisamatsu, S.; Takizawa, Y.

    1987-01-01

    The retention of 241 Am in mice 48 h after administration by gavage is reported here. The 241 Am was given to mice in the form of either 241 Am nitrate or 241 Am citrate. The 241 Am was also injected into rats in the same form. The homogenized livers of those rats were subsequently administered by gavage to another group of mice. The retention of 241 Am citrate was 1.5 X 10(-2)% of the original dose and was the highest among the compounds examined. The retention of biologically incorporated 241 Am into the liver as 241 Am nitrate and as 241 Am citrate was 2.4 X 10(-3) and 2.6 X 10(-3)%, respectively, and was similar to the retention of 241 Am nitrate, which was 2.8 X 10(-3)%. The ratio of the retention in the carcass to that in the liver for the 241 Am citrate was lower than that of the 241 Am nitrate and the biologically incorporated 241 Am. This difference indicates that the distribution of 241 Am in the animal body depends on the chemical form administered. The retention of liver-incorporated 241 Am as citrate after autolysis of the liver is similar to that of fresh liver-incorporated 241 Am citrate

  9. Use of radioisotopes in the study of tetracycline analytical application. Extraction of compounds formed between tetracycline and neptunium and americium elements

    International Nuclear Information System (INIS)

    Saiki, M.; Lima, F.W. de

    1986-01-01

    The behavior of tetracycline as complexing agent, in solvent extraction studies of neptunium and americium, using benzyl alcohol as the organic phase, is presented. By using radioactive tracers of 239 Np and 2 4 1 Am the extraction percent of these elements were determined as a function of pH in the absence and in the presence of several masking agents. The influence of shaking time and the use of different types of supporting eletrolytes upon the extraction behavior was also studied. The extraction curves obtained using EDTA as masking agent show that tetracycline can be used for neptunium and americium separation. In this condition neptunium is extracted into the organic phase and americium remains in the aqueous phase. (Author) [pt

  10. 241-SY Tank Farm Construction Extent of Condition Review for Tank Integrity

    Energy Technology Data Exchange (ETDEWEB)

    Barnes, Travis J.; Boomer, Kayle D.; Gunter, Jason R.; Venetz, Theodore J.

    2013-07-25

    This report provides the results of an extent of condition construction history review for tanks 241-SY-101, 241-SY-102, and 241-SY-103. The construction history of the 241-SY tank farm has been reviewed to identify issues similar to those experienced during tank 241-AY-102 construction. Those issues and others impacting integrity are discussed based on information found in available construction records, using tank 241-AY-102 as the comparison benchmark. In the 241-SY tank farm, the third DST farm constructed, refractory quality and stress relief were improved, while similar tank and liner fabrication issues remained.

  11. Transport of plutonium, americium, and curium from soils into plants by roots

    International Nuclear Information System (INIS)

    Pimpl, M.; Schuettelkopf, H.

    1979-12-01

    For assessing the dose from radionuclides in agricultural products by ingestion it is necessary to know the soil to plant transfer factors. The literature was entirely investigated, in order to judge the size of the soil to plant transfer factors. In total, 92 publications - from 1948 to 1978 -have been evaluated. As result, transfer factors from 10 -9 to 10 -3 have been found for Plutonium, and from 10 -6 to 1 for Americium. For Curium only few data are available in literature. The considerable variation of the measured transfer factors is based on the dependence of these transfer factors from the ion exchange capacity of soils, from the amount of organic materials, from the pH-value, and from the mode of contamination. There are, in any case, contradictory data, although there has been detected a dependence of the transfer factors from these parameters. Chelating agenst increase the transfer factors to approximately 1300. As well, fertilizers have an influence on the size of the transfer factors - however, the relationships have been scarcely investigated. The distribution of actinides within the individual parts of plants has been investigated. The highest concentrations are in the roots; in the plant parts above ground the concentration of actinides decreases considerably. The most inferior transfer factors were measured for the respective seed or fruits. The soil to plant transfer factors of actinides are more dependend on the age of the plants within one growing period. At the beginning of the period, the transfer factor is considerably higher than at the end of this period. With respect to plants with a growing period of several years, correlations are unknown. (orig.) [de

  12. Experiments comparing the uptake of americium from chloride media using extraction chromatography

    International Nuclear Information System (INIS)

    FitzPatrick, J.R.; Schake, B.S.; Schulte, L.D.; Martinez, B.T.; Salazar, R.R.

    1995-01-01

    Clean-up of actinide effluent waste steams is of increasing importance at the Los Alamos Plutonium Facility, TA-55, and removing the actinide elements to very low levels allows less radioactivity to go the Los Alamos National Laboratory Water Treatment Facility, TA-50, thus reducing the number of drums of TRU waste. Americium (Am) is a difficult element to remove from chloride media because the +3 state is difficult to oxidize and chelating resins work better with elements such as plutonium which are more readily oxidized to the +4 and/or +6 state. Currently in hydrochloric acid (HC1) media, the acidic liquid waste is neutralized with potassium hydroxide to precipitate the metal hydroxides, before disposal to TA-50. This process is not very efficient. The removal of Am from chloride media was compared using a series of resins, some commercial and some made in our laboratory, using different percentages by weight of octyl(phenyl)-N,N-diiso- butylcarbamoyl-methylphosphine oxide (CMPO ) along with diamyl amylphosphonate (DAAP) or tributyl phosphate (TBP) as diluents. Resins were also made with no added diluent. Early comparisons using small-scale contact studies with 0.5 grams of resin in 0.1M-12M HC1, and subsequent small-scale flow experiments show a trend in which Am uptake is proportional to the amount of CMPO on the resins and the diluent plays a minor role in the uptake of Am from these solutions. Redox chemistry effects were also investigated. From these studies, it is possible to determine the best conditions for the removal of Am from HC1 media thus reducing the gross alpha content of the waste stream by a factor of 10-100 which reduces the number of barrels of waste produced at the Water Treatment Facility

  13. Americium/Lanthanide Separations in Alkaline Solutions for Advanced Nuclear Fuel Cycles

    Energy Technology Data Exchange (ETDEWEB)

    Goff, George S. [Los Alamos National Laboratory; Long, Kristy Marie [Los Alamos National Laboratory; Reilly, Sean D. [Los Alamos National Laboratory; Jarvinen, Gordon D. [Los Alamos National Laboratory; Runde, Wolfgang H. [Los Alamos National Laboratory

    2012-06-11

    Project goals: Can used nuclear fuel be partitioned by dissolution in alkaline aqueous solution to give a solution of uranium, neptunium, plutonium, americium and curium and a filterable solid containing nearly all of the lanthanide fission products and certain other fission products? What is the chemistry of Am/Cm/Ln in oxidative carbonate solutions? Can higher oxidation states of Am be stabilized and exploited? Conclusions: Am(VI) is kinetically stable in 0.5-2.0 M carbonate solutions for hours. Aliquat 336 in toluene has been successfully shown to extract U(VI) and Pu(VI) from carbonate solutions. (Stepanov et al 2011). Higher carbonate concentration gives lower D, SF{sub U/Eu} for = 4 in 1 M K{sub 2}CO{sub 3}. Experiments with Am(VI) were unsuccessful due to reduction by the organics. Multiple sources of reducing organics...more optimization. Reduction experiments of Am(VI) in dodecane/octanol/Aliquat 336 show that after 5 minutes of contact, only 30-40% of the Am(VI) has been reduced. Long enough to perform an extraction. Shorter contact times, lower T, and lower Aliquat 336 concentration still did not result in any significant extraction of Am. Anion exchange experiments using a strong base anion exchanger show uptake of U(VI) with minimal uptake of Nd(III). Experiments with Am(VI) indicate Am sorption with a Kd of 9 (10 minute contact) but sorption mechanism is not yet understood. SF{sub U/Nd} for = 7 and SF{sub U/Eu} for = 19 after 24 hours in 1 M K{sub 2}CO{sub 3}.

  14. Distribution of plutonium and americium in whole bodies donated to the United States Transuranium Registry

    International Nuclear Information System (INIS)

    McInroy, J.F.; Kathren, R.L.; Swint, M.J.

    1989-01-01

    Radiochemical analysis of whole body donations from six former nuclear industry workers 30 or more years post-exposure revealed about 45% of the total body deposition of 239 Pu and 35% of the 241 Am in the respiratory tract of the four cases with inhalation exposure. These proportions are greater than predicted by the current ICRP lung model. Exclusive of the respiratory tract, the mean fractional systemic deposition of 239 Pu in the tissues of five whole bodies was: liver 35.4% ± 12.5%; skeleton 53.7% ± 12.5%; striated muscle 6.5% ± 1.8% and all other organs and tissues 4.4% ± 1.7%. For 241 Am, the comparable values in four cases were liver 6.5% ± 4.8%; skeleton 73.5% ± 12.4%; muscle 14.3% ± 7.6%; and all other tissues and organs 6.65% ± 4.2%. The systemic distribution of 239 Pu was generally consistent with ICRP Publication 30. A significant fraction of both nuclides was retained in the muscle and other soft tissues which serve as long-term storage depots. Initial fractionation of 241 Am between skeleton and liver is consistent with the 50:30 ratio proposed in ICRP Publication 48 assuming an effective clearance half-time from the liver of about 2 y. Estimates of 239 Pu deposition made on the basis of urinalysis results in vivo were typically greater than the observed deposition measured in the tissues of the whole body after death. (author)

  15. Plutonium, americium and 90Sr in bones of the some wild animals living in Poland

    International Nuclear Information System (INIS)

    Mietelski, J.W.; Kitowski, I.; Tomankiewicz, E.; Gaca, P.; Blazej, S.

    2006-01-01

    Bones of the wild foxes (Vulpes vulpes), roe deer (Capreolus capreolus), deer (Cervus elaphus), wild boars (Sus scorf), mooses (Alces alces), as well as of certain kinds of rodents and insectivorous animals were ashed and milled prior to the radioactivity measurement in the γ-spectrometer. 238 Pu, 239,240 Pu, 241 Am and 90 Sr contents were determined. The results are presented in terms of the kind and origin of the animals. North-east, central-east and south-est parts of Poland were taken into an account

  16. Assessment of Neptunium, Americium, and Curium in the Savannah River Site Environment

    International Nuclear Information System (INIS)

    Carlton, W.H.

    1997-01-01

    A series of documents has been published in which the impact of various radionuclides released to the environment by Savannah River Site (SRS) operations has been assessed. The quantity released, the disposition of the radionuclides in the environment, and the dose to offsite individuals has been presented for activation products, carbon cesium, iodine, plutonium, selected fission products, strontium, technetium, tritium, uranium, and the noble gases. An assessment of the impact of nonradioactive mercury also has been published.This document assesses the impact of radioactive transuranics released from SRS facilities since the first reactor became operational late in 1953. The isotopes reported here are 239Np, 241Am, and 244Cm

  17. Determination of americium and curium using ion-exchange in the nitric-acid-methanol medium for environmental analysis

    International Nuclear Information System (INIS)

    Holm, E.; Fukai, R.

    1976-01-01

    While transplutonic elements are only slightly sorbed to anion exchangers from hydrochloric or nitric acid media, the presence of alcohol enhances the anionic exchange of these elements, especially in nitric and sulfuric solutions. In the present work a method has been developed for determining americium and curium in environmental samples, on the basis of the difference between the sorption characteristics to anion exchangers in the acid-methanol system of these transplutonic elements and those of plutonium, polonium and thorium. The method also permits us to perform sequential determination of plutonium, when necessary

  18. Sequential determination of natural (232Th, 238U) and anthropogenic (137Cs, 90Sr, 241Am, 239+240Pu) radionuclides in environmental matrix

    International Nuclear Information System (INIS)

    Michel, H.; Levent, D.; Barci, V.; Barci-Funel, G.; Hurel, C.

    2008-01-01

    A new sequential method for the determination of both natural (U, Th) and anthropogenic (Sr, Cs, Pu, Am) radionuclides has been developed for application to soil and sediment samples. The procedure was optimised using a reference sediment (IAEA-368) and reference soils (IAEA-375 and IAEA-326). Reference materials were first digested using acids (leaching), 'total' acids on hot plate, and acids in microwave in order to compare the different digestion technique. Then, the separation and purification were made by anion exchange resin and selective extraction chromatography: Transuranic (TRU) and Strontium (SR) resins. Natural and anthropogenic alpha radionuclides were separated by Uranium and Tetravalent Actinide (UTEVA) resin, considering different acid elution medium. Finally, alpha and gamma semiconductor spectrometer and liquid scintillation spectrometer were used to measure radionuclide activities. The results obtained for strontium-90, cesium-137, thorium-232, uranium- 238, plutonium-239+240 and americium-241 isotopes by the proposed method for the reference materials provided excellent agreement with the recommended values and good chemical recoveries. (authors)

  19. Tank characterization data report: Tank 241-C-112

    Energy Technology Data Exchange (ETDEWEB)

    Simpson, B.C.; Borsheim, G.L.; Jensen, L.

    1993-09-01

    Tank 241-C-112 is a Hanford Site Ferrocyanide Watch List tank that was most recently sampled in March 1992. Analyses of materials obtained from tank 241-C-112 were conducted to support the resolution of the Ferrocyanide Unreviewed Safety Question (USQ) and to support Hanford Federal Facility Agreement and Consent Order (Tri-Party Agreement) Milestone M-10-00. Analysis of core samples obtained from tank 241-C-112 strongly indicates that the fuel concentration in the tank waste will not support a propagating exothermic reaction. Analysis of the process history of the tank as well as studies of simulants provided valuable information about the physical and chemical condition of the waste. This information, in combination with the analysis of the tank waste, sup ports the conclusion that an exothermic reaction in tank 241-C-112 is not plausible. Therefore, the contents of tank 241-C-112 present no imminent threat to the workers at the Hanford Site, the public, or the environment from its forrocyanide inventory. Because an exothermic reaction is not credible, the consequences of this accident scenario, as promulgated by the General Accounting Office, are not applicable.

  20. Tank characterization data report: Tank 241-C-112

    Energy Technology Data Exchange (ETDEWEB)

    Simpson, B.C.; Borsheim, G.L.; Jensen, L.

    1993-04-01

    Tank 241-C-112 is a Hanford Site Ferrocyanide Watch List tank that was most recently sampled in March 1992. Analyses of materials obtained from tank 241-C-112 were conducted to support the resolution of the Ferrocyanide Unreviewed Safety Question (USQ) and to support Hanford Federal Facility Agreement and Consent Order (Tri-Party Agreement) Milestone M-10-00. Analysis of core samples obtained from tank 241-C-112 strongly indicates that the fuel concentration in the tank waste will not support a propagating exothermic reaction. It is probable that tank 241-C-112 exceeds the 1,000 g-mol inventory criteria established for the Ferrocyanide USQ; however, extensive energetic analysis of the waste has determined a maximum exothermic value of -9 cal/g dry waste. This value is substantially below any levels of concern (-75 cal/g). In addition, an investigation of potential mechanisms to generate concentration levels of radionuclides high enough to be of concern was performed. No credible mechanism was postulated that could initiate the formation of such concentration levels in the tank. Tank 241-C-112 waste is a complex material made up primarily of water and inert salts. The insoluble solids are a mixture of phosphates, sulfates, and hydroxides in combination with aluminum, calcium, iron, nickel, and uranium. Disodium nickel ferrocyanide and sodium cesium nickel ferrocyanide probably exist in the tank; however, there appears to have been significant degradation of this material since the waste was initially settled in the tank.

  1. Tank characterization data report: Tank 241-C-112

    International Nuclear Information System (INIS)

    Simpson, B.C.; Borsheim, G.L.; Jensen, L.

    1993-09-01

    Tank 241-C-112 is a Hanford Site Ferrocyanide Watch List tank that was most recently sampled in March 1992. Analyses of materials obtained from tank 241-C-112 were conducted to support the resolution of the Ferrocyanide Unreviewed Safety Question (USQ) and to support Hanford Federal Facility Agreement and Consent Order (Tri-Party Agreement) Milestone M-10-00. Analysis of core samples obtained from tank 241-C-112 strongly indicates that the fuel concentration in the tank waste will not support a propagating exothermic reaction. Analysis of the process history of the tank as well as studies of simulants provided valuable information about the physical and chemical condition of the waste. This information, in combination with the analysis of the tank waste, sup ports the conclusion that an exothermic reaction in tank 241-C-112 is not plausible. Therefore, the contents of tank 241-C-112 present no imminent threat to the workers at the Hanford Site, the public, or the environment from its forrocyanide inventory. Because an exothermic reaction is not credible, the consequences of this accident scenario, as promulgated by the General Accounting Office, are not applicable

  2. Temperature and concentration dependences of the electrical resistivity for alloys of plutonium with americium under normal conditions

    Science.gov (United States)

    Tsiovkin, Yu. Yu.; Povzner, A. A.; Tsiovkina, L. Yu.; Dremov, V. V.; Kabirova, L. R.; Dyachenko, A. A.; Bystrushkin, V. B.; Ryabukhina, M. V.; Lukoyanov, A. V.; Shorikov, A. O.

    2010-01-01

    The temperature and concentration dependences of the electrical resistivity for alloys of americium with plutonium are analyzed in terms of the multiband conductivity model for binary disordered substitution-type alloys. For the case of high temperatures ( T > ΘD, ΘD is the Debye temperature), a system of self-consistent equations of the coherent potential approximation has been derived for the scattering of conduction electrons by impurities and phonons without any constraints on the interaction intensity. The definitions of the shift and broadening operator for a single-electron level are used to show qualitatively and quantitatively that the pattern of the temperature dependence of the electrical resistivity for alloys is determined by the balance between the coherent and incoherent contributions to the electron-phonon scattering and that the interference conduction electron scattering mechanism can be the main cause of the negative temperature coefficient of resistivity observed in some alloys involving actinides. It is shown that the great values of the observed resistivity may be attributable to interband transitions of charge carriers and renormalization of their effective mass through strong s-d band hybridization. The concentration and temperature dependences of the resistivity for alloys of plutonium and americium calculated in terms of the derived conductivity model are compared with the available experimental data.

  3. PLUTONIUM FINISHING PLANT (PFP) 241-Z LIQUID WASTE TREATMENT FACILITY DEACTIVATION AND DEMOLITION

    Energy Technology Data Exchange (ETDEWEB)

    JOHNSTON GA

    2008-01-15

    Liability Act of 1980' (CERCLA). The project completed TPA Milestone M-083-032 to 'Complete those activities required by the 241-Z Treatment and Storage Unit's RCRA Closure Plan' four years and seven months ahead of this legally enforceable milestone. In addition, the project completed TPA Milestone M-083-042 to 'Complete transition and dismantlement of the 241-2 Waste Treatment Facility' four years and four months ahead of schedule. The project used an innovative approach in developing the project-specific RCRA closure plan to assure clear integration between the 241-Z RCRA closure activities and ongoing and future CERCLA actions at PFP. This approach provided a regulatory mechanism within the RCRA closure plan to place segments of the closure that were not practical to address at this time into future actions under CERCLA. Lessons learned from th is approach can be applied to other closure projects within the DOE Complex to control scope creep and mitigate risk. A paper on this topic, entitled 'Integration of the 241-Z Building D and D Under CERCLA with RCRA Closure at the PFP', was presented at the 2007 Waste Management Conference in Tucson, Arizona. In addition, techniques developed by the 241-Z D&D Project to control airborne contamination, clean the interior of the waste tanks, don and doff protective equipment, size-reduce plutonium-contaminated process piping, and mitigate thermal stress for the workers can be applied to other cleanup activities. The project-management team developed a strategy utilizing early characterization, targeted cleanup, and close coordination with PFP Criticality Engineering to significantly streamline the waste- handling costs associated with the project . The project schedule was structured to support an early transition to a criticality 'incredible' status for the 241-Z Facility. The cleanup work was sequenced and coordinated with project-specific criticality analysis to allow the fissile

  4. PLUTONIUM FINISHING PLANT (PFP) 241-Z LIQUID WASTE TREATMENT FACILITY DEACTIVATION AND DEMOLITION

    International Nuclear Information System (INIS)

    JOHNSTON GA

    2008-01-01

    ' (CERCLA). The project completed TPA Milestone M-083-032 to 'Complete those activities required by the 241-Z Treatment and Storage Unit's RCRA Closure Plan' four years and seven months ahead of this legally enforceable milestone. In addition, the project completed TPA Milestone M-083-042 to 'Complete transition and dismantlement of the 241-2 Waste Treatment Facility' four years and four months ahead of schedule. The project used an innovative approach in developing the project-specific RCRA closure plan to assure clear integration between the 241-Z RCRA closure activities and ongoing and future CERCLA actions at PFP. This approach provided a regulatory mechanism within the RCRA closure plan to place segments of the closure that were not practical to address at this time into future actions under CERCLA. Lessons learned from th is approach can be applied to other closure projects within the DOE Complex to control scope creep and mitigate risk. A paper on this topic, entitled 'Integration of the 241-Z Building D and D Under CERCLA with RCRA Closure at the PFP', was presented at the 2007 Waste Management Conference in Tucson, Arizona. In addition, techniques developed by the 241-Z D and D Project to control airborne contamination, clean the interior of the waste tanks, don and doff protective equipment, size-reduce plutonium-contaminated process piping, and mitigate thermal stress for the workers can be applied to other cleanup activities. The project-management team developed a strategy utilizing early characterization, targeted cleanup, and close coordination with PFP Criticality Engineering to significantly streamline the waste- handling costs associated with the project . The project schedule was structured to support an early transition to a criticality 'incredible' status for the 241-Z Facility. The cleanup work was sequenced and coordinated with project-specific criticality analysis to allow the fissile material waste being generated to be managed in a bulk fashion

  5. Test plan for tank 241-AN-104 dilution studies

    International Nuclear Information System (INIS)

    Herting, D.L.

    1998-01-01

    Tank 241-AN-104 (104-AN) has been identified as the one of the first tanks to be retrieved for low level waste pretreatment and immobilization. Retrieval of the tank waste will require dilution. Laboratory tests are needed to determine the amount and type of dilution required for safe retrieval and transfer of feed and to re-dissolve major soluble sodium salts while not precipitating out other salts. The proposed laboratory tests are described in this document. Tank 241-AN-104 is on the Hydrogen Watch List

  6. Operational test procedure for Bldg 241-A-701 air compressor

    International Nuclear Information System (INIS)

    Desantis, G.N.

    1995-01-01

    This document is an Operability Test Procedure (OTP) which will verify and record that the 241-A-701 air compressor and associated equipment operates within their intended design parameters. The activities defined in this OTP will be performed to ensure the daily operation of the new compressed air system can be reliable and efficient. The Compressed Air System (CAS) for 241-A-701 supplies process and instrument air to the A, AX, AY, and AZ tank farms. The primary use of the CAS is for tank farms instrumentation, air operated valves, and air lift circulators

  7. Residual waste from Hanford tanks 241-C-203 and 241-C-204. 2. Contaminant release model.

    Science.gov (United States)

    Cantrell, Kirk J; Krupka, Kenneth M; Deutsch, William J; Lindberg, Michael J

    2006-06-15

    Release of U and 99Tc from residual sludge in Hanford waste tanks 241-C-203 and 241-C-204 atthe U.S. Department of Energy's (DOE) Hanford Site in southeastern Washington state was quantified by water-leaching, selective extractions, empirical solubility measurements, and thermodynamic modeling. A contaminant release model was developed based on these experimental results and solid-phase characterization results presented elsewhere. Uranium release was determined to be controlled by two phases and occurred in three stages. In the first stage, U release is controlled by the solubility of tejkaite, which is suppressed by high concentrations of sodium released from the dissolution of NaNO3 in the residual sludges. Equilibrium solubility calculations indicate the U released during this stage will have a maximum concentration of 0.021 M. When all the NaNO3 has dissolved from the sludge, the solubility of the remaining cejkaite will increase to 0.28 M. After cejkaite has completely dissolved, the majority of the remaining U is in the form of poorly crystalline Na2U2O7 [or clarkeite Na[(UO2)O(OH)](H20)0-1]. In contact with Hanford groundwater this phase is not stable, and becquerelite becomes the U solubility controlling phase, with a calculated equilibrium concentration of 1.2 x 10(-4) M. For Tc, a significant fraction of its concentration in the residual sludge was determined to be relatively insoluble (20 wt % for C-203 and 80 wt % for C-204). Because of the low concentrations of Tc in these sludge materials, the characterization studies did not identify any discrete Tc solids phases. Release of the soluble fraction of Tc was found to occur concomitantly with NO3-. It was postulated that a NaNO3-NaTcO4 solid solution could be responsible for this behavior. The Tc release concentrations for the soluble fraction were estimated to be 2.4 x 10-6 M for C-203 and 2.7 x 10(-5) M for C-204. Selective extraction results indicated that the recalcitrant fraction of Tc was

  8. The photoluminescence of crystallophosphors on the base of NaBi(WO4)2 activated by americium, plutonium and neptunium

    International Nuclear Information System (INIS)

    Gliva, V.R.; Novikov, Yu.P.; Myasoedov, B.F.

    1989-01-01

    The luminescence properties of crystallophosphors based on NaBi(WO 4 ) 2 activated by americium, plutonium and neptunium were studied. The synthesis of crystallophosphors is described. Crystallophosphors luminesce in the near infrared region. The excitation and luminescence spectra of crystallophosphors are considered. The dependence of luminescence yield is linear in the wide interval of activator concentration. (author) 3 refs.; 4 figs

  9. Role of americium interference in analysis of samples containing rare earths

    International Nuclear Information System (INIS)

    Mohapatra, P.K.; Adya, V.C.; Thulasidas, S.K.; Bhattacharyya, A.; Kumar, Mithlesh; Godbole, S.V.; Manchanda, V.K.

    2007-01-01

    Quality control of nuclear fuel samples requires precise estimation of rare earths which have high neutron absorption cross sections and act as neutron poisons. Am is generated by nuclear decay where as lanthanides may be present as impurities picked up during reprocessing/fuel fabrication. Precise estimation of the rare earths by ICP-AES method in presence of 241 Am is a challenging task due to the likelihood of spectral interference of the latter. Rare earths impurities in the purified Am sample were estimated by ICP-AES method. Known amounts of the rare earths viz. Sm, Eu, Dy and Gd were used as synthetic sample and the interference due to Am was investigated. (author)

  10. Interim safety equipment list for 241-C-106 waste retrieval, project W-320

    International Nuclear Information System (INIS)

    Conner, J.C.

    1996-01-01

    The purpose of this supporting document is to provide safety classifications for systems, structures, and components of the Tank 241-C-106 Waste Retrieval Sluicing System (WRSS) and to document the methodology used to develop these safety classifications. The WRSS requires two transfer lines, one to carry sluiced waste slurry to tank 241-AY-102 and the other to return supernatant to tank 241-C-106; pumps in each tank; sluicers to direct the supernatant stream inside tank 241-C-106; a slurry distributor in tank 241-AY-102; heating, ventilation, and air conditioning for tank 241-C-106; and instrumentation and control devices

  11. Analysis of the 241SY101 pump removal trailer and the 241SY101 strongback

    International Nuclear Information System (INIS)

    Coverdell, B.L.

    1995-09-01

    The purpose of the calculations contained in the attached appendix is to determine the vibrational stability of the following combination (The Combination); shipping container, strongback and trailer. The vibrational stability of The Combination will be determined with the shipping container and strongback in the upright position. If the natural frequency of The Combination coincides with the input frequency and no damping is present, resonance will occur. The result of this is that the natural frequency of the Combination must be calculated as well as the input frequency. The input frequency in this case is caused by wind. Due to their geometrical complexity the upper and lower hydraulic clevises were analyzed for structural adequacy by using finite-element analysis (FEA). The FEA software COSMOS/M version 1.70 was used to model the upper and lower hydraulic clevis. All designs are in accordance with Standard Architectural-Civil Design Criteria, Design Loads for Facilities (DOE-RL 1989) and are safety class 3. The design and fabrication of each component is in accordance with American Institute of Steel Construction, Manual of Steel Construction, (AISC, 1989). The analyses contained in this document reflects the as-built condition of the 241SY101 hydraulic trailer

  12. Peculiar Behavior of (U,Am)O(2-δ) Compounds for High Americium Contents Evidenced by XRD, XAS, and Raman Spectroscopy.

    Science.gov (United States)

    Lebreton, Florent; Horlait, Denis; Caraballo, Richard; Martin, Philippe M; Scheinost, Andreas C; Rossberg, Andre; Jégou, Christophe; Delahaye, Thibaud

    2015-10-19

    In U(1-x)Am(x)O(2±δ) compounds with low americium content (x ≤ 20 atom %) and oxygen-to-metal (O/M) ratios close to 2.0, Am(III+) cations are charge-balanced by an equivalent amount of U(V+) cations while the fluorite structure of pure U(IV+)O2 is maintained. Up to now, it is unknown whether this observation also holds for higher americium contents. In this study, we combined X-ray diffraction with Raman and X-ray absorption spectroscopies to investigate a U(0.5)Am(0.5)O(2±δ) compound. Our results indicate that americium is again only present as Am(III+), while U(V+) remains below the amount required for charge balance. Unlike lower americium contents, this leads to an overall oxygen hypostoichiometry with an average O/M ratio of 1.92(2). The cationic sublattice is only slightly affected by the coexistence of large amounts of reduced (Am(III+)) and oxidized (U(V+)) cations, whereas significant deviations from the fluorite structure are evidenced by both extended X-ray absorption fine structure and Raman spectroscopies in the oxygen sublattice, with the observation of both vacancies and interstitials, the latter being apparently consistent with the insertion of U6O12 cuboctahedral-type clusters (as observed in the U4O9 or U3O7 phases). These results thus highlight the specificities of uranium-americium mixed oxides, which behave more like trivalent lanthanide-doped UO2 than U(1-x)Pu(x)O(2±δ) MOX fuels.

  13. Photon interaction studies using 241Am γ-rays

    Indian Academy of Sciences (India)

    and wood samples, samples like sand, sugar etc., which contain particles of varying sizes as well as pellets and aqueous ... in natural wood, dry wood and dry leaves using 241Am γ-rays. They found that the ... Gamma ray interaction studies at energies near the photoelectric absorption edges have been of interest to ...

  14. Inhalation toxicology of 241Am(NO3)3

    International Nuclear Information System (INIS)

    Ballou, J.E.; Gies, R.A.; Beasley, A.H.

    1980-01-01

    Inhaled 241 Am(NO 3 ) 3 was rapidly cleared from the lung (90% in 30 days) and translocated principally to skeleton. Although the estimated radiation dose to lung was twofold greater than the bone dose, the principal treatment-related lesion appeared to be osteosarcoma of the skeleton

  15. 18 CFR 367.2410 - Account 241, Tax collections payable.

    Science.gov (United States)

    2010-04-01

    ... collections payable. (a) This account must include the amount of taxes collected by the service company... 18 Conservation of Power and Water Resources 1 2010-04-01 2010-04-01 false Account 241, Tax collections payable. 367.2410 Section 367.2410 Conservation of Power and Water Resources FEDERAL ENERGY...

  16. Solid Phase Characterization of Tank 241-C-105 Grab Samples

    Energy Technology Data Exchange (ETDEWEB)

    Ely, T. M. [Washington River Protection Solutions LLC, Richland, WA (United States); LaMothe, M. E. [Washington River Protection Solutions LLC, Richland, WA (United States); Lachut, J. S. [Washington River Protection Solutions LLC, Richland, WA (United States)

    2016-01-11

    The solid phase characterization (SPC) of three grab samples from single-shell Tank 241-C-105 (C-105) that were received at the laboratory the week of October 26, 2015, has been completed. The three samples were received and broken down in the 11A hot cells.

  17. ANALYSIS RESULTS FOR BUILDING 241 702-AZ A TRAIN

    International Nuclear Information System (INIS)

    DUNCAN JB; FRYE JM; COOKE CA; LI SW; BROCKMAN FJ

    2006-01-01

    This report presents the analyses results for three samples obtained under RPP-PLAN-28509, Sampling and Analysis Plan for Building 241 702-AZ A Train. The sampling and analysis was done in response to problem evaluation request number PER-2004-6139, 702-AZ Filter Rooms Need Radiological Cleanup Efforts

  18. Project W-320, 241-C-106 sluicing, master calculation list

    International Nuclear Information System (INIS)

    Bailey, J.W.

    1998-01-01

    This supporting document has been prepared to make the Master Calculation List readily retrievable. The list gives the status of the calculation (as-built, not used, applied, etc.), the calculation title, its originator, comments, and report number under which it was issued. Tank 241-C-106 has been included on the High Heat Load Watch List

  19. Results of tank 241-AN-107 ultrasonic examination

    International Nuclear Information System (INIS)

    LESHIKAR, G.A.

    1999-01-01

    A tank examination supplier was retained to provide and use an ultrasonic examination system (equipment, procedures, and inspectors) to examine a limited area of Tank 241-AN-107 primary tank wall. The exam found no indications of wall thinning, pits, or cracks in excess of the acceptance criteria

  20. Tank 241-BY-103 Tank Characterization Plan. Revision 1

    International Nuclear Information System (INIS)

    Schreiber, R.D.

    1995-01-01

    This document is a plan which serves as the contractual agreement between the Characterization Program, Sampling Operations and WHC 222-S Laboratory. The scope of this plan is to provide guidance for the sampling and analysis of samples for tank 241-BY-103

  1. 49 CFR 199.241 - Training for supervisors.

    Science.gov (United States)

    2010-10-01

    ... ADMINISTRATION, DEPARTMENT OF TRANSPORTATION (CONTINUED) PIPELINE SAFETY DRUG AND ALCOHOL TESTING Alcohol Misuse Prevention Program § 199.241 Training for supervisors. Each operator shall ensure that persons designated to determine whether reasonable suspicion exists to require a covered employee to undergo alcohol testing under...

  2. 36 CFR 241.3 - Federal refuge regulations.

    Science.gov (United States)

    2010-07-01

    ... 36 Parks, Forests, and Public Property 2 2010-07-01 2010-07-01 false Federal refuge regulations... AND WILDLIFE General Provisions § 241.3 Federal refuge regulations. Until a cooperative agreement has... reservation or a national game or bird refuge, preserve, sanctuary, or reservation established by or under...

  3. Justification for Continued Operation for Tank 241-Z-361

    International Nuclear Information System (INIS)

    BOGEN, D.M.

    1999-01-01

    This justification for continued operations (JCO) summarizes analyses performed to better understand and control the potential hazards associated with Tank 241-2-361. This revision to the JCO has been prepared to identify and control the hazards associated with sampling the tank using techniques developed and approved for use in the Tank Waste Remediation System (TWRS) at Hanford

  4. Tank 241-C-103 tank characterization plan. Revision 1

    International Nuclear Information System (INIS)

    Schreiber, R.D.

    1995-01-01

    This document is a plan which serves as the contractual agreement between the Characterization Program, Sampling Operations, WHC 222-S Laboratory, and PNL 325 Analytical Chemistry Laboratory. The scope of this plan is to provide guidance for the sampling and analysis of samples from tank 241-C-103

  5. Justification for Continued Operation for Tank 241-Z-361

    Energy Technology Data Exchange (ETDEWEB)

    BOGEN, D.M.

    1999-09-01

    This justification for continued operations (JCO) summarizes analyses performed to better understand and control the potential hazards associated with Tank 241-2-361. This revision to the JCO has been prepared to identify and control the hazards associated with sampling the tank using techniques developed and approved for use in the Tank Waste Remediation System (TWRS) at Hanford.

  6. 40 CFR 180.241 - Bensulide; tolerances for residues.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 23 2010-07-01 2010-07-01 false Bensulide; tolerances for residues...) PESTICIDE PROGRAMS TOLERANCES AND EXEMPTIONS FOR PESTICIDE CHEMICAL RESIDUES IN FOOD Specific Tolerances § 180.241 Bensulide; tolerances for residues. (a) General. Tolerances are established for the residues...

  7. ANALYSIS RESULTS FOR BUILDING 241 702-AZ A TRAIN

    Energy Technology Data Exchange (ETDEWEB)

    DUNCAN JB; FRYE JM; COOKE CA; LI SW; BROCKMAN FJ

    2006-12-13

    This report presents the analyses results for three samples obtained under RPP-PLAN-28509, Sampling and Analysis Plan for Building 241 702-AZ A Train. The sampling and analysis was done in response to problem evaluation request number PER-2004-6139, 702-AZ Filter Rooms Need Radiological Cleanup Efforts.

  8. On a low intensity 241Am Compton spectrometer for measurement ...

    Indian Academy of Sciences (India)

    In this paper, a new design and construction of a low intensity (100 mCi) 241Am -ray Compton spectrometer is presented. The planar spectrometer is based on a small disc source with the shortest geometry. Measurement of the momentum density of polycrystalline Al is used to evaluate the performance of the new design.

  9. On a low intensity 241 Am Compton spectrometer for measurement ...

    Indian Academy of Sciences (India)

    In this paper, a new design and construction of a low intensity (100 mCi) 241Am -ray Compton spectrometer is presented. The planar spectrometer is based on a small disc source with the shortest geometry. Measurement of the momentum density of polycrystalline Al is used to evaluate the performance of the new design.

  10. Project W-320, 241-C-106 sluicing supporting documentation bibliography

    International Nuclear Information System (INIS)

    Bailey, J.W.

    1998-01-01

    This supporting document has been prepared to make the listing of documentation used to develop, or in support of Project W-320, readily retrievable. All documents are sorted by document number and list the document type. Tank 241-C-106 has been included on the High Heat Load Watch List

  11. {sup 238}Pu, {sup 239+240}Pu and {sup 241}Am levels in the terrestrial and aquatic environment of the Loire and Garonne rivers basins (France)

    Energy Technology Data Exchange (ETDEWEB)

    Rousseau, G.; Mokili, M.B.; Le Roy, C.; Pagano, V. [SUBATECH/IN2P3 (France); Gontier, G.; Boyer, C. [EDF-DPI-DIN-CIDEN (France); Chardon, P. [CNRS/IN2P3 (France); Hemidy, P.Y. [EDF-DPN-UNIE-GPRE-IEV (France)

    2014-07-01

    Plutonium and americium long-lived alpha emitter isotopes can be found in the environment because of atmospheric global fallout due to thermonuclear tests performed between 1945 and 1980, to the American SNAP 9A satellite explosion in 1964, to the Chernobyl nuclear power plant accident,... In France, the nuclear safety authority does not allow the release of artificial alpha emitters from nuclear power plants. Thus, monitoring is performed to verify the absence of these alpha emitters in liquid discharges to respect the limits set by the regulations. These thresholds ensure a very low dosimetric impact to the population compared to other radionuclides. With the objective of environmental monitoring around nuclear facilities, activity measurements of long-lived alpha emitters are carried out to detect the traces of these radionuclides. Analysis of low activity by alpha spectrometry after chemical steps were performed and used to determine the {sup 238}Pu, {sup 239+240}Pu and {sup 241}Am activities on a large set of environmental solid samples likely to be encountered in environmental monitoring as soils, sediments, terrestrial and aquatic bio-indicators. The samples collected in the terrestrial and aquatic environment of the Loire and Garonne rivers basins (France) was investigated for the 2009-2014 period. It was found that the mean activity concentration of the most frequently detected was for the radionuclide {sup 238}Pu: from <0.00031 to 0.0061 Bq/kg dry in terrestrial samples and from <0.00086 to 0.011 Bq/kg dry in aquatic samples; for the radionuclide {sup 239+240}Pu: from 0.00041 to 0.150 Bq/kg dry in terrestrial samples and from 0.0023 to 0.240 Bq/kg dry in aquatic samples and for the radionuclide {sup 241}Am: from <0.00086 to 0.087 Bq/kg dry in terrestrial samples and from 0.0022 to 0.120 Bq/kg dry in aquatic samples. {sup 238}Pu/{sup 239+240}Pu and {sup 241}Am/{sup 239+240}Pu ratios determined are in accordance with an environmental contamination due to

  12. Chemical behaviour of trivalent and pentavalent americium in saline NaCl-solutions. Studies of transferability of laboratory data to natural conditions. Interim report. Reported period: 1.2.1993-31.12.1993; Chemisches Verhalten von drei- und fuenfwertigem Americium in Salinen NaCl-Loesungen. Untersuchung der Uebertragbarkeit von Labordaten auf natuerliche Verhaeltnisse. Zwischenbericht. Berichtszeitraum 1.2.1993-31.12.1993

    Energy Technology Data Exchange (ETDEWEB)

    Runde, W.; Kim, J.I.

    1994-09-15

    In order to clarify the chemical behaviour of Americium in saline aqueous systems relevant for final storage this study deals with the chemical reactions of trivalent and pentavalent Americium in NaCl-solutions under the influence of radiolysis from its own alpha radiation. The focus of the study was on investigating the geologically relevant reactions, such as hydrolysis or carbonate- and chloride complexing in solid-liquid equilibriums. Comprehensive measurements on solubility and spectroscopic studies in NaCl-solutions were carried out in a CO{sub 2}-free atmosphere and 10{sup -2} atm CO{sub 2} partial pressure. Identification and characterisation of the AM (III) and AM(V) solid phases were supplemented by structural research with the chemically analogue EU (III) and Np(V) compounds. The alpha-radiation induced radiolysis in saline NaCl solutions and the redox behaviour of Americium which was influenced thereby were spectroscopically quantified. (orig.) [Deutsch] Zur Klaerung des chemischen Verhaltens von Americium in endlagerrelevanten salinen aquatischen Systemen befasst sich die vorliegende Arbeit mit den chemischen Reaktionen des drei- und fuenfwertigen Americiums in NaCl-Loesungen unter dem Einfluss der Radiolyse durch die eigene {alpha}-Strahlung. Der Schwerpunkt dieser Arbeit lag auf der Untersuchung der geologisch relevanten Reaktionen, wie Hydrolyse sowie Carbonat- und Chloridkomplexierung in fest-fluessig Gleichgewichtssystemen. Hierzu wurden umfassende Loeslichkeitsmessungen und spektroskopische Untersuchungen in NaCl-Loesungen, sowohl unter CO{sub 2}-freier Atmosphaere als auch unter 10{sup -2} atm CO{sub 2}-Partialdruck, durchgefuehrt. Die Identifizierung und Charakterisierung der Am(III)- und Am(V)-Festphasen wurde ergaenzt durch strukturelle Untersuchungen mit den chemisch analogen Eu(III)- und Np(V)-Verbindungen. Die von der {alpha}-Strahlung induzierte Radiolyse in salinen NaCl-Loesungen und das dadurch beeinflusste Redoxverhalten von Americium

  13. Vertical distribution of 241Pu in the southern Baltic Sea sediments

    International Nuclear Information System (INIS)

    Strumińska-Parulska, Dagmara I.

    2014-01-01

    Highlights: • The unique study on 241 Pu in sediments from the southern Baltic Sea was presented. • 241 Pu was determined using alpha spectrometry by indirect method. • The biggest amount of 241 Pu existed in the surface layers of all analyzed sediments. • The highest 241 Pu amount comes from the Chernobyl accident. - Abstract: The vertical distribution of plutonium 241 Pu in marine sediments can assist in determining the deposition history and sedimentation process of analyzed regions. In addition, 241 Pu/ 239+240 Pu activity ratio could be used as a sensitive fingerprint for radioactive source identification. The present preliminary studies on vertical distribution of 241 Pu in sediments from four regions of the southern Baltic Sea are presented. The distribution of 241 Pu was not uniform and depended on sediment geomorphology and depth as well as location. The highest concentrations of plutonium were found in the surface layers of all analyzed sediments and originated from the Chernobyl accident

  14. Sequential separation method for the determination of Plutonium and Americium in fecal samples

    International Nuclear Information System (INIS)

    Raveendran, Nanda; Rao, D.D.; Yadav, J.R.; Baburajan, A.

    2014-01-01

    The estimation of internal contamination due to Plutonium and Americium of radiation workers of Advanced Fuel Fabrication Facility (AFFF) at Tarapur was carried out by the bioassay (Fecal sample) of the workers. Conventionally the separation of 'Pu' and 'Am' was carried out by alkali fusion followed by the anion exchange separation for Pu and cation exchange separation for Am. This paper deals with an alternative method in which initially the entire ash of the sample added with 236 Pu tracer (3-11 mBq) and 243 Am tracer (2.8-14.5 mBq) was acid leached and Pu was separated by anion exchange as per standard analytical procedure and Am by using TRU resin. In this work the extraction chromatography method using TRU resin procured from Eichrom,U.K. which contains N-N-di isobutyl carbanoyl methyl phosphine oxide (CMPO) as extractant, tri-n-butyl phosphate (TBP) as diluent absorbed on inert polymeric support has been used for the separation of Am from fecal sample. The 8N HNO 3 effluent from Pu separation step was dried and the residue was dissolved in 10 ml 1M Al(NO 3 ) 3 in 3M HNO 3 and pinch of Ascorbic acid was added and loaded on a TRU resin column (dia ∼ 4 mm and height 60 mm) preconditioned with 30 ml 1M Al(NO 3 ) 3 in 3 MHNO 3 . The column was washed with 5 ml 3M HNO 3 and 5 ml 2M HNO 3 . The nitrate concentration was lowered using addition of 10 ml 0.05 M HNO 3 . Am was eluted with 3 ml 9M HCl and 20 ml 2M HCl. The elute was dried and electrodeposited on a SS planchet in NH 4 (SO 4 ) 2 solution at pH 2.2 for two hours. Pu and Am activity estimated by counting in passivated ion implanted planner Silicon detector (PIPS) coupled to 8K channel alpha spectrometer. The sample was counted for duration of 3-4 lacs of seconds. In this study the numbers of samples analyzed are 25. The paper gives detail of analytical recoveries of Pu tracer varies from 55-90 % with a mean of 70% and std. deviation 9.9%. The Am tracer recovery was in the range of 20-89.3% with a mean of

  15. Crystallographic and Spectroscopic Characterization of Americium Complexes Containing the Bis[(phosphino)methyl]pyridine-1-oxide (NOPOPO) Ligand Platform

    Energy Technology Data Exchange (ETDEWEB)

    Corbey, Jordan F. [Pacific Northwest National Laboratory, Richland, Washington 99354, United States; Rapko, Brian M. [Pacific Northwest National Laboratory, Richland, Washington 99354, United States; Wang, Zheming [Pacific Northwest National Laboratory, Richland, Washington 99354, United States; McNamara, Bruce K. [Pacific Northwest National Laboratory, Richland, Washington 99354, United States; Surbella, Robert G. [Pacific Northwest National Laboratory, Richland, Washington 99354, United States; Pellegrini, Kristi L. [Pacific Northwest National Laboratory, Richland, Washington 99354, United States; Schwantes, Jon M. [Pacific Northwest National Laboratory, Richland, Washington 99354, United States

    2018-02-06

    Abstract The crystal structures of americium species containing a common multi-functional phosphine oxide ligand, reported for its ability to extract f elements from acidic solutions, namely 2,6-[Ph2P(O)CH2]2C5H3-NO, L, have finally been determined after over three decades of separations studies involving these species and their surrogates. The molecular compounds Am(L)(NO3)3, Am 1:1, and [Am(L)2(NO3)][NO3]2, Am 2:1, along with their neodymium and europium analogs were synthesized and characterized using single-crystal X-ray crystallography, attenuated total reflectance Fourier transform infrared (ATR) spectroscopy and luminescence spectroscopy to provide a comprehensive comparison with new and known analogous complexes.

  16. Separation of americium by liquid-liquid extraction using diglycol-amides water-soluble complexing agents

    Energy Technology Data Exchange (ETDEWEB)

    Chapron, S.; Marie, C.; Pacary, V.; Duchesne, M.T.; Miguirditchian, M. [CEA, Centre de Marcoule, Nuclear Energy Division, RadioChemistry and Processses Departement, 30207 Bagnols-sur-Ceze (France); Arrachart, G.; Pellet-Rostaing, S. [Institut de Chimie Separative de Marcoule, LTSM, Bat 426, F-30207 Bagnols-sur- Ceze (France)

    2016-07-01

    Recycling americium (Am) alone from spent nuclear fuels is an important option studied for the future nuclear cycle (Generation IV systems) since Am belongs to the main contributors of the long-term radiotoxicity and heat power of final waste. Since 2008, a liquid-liquid extraction process called EXAm has been developed by the CEA to allow the recovery of Am alone from a PUREX raffinate (a dissolution solution already cleared from U, Np and Pu). A mixture of DMDOHEMA (N,N'-dimethyl-N,N'-dioctyl-2-(2-(hexyloxy)ethyl)-malonamide) and HDEHP (di-2-ethylhexylphosphoric acid) in TPH is used as the solvent and the Am/Cm selectivity is improved using TEDGA (N,N,N',N'-tetraethyl-diglycolamide) as a selective complexing agent to maintain Cm and heavier lanthanides in the acidic aqueous phase (5 M HNO{sub 3}). Americium is then stripped selectively from light lanthanides at low acidity (pH=3) with a poly-aminocarboxylic acid. The feasibility of sole Am recovery was already demonstrated during hot tests in ATALANTE facility and the EXAm process was adapted to a concentrated raffinate to optimize the process compactness. The speciation of TEDGA complexes formed in the aqueous phase with Am, Cm and lanthanides was studied to better understand and model the behavior of TEDGA in the process. Some Ln-TEDGA species are extracted into the organic phase and this specific chemistry might play a role in the Am/Cm selectivity improvement. Hence the hydrophilicity-lipophilicity balance of the complexing agent is an important parameter. In this comprehensive study, new analogues of TEDGA were synthesized and tested in the EXAm process conditions to understand the relationship between their structure and selectivity. New derivatives of TEDGA with different N-alkyl chain lengths and ramifications were synthesized. The impact of lipophilicity on ligand partitioning and Am/Cm selectivity was investigated. (authors)

  17. 40 CFR 51.241 - Nonattainment areas for carbon monoxide and ozone.

    Science.gov (United States)

    2010-07-01

    ... and ozone. 51.241 Section 51.241 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED... Intergovernmental Consultation Agency Designation § 51.241 Nonattainment areas for carbon monoxide and ozone. (a... ozone will not be attained by July 1, 1979, the Governor (or Governors for interstate areas) shall...

  18. 8 CFR 241.10 - Special care and attention of removable aliens.

    Science.gov (United States)

    2010-01-01

    ... 8 Aliens and Nationality 1 2010-01-01 2010-01-01 false Special care and attention of removable aliens. 241.10 Section 241.10 Aliens and Nationality DEPARTMENT OF HOMELAND SECURITY IMMIGRATION REGULATIONS APPREHENSION AND DETENTION OF ALIENS ORDERED REMOVED Post-hearing Detention and Removal § 241.10...

  19. 8 CFR 241.9 - Notice to transportation line of alien's removal.

    Science.gov (United States)

    2010-01-01

    ... 8 Aliens and Nationality 1 2010-01-01 2010-01-01 false Notice to transportation line of alien's removal. 241.9 Section 241.9 Aliens and Nationality DEPARTMENT OF HOMELAND SECURITY IMMIGRATION REGULATIONS APPREHENSION AND DETENTION OF ALIENS ORDERED REMOVED Post-hearing Detention and Removal § 241.9...

  20. 8 CFR 241.3 - Detention of aliens during removal period.

    Science.gov (United States)

    2010-01-01

    ... 8 Aliens and Nationality 1 2010-01-01 2010-01-01 false Detention of aliens during removal period. 241.3 Section 241.3 Aliens and Nationality DEPARTMENT OF HOMELAND SECURITY IMMIGRATION REGULATIONS APPREHENSION AND DETENTION OF ALIENS ORDERED REMOVED Post-hearing Detention and Removal § 241.3 Detention of...

  1. 8 CFR 241.15 - Countries to which aliens may be removed.

    Science.gov (United States)

    2010-01-01

    ... 8 Aliens and Nationality 1 2010-01-01 2010-01-01 false Countries to which aliens may be removed. 241.15 Section 241.15 Aliens and Nationality DEPARTMENT OF HOMELAND SECURITY IMMIGRATION REGULATIONS APPREHENSION AND DETENTION OF ALIENS ORDERED REMOVED Post-hearing Detention and Removal § 241.15 Countries to...

  2. 30 CFR 241.76 - Can MMS reduce my penalty once it is assessed?

    Science.gov (United States)

    2010-07-01

    ... 30 Mineral Resources 2 2010-07-01 2010-07-01 false Can MMS reduce my penalty once it is assessed? 241.76 Section 241.76 Mineral Resources MINERALS MANAGEMENT SERVICE, DEPARTMENT OF THE INTERIOR... Provisions § 241.76 Can MMS reduce my penalty once it is assessed? Under 30 U.S.C. 1719(g), the Director or...

  3. Plutonium, americium, and uranium concentrations in Nevada Test Site soil profiles

    International Nuclear Information System (INIS)

    Essington, E.H.; Gilbert, R.O.; Eberhardt, L.L.; Fowler, E.B.

    1975-01-01

    Many soil profile samples were collected by the Nevada Applied Ecology Group from five nuclear safety test sites on the Nevada Test Site and Tonopah Test Range in Nevada, U.S.A. The profile samples were analyzed for 239 Pu, 240 Pu, 241 Am, and in some cases 235 U and 238 U, in order to estimate the depth of radionuclide penetration and level of contamination at specific sampling depths after an extended period of time since deposition on the surface. Nearly 70 individual profiles were examined. About one-half of the profiles exhibited a smooth leaching pattern with more than 95 percent of the plutonium in the top 5 cm. Other profile patterns are discussed relative to mechanical disturbance of the profile after the initial deposition, accumulation of plutonium in specific zones within the soil profile, and occurrence of large amounts of plutonium in the deepest parts of the soil profile. The implications of these observations are discussed with respect to redistribution of radioactivity by wind, water, and burrowing animals, ingestion by burrowing and grazing animals, uptake by vegetation, and cleanup operations. (auth)

  4. Incidence of liver tumors in beagles with body burdens of 239Pu or 241Am

    International Nuclear Information System (INIS)

    Taylor, G.N.; Mays, C.W.; Wrenn, M.E.; Shabestari, L.; Lloyd, R.D.

    1986-01-01

    Tetravalent 239 Pu or trivalent 241 Am in a citrate buffer, given via a single intravenous injection to beagles, induced very pronounced liver changes, usually at relatively long postinjection times. The lesions consisted of cell injury or cell necrosis which was followed by nodular hyperplasia and a significant incidence of primary liver tumors. The most frequent neoplasm was the bile duct adenoma, followed by the bile duct carcinoma. A lesser number of sarcomas were also induced, especially fibrosarcomas. The number of hepatic cell tumors was low. An abnormally high incidence of both hyperplastic nodules and primary liver tumors occurred at long postinjection times and at average doses extending down to ∼10 rads. The various nodular lesions and liver tumors frequently occurred as incidental findings in dogs dying from other causes, especially bone cancer. In comparison to bone neoplasia, the liver was a much less important target organ in the high-dose level groups, but in some of the low-dose groups, especially in the 241 Am groups, the risk of radiation-induced liver cancer was approximately equal to or exceeded the risk of skeletal tumors. However, in any projection of the risks observed in this animal model to man, one should be mindful that the beagle skeleton is approximately 25 times more sensitive to radiation-induced bone neoplasia than is the human skeleton (Mays et al., 1976) and that the radiosensitivity difference for the beagle and human liver is unknown. 41 refs., 8 figs., 5 tabs

  5. Bioremoval of Am-241 and Cs-137 from liquid radioactive wasters by bacterial consortiums; Biorremocao de Am-241 e Cs-137 de rejeitos radioativos liquidos por consorcios bacterianos

    Energy Technology Data Exchange (ETDEWEB)

    Ferreira, Rafael Vicente de Padua; Lima, Josenilson B. de; Gomes, Mirella C.; Borba, Tania R.; Bellini, Maria Helena; Marumo, Julio Takehiro; Sakata, Solange Kazumi, E-mail: rpadua@ipen.b, E-mail: sksakata@ipen.b, E-mail: jblima@ipen.b, E-mail: mbmarumo@ipen.b, E-mail: jtmarumo@ipen.b [Instituto de Pesquisas Energeticas e Nucleares (IPEN/CNEN-SP), Sao Paulo, SP (Brazil)

    2011-10-26

    This paper evaluates the capacity of two bacterial consortiums of impacted areas in removing the Am-241 and Cs-137 from liquid radioactive wastes.The experiments indicated that the two study consortiums were able to remove 100% of the Cs-137 and Am-241 presents in the waste from 4 days of contact. These results suggest that the bio removal with the selected consortiums, can be a viable technique for the treatment of radioactive wastes containing Am-241 and Cs-137

  6. Salinity affects the photoacclimation of Chlamydomonas raudensis Ettl UWO241.

    Science.gov (United States)

    Takizawa, Kenji; Takahashi, Shinichiro; Hüner, Norman P A; Minagawa, Jun

    2009-03-01

    Chlamydomonas raudensis Ettl UWO241, a natural variant of C. raudensis, is deficient in state transitions. Its habitat, the deepest layer of Lake Bonney in Antarctica, features low irradiance, low temperature, and high salinity. Although psychrophily and low-light acclimation of this green alga has been described, very little information is available on the effect of salinity. Here, we demonstrate that this psychrophile is halotolerant, not halophilic, and it shows energy redistribution between photosystem I and II based on energy spillover under low-salt conditions. Furthermore, we revealed that C. raudensis exhibits higher non-photochemical quenching in comparison with the mesophile Chlamydomonas reinhardtii, when grown with low-salt, which is due to the lower proton conductivity across the thylakoid membrane. Significance of the C. raudensis UWO241 traits found in the low salinity culture are implicated with their natural habitats, including the high salinity and extremely stable light environments.

  7. Operability test procedure [Tank] 241-SY-101 equipment removal system

    International Nuclear Information System (INIS)

    Mast, J.C.

    1994-01-01

    The 241-SY-101 equipment removal system (ERS) consists of components, equipment, instrumentation and procedures that will provide the means to disconnect, retrieve, contain, load and transport the Mitigation Pump Assembly (MPA) from waste Tank 241-SY-101 to the Central Waste Complex (CWC). The Operability Test Procedure (OTP) will test the interfaces between ERS components and will rehearse the procedure for MPA removal and transportation to the extent they can be mocked-up at the CTF (Cold Test Facility). At the conclusion of the OTP, the ERS components and equipment will be removed from the CTF, entered into the Component Based Recall System (CBRS), and stored until needed for actual MPA removal and transportation

  8. Characterisation of a protection level Am-241 calibration source

    Science.gov (United States)

    Bass, G. A.; Rossiter, M. J.; Williams, T. T.

    1992-11-01

    The various measurements involved in the commissioning process of an Am-241 radioactive source and transport mechanisms to be used for protection level calibration work are detailed. The source and its handling mechanisms are described and measurements to characterize the resultant gamma ray beam are described. For the beam measurements, the inverse square law is investigated and beam uniformity is assessed. A trial calibration of ionization chambers is described. The Am-241 irradiation facility is concluded to be suitable for calibrating secondary standards as part of the calibration service offered for protection level instruments. The umbra part of beam is acceptably uniform for a range of chambers and the measurements obtained were predictable and consistent. This quality will be added to the range of qualities offered as part of the protection level secondary standard calibration service.

  9. 241-AW Tank Farm Construction Extent of Condition Review for Tank Integrity

    Energy Technology Data Exchange (ETDEWEB)

    Barnes, Travis J.; Gunter, Jason R.; Reeploeg, Gretchen E.

    2013-11-19

    This report provides the results of an extent of condition construction history review for the 241-AW tank farm. The construction history of the 241-AW tank farm has been reviewed to identify issues similar to those experienced during tank AY-102 construction. Those issues and others impacting integrity are discussed based on information found in available construction records, using tank AY-102 as the comparison benchmark. In the 241-AW tank farm, the fourth double-shell tank farm constructed, similar issues as those with tank 241-AY-102 construction occured. The overall extent of similary and affect on 241-AW tank farm integrity is described herein.

  10. 241-AY-101 Tank Construction Extent of Condition Review for Tank Integrity

    Energy Technology Data Exchange (ETDEWEB)

    Barnes, Travis J.; Gunter, Jason R.

    2013-08-26

    This report provides the results of an extent of condition construction history review for tank 241-AY-101. The construction history of tank 241-AY-101 has been reviewed to identify issues similar to those experienced during tank AY-102 construction. Those issues and others impacting integrity are discussed based on information found in available construction records, using tank AY-102 as the comparison benchmark. In tank 241-AY-101, the second double-shell tank constructed, similar issues as those with tank 241-AY-102 construction reoccurred. The overall extent of similary and affect on tank 241-AY-101 integrity is described herein.

  11. Rotary mode core sampling approved checklist: 241-TX-113

    International Nuclear Information System (INIS)

    Fowler, K.D.

    1998-01-01

    The safety assessment for rotary mode core sampling was developed using certain bounding assumptions, however, those assumptions were not verified for each of the existing or potential flammable gas tanks. Therefore, a Flammable Gas/Rotary Mode Core Sampling Approved Checklist has been completed for tank 241-TX-113 prior to sampling operations. This transmittal documents the dispositions of the checklist items from the safety assessment

  12. 241-SY Double Shell Tanks (DST) Integrity Assessment Report

    International Nuclear Information System (INIS)

    JENSEN, C.E.

    1999-01-01

    This report presents the results of the integrity assessment of the 241-SY double-shell tank farm facility located in the 200 West Area of the Hanford Site. The assessment included the design evaluation and integrity examinations of the tanks and concluded that the facility is adequately designed, is compatible with the waste, and is fit for use. Recommendations including subsequent examinations, are made to ensure the continued safe operation of the tanks

  13. 241-AZ Double-Shell Tanks (DST) Integrity Assessment Report

    International Nuclear Information System (INIS)

    JENSEN, C.E.

    1999-01-01

    This report presents the results of the integrity assessment of the 241-A2 double-shell tank farm facility located in the 200 East Area of the Hanford Site. The assessment included the design evaluation and integrity examinations of the tanks and concluded that the facility is adequately designed, is compatible with the waste, and is fit for use. Recommendations including subsequent examinations, are made to ensure the continued safe operation of the tanks

  14. 241-AN Double Shell Tanks (DST) Integrity Assessment Report

    International Nuclear Information System (INIS)

    JENSEN, C.E.

    1999-01-01

    This report presents the results of the integrity assessment of the 241-AN double-shell tank farm facility located in the 200 East Area of the Hanford Site. The assessment included the design evaluation and integrity examinations of the tanks and concluded that the facility is adequately designed, is compatible with the waste, and is fit for use. Recommendations including subsequent examinations, are made to ensure the continued safe operation of the tanks

  15. 241-AY Double Shell Tanks (DST) Integrity Assessment Report

    International Nuclear Information System (INIS)

    JENSEN, C.E.

    1999-01-01

    This report presents the results of the integrity assessment of the 241-AY double-shell tank farm facility located in the 200 East Area of the Hanford Site. The assessment included the design evaluation and integrity examinations of the tanks and concluded that the facility is adequately designed, is compatible with the waste, and is fit for use. Recommendations including subsequent examinations, are made to ensure the continued safe operation of the tanks

  16. 241-AZ Double Shell Tanks (DST) Integrity Assessment Report

    Energy Technology Data Exchange (ETDEWEB)

    JENSEN, C.E.

    1999-09-21

    This report presents the results of the integrity assessment of the 241-A2 double-shell tank farm facility located in the 200 East Area of the Hanford Site. The assessment included the design evaluation and integrity examinations of the tanks and concluded that the facility is adequately designed, is compatible with the waste, and is fit for use. Recommendations including subsequent examinations, are made to ensure the continued safe operation of the tanks.

  17. 241-AY Double Shell Tanks (DST) Integrity Assessment Report

    Energy Technology Data Exchange (ETDEWEB)

    JENSEN, C.E.

    1999-09-21

    This report presents the results of the integrity assessment of the 241-AY double-shell tank farm facility located in the 200 East Area of the Hanford Site. The assessment included the design evaluation and integrity examinations of the tanks and concluded that the facility is adequately designed, is compatible with the waste, and is fit for use. Recommendations including subsequent examinations. are made to ensure the continued safe operation of the tanks.

  18. Tank 241-Z-361 Sludge Retrieval and Treatment Alternatives

    International Nuclear Information System (INIS)

    HAMPTON, B.K.

    2000-01-01

    The Plutonium Finishing Plant (PFP) Tank 241-Z-361 (Z-361) contains legacy sludge resulting from waste discharges from past missions at PFP. A sketch of the tank is shown in Figure 1. In this view various risers and penetrations are shown along with the sludge level depicted by the horizontal line halfway up the tank, and the ground level depicted by the horizontal line above the tank. The HEPA filter installed for breathing is also shown on one of the risers

  19. Status of tank 241-SY-101 data analyses

    Energy Technology Data Exchange (ETDEWEB)

    Anantatmula, R.P.

    1992-09-01

    The Waste Tank Flammable Gas Stabilization Program was established in 1990 to provide for resolution of a major safety issue identified for 23 of the high-level waste tanks at the Hanford Site. The safety issue involves the production, accumulation, and periodic release from these tanks of flammable gases in concentrations exceeding the lower flammability limits. This document deals primarily with tank 241-SY-101 from the SY Tank Farm. The flammable gas condition has existed for this tank since the tank was first filled in the time period from 1977 to 1980. During a general review of waste tank chemical stability in 1988--1989, this situation was re-examined and, in March 1990, the condition was declared to be an unreviewed safety question. Tank 241-SY-101 was placed under special operating restrictions, and a program of investigation was begun to evaluate the condition and determine appropriate courses of action. This report summarizes the data that have become available on tank 241-SY-101 since it was declared as an unreviewed safety question and updates the information reported in an earlier document (WHC-EP-0517). The report provides a technical basis for use in the evaluation of safety risks of the tank and subsequent resolution of the unreviewed safety question.

  20. Status of tank 241-SY-101 data analyses

    International Nuclear Information System (INIS)

    Anantatmula, R.P.

    1992-09-01

    The Waste Tank Flammable Gas Stabilization Program was established in 1990 to provide for resolution of a major safety issue identified for 23 of the high-level waste tanks at the Hanford Site. The safety issue involves the production, accumulation, and periodic release from these tanks of flammable gases in concentrations exceeding the lower flammability limits. This document deals primarily with tank 241-SY-101 from the SY Tank Farm. The flammable gas condition has existed for this tank since the tank was first filled in the time period from 1977 to 1980. During a general review of waste tank chemical stability in 1988--1989, this situation was re-examined and, in March 1990, the condition was declared to be an unreviewed safety question. Tank 241-SY-101 was placed under special operating restrictions, and a program of investigation was begun to evaluate the condition and determine appropriate courses of action. This report summarizes the data that have become available on tank 241-SY-101 since it was declared as an unreviewed safety question and updates the information reported in an earlier document (WHC-EP-0517). The report provides a technical basis for use in the evaluation of safety risks of the tank and subsequent resolution of the unreviewed safety question

  1. 241-AY/AZ waste storage tanks: Supplemental gravity load analysis. Volume 1

    International Nuclear Information System (INIS)

    Baliga, R.

    1994-01-01

    An analysis of the 241SY tanks performed by ADVENT(1994b) to resolve dome overload issues indicated that the tank can sustain the dome loads resulting from additional soil overburden depth, increased soil density, and increased concentrated load. Similar issues exist for the 241AY/AZ tanks and therefore, an interim analysis of the 241AY/AZ tanks is presented herein. The scope of this effort is to review and compare all design drawings pertaining to the 241AY and 241AZ tanks with those pertaining to the 241SY tanks; to modify the axisymmetric model of the 241SY tanks to represent the 241AY/AZ tanks; and to evaluate the effect of additional dome load on the 241AY/AZ tanks by performing a structural analysis for gravity loads (dead load + live load). ADVENTS's additional scope of work is to perform a qualitative evaluation of the 241AY/AZ tanks for seismic and thermal loadings (Vollert 1982 and Blume 1971). This qualitative evaluation does not include any detailed finite element analysis of the tanks. The following design-based gravity loading conditions are used in this interim analysis of the 241AY/AZ tanks to determine a baseline for the tank stresses or section loads

  2. Effect of solvent on in vitro dissolution: Summary of results for uranium, americium, and cobalt aerosols

    Energy Technology Data Exchange (ETDEWEB)

    Guilmette, R.A.; Hoover, M.D.

    1995-12-01

    The revised 10 CFR Part 20 has adopted the ICRP Publication 30 method for calculating the committed effective dose equivalent from intakes of radionuclides. This dosimetry scheme requires knowledge or assumptions about the chemical form of the radionuclide, its particle size, and its known or assumed solubility. The solubility is classified as being either D (relatively soluble), W, or Y (relatively insoluble), depending on whether the material dissolves over periods of days, weeks, or years. Although Nuclear Regulatory Commission licensees may wish to take advantage of material-specific knowledge in order to adjust annual limits on intake and derived air concentrations, relatively few radioactive materials to which workers and the general population may be exposed have been adequately characterized either in terms of physicochemical form or solubility. Experimental measurement of solubility using some type of in vitro dissolution measurement system is therefore needed. However, there is currently no clear consensus regarding the appropriate design of in vitro dissolution systems, particularly when considering the range of different radionuclides to be studied, and the complexity of the biological mechanisms involved in the retention and clearance of inhaled deposited radioactive particles. The purpose of this study was to evaluate the effect of the several solvents on the dissolution of four test aerosols ({sup 57}Co{sub 3}O{sub 4}, {sup 241}AmO{sub 2}, ammonium diuranate [ADU], and U{sub 3}O{sub 8}) selected to encompass a variety of chemical and biochemical properties in vivo. The results of this study provide some guidance on the usefulness of in vitro dissolution tests for estimating the solubility of unknown radionuclide particles within the context of a simple model such as the class D, W, and Y formulation of ICRP 30.

  3. Project W-211, initial tank retrieval systems, description of operations for 241-AP-102 and 241-AP-104

    Energy Technology Data Exchange (ETDEWEB)

    RIECK, C.A.

    1999-02-25

    The primary purpose of the Initial Tank Retrieval Systems (ITRS) is to provide systems for retrieval of radioactive wastes stored in underground double-shell tanks (DSTS) for transfer to alternate storage, evaporation, pretreatment or treatment, while concurrently reducing risks associated with safety watch list and other DSTs. This Description of Operations (DOO) defines the control philosophy for the waste retrieval system for tanks 241-AP-102 (AP-102) and 241-AP-104 (AP-104). This DOO will provide a basis for the detailed design of the Retrieval Control System (RCS) for AP-102 and AP-104 and establishes test criteria for the RCS. The test criteria will be used during qualification testing and acceptance testing to verify operability.

  4. Neutron cross section measurements on {sup 241}Am

    Energy Technology Data Exchange (ETDEWEB)

    Sage, C.; Gunsing, F. [CEA Saclay, DSM/IRFUISPhN, 91 - Gif-sur-Yvette (France); Sage, C.; Borella, A.; Kopecky, S.; Plompen, A.J.M.; Schillebeeckx, P.; Semkova, V.; Siegler, P. [European Commission, Joint Research Centre, Institute for Reference Materials and Measurements, Geel (Belgium); Sage, C.; Dessagne, P.; Rudolf, G. [IPHC Strasbourg, IN2P3, 67 - Strasbourg (France); Sage, C.; Bouland, O.; Noguere, G. [CEA Cadarache, DEN/CAD/DERISPRC/LEPh, 13 - St Paul-lez-Durance (France); Brossard, C.; Fernandez, A.; Holzhauser, M.; Nastren, C.; Ottmar, H.; Somers, J.; Wastin, F. [European Commission, Joint Research Centre, Institute for Transuranium elements, Karlsruhe (Germany); Bouland, O. [Los Alamos National Laboratory, Theoretical Division, Los Alamos, New Mexico (United States); Semkova, V. [Institute for Nuclear Research and Nuclear Energy, Bulgarian Academy of Science, Sofia (Bulgaria)

    2009-07-01

    Several measurements of neutron induced reaction cross sections on {sup 241}Am have been performed at the JRC-IRMM in Geel, Belgium. Raw material coming from the Atalante facility of CEA Marcoule has been transformed by JRC-ITU Karlsruhe into suitable {sup 241}AmO{sub 2} samples embedded in Al{sub 2}O{sub 3} and Y{sub 2}O{sub 3} matrices. They were specifically designed for activation and time-of-flight measurements. The irradiations for the {sup 241}Am(n,2n){sup 240}Am reaction cross section were carried out at the 7 MV Van de Graaff accelerator using the activation technique. The measurements were performed in 4 sessions, using quasi mono-energetic neutrons with energies ranging from 8 to 21 MeV produced via the D(d,n){sup 3}He and the T(d,n){sup 4}He reactions. The {sup 241}Am(n,2n) reaction cross section was determined relative to the {sup 27}Al(n,{alpha}){sup 24}Na standard cross section and was investigated for the first time above 15 MeV. The induced activity was measured off-line after the irradiation by standard gamma-ray spectrometry using a high purity germanium detector. A different sample of the same isotope {sup 241}Am has been measured in transmission and capture experiments in the resonance region at the neutron time-of-flight facility Gelina. Concerning the transmission, the experiments were performed during two measurement campaigns, the second one after a recent upgrade of the data acquisition system. The neutron flux was measured using a Li-glass scintillator via the {sup 6}Li(n,{alpha}){sup 3}He reaction. The same sample was used for the capture measurement, in which the detection of the photons produced in the capture events was accomplished by two cylindrical C{sub 6}D{sub 6} detectors. The neutron flux shape was determined with a Frisch gridded {sup 10}B ionisation chamber. This paper will describe the results of the (n,2n) measurement campaign, compared with previously existing data and the current evaluated data libraries Jeff-3.1, BROND-2

  5. Joule-Heated Ceramic-Lined Melter to Vitrify Liquid Radioactive Wastes Containing Am241 Generated From MOX Fuel Fabrication in Russia

    International Nuclear Information System (INIS)

    Smith, E C; Bowan II, B W; Pegg, I; Jardine, L J

    2004-01-01

    The governments of the United Stated of America and the Russian Federation (RF) signed an Agreement September 1, 2000 to dispose of weapons plutonium that has been designated as no longer required for defense purposes. The Agreement declares that each country will disposition 34MT of excess weapons grade plutonium from their stockpiles. The preferred disposition technology is the fabrication of mixed oxide (MOx) fuel for use or burning in pressurized water reactors to destroy the plutonium. Implementation of this Agreement will require the conversion of plutonium metal to oxide and the fabrication of MOx fuel within the Russian Federation. The MOx fuel fabrication and metal to oxide conversion processes will generate solid and liquid radioactive wastes containing trace amounts of plutonium, neptunium, americium, and uranium requiring treatment, storage, and disposal. Unique to the Russian MOx fuel fabrication facility's flow-sheet is a liquid waste stream with high concentrations (∼1 g/l) of 241 Am and non radioactive silver. The silver is used to dissolve PuO 2 feed materials to the MOx fabrication facility. Technical solutions are needed to treat and solidify this liquid waste stream. Alternative treatment technologies for this liquid waste stream are being evaluated by a Russian engineering team. The technologies being evaluated include borosilicate and phosphate vitrification alternatives. The evaluations are being performed at a conceptual design level of detail under a Lawrence Livermore National Laboratory (LLNL) contract with the Russian organization TVEL using DOE NA-26 funding. As part of this contract, the RF team is evaluating the technical and economic feasibility of the US borosilicate glass vitrification technology based on a Duratek melter to solidify this waste stream into a form acceptable for storage and geologic disposal. The composition of the glass formed from treating the waste is dictated by the concentration of silver and americium it

  6. Sorption of carbon, cobalt, nickel, strontium, iodine, cesium, americium and neptumium in rocks and minerals

    International Nuclear Information System (INIS)

    Pinnoja, S.; Jaakkola, T.; Kaemaeraeinen, E.L.; Koskinen, A.; Lindberg, A.

    1984-09-01

    Sorption of the radionuclides C-14, Co-58, Ni-63, I-125, Sr-85, Cs-134, Am-241 and Np-237, which are important in nuclear waste, were studied in rock by autoradiographic method. Samples were selected to represent common rocks and minerals in Finnish bedrock: rapakivi granite, tonalite, mica gneiss, granodiorite, biotite, quartz, plagioclase, K feldspar and hornblende. Polished thin sections were used to determine the contributions of different minerals to the sorption of the radionuclides. Sawn rock pieces (1.2 x 1.2 x 1.6 cm) were used to determine the Ksub(a)-values for rough rock surfaces where penetration into the rock matrix was found. The sorption order of the elements determined with the rock pieces was Ksub(a)sup(Cs)>Ksub(a)sup(Ni)>Ksub(a)sup(Co)>Ksub(a)sup(Sr)>Ksub(a)sup(C)>Ksub(a)sup(I). The same order of sorption was determined with thin sections for all nuclides except carbon, which was not sorbed on thin sections. Wide differences in the Ksub(a)-values for different minerals were found for Cs and Sr. The sorption mechanism for these elements is presumed to be ion exchange. The Ksub(a)-values of Cs varied between 0.1 x 10 -4 and 600 x 10 -4 m 3 /m 2 and those for Sr between 0.01 x 10 -4 and 10 x 10 -4 m 3 /m 2 . The lowest values were determined for quartz and the highest for biotite. Radionuclides having a tendency to form pseudocolloids and hydroxide precipitates (Am, Np, Ni) were sorbed on thin sections with only small variation in Ksub(a)-values: all values were between 1 x 10 -4 and 10 x 10 -4 and 100 x 10 -4 m 3 /m 2 . A very good agreement was found between experimental and calculated Ksub(a)-values for rock thin sections. Ksub(a)-values were calculated by multiplying the percentages of individual minerals in the rock by the Ksub(a)-values of the corresponding pure minerals and summing the results. Calculated Ksub(a)-values were occasionally up to 50% smaller than the experimental ones, owing to the low contents of some high adsorbing minerals

  7. Preliminary results from uranium/americium affinity studies under experimental conditions for cesium removal from NPP ''Kozloduy'' simulated wastes solutions

    International Nuclear Information System (INIS)

    Nikiforova, A.; Kinova, L.; Peneva, C.; Taskaeva, I.; Petrova, P.

    2005-01-01

    We use the approach described by Westinghouse Savannah River Company using ammonium molybdophosphate (AMP) to remove elevated concentrations of radioactive cesium to facilitate handling waste samples from NPP K ozloduy . Preliminary series of tests were carried out to determine the exact conditions for sufficient cesium removal from five simulated waste solutions with concentrations of compounds, whose complexing power complicates any subsequent processing. Simulated wastes solutions contain high concentrations of nitrates, borates, H 2 C 2 O 4 , ethylenediaminetetraacetate (EDTA) and Citric acid, according to the composition of the real waste from the NPP. On this basis a laboratory treatment protocol was created. This experiment is a preparation for the analysis of real waste samples. In this sense the results are preliminary. Unwanted removal of non-cesium radioactive species from simulated waste solutions was studied with gamma spectrometry with the aim to find a compromise between on the one hand the AMP effectiveness and on the other hand unwanted affinity to AMP of Uranium and Americium. Success for the treatment protocol is defined by proving minimal uptake of U and Am, while at the same time demonstrating good removal effectiveness through the use of AMP. Uptake of U and Am were determined as influenced by oxidizing agents at nitric acid concentrations, proposed by Savannah River National laboratory. It was found that AMP does not significantly remove U and Am when concentration of oxidizing agents is more than 0.1M for simulated waste solutions and for contact times inherent in laboratory treatment protocol. Uranium and Americium affinity under experimental conditions for cesium removal were evaluated from gamma spectrometric data. Results are given for the model experiment and an approach for the real waste analysis is chosen. Under our experimental conditions simulated wastes solutions showed minimal affinity to AMP when U and Am are most probably in

  8. Accumulation and release of 241Am by a macrophyte of the Yenisei River (Elodea canadensis).

    Science.gov (United States)

    Bolsunovsky, A; Zotina, T; Bondareva, L

    2005-01-01

    The source of radioactive contamination of the Yenisei River floodplain, including contamination with transuranic elements, is the Mining-and-Chemical Combine of the Russian Ministry of Atomic Energy, which has for many years been producing weapons-grade plutonium. Transuranic elements have been detected not only in the soil and sediment of the river but also in the biomass of aquatic plants. This work is an investigation of accumulation and release of 241Am by a submerged macrophyte of the Yenisei River (Elodea canadensis) in laboratory experiments. In 2000-2003, laboratory experiments were carried out with biomass of E. canadensis Mich. and filtered river water. The samples were collected from the Yenisei River upstream of the discharge of the Combine's radioactive effluent. The experiments showed that 241Am is accumulated by Elodea biomass: the activity concentration of 241Am can reach 3280+/-240 Bq/g, with the concentration factor for 241Am 16 600+/-2200l/kg. Results of chemical fractionation have proved that in the course of 241Am accumulation by Elodea biomass, 241Am tightly bound to biomass increases from 11% to 27% of the total 241Am in the biomass. Release of 241Am from the decaying Elodea biomass has been evaluated experimentally. By the end of the experiment (lasting up to 127 days), the Elodea plants had lost up to 65% of their initial 241Am activity and the rate of 241Am release into the water environment reached 23 Bq/day.

  9. Accumulation and release of 241Am by a macrophyte of the Yenisei River (Elodea canadensis)

    International Nuclear Information System (INIS)

    Bolsunovsky, A.; Zotina, T.; Bondareva, L.

    2005-01-01

    The source of radioactive contamination of the Yenisei River floodplain, including contamination with transuranic elements, is the Mining-and-Chemical Combine of the Russian Ministry of Atomic Energy, which has for many years been producing weapons-grade plutonium. Transuranic elements have been detected not only in the soil and sediment of the river but also in the biomass of aquatic plants. This work is an investigation of accumulation and release of 241 Am by a submerged macrophyte of the Yenisei River (Elodea canadensis) in laboratory experiments. In 2000-2003, laboratory experiments were carried out with biomass of E. canadensis Mich. and filtered river water. The samples were collected from the Yenisei River upstream of the discharge of the Combine's radioactive effluent. The experiments showed that 241 Am is accumulated by Elodea biomass: the activity concentration of 241 Am can reach 3280 ± 240 Bq/g, with the concentration factor for 241 Am 16 600 ± 2200 l/kg. Results of chemical fractionation have proved that in the course of 241 Am accumulation by Elodea biomass, 241 Am tightly bound to biomass increases from 11% to 27% of the total 241 Am in the biomass. Release of 241 Am from the decaying Elodea biomass has been evaluated experimentally. By the end of the experiment (lasting up to 127 days), the Elodea plants had lost up to 65% of their initial 241 Am activity and the rate of 241 Am release into the water environment reached 23 Bq/day

  10. 241-AW/AN waste storage tanks: Supplemental gravity load analysis. Volume 1

    International Nuclear Information System (INIS)

    Julyk, L.J.

    1994-01-01

    An analysis of the 241SY tanks performed by ADVENT(1994b) to resolve dome overload issues indicated that the tank can sustain the dome loads resulting from additional soil overburden depth, increased soil density, and increased concentrated load. Similar issues exist for the 241AW/AN tanks and therefore, an interim analysis of the 241AW/AN tanks is presented herein. The scope of this effort is to review and compare all design drawings pertaining to the 241AW and 241AN tanks with those pertaining to the 241SY tanks; to modify the axisymmetric model of the 241SY tanks to represent the 241AW/AN tanks; and to evaluate the effect of additional dome load on the 241AW/AN tanks by performing a structural analysis for gravity loads (dead load + live load). ADVENT's additional scope of work is to perform a qualitative evaluation of the 241AW/AN tanks for seismic and thermal loadings (Blume 1976). This qualitative evaluation does not include any detailed finite element analysis of the tanks. Volume 1 of this report contains the text and calculations. Volume 2 contains a printed copy of the computer files used in these analyses

  11. Recovery of 241Am/Be neutron sources, Wooster, Ohio

    International Nuclear Information System (INIS)

    Tompkins, J.A.; Wannigman, D.; Hatler, V.

    1998-07-01

    In August 1997, the Nuclear Regulatory Commission (NRC) submitted to the US Department of Energy (DOE) a partial list of licensed radioactive sealed sources to be recovered under a pilot project initiating Radioactive Source Recovery Program (RSRP) operations. The first of the pilot project recoveries was scheduled for September 1997 at Eastern Well Surveys in Wooster, Ohio, a company with five unwanted sealed sources on the NRC list. The sources were neutron emitters, each containing 241 Am/Be with activities ranging from 2.49 to 3.0 Ci. A prior radiological survey had established that one of these sources, a Gulf Nuclear Model 71-1 containing 3 Ci of 241 Am, was contaminated with 241 Am and might be leaking. The other four sources were obsolete and could no longer be used by Eastern Well Surveys for their intended application in well-logging applications due to NRC decertification of these sources. All of the sources exceeded the limits established for Class C waste under 10 CFR 61.55 and, as a result, are the ultimate responsibility of the DOE under the provisions of PL 99-240. This report describes the cooperative effort between the DOE and NRC to recover the sources and transport them to Los Alamos National Laboratory (LANL) for deactivation under the RSRP. This operation alleviated any potential risk to the public health and safety from the site which might result from the leaking neutron sources or the potential mismanagement of unwanted sources. The on-site recovery occurred on September 23, 1997, and was performed by personnel from LANL and its contractor and was observed by staff from the Region III office of the NRC. All aspects of the recovery were successfully accomplished, and the sources were received at LANL on September 29, 1997. Experience gained during this operation will be used to formulate operational poilicies and procedures which will contribute to the eventual routine recovery operations of a full-scale RSRP

  12. Activity determination of the Am-241 radioactive lightning rods

    International Nuclear Information System (INIS)

    Dellamano, Jose C.; Minematsu, Denise; Potiens Jr, Ademar J.

    2008-01-01

    Full text: The radioactive lightning rods had been manufactured in Brazil up to 1989, when the Comissao Nacional de Energia Nuclear (CNEN) lifted the license for manufacture, commerce and installation of these devices. Since this date, the radioactive lightning rods have been replaced for conventional protection systems against electric discharges and have been sent to the institutes subordinated to the CNEN, amongst them the Instituto de Pesquisas Energeticas e Nucleares (IPEN-CNEN/SP). The radioactive lightning rods are constituted in its majority for a central metallic rod where the plates are mounted. Am-241 radioactive sources are fixed in these plates. The treatment of these devices is made in a glove box, where mechanically the sources are separate of the plates and connecting rods, placed in a metallic package and stored for posterior characterization, final packaging, intermediate storage and final disposal. In accordance with manufacturers information had been installed in Brazil, approximately 75,000 units with activities varying between 25 and 92 MBq. Preliminary studies were carried out in some of the 16,000 lightning rods received by the Laboratorio de Rejeitos Radioativos (LRR) of the IPEN-CNEN/SP, and demonstrated that the variation of the values of activity is very bigger. The implantation of a methodology for the radioisotope characterization of the Am-241 removed sources of the radioactive lightning rods is important because the isotope inventory is necessary for the certification of the processes considered for packaging and storage, besides being indispensable data for the final disposal. It is convenient mentioning that one is not about the determination of activity of a radioactive source with geometry and defined characteristics, but the implantation of a measure protocol for groups of sources that will be used in the routine tasks of the LRR. The current work presents the methodology developed for the radioisotope characterization of the Am

  13. SAFETY ANALYSIS APPROACH TO TANK 241-SY-101 REMEDIATION ACTIVITIES

    International Nuclear Information System (INIS)

    RYAN, G.W.

    2000-01-01

    An Unreviewed Safety Question was declared related to the unexplained waste surface level growth in high-level radioactive waste storage Tank 241-SY-101 at the Hanford Site in Richland, Washington. Because the waste surface level in Tank 241-SY-101 was growing in a manner inconsistent with previous behavior, the following issues of concern were recognized: (1) The continually rising surface level had the potential to reach physical encumbrances or limits within the tank (e.g., instrumentation, cameras, established Authorization Basis limits, and the double containment boundary) and the potential to significantly change the consequences of previously analyzed accidents (e.g., flammable gas deflagrations). (2) The presence of new hazards because of significant quantities of flammable gas retained in the crust (e.g., crust collapse gas-release events). (3) The potential to inhibit information gathering related to the existing hazards in the tank (e.g., unable to determine surface level to assess the potential for large gas releases). In response to this situation, a Contractor Project Team, which included Department of Energy representation, was formed to constructively address the issue. The team was responsible for developing and evaluating remediation options and executing the chosen option for remediating the surface level rise issue for Tank 241-SY-101. From an Authorization Basis perspective, the following important aspects will be discussed in this paper: (1) The integrated nature of the Project Team. The team consisted of all the organizations necessary to ensure that the time available to remediate Tank 241-SY-101 was effectively used. Most notable is the connectivity of the Nuclear Safety and Licensing organization with the Engineering, Design, and Operations organizations. (2) The ability of the safety analysis support to adjust to and address evolving Project Team goals and dynamic tank conditions. (3) Due to the urgency to mitigate this developing issue

  14. Acceptance Test Report for 241-SY Pump Cradle Hydraulic System

    International Nuclear Information System (INIS)

    Koons, B.M.

    1995-01-01

    The purpose of this ATP is to verify that hydraulic system/cylinder procured to replace the cable/winch system on the 101-SY Mitigation Pump cradle assembly fulfills its functional requirements for raising and lowering the cradle assembly between 70 and 90 degrees, both with and without pump. A system design review was performed on the 101-SY Cradle Hydraulic System by the vendor before shipping (See WHC-SD-WM-DRR-045, 241-SY-101 Cradle Hydraulic System Design Review). The scope of this plan focuses on verification of the systems ability to rotate the cradle assembly and any load through the required range of motion

  15. Tank 241-AP-102 Characterization and Grout Product Test Results.

    Energy Technology Data Exchange (ETDEWEB)

    Welsh, T. L. [Hanford Site (HNF), Richland, WA (United States)

    1994-06-02

    Twenty-five samples were obtained from different locations within Tank 241-AP-102. Chemical and radiological analyses were performed on eighteen of these samples. Organic analyses were performed on the remaining seven samples. The results of the statistical analyses of the data indicated that the tank contents were homogeneous. A composite sample was formed using equal volumes of the individual samples. The composite sample was also chemically and radiologically analyzed. Grout specimens were made using the composite sample. The grout product was statistically compared to known criteria.

  16. Electronic structure of polycrystalline Cd metal using 241Am radioisotope

    Science.gov (United States)

    Dhaka, M. S.; Sharma, G.; Mishra, M. C.; Sharma, B. K.

    2014-04-01

    Electronic structure study of the polycrystalline cadmium metal is reported. The experimental measurement is undertaken on a polycrystalline sheet sample using 59.54 keV radioisotope of 241Am. These results are compared with the ab initio calculations. The theoretical calculations are performed using linear combination of atomic orbitals (LCAO) method employing the density functional theories (DFT) and Hartree-Fock (HF) and augmented plane wave (APW) methods. The spherically averaged APW and LCAO based theoretical Compton profiles are in good agreement with the experimental measurement however the APW based theoretical calculations show best agreement.

  17. Electronic structure of polycrystalline Cd metal using 241Am radioisotope

    International Nuclear Information System (INIS)

    Dhaka, M. S.; Sharma, G.; Mishra, M. C.; Sharma, B. K.

    2014-01-01

    Electronic structure study of the polycrystalline cadmium metal is reported. The experimental measurement is undertaken on a polycrystalline sheet sample using 59.54 keV radioisotope of 241 Am. These results are compared with the ab initio calculations. The theoretical calculations are performed using linear combination of atomic orbitals (LCAO) method employing the density functional theories (DFT) and Hartree-Fock (HF) and augmented plane wave (APW) methods. The spherically averaged APW and LCAO based theoretical Compton profiles are in good agreement with the experimental measurement however the APW based theoretical calculations show best agreement

  18. Sentinel node biopsy for melanoma: a study of 241 patients

    DEFF Research Database (Denmark)

    Chakera, Annette Hougaard; Drzewiecki, Krzysztof Tadeusz; Jakobsen, Annika Loft

    2004-01-01

    The aim of this study was to evaluate the sentinel node biopsy (SNB) technique for melanoma using both radiocolloid and blue dye in 241 clinically N0 patients with melanomas >1.0 mm, or thinner lesions exhibiting regression/ulceration. We showed that an increase in injected radioactivity increased......) of the lymph node basins, there was a discrepancy between the nodes visualized at lymphoscintigraphy and the nodes removed at surgery. There were 38 unusually located nodes. Only eight of these were removed surgically; none contained metastases. SN metastases were detected in 22% (53) of patients. There were...

  19. Sentinel node biopsy for melanoma: a study of 241 patients

    DEFF Research Database (Denmark)

    Chakera, Annette Hougaard; Drzewiecki, Krzysztof Tadeusz; Jakobsen, Annika Loft

    2004-01-01

    The aim of this study was to evaluate the sentinel node biopsy (SNB) technique for melanoma using both radiocolloid and blue dye in 241 clinically N0 patients with melanomas >1.0 mm, or thinner lesions exhibiting regression/ulceration. We showed that an increase in injected radioactivity increased...... nine haematoxylin and eosin (HE)-negatives, all of which were found by immunohistochemistry. The false negative rate for the SNB procedure was 4% (2/55). The complication rate was 6% after SNB and 29% after complete node dissection. In conclusion, SN status is a strong prognostic factor in melanoma...

  20. Sequential determination of natural ({sup 232}Th, {sup 238}U) and anthropogenic ({sup 137}Cs, {sup 90}Sr, {sup 241}Am, {sup 239+240}Pu) radionuclides in environmental matrix

    Energy Technology Data Exchange (ETDEWEB)

    Michel, H.; Levent, D.; Barci, V.; Barci-Funel, G.; Hurel, C. [Laboratoire de Radiochimie, Sciences Analytiques et Environnement (LRSAE), Universite de Nice Sophia-Antipolis 06108 Nice Cedex (France)

    2008-07-01

    A new sequential method for the determination of both natural (U, Th) and anthropogenic (Sr, Cs, Pu, Am) radionuclides has been developed for application to soil and sediment samples. The procedure was optimised using a reference sediment (IAEA-368) and reference soils (IAEA-375 and IAEA-326). Reference materials were first digested using acids (leaching), 'total' acids on hot plate, and acids in microwave in order to compare the different digestion technique. Then, the separation and purification were made by anion exchange resin and selective extraction chromatography: Transuranic (TRU) and Strontium (SR) resins. Natural and anthropogenic alpha radionuclides were separated by Uranium and Tetravalent Actinide (UTEVA) resin, considering different acid elution medium. Finally, alpha and gamma semiconductor spectrometer and liquid scintillation spectrometer were used to measure radionuclide activities. The results obtained for strontium-90, cesium-137, thorium-232, uranium- 238, plutonium-239+240 and americium-241 isotopes by the proposed method for the reference materials provided excellent agreement with the recommended values and good chemical recoveries. (authors)

  1. Analytical utility of the M series x-ray emission lines applied to uranium, neptunium, plutonium, and americium

    International Nuclear Information System (INIS)

    Miller, A.G.

    1976-01-01

    Secondary emission x-ray analysis for actinide elements has usually meant utilizing the L series x-ray lines. The major disadvantage of these x-ray lines is that they fall in the region of high level Bremsstrahlung radiation, producing a high background and, subsequently, larger error and high detection limits. The utilization of the M series x-ray lines of actinide elements with wavelength dispersive x-ray spectrometers greatly minimizes these problems. Calibration curves for uranium, neptunium, plutonium, and americium were prepared by the ''coprex'' method, and the analytical characteristics of the L and M series compared. The Mα and β x-ray lines, under optimum conditions, are several times more sensitive than their L series counterparts. With the greater sensitivity in addition to the lower background, peak to background ratios for M lines up to 40 times greater than those for L lines were obtained. Detection limits can be lowered from about 0.7 μg using the Lα 1 line to 0.05 μg when M x-ray lines are used. The relative advantages and disadvantages of utilizing the L and M series x-ray lines for secondary emission x-ray analysis are discussed

  2. Use of radioanalytical methods for determination of uranium, neptunium, plutonium, americium and curium isotopes in radioactive wastes

    International Nuclear Information System (INIS)

    Geraldo, Bianca

    2012-01-01

    Activated charcoal is a common type of radioactive waste that contains high concentrations of fission and activation products. The management of this waste includes its characterization aiming the determination and quantification of the specific radionuclides including those known as Difficult-to-Measure Radionuclides (RDM). The analysis of the RDM's generally involves complex radiochemical analysis for purification and separation of the radionuclides, which are expensive and time-consuming. The objective of this work was to define a methodology for sequential analysis of the isotopes of uranium, neptunium, plutonium, americium and curium present in a type of radioactive waste, evaluating chemical yield, analysis of time spent, amount of secondary waste generated and cost. Three methodologies were compared and validated that employ ion exchange (TI + EC), extraction chromatography (EC) and extraction with polymers (ECP). The waste chosen was the activated charcoal from the purification system of primary circuit water cooling the reactor IEA-R1. The charcoal samples were dissolved by acid digestion followed by purification and separation of isotopes with ion exchange resins, extraction and chromatographic extraction polymers. Isotopes were analyzed on an alpha spectrometer, equipped with surface barrier detectors. The chemical yields were satisfactory for the methods TI + EC and EC. ECP method was comparable with those methods only for uranium. Statistical analysis as well the analysis of time spent, amount of secondary waste generated and cost revealed that EC method is the most effective for identifying and quantifying U, Np, Pu, Am and Cm present in charcoal. (author)

  3. Microdistribution of 241Am in structures of submerged macrophyte Elodea canadensis growing in the Yenisei River.

    Science.gov (United States)

    Bondareva, L; Vlasova, I; Mogilnaya, O; Bolsunovsky, A; Kalmykov, S

    2010-01-01

    A submerged macrophyte of the Yenisei River, Elodea canadensis, was used to study the microdistribution of the artificial radionuclide (241)Am among different components of the plant. The total amount of (241)Am added to the experimental system was 1850+/-31 Bq/L. The total amount of (241)Am accumulated by the plants was 182 Bq per sample, or 758,333+/-385 Bq/kg dry mass. It has been found that the major portion of (241)Am accumulated by E. canadensis, up to 85%, was bound to solid components of the cells. It is observed that the microdistribution of (241)Am within different components of the submerged plant E. canadensis was not uniform. (241)Am distribution vary depending on the age of the leaf blades, the state of the cells and morphological features of the plant stem.

  4. Microdistribution of 241Am in structures of submerged macrophyte Elodea canadensis growing in the Yenisei River

    International Nuclear Information System (INIS)

    Bondareva, L.; Vlasova, I.; Mogilnaya, O.; Bolsunovsky, A.; Kalmykov, S.

    2010-01-01

    A submerged macrophyte of the Yenisei River, Elodea canadensis, was used to study the microdistribution of the artificial radionuclide 241 Am among different components of the plant. The total amount of 241 Am added to the experimental system was 1850 ± 31 Bq/L. The total amount of 241 Am accumulated by the plants was 182 Bq per sample, or 758,333 ± 385 Bq/kg dry mass. It has been found that the major portion of 241 Am accumulated by E. canadensis, up to 85%, was bound to solid components of the cells. It is observed that the microdistribution of 241 Am within different components of the submerged plant E. canadensis was not uniform. 241 Am distribution vary depending on the age of the leaf blades, the state of the cells and morphological features of the plant stem.

  5. Operational test report for the 241-A-701 air compressor upgrade

    Energy Technology Data Exchange (ETDEWEB)

    Meeuwsen, W.E.

    1997-06-30

    A description and safety class designation of the accumulator and 701-A compressor system is contained in VTHC-SD-@-DA-137, Safety Classification (of the 241-A-70) Compressed Air System and shown on drawings H-2-62895, Sheet 2 and H-14-20308, Sheet 3. The design basis for the 241-A-702 Ventilation System Accumulator is contained in @-C-SD-@-DB-016, 241-A-702 Ventilation System Accumulator Design Basis.

  6. Acceptance test report for the Tank 241-C-106 in-tank imaging system

    International Nuclear Information System (INIS)

    Pedersen, L.T.

    1998-01-01

    This document presents the results of Acceptance Testing of the 241-C-106 in-tank video camera imaging system. The purpose of this imaging system is to monitor the Project W-320 sluicing of Tank 241-C-106. The objective of acceptance testing of the 241-C-106 video camera system was to verify that all equipment and components function in accordance with procurement specification requirements and original equipment manufacturer's (OEM) specifications. This document reports the results of the testing

  7. Evaluation of tank waste transfers at 241-AW tank farm

    International Nuclear Information System (INIS)

    Willis, W.L.

    1998-01-01

    A number of waste transfers are needed to process and feed waste to the private contractors in support of Phase 1 Privatization. Other waste transfers are needed to support the 242-A Evaporator, saltwell pumping, and other ongoing Tank Waste Remediation System (TWRS) operations. The purpose of this evaluation is to determine if existing or planned equipment and systems are capable of supporting the Privatization Mission of the Tank Farms and continuing operations through the end of Phase 1B Privatization Mission. Projects W-211 and W-314 have been established and will support the privatization effort. Equipment and system upgrades provided by these projects (W-211 and W-314) will also support other ongoing operations in the tank farms. It is recognized that these projects do not support the entire transfer schedule represented in the Tank Waste Remediation system Operation and Utilization Plan. Additionally, transfers surrounding the 241-AW farm must be considered. This evaluation is provided as information, which will help to define transfer paths required to complete the Waste Feed Delivery (WFD) mission. This document is not focused on changing a particular project, but it is realized that new project work in the 241-AW Tank Farm is required

  8. Preliminary Analysis of High-Flux RSG-GAS to Transmute Am-241 of PWR’s Spent Fuel in Asian Region

    Science.gov (United States)

    Budi Setiawan, M.; Kuntjoro, S.

    2018-02-01

    A preliminary study of minor actinides (MA) transmutation in the high flux profile RSG-GAS research reactor was performed, aiming at an optimal transmutation loading for present nuclear energy development. The MA selected in the analysis includes Am-241 discharged from pressurized water reactors (PWRs) in Asian region. Until recently, studies have been undertaken in various methods to reduce radiotoxicity from actinides in high-level waste. From the cell calculation using computer code SRAC2006, it is obtained that the target Am-241 which has a cross section of the thermal energy absorption in the region (group 8) is relatively large; it will be easily burned in the RSG-GAS reactor. Minor actinides of Am-241 which can be inserted in the fuel (B/T fuel) is 2.5 kg which is equivalent to Am-241 resulted from the partition of spent fuel from 2 units power reactors PWR with power 1000MW(th) operated for one year.

  9. {sup 241}Pu concentrations in water, plankton and fish from the southern Baltic Sea

    Energy Technology Data Exchange (ETDEWEB)

    Struminska-Parulska, D.I.; Skwarzec, B. [Gdansk, Univ. (Poland). Facuty of Chemistry

    2013-08-01

    The aim of the work was to determine {sup 241}Pu activities in different components (water, plankton and fish) of the southern Baltic Sea ecosystem. Measurement of {sup 241}Pu in the samples was done indirectly by determining the increment in {sup 241}Am from the decay of the {beta}-emitting {sup 241}Pu in samples collected 10-15 years after the Chernobyl accident. Enhanced levels of {sup 241}Pu were observed in all analyzed Baltic samples. The highest {sup 241}Pu concentrations in fish were found in Perciformes: benthic round goby (0.863 {+-} 0.066 mBq/g ww) and pelagic perch (0.666 {+-} 0.001 mBq/g ww). Plutonium is also non-uniformly distributed in the organs and tissues of the analyzed fish; especially pelagic herring and cod as well as benthic flounder. Most of {sup 241}Pu in flounder, herring and cod is located in soft tissues, especially digestive organs (stomach, intestine, liver). The annual individual effective doses calculated on the basis of {sup 241}Pu concentrations in fish indicated that the impact of the consumption of {sup 241}Pu containing Baltic fish on the annual effective dose for a statistical inhabitant of Poland was very small. (orig.)

  10. 241-AZ Tank Farm Construction Extent of Condition Review for Tank Integrity

    Energy Technology Data Exchange (ETDEWEB)

    Barnes, Travis J.; Boomer, Kayle D.; Gunter, Jason R.; Venetz, Theodore J.

    2013-07-30

    This report provides the results of an extent of condition construction history review for tanks 241-AZ-101 and 241-AZ-102. The construction history of the 241-AZ tank farm has been reviewed to identify issues similar to those experienced during tank AY-102 construction. Those issues and others impacting integrity are discussed based on information found in available construction records, using tank AY-102 as the comparison benchmark. In the 241-AZ tank farm, the second DST farm constructed, both refractory quality and tank and liner fabrication were improved.

  11. Determination of plutonium-241 half-life by mass spectrometric measurement

    International Nuclear Information System (INIS)

    Hiyama, Takashi; Wada, Yukio; Onishi, Koichi

    1982-01-01

    Much data for Pu-241 half-life have been reported, but these values range from 13.8 years to 15.1 years depending on investigators. In order to define the half-life of Pu-241, the half-life was calculated by analyzing the mass spectrometry data obtained in the author's laboratory over the past six years on Plutonium Isotopic Standard Reference Materials prepared at the National Bureau of Standards (NBS). The sample used for this work consisted of SRM-947 and SRM-948 prepared at NBS. Before mass spectrometric analysis, the plutonium aliquot was separated from its Am-241 daughter by anion exchange chromatography, since Am-241 is not distinguished from Pu-241 in the mass spectrometer. 241 Pu/ 239 Pu and 241 Pu/ 240 Pu ratios were calculated from the values of mass spectrometric measurement. From the relation of log N to time, the half-life of Pu-241 was determined, based on the slope using a least squares fit. The half-life of Pu-241 was estimated to be 14.29+-0.15 years. (Yoshitake, I.)

  12. Hanford Tanks 241-C-203 and 241 C 204: Residual Waste Contaminant Release Model and Supporting Data

    Energy Technology Data Exchange (ETDEWEB)

    Deutsch, William J.; Krupka, Kenneth M.; Lindberg, Michael J.; Cantrell, Kirk J.; Brown, Christopher F.; Schaef, Herbert T.

    2007-05-23

    This report was revised in May 2007 to correct 90Sr values in Chapter 3. The changes were made on page 3.9, paragraph two and Table 3.10; page 3.16, last paragraph on the page; and Tables 3.21 and 3.31. The rest of the text remains unchanged from the original report issued in October 2004. This report describes the development of release models for key contaminants that are present in residual sludge remaining after closure of Hanford Tanks 241-C-203 (C-203) and 241-C-204 (C-204). The release models were developed from data generated by laboratory characterization and testing of samples from these two tanks. Key results from this work are (1) future releases from the tanks of the primary contaminants of concern (99Tc and 238U) can be represented by relatively simple solubility relationships between infiltrating water and solid phases containing the contaminants; and (2) high percentages of technetium-99 in the sludges (20 wt% in C-203 and 75 wt% in C-204) are not readily water leachable, and, in fact, are very recalcitrant. This is similar to results found in related studies of sludges from Tank AY-102. These release models are being developed to support the tank closure risk assessments performed by CH2M HILL Hanford Group, Inc., for the U.S. Department of Energy.

  13. Hanford Tanks 241-C-203 and 241-C-204: Residual Waste Contaminant Release Model and Supporting Data

    Energy Technology Data Exchange (ETDEWEB)

    Deutsch, William J.; Krupka, Kenneth M.; Lindberg, Michael J.; Cantrell, Kirk J.; Brown, Christopher F.; Schaef, Herbert T.

    2004-10-28

    This report describes the development of release models for key contaminants that are present in residual sludge remaining after closure of Hanford Tanks 241-C-203 (C-203) and 241-C-204 (C-204). The release models were developed from data generated by laboratory characterization and testing of samples from these two tanks. Key results from this work are (1) future releases from the tanks of the primary contaminants of concern (99Tc and 238U) can be represented by relatively simple solubility relationships between infiltrating water and solid phases containing the contaminants; and (2) high percentages of technetium-99 in the sludges (20 wt% in C-203 and 75 wt% in C-204) are not readily water leachable, and, in fact, are very recalcitrant. This is similar to results found in related studies of sludges from Tank AY-102. These release models are being developed to support the tank closure risk assessments performed by CH2M HILL Hanford Group, Inc., for the U.S. Department of Energy.

  14. Hanford Tanks 241-C-202 and 241-C-203 Residual Waste Contaminant Release Models and Supporting Data

    Energy Technology Data Exchange (ETDEWEB)

    Deutsch, William J.; Krupka, Kenneth M.; Lindberg, Michael J.; Cantrell, Kirk J.; Brown, Christopher F.; Mattigod, Shas V.; Schaef, Herbert T.; Arey, Bruce W.

    2007-09-13

    As directed by Congress, the U. S. Department of Energy (DOE) established the Office of River Protection in 1998 to manage DOE's largest, most complex environmental cleanup project – retrieval of radioactive waste from Hanford tanks for treatment and eventual disposal. Sixty percent by volume of the nation's high-level radioactive waste is stored at Hanford in aging deteriorating tanks. If not cleaned up, this waste is a threat to the Columbia River and the Pacific Northwest. CH2M Hill Hanford Group, Inc., is the Office of River Protection's prime contractor responsible for the storage, retrieval, and disposal of Hanford's tank waste. As part of this effort, CH2M HILL Hanford Group, Inc. contracted with Pacific Northwest National Laboratory (PNNL) to develop release models for key contaminants that are present in residual sludge remaining after closure of Hanford Tanks 241-C-203 (C-203) and 241-C-204 (C-204). The release models were developed from data generated by laboratory characterization and testing of samples from these two tanks. These release models are being developed to support the tank closure risk assessments performed by CH2M HILL Hanford Group, Inc., for DOE.

  15. Hanford Tanks 241-C-203 and 241-C-204: Residual Waste Contaminant Release Model and Supporting Data

    International Nuclear Information System (INIS)

    Deutsch, William J.; Krupka, Kenneth M.; Lindberg, Michael J.; Cantrell, Kirk J.; Brown, Christopher F.; Schaef, Herbert T.

    2004-01-01

    This report describes the development of release models for key contaminants that are present in residual sludge remaining after closure of Hanford Tanks 241-C-203 (C-203) and 241-C-204 (C-204). The release models were developed from data generated by laboratory characterization and testing of samples from these two tanks. Key results from this work are (1) future releases from the tanks of the primary contaminants of concern (99Tc and 238U) can be represented by relatively simple solubility relationships between infiltrating water and solid phases containing the contaminants; and (2) high percentages of technetium-99 in the sludges (20 wt% in C-203 and 75 wt% in C-204) are not readily water leachable, and, in fact, are very recalcitrant. This is similar to results found in related studies of sludges from Tank AY-102. These release models are being developed to support the tank closure risk assessments performed by CH2M HILL Hanford Group, Inc., for the U.S. Department of Energy

  16. Integrative analysis reveals selective 9p24.1 amplification, increased PD-1 ligand expression, and further induction via JAK2 in nodular sclerosing Hodgkin lymphoma and primary mediastinal large B-cell lymphoma.

    Science.gov (United States)

    Green, Michael R; Monti, Stefano; Rodig, Scott J; Juszczynski, Przemyslaw; Currie, Treeve; O'Donnell, Evan; Chapuy, Bjoern; Takeyama, Kunihiko; Neuberg, Donna; Golub, Todd R; Kutok, Jeffery L; Shipp, Margaret A

    2010-10-28

    Classical Hodgkin lymphoma (cHL) and mediastinal large B-cell lymphoma (MLBCL) are lymphoid malignancies with certain shared clinical, histologic, and molecular features. Primary cHLs and MLBCLs include variable numbers of malignant cells within an inflammatory infiltrate, suggesting that these tumors escape immune surveillance. Herein, we integrate high-resolution copy number data with transcriptional profiles and identify the immunoregulatory genes, PD-L1 and PD-L2, as key targets at the 9p24.1 amplification peak in HL and MLBCL cell lines. We extend these findings to laser-capture microdissected primary Hodgkin Reed-Sternberg cells and primary MLBCLs and find that programmed cell death-1 (PD-1) ligand/9p24.1 amplification is restricted to nodular sclerosing HL, the cHL subtype most closely related to MLBCL. Using quantitative immunohistochemical methods, we document the association between 9p24.1 copy number and PD-1 ligand expression in primary tumors. In cHL and MLBCL, the extended 9p24.1 amplification region also included the Janus kinase 2 (JAK2) locus. Of note, JAK2 amplification increased protein expression and activity, specifically induced PD-1 ligand transcription and enhanced sensitivity to JAK2 inhibition. Therefore, 9p24.1 amplification is a disease-specific structural alteration that increases both the gene dosage of PD-1 ligands and their induction by JAK2, defining the PD-1 pathway and JAK2 as complementary rational therapeutic targets.

  17. Contingency plan for deployment of the void fraction instrument in Tank 241-AY-102

    International Nuclear Information System (INIS)

    CONNER, J.M.

    1999-01-01

    High-heat producing sludge from tank 241-C-106 will be sluiced and transferred to tank 241-AY-102 beginning in October 1998. Safety analyses have postulated that after retrieval, the waste in 241-AY-102 may generate and retain unsafe levels of flammable gases (Noorani 1998, Pasamebmetoglu etal. 1997). Unsafe levels of retained gas are not expected, but cannot be ruled out because of the large uncertainty in the gas generation and retention rates. The Tank Waste Remediation System Basis for Interim Operation (Noorani 1998) identifies the need for a contingency plan to add void fraction monitoring to tank 241-AY-102 within 2 weeks of the identification of flammable gas buildup that would warrant monitoring. The Tank 241-C-106 Waste Retrieval Sluicing System Process Control Plan (Carothers et al. 1998) committed to providing a contingency plan for deployment of the void fraction instrument (VFI) in tank 241-AY-102. The VFI determines the local void fraction of the waste by compressing a waste sample captured in a gas-tight test chamber. The sample chamber is mounted on the end of a 76-cm (2.5-ft) arm that can be rotated from vertical to horizontal when the instrument is deployed. Once in the waste, the arm can be positioned horizontally and rotated to sample in different areas below the riser. The VFI is deployed using a crane. The VFI has been deployed previously in 241-AW, 241-AN, and 241-SY tank farms, most recently in tank 241-SY-101 in June and July 1998. An additional test in tank 241-SY-101 is planned in September 1998. Operating instructions for the VFI are included in the Void Fraction Instrument Operation and Maintenance Manual (Pearce 1994)

  18. Tank characterization report for double-shell tank 241-AN-102

    International Nuclear Information System (INIS)

    Jo, J.

    1996-01-01

    This characterization report summarizes the available information on the historical uses, current status, and sampling and analysis results of waste stored in double-shell underground storage tank 241- AN-102. This report supports the requirements of the Hanford Federal Facility Agreement and Consent Order, Milestone M-44-09 (Ecology et al. 1996). Tank 241-AN-102 is one of seven double-shell tanks located in the AN Tank Farm in the Hanford Site 200 East Area. The tank was hydrotested in 1981, and when the water was removed, a 6-inch heel was left. Tank 241-AN-102 began receiving waste from tank 241-SY-102 beginning in 1982. The tank was nearly emptied in the third quarter of 1983, leaving only 125 kL (33 kgal) of waste. Between the fourth quarter of 1983 and the first quarter of 1984, tank 241-AN-102 received waste from tanks 241-AY-102, 241-SY-102, 241-AW-105, and 241- AN-101. The tank was nearly emptied in the second quarter of 1984, leaving a heel of 129 kL (34 kgal). During the second and third quarters of 1984, the tank was filled with concentrated complexant waste from tank 241-AW-101. Since that time, only minor amounts of Plutonium-Uranium Extraction (PUREX) Plant miscellaneous waste and water have been received; there have been no waste transfer to or from the tank since 1992. Therefore, the waste currently in the tank is considered to be concentrated complexant waste. Tank 241-AN-102 is sound and is not included on any of the Watch Lists

  19. Investigation of Tank 241-AW-104 Composite Floating Layer

    Energy Technology Data Exchange (ETDEWEB)

    Meznarich, H. K. [Washington River Protection Solutions LLC (WRPS), Richland, WA (United States); Bolling, S. D. [Washington River Protection Solutions LLC (WRPS), Richland, WA (United States); Lachut, J. S. [Washington River Protection Solutions LLC (WRPS), Richland, WA (United States); Cooke, G. A. [Washington River Protection Solutions LLC (WRPS), Richland, WA (United States)

    2018-02-27

    Seven grab samples and one field blank were taken from Tank 241-AW-104 (AW-104) on June 2, 2017, and received at 222-S Laboratory on June 5, 2017. A visible layer with brown solids was observed floating on the top of two surface tank waste samples (4AW-17-02 and 4AW 17 02DUP). The floating layer from both samples was collected, composited, and submitted for chemical analyses and solid phase characterization in order to understand the composition of the floating layer. Tributyl phosphate and tridecane were higher in the floating layer than in the aqueous phase. Density in the floating layer was slightly lower than the mean density of all grab samples. Sodium nitrate and sodium carbonate were major components with a trace of gibbsite and very small size agglomerates were present in the solids of the floating layer. The supernate consisted of organics, soluble salt, and particulates.

  20. Mammalian target of rapamycin inhibitors for treatment in tuberous sclerosis

    Directory of Open Access Journals (Sweden)

    Won Seop Kim

    2013-06-01

    Full Text Available Korean J Pediatr 2011;54:241-5. &lt;a href='http://dx.doi.org/10.3345/kjp.2011.54.6.241'&gt;http://dx.doi.org/10.3345/kjp.2011.54.6.241&lt;/a&gt;. PMID: 21949518 [PubMed] &lt;div style="border-top:1px solid #0092C8"&gt;&lt;/div&gt; The following article&lt;sup&gt;1&lt;/sup&gt; is being retracted as a part of the manuscript was plagiarized. Yeong-Ho Rha, MD, PhD Editor-in-Chief, Korean J Pediatr 1.Kim WS. Mammalian target of rapamycin inhibitors for treatment in tuberous sclerosis. Korean J Pediatr 2011;54:241-5.

  1. Picomolar traces of americium(III) introduce drastic changes in the structural chemistry of terbium(III). A break in the ''gadolinium break''

    Energy Technology Data Exchange (ETDEWEB)

    Welch, Jan M. [TU Wien, Atominstitut, Vienna (Austria); Mueller, Danny; Knoll, Christian; Wilkovitsch, Martin; Weinberger, Peter [TU Wien, Institute of Applied Synthetic Chemistry, Vienna (Austria); Giester, Gerald [University of Vienna, Institute of Mineralogy and Crystallography, Vienna (Austria); Ofner, Johannes; Lendl, Bernhard [TU Wien, Institute of Chemical Technologies and Analytics, Vienna (Austria); Steinhauser, Georg [Leibniz Universitaet Hannover, Institute of Radioecology and Radiation Protection (Germany)

    2017-10-16

    The crystallization of terbium 5,5{sup '}-azobis[1H-tetrazol-1-ide] (ZT) in the presence of trace amounts (ca. 50 Bq, ca. 1.6 pmol) of americium results in 1) the accumulation of the americium tracer in the crystalline solid and 2) a material that adopts a different crystal structure to that formed in the absence of americium. Americium-doped [Tb(Am)(H{sub 2}O){sub 7}ZT]{sub 2} ZT.10 H{sub 2}O is isostructural to light lanthanide (Ce-Gd) 5,5{sup '}-azobis[1H-tetrazol-1-ide] compounds, rather than to the heavy lanthanide (Tb-Lu) 5,5{sup '}-azobis[1H-tetrazol-1-ide] (e.g., [Tb(H{sub 2}O){sub 8}]{sub 2}ZT{sub 3}.6 H{sub 2}O) derivatives. Traces of Am seem to force the Tb compound into a structure normally preferred by the lighter lanthanides, despite a 10{sup 8}-fold Tb excess. The americium-doped material was studied by single-crystal X-ray diffraction, vibrational spectroscopy, radiochemical neutron activation analysis, and scanning electron microscopy. In addition, the inclusion properties of terbium 5,5{sup '}-azobis[1H-tetrazol-1-ide] towards americium were quantified, and a model for the crystallization process is proposed. (copyright 2017 Wiley-VCH Verlag GmbH and Co. KGaA, Weinheim)

  2. Measurement of total alpha activity of neptunium, plutonium, and americium in highly radioactive Hanford waste by iron hydroxide precipitation and 2-heptanone solvent extraction

    International Nuclear Information System (INIS)

    Maiti, T.C.; Kaye, J.H.

    1992-06-01

    An improved method has been developed to concentrate the major alpha-emitting actinide elements neptunium, plutonium, and americium from samples with high salt content such as those resulting from efforts to characterize Hanford storage tank waste. Actinide elements are concentrated by coprecipitation of their hydroxides using iron carrier. The iron is removed by extraction from 8M HCI with 2-heptanone. The actinide elements remain in the aqueous phase free from salts, iron, and long-lived fission products. Recoveries averaged 98 percent

  3. 27 CFR 19.241 - Operations bond-distilled spirits plant and adjacent bonded wine cellar.

    Science.gov (United States)

    2010-04-01

    ... spirits plant and adjacent bonded wine cellar. 19.241 Section 19.241 Alcohol, Tobacco Products and... wine cellar. (a) General. A wine cellar under the provisions of 27 CFR part 24 shall be treated as... subpart G for the production of distilled spirits; and (2) Such wine cellar and distilled spirits plant...

  4. Assessment of vadose zone radionuclide contamination around Single Shell Tank 241-C-103

    International Nuclear Information System (INIS)

    Kos, S.E.

    1995-12-01

    Five drywells surrounding single shell tank 241-C-103 were logged with the high-purity germanium logging system to investigate possible leakage of radioactive contamination from the tank. The investigation included integration of the drywell survey results with several other data sources. There is no conclusive evidence showing indications that the 241-C-103 tank has leaked

  5. Safety evaluation for the interim stabilization of Tank 241-C-103

    International Nuclear Information System (INIS)

    Geschke, G.R.

    1995-03-01

    This document provides the basis for interim stabilization of tank 241-C-103. The document covers the removal of the organic liquid layer and the aqueous supernatant from tank 241-C-103. Hazards are identified, consequences are calculated and controls to mitigate or prevent potential accidents are developed

  6. 7 CFR 1951.241 - Special provision for interest rate change.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 14 2010-01-01 2009-01-01 true Special provision for interest rate change. 1951.241... Community and Direct Business Programs Loans and Grants § 1951.241 Special provision for interest rate... interest rate charged by FmHA or its successor agency under Public Law 103-354 to water and waste disposal...

  7. Safety evaluation for the interim stabilization of Tank 241-C-103

    Energy Technology Data Exchange (ETDEWEB)

    Geschke, G.R.

    1995-03-01

    This document provides the basis for interim stabilization of tank 241-C-103. The document covers the removal of the organic liquid layer and the aqueous supernatant from tank 241-C-103. Hazards are identified, consequences are calculated and controls to mitigate or prevent potential accidents are developed.

  8. 8 CFR 241.14 - Continued detention of removable aliens on account of special circumstances.

    Science.gov (United States)

    2010-01-01

    ... 8 Aliens and Nationality 1 2010-01-01 2010-01-01 false Continued detention of removable aliens on account of special circumstances. 241.14 Section 241.14 Aliens and Nationality DEPARTMENT OF HOMELAND SECURITY IMMIGRATION REGULATIONS APPREHENSION AND DETENTION OF ALIENS ORDERED REMOVED Post-hearing...

  9. 8 CFR 241.21 - Stay of deportation of excluded alien.

    Science.gov (United States)

    2010-01-01

    ... 8 Aliens and Nationality 1 2010-01-01 2010-01-01 false Stay of deportation of excluded alien. 241.21 Section 241.21 Aliens and Nationality DEPARTMENT OF HOMELAND SECURITY IMMIGRATION REGULATIONS APPREHENSION AND DETENTION OF ALIENS ORDERED REMOVED Deportation of Excluded Aliens (for Hearings Commenced...

  10. Acceptance Test Report for the 241-AN-107 Enraf Advanced Technology Gauges

    International Nuclear Information System (INIS)

    Dowell, J.L.; Enderlin, V.R.

    1995-06-01

    This Acceptance Test Report covers the results of the execution of the Acceptance Test Procedure for the 241-AN-107 Enraf Advanced Technology Gauges. The test verified the proper operation of the gauges to measure waste density and level in the 241-AN-107 tank

  11. Structural analysis and evaluation of the 241SY101 tank annulus heat-up

    International Nuclear Information System (INIS)

    Ziada, H.H.

    1994-01-01

    This document provides the structural analysis (static and thermal loads) of the 241SY101 tank to determine the maximum allowable temperature and rate of heating that could be applied to tank 241SY101 through annulus air heating without detrimental effects to the structural integrity of the concrete and steel liner of the tank

  12. Final report for tank 241-BX-109, push mode cores 84 and 85

    International Nuclear Information System (INIS)

    Schreiber, R.D.

    1996-01-01

    This document summarizes the sampling activities for tank 241-BX-109. This report contains tables of the analytical results on total organic compounds and total inorganic compounds in the radioactive wastes. Tank 241-BX-109 has not been on a Watch List

  13. Tank 241-C-106 in-tank imaging system operational test report

    International Nuclear Information System (INIS)

    Pedersen, L.T.

    1998-01-01

    This document presents the results of operational testing of the 241-C-106 In-Tank Video Camera Imaging System. This imaging system was installed as a component of Project W-320 to monitor sluicing and waste retrieval activities in Tank 241-C-106

  14. Removal of floating organic in Hanford Waste Tank 241-C-103 restart plan

    International Nuclear Information System (INIS)

    Wilson, T.R.; Hanson, C.

    1994-01-01

    The decision whether or not to remove the organic layer from Waste Tank 241-C-103 was deferred until May, 1995. The following restart plan was prepared for removal of the organic if the decision is to remove the organic from the waste tank 241-C-103

  15. Removal of floating organic in Hanford Waste Tank 241-C-103 restart plan

    Energy Technology Data Exchange (ETDEWEB)

    Wilson, T.R.; Hanson, C.

    1994-10-03

    The decision whether or not to remove the organic layer from Waste Tank 241-C-103 was deferred until May, 1995. The following restart plan was prepared for removal of the organic if the decision is to remove the organic from the waste tank 241-C-103.

  16. 241-SY-101 DACS instrument problem screen (SCR 448) acceptance test procedure

    International Nuclear Information System (INIS)

    ERMI, A.M.

    1999-01-01

    The operability of the 241-SY-101 Data Acquisition and Control System (DACS) to provide proper control and monitoring of the mitigation mixer pump and instrumentation installed in the 241-SY-101 underground storage tank utilizing the [INSTPROB] screen will be systematically evaluated by the performance of this procedure

  17. Biosorption of {sup 241}Am by Rhizopus arrihizus: preliminary investigation and evaluation

    Energy Technology Data Exchange (ETDEWEB)

    Liu Ning E-mail: 5416507@mail.sc.cninfo.net; Yang Yuanyou; Luo Shunzhong; Zhang Taiming; Jin Jiannan; Liao Jiali; Hua Xifeng

    2002-08-01

    The biosorption of {sup 241}Am from solution by a fungus--Rhizopus Arrihizus (R. arrihizus), and the effect of experimental conditions on the adsorption were investigated. The preliminary results showed that the biosorption of {sup 241}Am by R. arrihizus is very efficient. An average of more than 99% of the total {sup 241}Am was removed by R. arrihizus of 1.3 g/l (dry weight) from {sup 241}Am solutions of 5.6-111 MBq/l (44.3-877.2 {mu}g/l) (C{sub 0}), with adsorption capacities (W) of 4.2-79.4 MBq/g biomass (dry weight) (33.2-627.5 {mu}g/g). The biosorption equilibrium was achieved within 1 h and the optimum pH ranged from 1 to 3. No significant differences in {sup 241}Am biosorption were observed at 10-45 deg. C, or in solutions containing Au{sup 3+} or Ag{sup +}, even 2000 times above {sup 241}Am concentration. The relationship between concentrations and adsorption capacities of {sup 241}Am indicated that the {sup 241}Am biosorption by R. arrihizus obeys the Freundlich adsorption equation.

  18. Characterization of Direct-Push Vadose Zone Sediments from the 241-B and 241-BX Tank Farms

    Energy Technology Data Exchange (ETDEWEB)

    Brown, Christopher F.; Icenhower, Jonathan P.; Um, Wooyong; Bjornstad, Bruce N.; Valenta, Michelle M.; Iovin, Cristian; Lanigan, David C.; Clayton, Ray E.; Geiszler, Keith N.; Clayton, Eric T.; Kutnyakov, Igor V.; Baum, Steven R.; Lindberg, Michael J.; Orr, Robert D.

    2007-12-21

    Geochemical tests provide evidence for the transit of a plume of caustic waste solution through the sediment column at the Hanford 241-B and -BX Tank Farms. Direct-push samples recovered from boreholes surrounding Tanks 241-B-110 and 241-BX-102 and related waste transfer lines and diversion boxes included sediments typical of those previously recovered from other localities on the Hanford Site. The Hanford formation sediments are dominantly quartzo-feldspathic sands strewn with lithic fragments, displaying a range of particle size distributions and sorting characteristics. Some moderately well-sorted, fine-grained lithologies are interpreted as lenticular bodies irregularly dispersed in coarser-grained, more poorly sorted sediments. Tier I tests conducted on the vadose zone sediments revealed an inverse correlation between moisture content and sediment size fraction (i.e., there is greater moisture content in finer-grained sediments). The Tier I tests also showed that the pore water solutions were likely sodium-rich, moderately saline, and possessed higher pH values than background (untainted) sediments. These data are characteristic of sediments that have encountered sodium-rich, saline, caustic waste solution, as documented in other reports at other suspect contamination sites around Hanford. Analyses of solutions from 1:1 water extracts reveal relatively balanced cation and anion concentrations, indicating that most of the geochemical species have been accounted for. The water extract data for affected sediments also indicate unusually high concentrations of aluminum, iron, and phosphorus. The relatively high concentrations of aluminum and iron may be the result of dissolution of secondary amorphous phases that precipitated after a reactive plume partially dissolved aluminum- and iron-bearing phases as it migrated through the sediment column. On the other hand, the presence of elevated concentrations of phosphorous may be the tell-tale signature of wastes

  19. Results of Waste Transfer and Back-Dilution in Tanks 241-SY-101 and 241-SY-102

    Energy Technology Data Exchange (ETDEWEB)

    LA Mahoney; ZI Antoniak; WB Barton; JM Conner; NW Kirch; CW Stewart; BE Wells

    2000-07-26

    This report chronicles the process of remediation of the flammable gas hazard in Tank 241-SY-101 (SY-101) by waste transfer and back-dilution from December 18, 1999 through April 2, 2000. A brief history is given of the development of the flammable gas retention and release hazard in this tank, and the transfer and dilution systems are outlined. A detailed narrative of each of the three transfer and dilution campaigns is given to provide structure for the balance of the report. Details of the behavior of specific data are then described, including the effect of transfer and dilution on the waste levels in Tanks SY-101 and SY-102, data from strain gauges on equipment suspended from the tank dome, changes in waste configuration as inferred from neutron and gamma logs, headspace gas concentrations, waste temperatures, and the mixerpump operating performance. Operating data and performance of the transfer pump in SY-101 are also discussed.

  20. Results of Waste Transfer and Back-Dilution in Tanks 241-SY-101 and 241-SY-102

    International Nuclear Information System (INIS)

    Mahoney, L.A.; Antoniak, Z.I.; Barton, W.B.; Conner, J.M.; Kirch, N.W.; Stewart, C.W.; Wells, B.E.

    2000-01-01

    This report chronicles the process of remediation of the flammable gas hazard in Tank 241-SY-101 (SY-101) by waste transfer and back-dilution from December 18, 1999 through April 2, 2000. A brief history is given of the development of the flammable gas retention and release hazard in this tank, and the transfer and dilution systems are outlined. A detailed narrative of each of the three transfer and dilution campaigns is given to provide structure for the balance of the report. Details of the behavior of specific data are then described, including the effect of transfer and dilution on the waste levels in Tanks SY-101 and SY-102, data from strain gauges on equipment suspended from the tank dome, changes in waste configuration as inferred from neutron and gamma logs, headspace gas concentrations, waste temperatures, and the mixerpump operating performance. Operating data and performance of the transfer pump in SY-101 are also discussed

  1. Accumulation and release of {sup 241}Am by a macrophyte of the Yenisei River (Elodea canadensis)

    Energy Technology Data Exchange (ETDEWEB)

    Bolsunovsky, A. [Institute of Biophysics, Siberian Branch of the Russian Academy of Sciences, Krasnoyarsk 660036 (Russian Federation)]. E-mail: radecol@ibp.ru; Zotina, T. [Institute of Biophysics, Siberian Branch of the Russian Academy of Sciences, Krasnoyarsk 660036 (Russian Federation); Bondareva, L. [Institute of Biophysics, Siberian Branch of the Russian Academy of Sciences, Krasnoyarsk 660036 (Russian Federation)

    2005-07-01

    The source of radioactive contamination of the Yenisei River floodplain, including contamination with transuranic elements, is the Mining-and-Chemical Combine of the Russian Ministry of Atomic Energy, which has for many years been producing weapons-grade plutonium. Transuranic elements have been detected not only in the soil and sediment of the river but also in the biomass of aquatic plants. This work is an investigation of accumulation and release of {sup 241}Am by a submerged macrophyte of the Yenisei River (Elodea canadensis) in laboratory experiments. In 2000-2003, laboratory experiments were carried out with biomass of E. canadensis Mich. and filtered river water. The samples were collected from the Yenisei River upstream of the discharge of the Combine's radioactive effluent. The experiments showed that {sup 241}Am is accumulated by Elodea biomass: the activity concentration of {sup 241}Am can reach 3280 {+-} 240 Bq/g, with the concentration factor for {sup 241}Am 16 600 {+-} 2200 l/kg. Results of chemical fractionation have proved that in the course of {sup 241}Am accumulation by Elodea biomass, {sup 241}Am tightly bound to biomass increases from 11% to 27% of the total {sup 241}Am in the biomass. Release of {sup 241}Am from the decaying Elodea biomass has been evaluated experimentally. By the end of the experiment (lasting up to 127 days), the Elodea plants had lost up to 65% of their initial {sup 241}Am activity and the rate of {sup 241}Am release into the water environment reached 23 Bq/day.

  2. Detection of fallout 241Am in U.S. Atlantic salt marsh soils

    Science.gov (United States)

    Boyd, B. M.; Sommerfield, C. K.

    2017-09-01

    We report the presence of the fallout radionuclide 241Am (t1/2 = 433 years) in salt marsh soils from two U.S. Atlantic estuaries and discuss its utility as a particle tracer and geochronometer. This work is motivated by the knowledge that 137Cs, the most widely used geochronometer in environmental studies, will decay to extinction during the next century. At the same time, levels of 241Am, produced by radioactive decay of fallout 241Pu, will continue to increase on Earth's surface as they have since the height of atmospheric nuclear weapons testing in the 1960s. Measurements of 241Am in soils at eighteen salt marsh locations were made by non-destructive gamma spectrometry and compared to activities of 137Cs in the same samples. Results indicate that decay of fallout 241Pu can explain the presence of 241Am in the soils, and that the activities are sufficiently high to provide meaningful chronological information with acceptable confidence limits. We achieved a detection limit of 0.28-1.47 Bq kg-1 using low-energy, planar germanium detectors and 11-55 g powderized samples. Activities of 241Am (0.08-6.44 Bq kg-1) were similar in mineral- and organic-rich marsh soils indicating that soil composition does not appear to influence the initial capture of 241Pu and retention of its 241Am progeny. Given its high affinity for fine particles, long half-life, and ease of measurement by non-destructive gamma spectrometry, 241Am has potential to serve as an alternative to 137Cs geochronometry in salt marshes and perhaps other estuarine and coastal environments.

  3. Mechanisms of gas retention and release: Experimental results for Hanford waste tanks 241-AW-101 and 241-AN-103

    Energy Technology Data Exchange (ETDEWEB)

    Rassat, S.D.; Gauglitz, P.A.; Bredt, P.R.; Mahoney, L.A.; Forbes, S.V.; Tingey, S.M.

    1997-09-01

    The 177 storage tanks at Hanford contain a vast array of radioactive waste forms resulting, primarily, from nuclear materials processing. Through radiolytic, thermal, and other decomposition reactions of waste components, gaseous species including hydrogen, ammonia, and the oxidizer nitrous oxide are generated within the waste tanks. Many of these tanks are known to retain and periodically release quantities of these flammable gas mixtures. The primary focus of the Flammable Gas Project is the safe storage of Hanford tank wastes. To this end, we strive to develop an understanding of the mechanisms of flammable gas retention and release in Hanford tanks through laboratory investigations on actual tank wastes. These results support the closure of the Flammable Gas Unreviewed Safety Question (USQ) on the safe storage of waste tanks known to retain flammable gases and support resolution of the broader Flammable Gas Safety Issue. The overall purpose of this ongoing study is to develop a comprehensive and thorough understanding of the mechanisms of flammable gas retention and release. The first objective of the current study was to classify bubble retention and release mechanisms in two previously untested waste materials from Tanks 241-AN-103 (AN-103) and 241-AW-101 (AW-101). Results were obtained for retention mechanisms, release characteristics, and the maximum gas retention. In addition, unique behavior was also documented and compared with previously studied waste samples. The second objective was to lengthen the duration of the experiments to evaluate the role of slowing bubble growth on the retention and release behavior. Results were obtained for experiments lasting from a few hours to a few days.

  4. Mechanisms of gas retention and release: Experimental results for Hanford waste tanks 241-AW-101 and 241-AN-103

    International Nuclear Information System (INIS)

    Rassat, S.D.; Gauglitz, P.A.; Bredt, P.R.; Mahoney, L.A.; Forbes, S.V.; Tingey, S.M.

    1997-09-01

    The 177 storage tanks at Hanford contain a vast array of radioactive waste forms resulting, primarily, from nuclear materials processing. Through radiolytic, thermal, and other decomposition reactions of waste components, gaseous species including hydrogen, ammonia, and the oxidizer nitrous oxide are generated within the waste tanks. Many of these tanks are known to retain and periodically release quantities of these flammable gas mixtures. The primary focus of the Flammable Gas Project is the safe storage of Hanford tank wastes. To this end, we strive to develop an understanding of the mechanisms of flammable gas retention and release in Hanford tanks through laboratory investigations on actual tank wastes. These results support the closure of the Flammable Gas Unreviewed Safety Question (USQ) on the safe storage of waste tanks known to retain flammable gases and support resolution of the broader Flammable Gas Safety Issue. The overall purpose of this ongoing study is to develop a comprehensive and thorough understanding of the mechanisms of flammable gas retention and release. The first objective of the current study was to classify bubble retention and release mechanisms in two previously untested waste materials from Tanks 241-AN-103 (AN-103) and 241-AW-101 (AW-101). Results were obtained for retention mechanisms, release characteristics, and the maximum gas retention. In addition, unique behavior was also documented and compared with previously studied waste samples. The second objective was to lengthen the duration of the experiments to evaluate the role of slowing bubble growth on the retention and release behavior. Results were obtained for experiments lasting from a few hours to a few days

  5. 49 CFR 241.13 - Prohibition against track owner's requiring or permitting use of its line for a railroad...

    Science.gov (United States)

    2010-10-01

    ... OF UNITED STATES RAIL OPERATIONS § 241.13 Prohibition against track owner's requiring or permitting... for compliance with this section and subject to civil penalties under § 241.15. A common carrier by...

  6. Methodology for the Inventory and Assessment of Americium Contamination Level in 1987 in an Area of Palomares Contaminated with Plutonium Weapon Grade

    International Nuclear Information System (INIS)

    Espinosa, A.; Aragon, A.; Cruz de la, B.

    2001-01-01

    This paper presents a methodology applied for the assessment of the ''241 Am coming from the decay of ''241 Pu isotope content in a contaminated area of Palomares, where the clean-up work done in 1966, given the negligible agricultural importance of such area at the time and its geographical characteristics, was not of the same magnitude as for the rest of the region. (Author) 4 refs

  7. Determining the americium transmutation rate and fission rate by post-irradiation examination within the scope of the ECRIX-H experiment

    Energy Technology Data Exchange (ETDEWEB)

    Lamontagne, J., E-mail: jerome.lamontagne@cea.fr [Commissariat à l’énergie atomique et aux énergies alternatives (CEA), DEN, DEC, Cadarache, F-13108 St. Paul Lez Durance (France); Pontillon, Y. [Commissariat à l’énergie atomique et aux énergies alternatives (CEA), DEN, DEC, Cadarache, F-13108 St. Paul Lez Durance (France); Esbelin, E. [CEA, DEN, DRCP, Marcoule, F-30207 Bagnols-sur-Cèze (France); Béjaoui, S.; Pasquet, B. [Commissariat à l’énergie atomique et aux énergies alternatives (CEA), DEN, DEC, Cadarache, F-13108 St. Paul Lez Durance (France); Bourdot, P. [CEA, DEN, DER, Cadarache, F-13108 St. Paul Lez Durance (France); Bonnerot, J.M. [Commissariat à l’énergie atomique et aux énergies alternatives (CEA), DEN, DEC, Cadarache, F-13108 St. Paul Lez Durance (France)

    2013-09-15

    The ECRIX-H experiment aims to assess the feasibility of transmuting americium micro-dispersed in an inert magnesia matrix under a locally moderated neutron flux in the Phénix reactor. A first set of examinations demonstrated that pellet behaviour was satisfactory with moderate swelling at the end of the irradiation. Additional post-irradiation examinations needed to be conducted to confirm the high transmutation rate so as to definitively conclude on the success of the ECRIX-H experiment. This article presents and discusses the results of these new examinations. They confirm the satisfactory behaviour of the MgO matrix not only during the basic irradiation but also during post-irradiation thermal transients. These examinations also provide additional information on the behaviour of fission products both in the americium-based particles and in the MgO matrix. These results particularly validate the transmutation rate predicted by the calculation codes using several different analytical techniques. The fission rate is also determined.

  8. Analytical performance of radiochemical method for americium determination in urine; Desempenho analitico do metodo radioquimico para determinacao de americio em urina

    Energy Technology Data Exchange (ETDEWEB)

    Barreto, Juliana Ferreira; Carneiro, Janete C.G. [Instituto de Pesquisas Energeticas e Nucleares (IPEN), Sao Paulo, SP (Brazil)]. E-mail: ju_barreto@terra.com.br

    2005-07-01

    This paper presents an analytical method developed and adapted for separation and analysis of Plutonium (Pu) isotopes and Americium (Am) in urine samples. The proposed method will attend the demand of internal exposure monitoring program for workers involved mainly with dismantling rods and radioactive smoke detectors. In this experimental procedure four steps are involved as preparation of samples, sequential radiochemical separation, preparation of the source for electroplating and quantification by alpha spectrometry. In the first stage of radiochemical separation, plutonium is conventionally isolated employing the anion exchange technique. Americium isolation is achieved sequentially by chromatographic extraction (Tru.spec column) from the load and rinse solutions coming from the anion exchange column. The {sup 243}Am tracer is added into the sample as chemical yield monitors and to correct the results improving the precision and accuracy. The mean recovery obtained is 60%, and the detection limit for 24h urine sample is 1.0 mBq L{sup -1} in accordance with the literature. Based in the preliminary results, the method is appropriate to be used in monitoring programme of workers with a potential risk of internal contamination. (author)

  9. Results of shear studies with 241-AY-101 sludge

    International Nuclear Information System (INIS)

    WARRANT, R.W.

    2001-01-01

    The Department of Energy's Tanks Focus Area (TFA) authorized a project to study the effect of shear on the settling properties of high-level waste sludge to support retrieval programs. A series of settling studies was conducted on a composite sample of tank 241-AY-101 (AY-101) material. Comparisons were made with duplicate samples that were sheared with a tissue homogenizer and allowed to settle. Aliquots of sheared and unsheared settled solids were submitted for chemical and radiological analyses. There are five major conclusions from the study that apply to AY-101 sludge: (1) Sludge settling rates are detectably decreased after shearing of particles by means of a tissue homogenizer. A significant decrease in the settling rates was measured after 2 minutes of shearing. A smaller additional decrease in the settling rates was observed after an additional 10 minutes of shearing. (2) Sodium and Cesium appear to be present in both the liquid and solid phases of the composite sample. (3) The shearing of the solids does not appear to significantly change the distribution of the radionuclides, ( 241 Am, 90 Sr, Total Alpha, or other radionuclides), within the solids. (4) The mean particle diameter decreases after shearing with the tissue homogenizer and affects the settling rate in proportion to the square of the particle diameter. (5) The sonication of the unsheared particles produces a similar particle size reduction to that of shearing with a tissue homogenizer. It is difficult to quantitatively compare the shear produced by a mixer pump installed in a double-shell tank with that produced by the tissue homogenizer in the laboratory. On a qualitative basis, the mixing pump would be expected to have less mechanical and more hydraulic shearing effect than the tissue homogenizer. Since the particle size distribution studies indicate that (for the AY-101 solids) the breaking up of particle aggregates is the main means of particle size reduction, then the hydraulic shearing

  10. Tank 241-Z-361 vapor sampling and analysis plan

    Energy Technology Data Exchange (ETDEWEB)

    BANNING, D.L.

    1999-02-23

    Tank 241-Z-361 is identified in the Hanford Federal Facility Agreement and Consent Order (commonly referred to as the Tri-Party Agreement), Appendix C, (Ecology et al. 1994) as a unit to be remediated under the authority of the Comprehensive Environmental Response, Compensation, and Liability Act of 1980 (CERCLA). As such, the U.S. Environmental Protection Agency will serve as the lead regulatory agency for remediation of this tank under the CERCLA process. At the time this unit was identified as a CERCLA site under the Tri-Party Agreement, it was placed within the 200-ZP-2 Operable Unit. In 1997, The Tri-parties redefined 200 Area Operable Units into waste groupings (Waste Site Grouping for 200 Areas Soils Investigations [DOE-RL 1992 and 1997]). A waste group contains waste sites that share similarities in geological conditions, function, and types of waste received. Tank 241-Z-361 is identified within the CERCLA Plutonium/Organic-rich Process Condensate/Process Waste Group (DOE-RL 1992). The Plutonium/Organic-rich Process Condensate/Process Waste Group has been prioritized for remediation beginning in the year 2004. Results of Tank 216-Z-361 sampling and analysis described in this Sampling and Analysis Plan (SAP) and in the SAP for sludge sampling (to be developed) will determine whether expedited response actions are required before 2004 because of the hazards associated with tank contents. Should data conclude that remediation of this tank should occur earlier than is planned for the other sites in the waste group, it is likely that removal alternatives will be analyzed in a separate Engineering Evaluation/Cost Analysis (EE/CA). Removal actions would proceed after the U.S. Environmental Protection Agency (EPA) signs an Action Memorandum describing the selected removal alternative for Tank 216-Z-361. If the data conclude that there is no immediate threat to human health and the environment from this tank, remedial actions for the tank will be defined in a

  11. Tank 241-T-201, core 192 analytical results for the final report

    Energy Technology Data Exchange (ETDEWEB)

    Nuzum, J.L.

    1997-08-07

    This document is the final laboratory report for Tank 241-T-201. Push mode core segments were removed from Riser 3 between April 24, 1997, and April 25, 1997. Segments were received and extruded at 222-S Laboratory. Analyses were performed in accordance with Tank 241-T-201 Push Mode Core Sampling and Analysis Plan (TSAP) (Hu, 1997), Letter of Instruction for Core Sample Analysis of Tanks 241-T-201, 241-T-202, 241-T-203, and 241-T-204 (LOI) (Bell, 1997), Additional Core Composite Sample from Drainable Liquid Samples for Tank 241-T-2 01 (ACC) (Hall, 1997), and Safety Screening Data Quality Objective (DQO) (Dukelow, et al., 1995). None of the subsamples submitted for total alpha activity (AT) or differential scanning calorimetry (DSC) analyses exceeded the notification limits stated in DQO. The statistical results of the 95% confidence interval on the mean calculations are provided by the Tank Waste Remediation Systems Technical Basis Group, and are not considered in this report.

  12. Pore Water Extraction Test Near 241-SX Tank Farm at the Hanford Site, Washington, USA

    International Nuclear Information System (INIS)

    Eberlein, Susan J.; Parker, Danny L.; Tabor, Cynthia L.; Holm, Melissa J.

    2013-01-01

    A proof-of-principle test is underway near the Hanford Site 241-SX Tank Farm. The test will evaluate a potential remediation technology that will use tank farm-deployable equipment to remove contaminated pore water from vadose zone soils. The test system was designed and built to address the constraints of working within a tank farm. Due to radioactive soil contamination and limitations in drilling near tanks, small-diameter direct push drilling techniques applicable to tank farms are being utilized for well placement. To address space and weight limitations in working around tanks and obstacles within tank farms, the above ground portions of the test system have been constructed to allow deployment flexibility. The test system utilizes low vacuum over a sealed well screen to establish flow into an extraction well. Extracted pore water is collected in a well sump,and then pumped to the surface using a small-diameter bladder pump.If pore water extraction using this system can be successfully demonstrated, it may be possible to target local contamination in the vadose zone around underground storage tanks. It is anticipated that the results of this proof-of-principle test will support future decision making regarding interim and final actions for soil contamination within the tank farms

  13. Tank 241-AY-102 Secondary Liner Corrosion Evaluation - 14191

    Energy Technology Data Exchange (ETDEWEB)

    Boomer, Kayle D. [Washington River Protection Solutions (United States); Washenfelder, Dennis J. [Washington River Protection Solutions (United States); Johnson, Jeremy M. [Department of Energy, Washington, DC (United States). Office of River Protection

    2014-01-07

    In October 2012, Washington River Protection Solutions, LLC (WRPS) determined that the primary tank of 241-AY-102 (AY-102) was leaking. A number of evaluations were performed after discovery of the leak which identified corrosion from storage of waste at the high waste temperatures as one of the major contributing factors in the failure of the tank. The propensity for corrosion of the waste on the annulus floor will be investigated to determine if it is corrosive and must be promptly removed or if it is benign and may remain in the annulus. The chemical composition of waste, the temperature and the character of the steel are important factors in assessing the propensity for corrosion. Unfortunately, the temperatures of the wastes in contact with the secondary steel liner are not known; they are estimated to range from 45 deg C to 60 deg C. It is also notable that most corrosion tests have been carried out with un-welded, stress-relieved steels, but the secondary liner in tank AY-102 was not stress-relieved. In addition, the cold weather fabrication and welding led to many problems, which required repeated softening of the metal to flatten secondary bottom during its construction. This flame treatment may have altered the microstructure of the steel.

  14. Perianal fistula: retrospective study of surgical treatment of 241 cases

    Directory of Open Access Journals (Sweden)

    Drager Luciano Ferreira

    1998-01-01

    Full Text Available Perianal fistula, usually has a criptoglandular etiology, developing from a perianal abscess and communicating the anal mucosa with the perianal skin. The aim of this paper is to study retrospectively 241 cases of perianal fistula (172 men and 69 women; 2,5:1 aging from 7 and 80 years old (average: 37,4 years, operated on at the Hospital da Clínicas - UFMG, from 1977 to 1996. The surgical techniques and post-operative outcome have been analysed. Perianal abscesses with spontaneous drainage were the predominant etiology (132 patients; 54,8%. Eighty percent were submitted to fistulectomy as the first surgical treatment. Among early complications (78; 32,4%, local pain was the most frequent (60; 24,9%. Among the late complications (136; 56,4% fistula recurrence (101; 41,9% was the most frequent. There were 141 reoperations in 80 patients. Fistulectomy was the predominant surgical technique employed for the treatment (101; 71,6%. The average hospitalization time was 6,3 days until 1990 and 1,5 day from 1991 to 1996, after the advent of day-surgery beds in HC-UFMG. The surgical treatment of perianal fístula has a significant rate of post-operative complications and a high recurrence rate, in spite of the short stay in hospital.

  15. Tank 241-AY-102 Secondary Liner Corrosion Evaluation - 14191

    International Nuclear Information System (INIS)

    Boomer, Kayle D.; Washenfelder, Dennis J.; Johnson, Jeremy M.

    2014-01-01

    In October 2012, Washington River Protection Solutions, LLC (WRPS) determined that the primary tank of 241-AY-102 (AY-102) was leaking. A number of evaluations were performed after discovery of the leak which identified corrosion from storage of waste at the high waste temperatures as one of the major contributing factors in the failure of the tank. The propensity for corrosion of the waste on the annulus floor will be investigated to determine if it is corrosive and must be promptly removed or if it is benign and may remain in the annulus. The chemical composition of waste, the temperature and the character of the steel are important factors in assessing the propensity for corrosion. Unfortunately, the temperatures of the wastes in contact with the secondary steel liner are not known; they are estimated to range from 45 deg C to 60 deg C. It is also notable that most corrosion tests have been carried out with un-welded, stress-relieved steels, but the secondary liner in tank AY-102 was not stress-relieved. In addition, the cold weather fabrication and welding led to many problems, which required repeated softening of the metal to flatten secondary bottom during its construction. This flame treatment may have altered the microstructure of the steel

  16. [Evaluation of the understanding of sun risk among 241 adolescents].

    Science.gov (United States)

    Michel, J L; Magant, E

    2000-04-01

    We investigated adolescent's knowledge of the consequences of sun exposure in order to determine what preventive measures would be effective. A questionnaire was given to 241 adolescents (111 girls and 130 boys) aged 13 to 15 years whose background included all social occupational categories. The questionnaire included 21 open response items. We also interviewed 100 adolescents 3 months after an information session with a 1-hour slide presentation. Eighty-five percent of the girls and 62 p. 100 of the boys said they exposed themselves to sun regularly. For 50 p. 100 of the adolescents, sun exposure occurred between 12 noon and 4 p.m. Less than 9 p. 100 knew that this period corresponds to maximal sunlight intensity and that maximal photoprotection is necessary. Only 47 p. 100 of the girls and 25 p. 100 of the boys regularly used protective skin lotions. Twenty-five percent of the girls used a lotion adapted to their phototype and 8 p. 100 of the boys. Twenty percent of the adolescents questioned were aware that applications should be repeated every 2 hours or after bathing. The cost of skin lotions was never cited as a limiting factor for their use. More than 90 p. 100 of the adolescents gave correct responses at the second test. Our study demonstrated that the risk of sun exposure is largely unrecognized by adolescents and that they have very incomplete information concerning protective measures. An adapted information program would be useful for this risk population.

  17. Acceptance test report for 241-AW process air system

    International Nuclear Information System (INIS)

    Kostelnik, A.J.

    1994-01-01

    The acceptance test procedure (ATP) for the compressed air system at building 241-AW-273 was completed on March 11, 1993. The system was upgraded to provide a reliable source of compressed air to the tank farm. The upgrade included the demolition of the existing air compressor and associated piping, as well as the installation of a new air compressor with a closed loop cooling system. A compressed air cross-tie was added to allow the process air compressor to function as a back-up to the existing instrument air compressor. The purpose of the ATP was to achieve three primary objectives: verify system upgrade in accordance with the design media; provide functional test of system components and controls; and prepare the system for the Operational Test. The ATP was successfully completed with thirteen exceptions, which were resolved prior to completing the acceptance test. The repaired exceptions had no impact to safety or the environment and are briefly summarized. Testing ensured that the system was installed per design, that its components function as required and that it is ready for operational testing and subsequent turnover to operations

  18. Tank 241-C-106 waste retrieval sluicing system process control plan

    International Nuclear Information System (INIS)

    Carothers, K.G.

    1998-01-01

    Project W-320 has installed the Waste Retrieval Sluicing System at the 200 East Area on the Hanford Site to retrieve the sludge from single-shell tank 241-C-106 and transfer it into double-shell tank 241-AY-102. Operation of the WRSS process will resolve the high-heat safety issue for tank 241-C-106 and demonstrate a technology for the retrieval of single-shell tank wastes. This process control plan coordinates the technical operating requirements (primarily mass transfer, temperature, and flammable gas) for the sluicing operation and provides overall technical guidance for the retrieval activity

  19. Tank 241-S-102, Core 232 analytical results for the final report

    Energy Technology Data Exchange (ETDEWEB)

    STEEN, F.H.

    1998-11-04

    This document is the analytical laboratory report for tank 241-S-102 push mode core segments collected between March 5, 1998 and April 2, 1998. The segments were subsampled and analyzed in accordance with the Tank 241-S-102 Retained Gas Sampler System Sampling and Analysis Plan (TSAP) (McCain, 1998), Letter of Instruction for Compatibility Analysis of Samples from Tank 241-S-102 (LOI) (Thompson, 1998) and the Data Quality Objectives for Tank Farms Waste Compatibility Program (DQO) (Mulkey and Miller, 1998). The analytical results are included in the data summary table (Table 1).

  20. Tank 241-C-106 waste retrieval sluicing system process control plan

    Energy Technology Data Exchange (ETDEWEB)

    Carothers, K.G.

    1998-07-25

    Project W-320 has installed the Waste Retrieval Sluicing System at the 200 East Area on the Hanford Site to retrieve the sludge from single-shell tank 241-C-106 and transfer it into double-shell tank 241-AY-102. Operation of the WRSS process will resolve the high-heat safety issue for tank 241-C-106 and demonstrate a technology for the retrieval of single-shell tank wastes. This process control plan coordinates the technical operating requirements (primarily mass transfer, temperature, and flammable gas) for the sluicing operation and provides overall technical guidance for the retrieval activity.

  1. Operational test report for the 241-A-701 air compressor upgrade

    International Nuclear Information System (INIS)

    Meeuwsen, W.E.

    1997-01-01

    A description and safety class designation of the accumulator and 701-A compressor system is contained in VTHC-SD-at sign-DA-137, Safety Classification (of the 241-A-70) Compressed Air System and shown on drawings H-2-62895, Sheet 2 and H-14-20308, Sheet 3. The design basis for the 241-A-702 Ventilation System Accumulator is contained in at sign-C-SD-at sign-DB-016, 241-A-702 Ventilation System Accumulator Design Basis

  2. Tank 241-S-102, Core 232 analytical results for the final report

    International Nuclear Information System (INIS)

    STEEN, F.H.

    1998-01-01

    This document is the analytical laboratory report for tank 241-S-102 push mode core segments collected between March 5, 1998 and April 2, 1998. The segments were subsampled and analyzed in accordance with the Tank 241-S-102 Retained Gas Sampler System Sampling and Analysis Plan (TSAP) (McCain, 1998), Letter of Instruction for Compatibility Analysis of Samples from Tank 241-S-102 (LOI) (Thompson, 1998) and the Data Quality Objectives for Tank Farms Waste Compatibility Program (DQO) (Mulkey and Miller, 1998). The analytical results are included in the data summary table (Table 1)

  3. 241-AP Tank Farm Construction Extent of Condition Review for Tank Integrity

    Energy Technology Data Exchange (ETDEWEB)

    Barnes, Travis J.; Gunter, Jason R.; Reeploeg, Gretchen E.

    2014-04-04

    This report provides the results of an extent of condition construction history review for the 241-AP tank farm. The construction history of the 241-AP tank farm has been reviewed to identify issues similar to those experienced during tank AY-102 construction. Those issues and others impacting integrity are discussed based on information found in available construction records, using tank AY-102 as the comparison benchmark. In the 241-AP tank farm, the sixth double-shell tank farm constructed, tank bottom flatness, refractory material quality, post-weld stress relieving, and primary tank bottom weld rejection were improved.

  4. Salicylic acid failed to increase the efficacy of Ca-DTPA in the decorporation of plutonium and americium

    International Nuclear Information System (INIS)

    Jones, C.W.; Lloyd, R.D.; Mays, C.W.

    1979-01-01

    Male and female C57BL/Do mice were each given a single i.p. injection of 237+239 Pu + 241 Am as the citrate complex at 45 days of age. Twice weekly i.p. injecctions of either 500 μmol/kg Ca-DTPA or 500 μmol/kg Ca-DTPA, mixed just before injection with 2000 μmol/kg salicylic acid (SA), were begun 3 days after nuclide administration and continued for 5 weeks. Control mice were injected each time with isotonic saline. Nuclide retention was determined by in vivo counting using NaI(T1) spectrometry. At the end of treatment, total-body retention of Pu or Am in the mice given Ca-DTPA was significantly lower (P < 0.001) than in the control animals. Mice treated with Ca-DTPA + SA were statistically indistinguishable from mice treated with Ca-DTPA

  5. Artificial radioactivity and marine environment. Study of 238Pu, 239Pu+240Pu, 241Pu and 241Am in the Mediterranean sea

    International Nuclear Information System (INIS)

    Ballestra, Serge.

    1980-10-01

    This paper is in two parts. Part one is about the methods for analyzing transuranium elements particularly the development of an analytical process for plutonium and for perfecting an Americium analyzing method, capable of treating samples of 200 litres of sea water, 100 grams of sediment and 100 grams of biological matter. Part two concerns the in situ determinations carried out within the scope of the study on the distribution and behaviour of transuranium elements in the Mediterranean sea. The high sea studies concerned the effects of atmospheric fall out and the vertical distribution of Pu and Am. Studies along the coasts enabled a quantitative study to be made of the contribution of rivers to the Mediterranean and to study the distribution of Pu along the French Mediterranean coast line [fr

  6. Radioactive air emissions notice of construction for installation and operation of a waste retrieval system and tanks 241-AP-102 and 241-AP-104 project

    International Nuclear Information System (INIS)

    DEXTER, M.L.

    1999-01-01

    This document serves as a notice of construction (NOC) pursuant to the requirements of Washington Administrative Code (WAC) 246 247-060, and as a request for approval to modify pursuant to 40 Code of Federal Regulations (CFR) 61 07 for the installation and operation of one waste retrieval system in the 24 1 AP-102 Tank and one waste retrieval system in the 241 AP 104 Tank Pursuant to 40 CFR 61 09 (a)( 1) this application is also intended to provide anticipated initial start up notification Its is requested that EPA approval of this application will also constitute EPA acceptance of the initial start up notification Project W 211 Initial Tank Retrieval Systems (ITRS) is scoped to install a waste retrieval system in the following double-shell tanks 241-AP 102-AP 104 AN 102, AN 103, AN-104, AN 105, AY 102 AZ 102 and SY-102 between now and the year 2011. Because of the extended installation schedules and unknowns about specific activities/designs at each tank, it was decided to submit NOCs as that information became available This NOC covers the installation and operation of a waste retrieval system in tanks 241 AP-102 and 241 AP 104 Generally this includes removal of existing equipment installation of new equipment and construction of new ancillary equipment and buildings Tanks 241 AP 102 and 241 AP 104 will provide waste feed for immobilization into a low activity waste (LAW) product (i.e. glass logs) The total effective dose equivalent (TEDE) to the offsite maximally exposed individual (MEI) from the construction activities is 0 045 millirem per year The unabated TEDE to the offsite ME1 from operation of the mixer pumps is 0 042 millirem per year

  7. Biological effects of α-radiation exposure by 241Am in Arabidopsis thaliana seedlings are determined both by dose rate and 241Am distribution

    International Nuclear Information System (INIS)

    Biermans, Geert; Horemans, Nele; Vanhoudt, Nathalie; Vandenhove, Hildegarde; Saenen, Eline; Van Hees, May; Wannijn, Jean; Vangronsveld, Jaco; Cuypers, Ann

    2015-01-01

    Human activity has led to an increasing amount of radionuclides in the environment and subsequently to an increased risk of exposure of the biosphere to ionising radiation. Due to their high linear energy transfer, α-emitters form a threat to biota when absorbed or integrated in living tissue. Among these, 241 Am is of major concern due to high affinity for organic matter and high specific activity. This study examines the dose-dependent biological effects of α-radiation delivered by 241 Am at the morphological, physiological and molecular level in 14-day old seedlings of Arabidopsis thaliana after hydroponic exposure for 4 or 7 days. Our results show that 241 Am has high transfer to the roots but low translocation to the shoots. In the roots, we observed a transcriptional response of reactive oxygen species scavenging and DNA repair pathways. At the physiological and morphological level this resulted in a response which evolved from redox balance control and stable biomass at low dose rates to growth reduction, reduced transfer and redox balance decline at higher dose rates. This situation was also reflected in the shoots where, despite the absence of a transcriptional response, the control of photosynthesis performance and redox balance declined with increasing dose rate. The data further suggest that the effects in both organs were initiated in the roots, where the highest dose rates occurred, ultimately affecting photosynthesis performance and carbon assimilation. Though further detailed study of nutrient balance and 241 Am localisation is necessary, it is clear that radionuclide uptake and distribution is a major parameter in the global exposure effects on plant performance and health. - Highlights: • Arabidopsis thaliana was exposed hydroponically to a range of 241 Am concentrations. • Effects at molecular, morphological and physiological level were observed. • Effects were dependent on both dose rate and 241 Am distribution.

  8. Tank 241-A-101 cores 154 and 156 analytical results for the final report

    Energy Technology Data Exchange (ETDEWEB)

    Steen, F.H.

    1997-05-02

    This report contains tables of the analytical results from sampling Tank 241-A-101 for the following: fluorides, chlorides, nitrites, bromides, nitrates, phosphates, sulfates, and oxalates. This tank is listed on the Hydrogen Watch List.

  9. Acceptance test report for the 241-SY-101 Flexible Receiver Gamma Detector System

    International Nuclear Information System (INIS)

    Dowell, J.L.

    1995-01-01

    This Acceptance Test Report is for the 241-SY-101 Flexible Receiver Gamma Detector System. This test verified that the data logger and data converter for the gamma detector system functions as intended

  10. Tank characterization report for double-shell tank 241-SY-103

    International Nuclear Information System (INIS)

    Conner, J.M.

    1996-01-01

    This document summarizes the information on the historical uses, present status, and the sampling and analysis results of waste stored in tank 241-SY-103. This report supports the requirements of Tri-Party Agreement Milestone M-44 09

  11. A discussion on the safety classification of the tank 241-SY-101 mixer pump

    International Nuclear Information System (INIS)

    Van Vleet, R.J.

    1997-01-01

    An analysis, consistent with the methodology used in the draft TWRS FSAR (HNF-SD-WM-SAR-067), is presented to show that the classification of the mixer pump in tank 241-SY-101 should be safety significant

  12. Tank characterization report for single-shell tank 241-B-101

    International Nuclear Information System (INIS)

    Schreiber, R.D.

    1996-01-01

    This document summarizes the information on the historical uses, present status, and the sampling and analysis results of waste stored in tank 241-B-101. This report supports the requirements of Tri-Party Agreement Milestone M-44-09

  13. Tank characterization report for single-shell tank 241-B-201

    Energy Technology Data Exchange (ETDEWEB)

    Conner, J.M., Fluor Daniel Hanford

    1997-02-03

    This document summarizes the information on the historical uses, present status, and the sampling and analysis results of waste stored in Tank 241-B-201. This report supports the requirements of the Ri- Party Agreement Milestone M-44-05.

  14. The association of XRCC3 Thr241Met genetic variant with risk of ...

    African Journals Online (AJOL)

    complementing group 3 gene (XRCC3) Thr241Met genetic variant could be potentially associated with the risk of prostate cancer. However, results from these published studies were conflicting rather than conclusive. Objectives:This meta-analysis ...

  15. Tank characterization report for single-shell tank 241-B-107

    International Nuclear Information System (INIS)

    Conner, J.M.

    1998-01-01

    This document summarizes the information on the historical uses, present status, and the sampling and analysis results of waste stored in Tank 241-B-107. This report supports the requirements of the Tri-Party Agreement Milestone M-44-ISB

  16. Tank characterization report for single-shell tank 241-T-104

    Energy Technology Data Exchange (ETDEWEB)

    Sasaki, L.M., Fluor Daniel Hanford

    1997-02-04

    This document summarizes the information on the historical uses, present status, and the sampling and analysis results of waste stored in Tank 241-T-104. This report supports the requirements of the Tri- Party Agreement Milestone M-44-05.

  17. Vertical distribution of (241)Pu in the southern Baltic Sea sediments.

    Science.gov (United States)

    Strumińska-Parulska, Dagmara I

    2014-12-15

    The vertical distribution of plutonium (241)Pu in marine sediments can assist in determining the deposition history and sedimentation process of analyzed regions. In addition, (241)Pu/(239+240)Pu activity ratio could be used as a sensitive fingerprint for radioactive source identification. The present preliminary studies on vertical distribution of (241)Pu in sediments from four regions of the southern Baltic Sea are presented. The distribution of (241)Pu was not uniform and depended on sediment geomorphology and depth as well as location. The highest concentrations of plutonium were found in the surface layers of all analyzed sediments and originated from the Chernobyl accident. Copyright © 2014 Elsevier Ltd. All rights reserved.

  18. Tank 241-U-105 push mode core sampling and analysis plan

    International Nuclear Information System (INIS)

    Bell, K.E.

    1995-01-01

    This Sampling and Analysis Plan (SAP) will identify characterization objectives pertaining to sample collection, laboratory analytical evaluation, and reporting requirements for vapor samples and two push mode core samples from tank 241-U-105 (U-105)

  19. Tank characterization report for single-shell tank 241-C-204

    International Nuclear Information System (INIS)

    Conner, J.M.

    1996-01-01

    This document summarizes the information on the historical uses, present status, and the sampling and analysis results of waste stored in Tank 241-C-204. This report supports the requirements of Tri Party Agreement Milestone M 44 09

  20. Design basis and requirements for 241-SY Modular Exhauster concrete pad and retaining wall

    International Nuclear Information System (INIS)

    Kriskovich, J.R.

    1994-01-01

    The purpose of this document is to serve as the design and functional requirements for a concrete pad for the new 241-SY Modular Exhauster and for a retaining wall to be built near the new ventilation systems