WorldWideScience

Sample records for allura red ac

  1. Extraction, Analytical and Advanced Methods for Detection of Allura Red AC (E129) in Food and Beverages Products

    Science.gov (United States)

    Rovina, Kobun; Siddiquee, Shafiquzzaman; Shaarani, Sharifudin M.

    2016-01-01

    Allura Red AC (E129) is an azo dye that widely used in drinks, juices, bakery, meat, and sweets products. High consumption of Allura Red has claimed an adverse effects of human health including allergies, food intolerance, cancer, multiple sclerosis, attention deficit hyperactivity disorder, brain damage, nausea, cardiac disease and asthma due to the reaction of aromatic azo compounds (R = R′ = aromatic). Several countries have banned and strictly controlled the uses of Allura Red in food and beverage products. This review paper is critically summarized on the available analytical and advanced methods for determination of Allura Red and also concisely discussed on the acceptable daily intake, toxicology and extraction methods. PMID:27303385

  2. Spectrophotometric and theoretical studies of the protonation of Allura Red AC and Ponceau 4R

    Science.gov (United States)

    Bevziuk, Kateryna; Chebotarev, Alexander; Snigur, Denys; Bazel, Yaroslav; Fizer, Maksym; Sidey, Vasyl

    2017-09-01

    The acid-base properties of Allura Red AC and Ponceau 4R azo dyes were investigated by spectrophotometric, potentiometric and tristimulus colourimetry methods. Ionization constants of the functional groups were also found in aqueous solutions of the dyes. It was discovered that the wavelength of the maximum light absorption of Allura Red AC and Ponceau 4R solutions does not change significantly over a wide pH range. As a result, spectrophotometric methods yield little information for assessing the acid-base properties of the dyes. It was shown with a help of the tristimulus colourimetry method that it is possible to determine the ionization constants of the functional groups of the dyes even when there is significant overlap of the absorption bands of the acid-base forms. The basic spectrophotometric characteristics of the main forms of Allura Red AC and Ponceau 4R in water and organic solvents were calculated. The molar absorbance coefficients of azo forms were shown to increase as the dielectric permittivity of the solvent increases. It was determined that in aqueous solution the dyes exist in the azo form over a wide range of acidity - pH 2-12 for Allura Red AC (λmax = 505 nm; ελ = 3.1·104 dm3 mol-1 cm-1) and 1-13 for Ponceau 4R (λmax = 510 nm; ελ = 1.7·10-4 dm3 mol-1 cm-1). The most probable protonation/deprotonation schemes were theoretically determined for Allura Red AC and Ponceau 4R using DFT calculations.

  3. Extraction, Analytical and Advanced Methods for Detection of Allura Red AC (E129 in Food and Beverages Products

    Directory of Open Access Journals (Sweden)

    Shafiquzzaman eSiddiquee

    2016-05-01

    Full Text Available Allura Red AC (E129 is an azo dye that widely used in drinks, juices, bakery, meat and sweets products. High consumption of Allura Red has claimed an adverse effects of human health including allergies, food intolerance, cancer, multiple sclerosis, attention deficit hyperactivity disorder (ADHD, brain damage, nausea, cardiac disease and asthma due to the reaction of aromatic azo compounds (R = R' = aromatic. Several countries have banned and strictly controlled the uses of Allura Red in food and beverage products. This review paper is critically summarized on the available analytical and advanced methods for determination of Allura Red and also concisely discussed on the acceptable daily intake (ADI, toxicology and extraction methods.

  4. Decolorization and mineralization of Allura Red AC aqueous solutions by electrochemical advanced oxidation processes

    International Nuclear Information System (INIS)

    Thiam, Abdoulaye; Sirés, Ignasi; Garrido, José A.; Rodríguez, Rosa M.; Brillas, Enric

    2015-01-01

    Highlights: • Quicker degradation of Allura Red AC in the order EO-H 2 O 2 < EF < PEF with Pt or BDD anode. • Almost total mineralization achieved by the most powerful PEF process with BDD. • Similar decolorization and mineralization rate in SO 4 2− , ClO 4 − and NO 3 − media. • In Cl − medium, only slightly larger decolorization rate but strong inhibition of mineralization. • Identification of aromatic products, carboxylic acids and released NH 4 + , NO 3 − and SO 4 2− ions. - Abstract: The decolorization and mineralization of solutions containing 230 mg L −1 of the food azo dye Allura Red AC at pH 3.0 have been studied upon treatment by electrochemical oxidation with electrogenerated H 2 O 2 (EO-H 2 O 2 ), electro-Fenton (EF) and photoelectro-Fenton (PEF). Experiments were performed with a stirred tank reactor containing a boron-doped diamond (BDD) or Pt anode and an air-diffusion cathode to generate H 2 O 2 . The main oxidants were hydroxyl radicals formed at the anode surface from water oxidation and in the bulk from Fenton’s reaction between H 2 O 2 and added Fe 2+ . The oxidation ability increased in the sequence EO-H 2 O 2 < EF < PEF and faster degradation was always obtained using BDD. PEF process with BDD yielded almost total mineralization following similar trends in SO 4 2− , ClO 4 − and NO 3 − media, whereas in Cl − medium, mineralization was inhibited by the formation of recalcitrant chloroderivatives. GC–MS analysis confirmed the cleavage of the −N=N− bond with formation of two main aromatics in SO 4 2− medium and three chloroaromatics in Cl − solutions. The effective oxidation of final oxalic and oxamic acids by BDD along with the photolysis of Fe(III)-oxalate species by UVA light accounted for the superiority of PEF with BDD. NH 4 + , NO 3 − and SO 4 2− ions were released during the mineralization

  5. Negatively charged food additive dye "Allura Red" rapidly induces SDS-soluble amyloid fibril in beta-lactoglobulin protein.

    Science.gov (United States)

    Al-Shabib, Nasser Abdulatif; Khan, Javed Masood; Malik, Ajamaluddin; Alsenaidy, Abdulrahman M; Alsenaidy, Mohammad A; Husain, Fohad Mabood; Shamsi, Monis Bilal; Hidayathulla, Syed; Khan, Rizwan Hasan

    2018-02-01

    Recent studies have led to an increased interest to categorize small molecular inhibitors of protein fibrillation. In this study, we used spectroscopy, microscopy and gel electrophoresis techniques that provides an elaborated description of the Allura Red-induced amyloid fibrillation in the β-LG protein at two pHs (7.4 and 3.5). The spectroscopy results show that β-LG protein form aggregates in the presence of Allura Red (0.04-15.0mM) at pH 3.5 due to electrostatic and hydrophobic interactions. However, at pH 7.4, the β-LG does not interact electrostatically with Allura Red and therefore no aggregation occurred. The Allura Red-induced aggregates have an amyloid-like structure that was confirmed by far-UV CD, Congo Red and transmission electron microscopy (TEM). The CD spectrum of β-LG contains single minima at ∼218nm, which shifts towards higher wavelength minima at ∼225nm in the presence of Allura Red, characteristics of the cross β-sheet structure. The TEM results suggest that β-LG form long straight fibril when exposed to Allura Red at pH 3.5. The Allura Red-induced amyloid fibril is SDS-soluble confirmed by SDS-PAGE techniques. A far UV CD result shows the conversion of Allura Red induced cross β-sheet structure into alpha-helical structure in the presence of increasing concentration of SDS. The results of this study suggest that the electrostatic, as well as hydrophobic interactions play an important role during Allura Red-induced β-LG fibrillation. Copyright © 2017. Published by Elsevier B.V.

  6. Simultaneous determination of color additives tartrazine and allura red in food products by digital image analysis.

    Science.gov (United States)

    Vidal, Maider; Garcia-Arrona, Rosa; Bordagaray, Ane; Ostra, Miren; Albizu, Gorka

    2018-07-01

    A method based on digital image is described to quantify tartrazine (E102), yellow, and allura red (E129) colorants in food samples. HPLC is the habitual method of reference used for colorant separation and quantification, but it is expensive, time-consuming and it uses solvents, sometimes toxic. By a flatbed scanner, which can be found in most laboratories, images of mixtures of colorants can be taken in microtitration plates. Only 400 µL of sample are necessary and up to 92 samples can be measured together in the same image acquisition. A simple-to-obtain color fingerprint is obtained by converting the original RGB image into other color spaces and individual PLS models are built for each colorant. In this study, root mean square errors of 3.3 and 3.0 for tartrazine and 1.1 and 1.2 for allura red have been obtained for cross-validation and external validation respectively. Results for repeatability and reproducibility are under 12%. These results are slightly worse but comparable to the ones obtained by HPLC. The applicability of both methodologies to real food samples has proven to give the same result, even in the presence of a high concentration of an interfering species, provided that this interference is included in the image analysis calibration model. Considering the colorant content found in most samples this should not be a problem though and, in consequence, the method could be extended to different food products. Values of LODs of 1.8 mg L -1 and 0.6 mg L -1 for tartrazine and allura red have been obtained by image analysis. Copyright © 2018 Elsevier B.V. All rights reserved.

  7. ADSORPTION OF FOOD COLORING ALLURA RED DYE (E129 FROM AQUEOUS SOLUTIONS USING ACTIVATED CARBON

    Directory of Open Access Journals (Sweden)

    Saad A Alkahtani

    2017-09-01

    Full Text Available The adsorption behavior of Allura red (E129 from aqueous solutions onto activated carbon was successfully investigated. All factors affecting the adsorption process were carefully studied and the conditions were optimized. Adsorption of E129 onto activated carbon was found to increase by decreasing the mass of activated carbon, pH and ionic strength of the solution and by increasing temperature. The adsorption capacity of the activated carbon for Allura red was relatively high. Under the optimum conditions, the maximum adsorption capacity for E129 dye was 72.85 mg/g. Three adsorption models; Langmuir, Freundlich and Temkin model were investigated regarding the adsorption of E129. The models’ parameters KL, qm, R2, (n were determined and found to be 0.0222, 72.85 mg/g, 0.9057-0.9984, and 0.992, respectively. Also, pseudo first and second-order kinetic models were tested to determine the best-fit model to the adsorption of E129 dye onto activated carbon. The results showed that the adsorption of E129 onto activated carbon obeyed both the Freundlich isotherm and pseudo second-order kinetic models. Moreover, thermodynamic studies indicated that the adsorption of E129 dye onto the activated carbon was spontaneous. 

  8. Highly reproducible and sensitive silver nanorod array for the rapid detection of Allura Red in candy

    Science.gov (United States)

    Yao, Yue; Wang, Wen; Tian, Kangzhen; Ingram, Whitney Marvella; Cheng, Jie; Qu, Lulu; Li, Haitao; Han, Caiqin

    2018-04-01

    Allura Red (AR) is a highly stable synthetic red azo dye, which is widely used in the food industry to dye food and increase its attraction to consumers. However, the excessive consumption of AR can result in adverse health effects to humans. Therefore, a highly reproducible silver nanorod (AgNR) array was developed for surface enhanced Raman scattering (SERS) detection of AR in candy. The relative standard deviation (RSD) of AgNR substrate obtained from the same batch and different batches were 5.7% and 11.0%, respectively, demonstrating the high reproducibility. Using these highly reproducible AgNR arrays as the SERS substrates, AR was detected successfully, and its characteristic peaks were assigned by the density function theory (DFT) calculation. The limit of detection (LOD) of AR was determined to be 0.05 mg/L with a wide linear range of 0.8-100 mg/L. Furthermore, the AgNR SERS arrays can detect AR directly in different candy samples within 3 min without any complicated pretreatment. These results suggest the AgNR array can be used for rapid and qualitative SERS detection of AR, holding a great promise for expanding SERS application in food safety control field.

  9. Magnetic solid-phase extraction coupled with HPLC for the determination of Allura Red in food and beverage samples.

    Science.gov (United States)

    Yu, Youwei; Fan, Zhefeng

    2016-10-01

    A magnetic solid-phase extraction (MSPE) protocol prior to HPLC was developed for the extraction and determination of Allura Red in food samples. Magnetic nanoparticles were coated with tetraethylorthosilicate and 3-aminopropyltriethoxysilane and modified by graphene. Scanning electron microscopy, transmission electron microscopy and Fourier-transform infrared spectrometry were used to characterise the graphene-functionalised sorbents; and the main parameters affecting the extraction such as sample volume, temperature, pH and time were investigated and established. Under optimised conditions, the pre-concentration factor of Allura Red was 200, and the calibration curve was linear at a concentration range of 5-1500 μg kg -1 . The LOD was 2 μg kg -1 , the limit of quantification was 7 μg kg -1 , and the relative standard deviation was 3.3%. The prepared MSPE procedure was simple and fast, and it was successfully applied for the determination of Allura Red in beverages, candy and jelly.

  10. Gold Nanorods as Surface-Enhanced Raman Spectroscopy Substrates for Rapid and Sensitive Analysis of Allura Red and Sunset Yellow in Beverages.

    Science.gov (United States)

    Ou, Yiming; Wang, Xiaohui; Lai, Keqiang; Huang, Yiqun; Rasco, Barbara A; Fan, Yuxia

    2018-03-21

    Synthetic colorants in food can be a potential threat to human health. In this study, surface-enhanced Raman spectroscopy (SERS) coupled with gold nanorods as substrates is proposed to analyze allura red and sunset yellow in beverages. The gold nanorods with different aspect ratios were synthesized, and their long-term stability, SERS activity, and the effect of the different salts on the SERS signal were investigated. The results demonstrate that gold nanorods have a satisfactory stability (stored up to 28 days). SERS coupled with gold nanorods exhibit stronger sensitivity. MgSO 4 was chosen to improve the SERS signal of sunset yellow, and no salts could enhance the SERS signal of allura red. The lowest concentration was 0.10 mg/L for both colorant standard solutions. The successful prediction results using SERS were much closer to those obtained by high-performance liquid chromatography for the sample in beverages. SERS combined with gold nanorods shows potential for analyzing food colorants and other food additives as a rapid, convenient, and sensitive method.

  11. Electrochemical-assisted photodegradation of Allura Red and textile effluent using a half-exposed rotating TiO(2)/Ti disc electrode.

    Science.gov (United States)

    Xu, Yun L; Zhong, Deng J; Jia, Jin P

    2008-04-01

    In this work, a rotating photoelectrocatalytic (RPEC) reactor, using a half-exposed and half-immersed TiO(2)/Ti disc as photoanode was developed for the first time to degrade Allura Red (AR) and textile effluent. The TiO(2) film was characterised by X-ray reflection diffraction (XRD) spectra and field emission scanning electron microscope (FESEM). When AR solutions with concentrations ranging from 10 mg L(- 1) to 50 mg L(- 1)AR were treated by half-exposed disc PEC (EPEC) process for 1 hour, solution color and TOC were reduced by 36-54% and 19-33%, respectively, higher than reduction of 9-46% and 4-27% observed for the conventional PEC (CPEC) process with half TiO(2)/Ti disc immersed in solution. Similarly, solution color and TOC for textile effluent was reduced by 46% and 10% for EPEC process, respectively, higher than reduction of 26% and 2% for CPEC process. Effectiveness of the RPEC process was further demonstrated in the treatment of textile effluent and textile effluent containing 30 mgL(- 1) AR by determining change of solution color, total organic carbon (TOC), biochemical oxygen demand (BOD(5)), and chemical oxygen demand (COD). Furthermore, a long run experiment was carried out for the TiO(2)/Ti disc and almost stable photoactivity was found after 10 runs of RPEC oxidation of both AR and textile effluent. Our results indicate the proposed RPEC is effective in degrading textile wastewater, probably because the light can directly irradiate the exposed disc in air instead of through solution in the CPEC reactor.

  12. Degradation products of the artificial azo dye, Allura red, inhibit esterase activity of carbonic anhydrase II: A basic in vitro study on the food safety of the colorant in terms of enzyme inhibition.

    Science.gov (United States)

    Esmaeili, Sajjad; Ashrafi-Kooshk, Mohammad Reza; Khaledian, Koestan; Adibi, Hadi; Rouhani, Shohre; Khodarahmi, Reza

    2016-12-15

    Allura red is a widely used food colorant, but there is debate on its potential security risk. In the present study, we found that degradation products of the dye were more potent agents with higher carbonic anhydrase inhibitory action than the parent dye. The mechanism by which the compounds inhibit the enzyme activity has been determined as competitive mode. In addition, the enzyme binding properties of the compounds were investigated employing different spectroscopic techniques and molecular docking. The analyses of fluorescence quenching data revealed the existence of the same binding site for the compounds on the enzyme molecule. The thermodynamic parameters of ligand binding were not similar, which indicates that different interactions are responsible in binding of the parent dye and degradation products to the enzyme. It appears that enzyme inhibition should be considered, more seriously, as a new opened dimension in food safety. Copyright © 2016 Elsevier Ltd. All rights reserved.

  13. PENENTUAN KUANTITATIF ZAT WARNA KARMOSIN,PONCEAU 4R DAN MERAH ALURA YANG DITAMBAHKAN DALAM MINUMAN AGREM (Hibiscus sabdariffa, Linn [Quantitative Determination of Carmoisine, Ponceau 4R and Allura Red Colouring Agents Added Into Softdrink Containing the Aqueous Extract of (Hibiscus sabdariffa, Linn

    Directory of Open Access Journals (Sweden)

    Embit Kartadarma

    2007-06-01

    Full Text Available The synthetic food-colouring agent is stiil commonly used in soft drink to enhance the colour of the food and to make foods more attractive, particularly for the drink containing natural colour. Addition of colour is legally permitted by the govermment, however, the product sometime contain the substance more than the permissible maximum dosage, and it may possibly cause iillhealth to the consumer. Preparation of soft drink containing the aqueous extract of Hibiscus sabdariffa fruits gave less intense colour due to the colour. The quantity of the synthetic food colour in soft drink must be determined quantitatively for food safety and the presence of natural colour in the products may affect the results. Determination of three synthetic colouring agents, carmoisine, ponceau 4R and allura red added into soft drink containing the aqueous extract of hisbicus sabdariffa was carried out. Result showed that the determination of such colouring agents can only be achivied after adjusting the pH up to 4.5 and the recovery of carmoisine, ponceau 4R and allura red were 99.8: 100.2 and 100.0%, with the accuracy of 0.1;0.3 and 0.1% and the precission of 0.1; 0.3 and 0.1% respectively.

  14. Biochemical and functional characterization of AcUFGT3a, a galactosyltransferase involved in anthocyanin biosynthesis in the red-fleshed kiwifruit (Actinidia chinensis).

    Science.gov (United States)

    Liu, Yanfei; Zhou, Bin; Qi, Yingwei; Liu, Cuihua; Liu, Zhande; Ren, Xiaolin

    2018-04-01

    Much of the diversity of anthocyanin pigmentation in plant tissues is due to the action of glycosyltransferases, which attach sugar moieties to the anthocyanin aglycone. This step can increase both their solubility and stability. We investigated the pigmentation of the outer and inner pericarps of developing fruits of the red-fleshed kiwifruit Actinidia chinensis cv. 'Hongyang'. The results show that the red color of the inner pericarp is due to anthocyanin. Based on expression analyses of structural genes, AcUFGT was shown to be the key gene involved in the anthocyanin biosynthetic pathway. Expression of AcUFGT in developing fruit paralleled changes in anthocyanin concentration. Thirteen putative UFGT genes, including different transcripts, were identified in the genome of 'Hongyang'. Among these, only the expression of AcUFGT3a was found to be highly consistent with anthocyanin accumulation. Fruit infiltrated with virus-induced gene silencing showed delayed red colorations, lower anthocyanin contents and lower expressions of AcUFGT3a. At the same time, transient overexpression of AcUFGT3a in both Actinidia arguta and green apple fruit resulted in higher anthocyanin contents and deeper red coloration. In vitro biochemical assays revealed that recombinant AcUFGT3a recognized only anthocyanidins as substrate but not flavonols. Also, UDP-galactose was used preferentially as the sugar donor. These results indicate AcUFGT3a is the key enzyme regulating anthocyanin accumulation in red-fleshed kiwifruit. © 2017 Scandinavian Plant Physiology Society.

  15. Turismo rural y empleo rural no agrícola en la Sierra Nororiente del estado de Puebla: caso red de Turismo Alternativo Totaltipak, A.C.

    Directory of Open Access Journals (Sweden)

    Adriana Montserrat Pérez Serrano

    2010-06-01

    Full Text Available Resumen. El objetivo del estudio fue conocer el recurso turístico que es aprovechado por las siete empresas que integran la Red de Turismo Alternativo Totaltikpak, A.C., la cual opera en la Sierra Norte del estado de Puebla, e investigar si el turismo rural contribuye a mejorar el ingreso de las personas involucradas en esta actividad. Los recursos turísticos aprovechados por las empresas son: patrimonio histórico, atractivos naturales, folclore y manifestaciones de cultura tradicional. Se encontró que el turismo rural contribuye de manera significativa en los ingresos anuales de las personas que están vinculadas a esta actividad. Asimismo, aun cuando para la mayoría de los casos el principal beneficio es económico, también se reconocen beneficios personales, sociales y ambientales.

  16. Kinetics of degradation of allura red, ponceau 4R and carmosine dyes with potassium ferrioxalate complex in the presence of H(2)O(2).

    Science.gov (United States)

    Salem, Mohamed A; Abdel-Halim, Shaker T; El-Sawy, Abd El-Hamid M; Zaki, Ahmed B

    2009-08-01

    The degradation of title dyes with ferrioxalate and H(2)O(2) couple has been investigated spectrophotometrically. In the absence of either one of the oxidizing agents no degradation occurred. The reaction rate was proportional to moderate concentrations of the dye and H(2)O(2). At high concentration of the dye and H(2)O(2) the reaction rate decreased. With regard to the concentration of the ferrioxalate complex the rate of reaction increased even over a wide range of complex concentration. Degradation of dyes does not occur in acidic medium. It is slow in neutral but thoroughly fast in alkaline medium. The reaction rate reaches a maximum value at pH 11.5. This behavior was again observed if HCl or NaOH were added. With HCl the reaction rate decreases with increasing acid concentration but greatly increases with NaOH concentration. Isopropanol showed inhibiting effect due to scavenging the in situ generated hydroxyl radical (()OH). Oxalate ion enhanced the rate, confirming an outer sphere mechanism. The activation parameters of the reaction are estimated and a possible mechanism is proposed. The mechanism is well confirmed with data simulation procedure.

  17. Peltier ac calorimeter

    OpenAIRE

    Jung, D. H.; Moon, I. K.; Jeong, Y. H.

    2001-01-01

    A new ac calorimeter, utilizing the Peltier effect of a thermocouple junction as an ac power source, is described. This Peltier ac calorimeter allows to measure the absolute value of heat capacity of small solid samples with sub-milligrams of mass. The calorimeter can also be used as a dynamic one with a dynamic range of several decades at low frequencies.

  18. ACAC Converters for UPS

    Directory of Open Access Journals (Sweden)

    Rusalin Lucian R. Păun

    2008-05-01

    Full Text Available This paper propose a new control technique forsingle – phase ACAC converters used for a on-line UPSwith a good dynamic response, a reduced-partscomponents, a good output characteristic, a good powerfactorcorrection(PFC. This converter no needs anisolation transformer. A power factor correction rectifierand an inverter with the proposed control scheme has beendesigned and simulated using Caspoc2007, validating theconcept.

  19. AC power supply systems

    International Nuclear Information System (INIS)

    Law, H.

    1987-01-01

    An ac power supply system includes a rectifier fed by a normal ac supply, and an inverter connected to the rectifier by a dc link, the inverter being effective to invert the dc output of the receiver at a required frequency to provide an ac output. A dc backup power supply of lower voltage than the normal dc output of the rectifier is connected across the dc link such that the ac output of the rectifier is derived from the backup supply if the voltage of the output of the inverter falls below that of the backup supply. The dc backup power may be derived from a backup ac supply. Use in pumping coolant in nuclear reactor is envisaged. (author)

  20. ACS Zero Point Verification

    Science.gov (United States)

    Dolphin, Andrew

    2005-07-01

    The uncertainties in the photometric zero points create a fundamental limit to the accuracy of photometry. The current state of the ACS calibration is surprisingly poor, with zero point uncertainties of 0.03 magnitudes. The reason for this is that the ACS calibrations are based primarily on semi-emprical synthetic zero points and observations of fields too crowded for accurate ground-based photometry. I propose to remedy this problem by obtaining ACS images of the omega Cen standard field with all nine broadband ACS/WFC filters. This will permit the direct determination of the ACS zero points by comparison with excellent ground-based photometry, and should reduce their uncertainties to less than 0.01 magnitudes. A second benefit is that it will facilitate the comparison of the WFPC2 and ACS photometric systems, which will be important as WFPC2 is phased out and ACS becomes HST's primary imager. Finally, three of the filters will be repeated from my Cycle 12 observations, allowing for a measurement of any change in sensitivity.

  1. Antioxidant capacity of plasma after red wine intake in Human

    Directory of Open Access Journals (Sweden)

    M. Gianmmanco

    2009-01-01

    Full Text Available Aim: Antioxidant effects after consumption of red wine have been investigated in several studies but results are contradictory and the difference in the plasma antioxidant capacity (AC after intake of red wine between women and men has never been studies. This work purpose is manifold: to ascertain whether red wine intake modifies the human plasma AC; to study the behaviour of plasma AC of women in comparison with men and finally to investigate on the plasma uric acid concentration and its relationships with the plasma AC after red wine intake.

  2. AC/RF Superconductivity

    Energy Technology Data Exchange (ETDEWEB)

    Ciovati, Gianluigi [JLAB

    2015-02-01

    This contribution provides a brief introduction to AC/RF superconductivity, with an emphasis on application to accelerators. The topics covered include the surface impedance of normal conductors and superconductors, the residual resistance, the field dependence of the surface resistance, and the superheating field.

  3. Increased Ac excision (iae): Arabidopsis thaliana mutations affecting Ac transposition

    International Nuclear Information System (INIS)

    Jarvis, P.; Belzile, F.; Page, T.; Dean, C.

    1997-01-01

    The maize transposable element Ac is highly active in the heterologous hosts tobacco and tomato, but shows very much reduced levels of activity in Arabidopsis. A mutagenesis experiment was undertaken with the aim of identifying Arabidopsis host factors responsible for the observed low levels of Ac activity. Seed from a line carrying a single copy of the Ac element inserted into the streptomycin phosphotransferase (SPT) reporter fusion, and which displayed typically low levels of Ac activity, were mutagenized using gamma rays. Nineteen mutants displaying high levels of somatic Ac activity, as judged by their highly variegated phenotypes, were isolated after screening the M2 generation on streptomycin-containing medium. The mutations fall into two complementation groups, iae1 and iae2, are unlinked to the SPT::Ac locus and segregate in a Mendelian fashion. The iae1 mutation is recessive and the iae2 mutation is semi-dominant. The iae1 and iae2 mutants show 550- and 70-fold increases, respectively, in the average number of Ac excision sectors per cotyledon. The IAE1 locus maps to chromosome 2, whereas the SPT::Ac reporter maps to chromosome 3. A molecular study of Ac activity in the iae1 mutant confirmed the very high levels of Ac excision predicted using the phenotypic assay, but revealed only low levels of Ac re-insertion. Analyses of germinal transposition in the iae1 mutant demonstrated an average germinal excision frequency of 3% and a frequency of independent Ac re-insertions following germinal excision of 22%. The iae mutants represents a possible means of improving the efficiency of Ac/Ds transposon tagging systems in Arabidopsis, and will enable the dissection of host involvement in Ac transposition and the mechanisms employed for controlling transposable element activity

  4. Superconducting ac cable

    International Nuclear Information System (INIS)

    Schmidt, F.

    1980-01-01

    The components of a superconducting 110 kV ac cable for power ratings >= 2000 MVA have been developed. The cable design especially considered was of the semiflexible type, with a rigid cryogenic envelope and flexible hollow coaxial cable cores pulled into the former. The cable core consists of spirally wound Nb-Al composite wires and a HDPE-tape wrapped electrical insulation. A 35 m long single phase test cable with full load terminations for 110 kV and 10 kA was constructed and successfully tested. The results obtained prove the technical feasibility and capability of our cable design. (orig.) [de

  5. High performance AC drives

    CERN Document Server

    Ahmad, Mukhtar

    2010-01-01

    This book presents a comprehensive view of high performance ac drives. It may be considered as both a text book for graduate students and as an up-to-date monograph. It may also be used by R & D professionals involved in the improvement of performance of drives in the industries. The book will also be beneficial to the researchers pursuing work on multiphase drives as well as sensorless and direct torque control of electric drives since up-to date references in these topics are provided. It will also provide few examples of modeling, analysis and control of electric drives using MATLAB/SIMULIN

  6. AC resistance measuring instrument

    Science.gov (United States)

    Hof, P.J.

    1983-10-04

    An auto-ranging AC resistance measuring instrument for remote measurement of the resistance of an electrical device or circuit connected to the instrument includes a signal generator which generates an AC excitation signal for application to a load, including the device and the transmission line, a monitoring circuit which provides a digitally encoded signal representing the voltage across the load, and a microprocessor which operates under program control to provide an auto-ranging function by which range resistance is connected in circuit with the load to limit the load voltage to an acceptable range for the instrument, and an auto-compensating function by which compensating capacitance is connected in shunt with the range resistance to compensate for the effects of line capacitance. After the auto-ranging and auto-compensation functions are complete, the microprocessor calculates the resistance of the load from the selected range resistance, the excitation signal, and the load voltage signal, and displays of the measured resistance on a digital display of the instrument. 8 figs.

  7. Single-Phase Direct Boost AC-AC Converter

    Directory of Open Access Journals (Sweden)

    URSARU, O.

    2017-11-01

    Full Text Available This paper introduces and studies a boost AC-AC converter circuit that can be used to supply power to the 220V receivers in the 110V grids or to increase and adjust voltage at the end of long lines. High frequency AC-AC converters have better specifications than alternative voltage phase control drives with thyristors or TRIACs. When frequency exceeds 20kHz, noise is eliminated, filters are smaller and efficiency is higher. The current waveform is much better, the output voltage can be higher than the input voltage and voltage control is more accurate.

  8. ACS Postflash Characterization

    Science.gov (United States)

    Smith, Linda

    2011-10-01

    This program will evaluate the in-flight performance of the ACS/WFC post-flash lamp. A series of observations of Omega Cen will be taken using short and long exposures. The short exposures will be post-flashed using pre-determined exposure times to produce backgrounds from 0 to 125 e-. The data will be used to {1} make an empirical study of the effectiveness in preserving counts for faint stars on various post-flash backgrounds; {2} validate that our current mechanisms for formula-based and pixel-based corrections provide good fixes for whatever CTE remains; and {3} probe a fine enough range of backgrounds that users will be able to pick the level that optimizes their science, which will be a straightforward compromise between the noise added and the signal preserved.

  9. Monoclonal antibodies AC-43 and AC-29 disrupt Plasmodium vivax ...

    Indian Academy of Sciences (India)

    Prakash

    Therefore, these glycoproteins appear to be potential candidates for a vector- directed transmission-blocking vaccine (TBV). [Chugh M, Gulati B R and Gakhar S K 2010 Monoclonal antibodies AC-43 and AC-29 disrupt Plasmodium vivax development in the Indian malaria vector Anopheles culicifacies (Diptera: culicidae); J.

  10. ACS Photometric Zero Point Verification

    Science.gov (United States)

    Dolphin, Andrew

    2003-07-01

    The uncertainties in the photometric zero points create a fundamental limit to the accuracy of photometry. The current state of the ACS calibration is surprisingly poor, with zero point uncertainties of 0.03 magnitudes in the Johnson filters. The reason for this is that ACS observations of excellent ground-based standard fields, such as the omega Cen field used for WFPC2 calibrations, have not been obtained. Instead, the ACS photometric calibrations are based primarily on semi-emprical synthetic zero points and observations of fields too crowded for accurate ground-based photometry. I propose to remedy this problem by obtaining ACS broadband images of the omega Cen standard field with both the WFC and HRC. This will permit the direct determination of the ACS transformations, and is expected to double the accuracy to which the ACS zero points are known. A second benefit is that it will facilitate the comparison of the WFPC2 and ACS photometric systems, which will be important as WFPC2 is phased out and ACS becomes HST's primary imager.

  11. Electricity-AC versus DC

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education; Volume 2; Issue 10. Electricity - AC versus DC. D P Sen Gupta. General Article Volume 2 Issue 10 October 1997 pp 46-53. Fulltext. Click here to view fulltext PDF. Permanent link: http://www.ias.ac.in/article/fulltext/reso/002/10/0046-0053. Author Affiliations.

  12. Introduction to AC machine design

    CERN Document Server

    Lipo, Thomas A

    2018-01-01

    AC electrical machine design is a key skill set for developing competitive electric motors and generators for applications in industry, aerospace, and defense. This book presents a thorough treatment of AC machine design, starting from basic electromagnetic principles and continuing through the various design aspects of an induction machine. Introduction to AC Machine Design includes one chapter each on the design of permanent magnet machines, synchronous machines, and thermal design. It also offers a basic treatment of the use of finite elements to compute the magnetic field within a machine without interfering with the initial comprehension of the core subject matter. Based on the author's notes, as well as after years of classroom instruction, Introduction to AC Machine Design: * Brings to light more advanced principles of machine design--not just the basic principles of AC and DC machine behavior * Introduces electrical machine design to neophytes while also being a resource for experienced designers * ...

  13. Aislamiento acústico

    Directory of Open Access Journals (Sweden)

    Tobío, J. M.

    1970-07-01

    Full Text Available This is a very specific subject in the field of architectural acoustics, namely, insulation'. Emphasis is placed on the theoretical foundations of this phenomenon, and the most simple formula are developed to calculate easily the transmission losses of a material or the constructional insulating arrangements. The practical aspect of insulation can be considered by means of several graphs and charts, without the use of mathematics, and utilising common materials, that will not substantially increase the cost of the project. Finally this papers offers a critical discussion of building codes, and their reference to the acoustical insulation of dwellings, and data is included on the new regulations of the Madrid Municipality.Se trata un tema muy concreto de la Acústica Arquitectónica, el aislamiento, haciendo hincapié en los fundamentos teóricos del fenómeno y estableciendo las fórmulas más sencillas que permiten calcular fácilmente las pérdidas de transmisión de un material o disposición constructiva aislante. Varias gráficas y abacos permiten abordar, sin ningún tratamiento matemático, el problema práctico del aislamiento, aprovechando los materiales comunes y sin ocasionar gastos que graven sustancialmente el importe del proyecto. Por último, se hace un estudio crítico de las normas y su incidencia en los problemas del aislamiento de viviendas, incluyendo datos referentes a la nueva Ordenanza del Ayuntamiento de Madrid.

  14. AcEST: DK945159 [AcEST

    Lifescience Database Archive (English)

    Full Text Available id J. Lipman (1997), Gapped BLAST and PSI-BLAST: a new generation of protein database search programs...T and PSI-BLAST: a new generation of protein database search programs, Nucleic Ac

  15. AcEST: DK945724 [AcEST

    Lifescience Database Archive (English)

    Full Text Available id J. Lipman (1997), Gapped BLAST and PSI-BLAST: a new generation of protein database search programs...T and PSI-BLAST: a new generation of protein database search programs, Nucleic Ac

  16. Monoclonal antibodies AC-43 and AC-29 disrupt Plasmodium vivax ...

    Indian Academy of Sciences (India)

    The number of oocysts that developed was reduced by 78.6% when mosquitoes ingested a combination of these two mAbs along with the blood meal. AC-43 mAb binds to the epitope common in 97, 80 and 43 kDa polypeptides from the midgut protein extract, as indicated by western blot analysis. Similarly, the mAb AC-29 ...

  17. Using AC Motors in Robotics

    Directory of Open Access Journals (Sweden)

    Hosein Marzi

    2008-11-01

    Full Text Available It has been proven that fuzzy controllers are capable of controlling non-linear systems where it is cumbersome to develop conventional controllers based on mathematical modeling. This paper describes designing fuzzy controllers for an AC motor run mechanism. It also compares performance of two controllers designed based on Mamdani and Takagi-Sugeno with the conventional control scheme in a short track length, following a high disturbance. Fine and rapid control of AC motors have been a challenge and the main obstacle in gaining popularity in use of AC motors in robots actuators. This chapter reviews how use of intelligent control scheme can help to solve this problem.

  18. Iris pigmentation and AC thresholds.

    Science.gov (United States)

    Roche, A F; Mukherjee, D; Chumlea, W C; Siervogel, R M

    1983-03-01

    Data from 160 White children were used to analyze possible associations between iris pigmentation and AC pure-tone thresholds. Iris pigmentation was graded from iris color using glass models of eyes, and AC thresholds were obtained under carefully controlled conditions. Analyses of variance using two groupings of iris color grades showed no evidence of an association between iris color grade and AC thresholds. Furthermore, inspection of arrays of the actual glass eye models, in conjunction with the order of mean thresholds at each test frequency, did not indicate the presence of an association between iris color grades and thresholds. It was concluded that while iris pigmentation may be related to some aspects of hearing ability, it does not appear to be related to AC thresholds in children.

  19. Red Hill

    Science.gov (United States)

    Information about the Red Hill Bulk Fuel Storage Facility in Hawaii Administrative Order on Consent (AOC), an enforceable agreement of the Hawaii Department of Health, the Environmental Protection Agency, and the U.S. Navy -- Defense Logistics Agency.

  20. AcEST: DK963222 [AcEST

    Lifescience Database Archive (English)

    Full Text Available sp|P81919|OR46A_DROME Odorant receptor 46a, isoform A OS=Drosoph... 32 2.8 sp|Q5MJ68|SPDYC_HUMAN Speed...FCFKA 181 CS +T + AV S L + +YV + AC Q FI C+ A Sbjct: 262 CSVLVLTANFYAIAVLSDERLELFKYVTYQACMLIQIFILCYYA 305 >sp|Q5MJ68|SPDYC_HUMAN Spee

  1. AcEST: BP913556 [AcEST

    Lifescience Database Archive (English)

    Full Text Available N Ubiquitin-protein ligase E3B OS=Homo sapie... 31 3.5 sp|Q9VDW6|DMDA_DROME Dystrophin, isoforms A/C/F/G/H O...SVPALVTHLSTVTPERLTVLESHDMLRKF 287 >sp|Q9VDW6|DMDA_DROME Dystrophin, isoforms A/C/

  2. AcEST: BP918420 [AcEST

    Lifescience Database Archive (English)

    Full Text Available D 180 >sp|A8AC98|APGM_IGNH4 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Ignicoccus hosp...italis (strain KIN4/I / DSM 18386 / JCM 14125) GN=apgM PE=3 SV=1 Length = 416 Score

  3. Nuclear structure of $^{231}$Ac

    CERN Document Server

    Boutami, R; Mach, H; Kurcewicz, W; Fraile, L M; Gulda, K; Aas, A J; García-Raffi, L M; Løvhøiden, G; Martínez, T; Rubio, B; Taín, J L; Tengblad, O

    2008-01-01

    The low-energy structure of 231Ac has been investigated by means of gamma ray spectroscopy following the beta-decay of 231Ra. Multipolarities of 28 transitions have been established by measuring conversion electrons with a mini-orange electron spectrometer. The decay scheme of 231Ra --> 231Ac has been constructed for the first time. The Advanced Time Delayed beta-gamma-gamma(t) method has been used to measure the half-lives of five levels. The moderately fast B(E1) transition rates derived suggest that the octupole effects, albeit weak, are still present in this exotic nucleus.

  4. Nuclear structure of 231Ac

    International Nuclear Information System (INIS)

    Boutami, R.; Borge, M.J.G.; Mach, H.; Kurcewicz, W.; Fraile, L.M.; Gulda, K.; Aas, A.J.; Garcia-Raffi, L.M.; Lovhoiden, G.; Martinez, T.; Rubio, B.; Tain, J.L.; Tengblad, O.

    2008-01-01

    The low-energy structure of 231 Ac has been investigated by means of γ ray spectroscopy following the β - decay of 231 Ra. Multipolarities of 28 transitions have been established by measuring conversion electrons with a MINI-ORANGE electron spectrometer. The decay scheme of 231 Ra → 231 Ac has been constructed for the first time. The Advanced Time Delayed βγγ(t) method has been used to measure the half-lives of five levels. The moderately fast B(E1) transition rates derived suggest that the octupole effects, albeit weak, are still present in this exotic nucleus

  5. Hopping models and ac universality

    DEFF Research Database (Denmark)

    Dyre, Jeppe; Schrøder, Thomas

    2002-01-01

    Some general relations for hopping models are established. We proceed to discuss the universality of the ac conductivity which arises in the extreme disorder limit of the random barrier model. It is shown that the relevant dimension entering into the diffusion cluster approximation (DCA) is the h......Some general relations for hopping models are established. We proceed to discuss the universality of the ac conductivity which arises in the extreme disorder limit of the random barrier model. It is shown that the relevant dimension entering into the diffusion cluster approximation (DCA...

  6. Speed Control of DC Motor using AC/AC/DC Converter Based on Intelligent Techniques

    Directory of Open Access Journals (Sweden)

    Rakan Kh Antar

    2013-05-01

    Full Text Available    This paper describes the application of ac/ac/dc and ac/dc converters to control the speed of a separately excited DC motor. Artificial neural network and PI controller are trained to select the desired values of firing angles for triggering thyristors of the ac/ac/dc and ac/dc bridge converters in order to control the speed of the dc motor at a desired value with constant and different load torques in order to obtain the best speed response. Simulation results show that the rising time for ac/dc and ac/ac/dc converters at 250rpm are reduced about 79% and 89% respectively, while delay time it reduced about 69% and 64% respectively. Therefore, speed response of the dc motor is more efficient for closed loop system compared with open loop also the response of ac/ac/dc converter is better than ac/dc converter.

  7. AcEST: DK954361 [AcEST

    Lifescience Database Archive (English)

    Full Text Available in 5-4 OS=Homo sap... 33 1.1 sp|Q9DBY1|SYVN1_MOUSE E3 ubiquitin-protein ligase synoviolin OS=... 33 1.4 sp|Q...86TM6|SYVN1_HUMAN E3 ubiquitin-protein ligase synoviolin OS=... 33 1.4 sp|O55188|DMP1_MOUSE Dentin matrix ac

  8. Tomato ACS4 is necessary for timely start of and progression through the climacteric phase of fruit ripening

    Directory of Open Access Journals (Sweden)

    Suzanne eHoogstrate

    2014-09-01

    Full Text Available Climacteric fruit ripening, as it occurs in many fruit crops, depends on a rapid, autocatalytic increase in ethylene production. This agriculturally important process has been studied extensively, with tomato simultaneously acting both as a model species and target crop for modification. In tomato, the ethylene biosynthetic genes ACC SYNTHASE2 (ACS2 and ACS4 are highly expressed during fruit ripening, with a combined loss of both ACS2 and ACS4 activity preventing generation of the ethylene burst necessary for fruit ripening. However, the individual roles and importance of ACS2 and ACS4 have not been determined. In this study, we examined specifically the role of ACS4 by comparing the phenotype of an acs4 mutant firstly with that of the wild-type, and secondly with two novel ripening-inhibitor (rin mutants. Ethylene production during ripening was significantly reduced in both acs4-1, and rin lines, with rin genotypes showing the weaker ethylene burst. Also i the time between anthesis and the start of fruit ripening and ii the time required to progress through ripening were significantly longer in acs4-1 than in the wild type, but shorter than in the strongest rin mutant. The delay in ripening was reflected in the lower expression of ripening-related transcripts during the mature green and light red ripening stages. Furthermore, expression of ACS2 and ACS4 was strongly dependent on a functional RIN gene, while ACS2 expression was largely independent of ACS4. Altogether, we show that ACS4 is necessary for normal progression of tomato fruit ripening and that mutation of this gene may provide a useful means for altering ripening traits.

  9. Aperture measurements with AC dipole

    CERN Document Server

    Fuster Martinez, Nuria; Dilly, Joschua Werner; Nevay, Laurence James; Bruce, Roderik; Tomas Garcia, Rogelio; Redaelli, Stefano; Persson, Tobias Hakan Bjorn; CERN. Geneva. ATS Department

    2018-01-01

    During the MDs performed on the 15th of September and 29th of November 2017, we measured the LHC global aperture at injection with a new AC dipole method as well as using the Transverse Damper (ADT) blow-up method used during the 2017 LHC commissioning for benchmarking. In this note, the MD procedure is presented as well as the analysis of the comparison between the two methods. The possible benefits of the new method are discussed.

  10. Product (RED)

    DEFF Research Database (Denmark)

    Ponte, Stefano

    2011-01-01

    for a better world) by enrolling consumers in ways that do not rely on accurate knowledge of the products or specific understanding of the cause that The Global Fund engages but, instead, rely on a system of more general, affective affinity between the ‘aid celebrities’ who are behind RED (such as Bono...

  11. Simultaneous distribution of AC and DC power

    Science.gov (United States)

    Polese, Luigi Gentile

    2015-09-15

    A system and method for the transport and distribution of both AC (alternating current) power and DC (direct current) power over wiring infrastructure normally used for distributing AC power only, for example, residential and/or commercial buildings' electrical wires is disclosed and taught. The system and method permits the combining of AC and DC power sources and the simultaneous distribution of the resulting power over the same wiring. At the utilization site a complementary device permits the separation of the DC power from the AC power and their reconstruction, for use in conventional AC-only and DC-only devices.

  12. Microwave-induced crystallization of AC/TiO{sub 2} for improving the performance of rhodamine B dye degradation

    Energy Technology Data Exchange (ETDEWEB)

    Tian, Fei [School of Chemistry and Chemical Engineering, Shihezi University, Shihezi 832003 (China); Wu, Zhansheng, E-mail: wuzhans@126.com [School of Chemistry and Chemical Engineering, Shihezi University, Shihezi 832003 (China); Chen, Qiuyu; Yan, Yujun [School of Chemistry and Chemical Engineering, Shihezi University, Shihezi 832003 (China); Cravotto, Giancarlo; Wu, Zhilin [Dipartimento di Scienza e Tecnologia del Farmaco, University of Turin, Torino 10125 (Italy)

    2015-10-01

    Graphical abstract: - Highlights: • Mixed phase titania coated with AC was obtained by microwave irradiation method. • The TiO{sub 2} nanoparticles were spherical and well distributed on the surface of AC. • The light absorption edges of AC/TiO{sub 2} showed red-shift compared to the pure TiO{sub 2}. • Higher surface and TiO{sub 2} content of AC/TiO{sub 2} could improve photocatalytic efficiency. - Abstract: Titanium dioxide (TiO{sub 2}) deposition on activated carbon (AC) is widely used for pollutant photodegradation. In this study, a simple and efficient method for preparing AC/TiO{sub 2} composites under microwave irradiation was developed for photocatalytic degradation of rhodamine B (RhB) under UV light. Results of X-ray diffraction, scanning electron microscopy, and transmission electron microscopy revealed that TiO{sub 2} nanoparticles are anatase and rutile, with a spherical shape and a particle size of 20–50 nm and are well distributed on the AC surface. The UV–vis spectrum of TiO{sub 2} coated on AC showed an evident red-shift and exhibited stronger optical absorption capacity than pure TiO{sub 2}. The AC/TiO{sub 2} nanoparticles prepared at a microwave power of 700 W for 15 min exhibited 98% efficiency in removing RhB dye under UV irradiation for 30 min. The high photocatalytic activity of AC/TiO{sub 2}-700 W could be mainly attributed to the high sorption capacity of the mesoporous carbon material and high TiO{sub 2} content, which could produce higher quantity of ·OH. This study provides a rapid synthesis technique to prepare AC/TiO{sub 2} and a novel method to improve photocatalytic efficiency via synergistic effect for other catalytic systems.

  13. SNS AC Power Distribution and Reliability of AC Power Supply

    CERN Document Server

    Holik, Paul S

    2005-01-01

    The SNS Project has 45MW of installed power. A design description under the Construction Design and Maintenance (CDM) with regard to regulations (OSHA, NFPA, NEC), reliability issues and maintenance of the AC power distribution system are herewith presented. The SNS Project has 45MW of installed power. The Accelerator Systems are Front End (FE)and LINAC KLYSTRON Building (LK), Central Helium Liquefier (CHL), High Energy Beam Transport (HEBT), Accumulator Ring and Ring to Target Beam Transport (RTBT) Support Buildings have 30MW installed power. FELK has 16MW installed, majority of which is klystron and magnet power supply system. CHL, supporting the super conducting portion of the accelerator has 7MW installed power and the RING Systems (HEBT, RING and RTBT) have also 7MW installed power.*

  14. Red Sky

    OpenAIRE

    Young, John

    2015-01-01

    Red Sky is scored for alto flute (Kingma system), Clarinet in B-flat/bass clarinet), piano and 14 channel digital audio files (48 kHz/24 bit). A MAX patch for triggering the sound files in performance is available. Permission to include oral history recordings of First World War survivors was kindly granted by the Imperial War Museum, London. The work was created to mark the close of the New Walk Museum and Art Gallery’s ‘Leicester at War 1914-15’ exhibition. The work is in 31 movem...

  15. Universality of ac conduction in disordered solids

    DEFF Research Database (Denmark)

    Dyre, Jeppe; Schrøder, Thomas

    2000-01-01

    The striking similarity of ac conduction in quite different disordered solids is discussed in terms of experimental results, modeling, and computer simulations. After giving an overview of experiment, a macroscopic and a microscopic model are reviewed. For both models the normalized ac conductivity...... as a function of a suitably scaled frequency becomes independent of details of the disorder in the extreme disorder limit, i.e., when the local randomly varying mobilities cover many orders of magnitude. The two universal ac conductivities are similar, but not identical; both are examples of unusual non......-power-law universalities. It is argued that ac universality reflects an underlying percolation determining dc as well as ac conductivity in the extreme disorder limit. Three analytical approximations to the universal ac conductivities are presented and compared to computer simulations. Finally, model predictions...

  16. RHIC spin flipper AC dipole controller

    Energy Technology Data Exchange (ETDEWEB)

    Oddo, P.; Bai, M.; Dawson, C.; Gassner, D.; Harvey, M.; Hayes, T.; Mernick, K.; Minty, M.; Roser, T.; Severino, F.; Smith, K.

    2011-03-28

    The RHIC Spin Flipper's five high-Q AC dipoles which are driven by a swept frequency waveform require precise control of phase and amplitude during the sweep. This control is achieved using FPGA based feedback controllers. Multiple feedback loops are used to and dynamically tune the magnets. The current implementation and results will be presented. Work on a new spin flipper for RHIC (Relativistic Heavy Ion Collider) incorporating multiple dynamically tuned high-Q AC-dipoles has been developed for RHIC spin-physics experiments. A spin flipper is needed to cancel systematic errors by reversing the spin direction of the two colliding beams multiple times during a store. The spin flipper system consists of four DC-dipole magnets (spin rotators) and five AC-dipole magnets. Multiple AC-dipoles are needed to localize the driven coherent betatron oscillation inside the spin flipper. Operationally the AC-dipoles form two swept frequency bumps that minimize the effect of the AC-dipole dipoles outside of the spin flipper. Both AC bumps operate at the same frequency, but are phase shifted from each other. The AC-dipoles therefore require precise control over amplitude and phase making the implementation of the AC-dipole controller the central challenge.

  17. Re-evaluation of azo dyes as food additives

    DEFF Research Database (Denmark)

    Pratt, Iona; Larsen, John Christian; Mortensen, Alicja

    2013-01-01

    additives to be assessed by the Scientific Committee on Food, many years ago, (ii) because of concern regarding possible health effects of artificial colours arising since the original evaluations.Concerns includedbehavioural effects in children, allergic reactions, genotoxicity and possible carcinogenicity....... Of the 11 previously authorisedazo dyes (Red 2 G, Tartrazine, Sunset Yellow FCF, Azorubine, Ponceau 4R, Allura Red AC, Amaranth, Brilliant Black BN, Brown FK, Brown HT and Litholrubine BK), the Acceptable Daily Intake (ADI) for Red 2G was withdrawn because of concerns regarding genotoxicity...

  18. Les ports de la mer Rouge, de l’Antiquité à l’époque islamique (ive siècle av. – xve siècle apr. J.-C. The Ports in the Red Sea (4th c. B.C. – 15th c. A.C.: Introduction

    Directory of Open Access Journals (Sweden)

    Éric Vallet

    2008-04-01

    Full Text Available La mer Rouge a longtemps été considérée comme un territoire sans histoire, dont les ports n’ont retenu que peu l’attention des historiens. La multiplication des fouilles et prospections archéologiques et l’exploration de nouvelles sources écrites permettent d’envisager désormais le « fait portuaire » en mer Rouge, de l’Antiquité à l’époque islamique, sous un jour nouveau. Les trois études qui suivent mettent particulièrement en lumière l’importance les réseaux de navigation locale dans le développement de la mer Rouge comme bassin d’échange.The Red Sea has for a long time been considered as an area without history. Moreover, few historical studies have been devoted to its ports. New data collected from excavations and archaeological surveys, or from documents, invite to write a history of the genesis and development of the ports in the Red Sea, from Antiquity to Islamic times. The three following contributions underline the major importance of local maritime networks in the constitution of the Red Sea as a cohesive economical area.

  19. Bioinformatics and Astrophysics Cluster (BinAc)

    Science.gov (United States)

    Krüger, Jens; Lutz, Volker; Bartusch, Felix; Dilling, Werner; Gorska, Anna; Schäfer, Christoph; Walter, Thomas

    2017-09-01

    BinAC provides central high performance computing capacities for bioinformaticians and astrophysicists from the state of Baden-Württemberg. The bwForCluster BinAC is part of the implementation concept for scientific computing for the universities in Baden-Württemberg. Community specific support is offered through the bwHPC-C5 project.

  20. Three phase AC motor controller

    Science.gov (United States)

    Vuckovich, Michael; Wright, Maynard K.; Burkett, John P.

    1984-03-20

    A motor controller for a three phase AC motor (10) which is adapted to operate bidirectionally from signals received either from a computer (30) or a manual control (32). The controller is comprised of digital logic circuit means which implement a forward and reverse command signal channel (27, 29) for the application of power through the forward and reverse power switching relays (16, 18, 20, 22). The digital logic elements are cross coupled to prevent activation of both channels simultaneously and each includes a plugging circuit (65, 67) for stopping the motor upon the removal of control signal applied to one of the two channels (27, 29) for a direction of rotation desired. Each plugging circuit (65, 67) includes a one-shot pulse signal generator (88, 102) which outputs a single pulse signal of predetermined pulsewidth which is adapted to inhibit further operation of the application of power in the channel which is being activated and to apply a reversal command signal to the other channel which provides a reversed phase application of power to the motor for a period defined by the pulse-width output of the one-shot signal generator to plug the motor (10) which will then be inoperative until another rotational command signal is applied to either of the two channels.

  1. Influence of SDBD plasma aerodynamic actuation on flow control by AC power supply and AC-DC power supply

    Science.gov (United States)

    Hu, Xu; Gao, Chao; Hao, Jiangnan

    2018-01-01

    In this paper, the excitation effect of single dielectric barrier discharge plasma actuator (SDBD) is compared by using AC power supply and AC-DC power supply. AC-DC power supply is based on the AC power supply, just adding DC component. The flow measurement is carried out by PIV technique. Results show that the excitation effect of AC power supply and AC-DC power supply increases by the increase of voltage, the range of speed field excited by AC power is greater than that of AC-DC power supply. For x direction maximum speed, excited by AC power supply is close to AC-DC, and for y direction maximum speed, AC power supply is greater than AC-DC power supply. So the excitation effect of AC power supply is better than that of AC-DC power supply for SDBD.

  2. Economics of Red Pine Management for Utility Pole Timber

    Science.gov (United States)

    Gerald H. Grossman; Karen Potter-Witter

    1991-01-01

    Including utility poles in red pine management regimes leads to distinctly different management recommendations. Where utility pole markets exist, managing for poles will maximize net returns. To do so, plantations should be maintained above 110 ft2/ac, higher than usually recommended. In Michigan's northern lower peninsula, approximately...

  3. ACS sampling system: design, implementation, and performance evaluation

    Science.gov (United States)

    Di Marcantonio, Paolo; Cirami, Roberto; Chiozzi, Gianluca

    2004-09-01

    By means of ACS (ALMA Common Software) framework we designed and implemented a sampling system which allows sampling of every Characteristic Component Property with a specific, user-defined, sustained frequency limited only by the hardware. Collected data are sent to various clients (one or more Java plotting widgets, a dedicated GUI or a COTS application) using the ACS/CORBA Notification Channel. The data transport is optimized: samples are cached locally and sent in packets with a lower and user-defined frequency to keep network load under control. Simultaneous sampling of the Properties of different Components is also possible. Together with the design and implementation issues we present the performance of the sampling system evaluated on two different platforms: on a VME based system using VxWorks RTOS (currently adopted by ALMA) and on a PC/104+ embedded platform using Red Hat 9 Linux operating system. The PC/104+ solution offers, as an alternative, a low cost PC compatible hardware environment with free and open operating system.

  4. Security analysis of interconnected AC/DC systems

    DEFF Research Database (Denmark)

    Eriksson, Robert

    2015-01-01

    This paper analyses N-1 security in an interconnected ac/dc transmission system using power transfer distribution factors (PTDFs). In the case of a dc converter outage the power needs to be redistributed among the remaining converter to maintain power balance and operation of the dc grid. The red......This paper analyses N-1 security in an interconnected ac/dc transmission system using power transfer distribution factors (PTDFs). In the case of a dc converter outage the power needs to be redistributed among the remaining converter to maintain power balance and operation of the dc grid...... voltage control design consider the power distribution for a converter outage. By proper design and utilizing the proposed method increases the N-1 security and the secure transfer limits. This article proposes a method which minimizes the 2-norm of the sum of the PTDFs with constraints of not violating...... any line or transformer limits. Simulations were performed in a model of the Nordic power system where a dc grid is placed on top. The simulation supports the method as a tool to consider transfer limits in the grid to avoid violate the same and increase the security after a converter outage....

  5. Red, far red wavelength, the ratio red to far red, temperature and ...

    African Journals Online (AJOL)

    Measurements of temperature, red, far red wavelength of light and the ratio red to far red were made at every 10 minutes interval at marked points along a 15 m transect using thermometers and a Skye 660/730 Radiation Detector and Measuring unit (SKR100: SKR110) at Umudike, Nigeria. Readings were made during the ...

  6. AC distribution system for TFTR pulsed loads

    International Nuclear Information System (INIS)

    Carroll, R.F.; Ramakrishnan, S.; Lemmon, G.N.; Moo, W.I.

    1977-01-01

    This paper outlines the AC distribution system associated with the Tokamak Fusion Test Reactor and discusses the significant areas related to design, protection, and equipment selection, particularly where there is a departure from normal utility and industrial applications

  7. Logistics Reduction: Advanced Clothing System (ACS)

    Data.gov (United States)

    National Aeronautics and Space Administration — The goal of the Advanced Exploration System (AES) Logistics Reduction (LR) project's Advanced Clothing System (ACS) is to use advanced commercial off-the-shelf...

  8. Proportional-Integral-Resonant AC Current Controller

    Directory of Open Access Journals (Sweden)

    STOJIC, D.

    2017-02-01

    Full Text Available In this paper an improved stationary-frame AC current controller based on the proportional-integral-resonant control action (PIR is proposed. Namely, the novel two-parameter PIR controller is applied in the stationary-frame AC current control, accompanied by the corresponding parameter-tuning procedure. In this way, the proportional-resonant (PR controller, common in the stationary-frame AC current control, is extended by the integral (I action in order to enable the AC current DC component tracking, and, also, to enable the DC disturbance compensation, caused by the voltage source inverter (VSI nonidealities and by nonlinear loads. The proposed controller parameter-tuning procedure is based on the three-phase back-EMF-type load, which corresponds to a wide range of AC power converter applications, such as AC motor drives, uninterruptible power supplies, and active filters. While the PIR controllers commonly have three parameters, the novel controller has two. Also, the provided parameter-tuning procedure needs only one parameter to be tuned in relation to the load and power converter model parameters, since the second controller parameter is directly derived from the required controller bandwidth value. The dynamic performance of the proposed controller is verified by means of simulation and experimental runs.

  9. The Effect of the Feedback Controller on Superconducting Tokamak AC Losses + AC-CRPP user manual

    International Nuclear Information System (INIS)

    Schaerz, B.; Bruzzone, P.; Favez, J.Y.; Lister, J.B.; Zapretilina, E.

    2001-11-01

    Superconducting coils in a Tokamak are subject to AC losses when the field transverse to the coil current varies. A simple model to evaluate the AC losses has been derived and benchmarked against a complete model used in the ITER design procedure. The influence of the feedback control strategy on the AC losses is examined using this model. An improved controller is proposed, based on this study. (author)

  10. Excitation and photo-ionization of ultra-cold potassium atoms in the AC-driven magneto optical trap (AC-MOT)

    Science.gov (United States)

    Agomuo, John; Murray, Andrew; Harvey, Matthew

    2014-03-01

    The operation of a new cold atom trap (the AC-MOT) and its application in photoionization experiments is described. Ionization of cold K atoms in the AC-MOT is discussed, the ionization proceeding in a stepwise fashion using a combination of infra-red radiation with that from a blue diode laser. A significant limitation of magneto optical trapping (MOT) techniques has been the requirement to eliminate the magnetic fields prior to the interaction occurring. To address this, the AC-MOT was invented in Manchester. This is a pulsed trap, so that the magnetic fields are completely eliminated prior to the electron interaction. Low energy electrons can then be extracted from laser photoionization. In this work, the potassium is cooled to ~0.25mK. Photoionization proceeds by a stepwise route, atoms excited by the trapping laser at ~766nm being ionized by radiation at ~448nm. Both fluorescence from the atoms and the ion yield are used to determine details of the interaction. These techniques are being studied since it then is possible to create cold electron bunches of high coherence. A detailed description of the AC-MOT, its operation and application will be presented. A new cold electron source being built in Manchester will also be discussed. I wish to acknowledge the financial support from Tertiary Education Trust Fund Nigeria and Nigerian Defence Academy Kaduna.

  11. imulation Results of Single Stage AC- AC Converter for Induction Heating

    Directory of Open Access Journals (Sweden)

    S. ARUMUGAM

    2010-12-01

    Full Text Available This paper presents simulation of single stage Induction heating system with series Load Resonance. Low frequency AC is converted in to High Frequency Ac using newly developed ZVS-PWM high frequency inverter. This High Frequency is used for Induction Heating .Single stage AC-AC converter system is modeled and simulated using Matlab Simulink. The simulation results of ZVS-PWM high frequency system are presented. The effectiveness of this UFAC-to-HFAC direct power frequency converter using IGBTs for consumer high-frequency IH appliances is evaluated and proved on the basis of simulation results.

  12. From Beamline to Scanner with 225Ac

    Science.gov (United States)

    Robertson, Andrew K. H.; Ramogida, Caterina F.; Kunz, Peter; Rodriguez-Rodriguez, Cristina; Schaffer, Paul; Sossi, Vesna

    2016-09-01

    Due to the high linear energy transfer and short range of alpha-radiation, targeted radiation therapy using alpha-emitting pharmaceuticals that successfully target small disease clusters will kill target cells with limited harm to healthy tissue, potentially treating the most aggressive forms of cancer. As the parent of a decay chain with four alpha- and two beta-decays, 225Ac is a promising candidate for such a treatment. However, this requires retention of the entire decay chain at the target site, preventing the creation of freely circulating alpha-emitters that reduce therapeutic effect and increase toxicity to non-target tissues. Two major challenges to 225Ac pharmaceutical development exist: insufficient global supply, and the difficulty of preventing toxicity by retaining the entire decay chain at the target site. While TRIUMF works towards large-scale (C i amounts) production of 225Ac, we already use our Isotope Separation On-Line facility to provide small (< 1 mCi) quantities for in-house chemistry and imaging research that aims to improve and assess 225Ac radiopharmaceutical targeting. This presentation provides an overview of this research program and the journey of 225Ac from the beamline to the scanner. This research is funded by the Natural Sciences and Engineering Research Council of Canada.

  13. single-phase dc phase dc-ac boost converter ac boost converter

    African Journals Online (AJOL)

    User

    supply (UPS) AC motor drives and other power sup systems, need to step-up the DC input voltage. increase the output voltage level in order requirements, DC-DC boost converter is used provide DC bus voltage for PWM inverters. Hence, conventional design always cascades DC and a separate DC-AC converter.

  14. Approaches to building single-stage AC/AC conversion switch-mode audio power amplifiers

    DEFF Research Database (Denmark)

    Ljusev, Petar; Andersen, Michael Andreas E.

    2004-01-01

    This paper discusses the possible topologies and promising approaches towards direct single-phase AC-AC conversion of the mains voltage for audio applications. When compared to standard Class-D switching audio power amplifiers with a separate power supply, it is expected that direct conversion...

  15. 21 CFR 886.4440 - AC-powered magnet.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 8 2010-04-01 2010-04-01 false AC-powered magnet. 886.4440 Section 886.4440 Food... DEVICES OPHTHALMIC DEVICES Surgical Devices § 886.4440 AC-powered magnet. (a) Identification. An AC-powered magnet is an AC-powered device that generates a magnetic field intended to find and remove...

  16. Alternating current (AC) iontophoretic transport across human epidermal membrane: effects of AC frequency and amplitude.

    Science.gov (United States)

    Yan, Guang; Xu, Qingfang; Anissimov, Yuri G; Hao, Jinsong; Higuchi, William I; Li, S Kevin

    2008-03-01

    As a continuing effort to understand the mechanisms of alternating current (AC) transdermal iontophoresis and the iontophoretic transport pathways in the stratum corneum (SC), the objectives of the present study were to determine the interplay of AC frequency, AC voltage, and iontophoretic transport of ionic and neutral permeants across human epidermal membrane (HEM) and use AC as a means to characterize the transport pathways. Constant AC voltage iontophoresis experiments were conducted with HEM in 0.10 M tetraethyl ammonium pivalate (TEAP). AC frequencies ranging from 0.0001 to 25 Hz and AC applied voltages of 0.5 and 2.5 V were investigated. Tetraethyl ammonium (TEA) and arabinose (ARA) were the ionic and neutral model permeants, respectively. In data analysis, the logarithm of the permeability coefficients of HEM for the model permeants was plotted against the logarithm of the HEM electrical resistance for each AC condition. As expected, linear correlations between the logarithms of permeability coefficients and the logarithms of resistances of HEM were observed, and the permeability data were first normalized and then compared at the same HEM electrical resistance using these correlations. Transport enhancement of the ionic permeant was significantly larger than that of the neutral permeant during AC iontophoresis. The fluxes of the ionic permeant during AC iontophoresis of 2.5 V in the frequency range from 5 to 1,000 Hz were relatively constant and were approximately 4 times over those of passive transport. When the AC frequency decreased from 5 to 0.001 Hz at 2.5 V, flux enhancement increased to around 50 times over passive transport. While the AC frequency for achieving the full effect of iontophoretic enhancement at low AC frequency was lower than anticipated, the frequency for approaching passive diffusion transport at high frequency was higher than expected from the HEM morphology. These observations are consistent with a transport model of multiple

  17. A New Method for Immobilization of His-Tagged Proteins with the Application of Low-Frequency AC Electric Field.

    Science.gov (United States)

    Takahashi, Shunsuke; Kishi, Kazuki; Hiraga, Ryota; Hayashi, Kazuki; Mamada, Youhei; Oshige, Masahiko; Katsura, Shinji

    2018-03-05

    Continued advancement of protein array, bioelectrode, and biosensor technologies is necessary to develop methods for higher amount and highly oriented immobilization activity of proteins. In pursuit of these goals, we developed a new immobilization method by combining electrostatic transport and subsequent molecular diffusion of protein molecules. Our developed immobilization method is based on a model that transports proteins toward the substrate surface due to steep concentration gradient generated by low-frequency AC electric field. The immobilization of the maximum amounts can be obtained by the application of the AC voltage of 80 Vpp, 20 Hz both for His-tagged Green Fluorescent Protein (GFP) and Discosoma sp. Red Fluorescent Protein (DsRed), used as model proteins. The amounts of the immobilized His-tagged GFP and DsRed were approximately seven-fold higher than that in the absence of the application of low-frequency AC electric field. Furthermore, the positively and negatively charged His-tagged GFP at acidic and alkaline pH were immobilized by applying of low-frequency AC electric field, whereas the non-charged His-tagged GFP at the pH corresponding to its isoelectric point (pI) was not immobilized. Therefore, unless the pH is equal to pI, the immobilization of electrically charged proteins was strongly enhanced through electrostatic transport and subsequent molecular diffusion.

  18. A New Method for Immobilization of His-Tagged Proteins with the Application of Low-Frequency AC Electric Field

    Directory of Open Access Journals (Sweden)

    Shunsuke Takahashi

    2018-03-01

    Full Text Available Continued advancement of protein array, bioelectrode, and biosensor technologies is necessary to develop methods for higher amount and highly oriented immobilization activity of proteins. In pursuit of these goals, we developed a new immobilization method by combining electrostatic transport and subsequent molecular diffusion of protein molecules. Our developed immobilization method is based on a model that transports proteins toward the substrate surface due to steep concentration gradient generated by low-frequency AC electric field. The immobilization of the maximum amounts can be obtained by the application of the AC voltage of 80 Vpp, 20 Hz both for His-tagged Green Fluorescent Protein (GFP and Discosoma sp. Red Fluorescent Protein (DsRed, used as model proteins. The amounts of the immobilized His-tagged GFP and DsRed were approximately seven-fold higher than that in the absence of the application of low-frequency AC electric field. Furthermore, the positively and negatively charged His-tagged GFP at acidic and alkaline pH were immobilized by applying of low-frequency AC electric field, whereas the non-charged His-tagged GFP at the pH corresponding to its isoelectric point (pI was not immobilized. Therefore, unless the pH is equal to pI, the immobilization of electrically charged proteins was strongly enhanced through electrostatic transport and subsequent molecular diffusion.

  19. Control of grid interactive AC microgrids

    DEFF Research Database (Denmark)

    Wang, Xiongfei; Guerrero, Josep M.; Chen, Zhe

    2010-01-01

    Over the last decade, distributed energy resources (DER) technology has undergone a fast development. Increased penetration of DER units and wide spread use of renewable energy sources challenge the entire architecture of traditional power system. Microgrid, characterizing higher flexibility...... and reliability, becomes an attractive candidate for the configuration of future electrical power system. This paper gives a brief review of grid interactive ac microgrid configurations. Control methods for power electronics interfaced DER units in grid interactive ac microgrids are discussed. In addition......, microgrid controls and power management strategies are presented. Future trends of microgrid are discussed pointing out how this concept can be a key to achieve a more intelligent and flexible AC grid....

  20. ac propulsion system for an electric vehicle

    Science.gov (United States)

    Geppert, S.

    1980-01-01

    It is pointed out that dc drives will be the logical choice for current production electric vehicles (EV). However, by the mid-80's, there is a good chance that the price and reliability of suitable high-power semiconductors will allow for a competitive ac system. The driving force behind the ac approach is the induction motor, which has specific advantages relative to a dc shunt or series traction motor. These advantages would be an important factor in the case of a vehicle for which low maintenance characteristics are of primary importance. A description of an EV ac propulsion system is provided, taking into account the logic controller, the inverter, the motor, and a two-speed transmission-differential-axle assembly. The main barrier to the employment of the considered propulsion system in EV is not any technical problem, but inverter transistor cost.

  1. Superconducting three element synchronous ac machine

    International Nuclear Information System (INIS)

    Boyer, L.; Chabrerie, J.P.; Mailfert, A.; Renard, M.

    1975-01-01

    There is a growing interest in ac superconducting machines. Of several new concepts proposed for these machines in the last years one of the most promising seems to be the ''three elements'' concept which allows the cancellation of the torque acting on the superconducting field winding, thus overcoming some of the major contraints. This concept leads to a device of induction-type generator. A synchronous, three element superconducting ac machine is described, in which a room temperature, dc fed rotating winding is inserted between the superconducting field winding and the ac armature. The steady-state machine theory is developed, the flux linkages are established, and the torque expressions are derived. The condition for zero torque on the field winding, as well as the resulting electrical equations of the machine, are given. The theoretical behavior of the machine is studied, using phasor diagrams and assuming for the superconducting field winding either a constant current or a constant flux condition

  2. Red blood cell production

    Science.gov (United States)

    ... bone marrow of bones. Stem cells in the red bone marrow called hemocytoblasts give rise to all of the formed elements in blood. If a hemocytoblast commits to becoming a cell called a proerythroblast, it will develop into a new red blood cell. The formation of a red blood ...

  3. RED-ML

    DEFF Research Database (Denmark)

    Xiong, Heng; Liu, Dongbing; Li, Qiye

    2017-01-01

    using diverse RNA-seq datasets, we have developed a software tool, RED-ML: RNA Editing Detection based on Machine learning (pronounced as "red ML"). The input to RED-ML can be as simple as a single BAM file, while it can also take advantage of matched genomic variant information when available...

  4. Nuclear structure of {sup 231}Ac

    Energy Technology Data Exchange (ETDEWEB)

    Boutami, R. [Instituto de Estructura de la Materia, CSIC, Serrano 113 bis, E-28006 Madrid (Spain); Borge, M.J.G. [Instituto de Estructura de la Materia, CSIC, Serrano 113 bis, E-28006 Madrid (Spain)], E-mail: borge@iem.cfmac.csic.es; Mach, H. [Department of Radiation Sciences, ISV, Uppsala University, SE-751 21 Uppsala (Sweden); Kurcewicz, W. [Department of Physics, University of Warsaw, Pl-00 681 Warsaw (Poland); Fraile, L.M. [Departamento Fisica Atomica, Molecular y Nuclear, Facultad CC. Fisicas, Universidad Complutense, E-28040 Madrid (Spain); ISOLDE, PH Department, CERN, CH-1211 Geneva 23 (Switzerland); Gulda, K. [Department of Physics, University of Warsaw, Pl-00 681 Warsaw (Poland); Aas, A.J. [Department of Chemistry, University of Oslo, PO Box 1033, Blindern, N-0315 Oslo (Norway); Garcia-Raffi, L.M. [Instituto de Fisica Corpuscular, CSIC - Universidad de Valencia, Apdo. 22805, E-46071 Valencia (Spain); Lovhoiden, G. [Department of Physics, University of Oslo, PO Box 1048, Blindern, N-0316 Oslo (Norway); Martinez, T.; Rubio, B.; Tain, J.L. [Instituto de Fisica Corpuscular, CSIC - Universidad de Valencia, Apdo. 22805, E-46071 Valencia (Spain); Tengblad, O. [Instituto de Estructura de la Materia, CSIC, Serrano 113 bis, E-28006 Madrid (Spain); ISOLDE, PH Department, CERN, CH-1211 Geneva 23 (Switzerland)

    2008-10-15

    The low-energy structure of {sup 231}Ac has been investigated by means of {gamma} ray spectroscopy following the {beta}{sup -} decay of {sup 231}Ra. Multipolarities of 28 transitions have been established by measuring conversion electrons with a MINI-ORANGE electron spectrometer. The decay scheme of {sup 231}Ra {yields}{sup 231}Ac has been constructed for the first time. The Advanced Time Delayed {beta}{gamma}{gamma}(t) method has been used to measure the half-lives of five levels. The moderately fast B(E1) transition rates derived suggest that the octupole effects, albeit weak, are still present in this exotic nucleus.

  5. Preliminary study on AC superconducting machines

    International Nuclear Information System (INIS)

    Yamamoto, M.; Ishigohka, T.; Shimohka, T.; Mizukami, N.; Yamaguchi, M.

    1988-01-01

    This paper describes the issues involved in developing AC superconducting machines. In the first phase, as a preliminary experiment, a 4kVa AC superconducting coil which employs 100A class 50/60Hz superconductors is made and tested. And, in the second phase, as an extension of the 4kVa coil, a model superconducting transformer is made and examined. The transformer has a novel quench protection system with an auxiliary coil only in the low voltage side. The behavior of the overcurrent protection system is confirmed

  6. AC conductivity for a holographic Weyl semimetal

    Energy Technology Data Exchange (ETDEWEB)

    Grignani, Gianluca; Marini, Andrea; Peña-Benitez, Francisco; Speziali, Stefano [Dipartimento di Fisica e Geologia, Università di Perugia,I.N.F.N. Sezione di Perugia,Via Pascoli, I-06123 Perugia (Italy)

    2017-03-23

    We study the AC electrical conductivity at zero temperature in a holographic model for a Weyl semimetal. At small frequencies we observe a linear dependence in the frequency. The model shows a quantum phase transition between a topological semimetal (Weyl semimetal phase) with a non vanishing anomalous Hall conductivity and a trivial semimetal. The AC conductivity has an intermediate scaling due to the presence of a quantum critical region in the phase diagram of the system. The phase diagram is reconstructed using the scaling properties of the conductivity. We compare with the experimental data of https://www.doi.org/10.1103/PhysRevB.93.121110 obtaining qualitative agreement.

  7. Effective Peroxidase-Like Activity of Co-Aminoclay [CoAC] and Its Application for Glucose Detection

    Directory of Open Access Journals (Sweden)

    Han Pill Song

    2018-02-01

    Full Text Available In this study, we describe a novel peroxidase-like activity of Co-aminoclay [CoAC] present at pH ~5.0 and its application to fluorescent biosensor for the determination of H2O2 and glucose. It is synthesized with aminoclays (ACs entrapping cationic metals such as Fe, Cu, Al, Co., Ce, Ni, Mn, and Zn to find enzyme mimicking ACs by sol–gel ambient conditions. Through the screening of catalytic activities by the typical colorimetric reaction employing 2,2′-azino-bis(3-ethylbenzo-thiazoline-6-sulfonic aciddiammonium salt (ABTS as a substrate with or without H2O2, Fe, Cu, and CoACs are found to exhibit peroxidase-like activity, as well as oxidase-like activity was observed from Ce and MnACs. Among them, CoAC shows exceptionally high peroxidase-like activity, presumably due to its ability to induce electron transfer between substrates and H2O2. CoAC is then used to catalyze the oxidation of Amplex® UltraRed (AUR into a fluorescent end product, which enables a sensitive fluorescent detection of H2O2. Moreover, a highly sensitive and selective glucose biosensing strategy is developed, based on enzyme cascade reaction between glucose oxidase (GOx and CoAC. Using this strategy, a highly linear fluorescence enhancement is verified when the concentration of glucose is increased in a wide range from 10 μM to 1 mM with a lower detection limit of 5 μM. The practical diagnostic capability of the assay system is also verified by its use to detect glucose in human blood serum. Based on these results, it is anticipated that CoAC can serve as potent peroxidase mimetics for the detection of clinically important target molecules.

  8. Multi-phase AC/AC step-down converter for distribution systems

    Energy Technology Data Exchange (ETDEWEB)

    Aeloiza, Eddy C.; Burgos, Rolando P.

    2017-10-25

    A step-down AC/AC converter for use in an electric distribution system includes at least one chopper circuit for each one of a plurality of phases of the AC power, each chopper circuit including a four-quadrant switch coupled in series between primary and secondary sides of the chopper circuit and a current-bidirectional two-quadrant switch coupled between the secondary side of the chopper circuit and a common node. Each current-bidirectional two-quadrant switch is oriented in the same direction, with respect to the secondary side of the corresponding chopper circuit and the common node. The converter further includes a control circuit configured to pulse-width-modulate control inputs of the switches, to convert a first multiphase AC voltage at the primary sides of the chopper circuits to a second multiphase AC voltage at the secondary sides of the chopper circuits, the second multiphase AC voltage being lower in voltage than the first multiphase AC voltage.

  9. Brazilian Angiostrongylus cantonensis haplotypes, ac8 and ac9, have two different biological and morphological profiles

    Directory of Open Access Journals (Sweden)

    Tainá CC Monte

    2014-12-01

    Full Text Available Angiostrongylus cantonensis is the etiologic agent of eosinophilic meningoencephalitis in humans. Cases have been recorded in many parts of the world, including Brazil. The aim of this study was to compare the differences in the biology and morphology of two different Brazilian haplotypes of A. : ac8 and ac9. A significantly larger number of L1 larvae eliminated in the faeces of rodents at the beginning of the patent period was observed for ac9 haplotype and compared to the total of L1 larvae eliminated, there was a significant difference between the two haplotypes. The ac9 haplotype showed a significant difference in the proportion of female and male specimens (0.6:1, but the same was not observed for ac8 (1.2:1. The morphometric analysis showed that male and female specimens isolated from ac8 haplotype were significantly larger with respect to body length, oesophagus length, spicule length (male and distance from the anus to the rear end (female compared to specimens from ac9. The morphological analysis by light microscopy showed little variation in the level of bifurcations at the lateral rays in the right lobe of the copulatory bursa between the two haplotypes. The biological, morphological and morphometric variations observed between the two haplotypes agree with the observed variation at the molecular level using the cytochrome oxidase subunit I marker and reinforce the possible influence of geographical isolation on the development of these haplotypes.

  10. Brazilian Angiostrongylus cantonensis haplotypes, ac8 and ac9, have two different biological and morphological profiles.

    Science.gov (United States)

    Monte, Tainá C C; Gentile, Rosana; Garcia, Juberlan; Mota, Ester; Santos, Jeannie N; Maldonado Júnior, Arnaldo

    2014-12-01

    Angiostrongylus cantonensis is the etiologic agent of eosinophilic meningoencephalitis in humans. Cases have been recorded in many parts of the world, including Brazil. The aim of this study was to compare the differences in the biology and morphology of two different Brazilian haplotypes of A. cantonensis: ac8 and ac9. A significantly larger number of L1 larvae eliminated in the faeces of rodents at the beginning of the patent period was observed for ac9 haplotype and compared to the total of L1 larvae eliminated, there was a significant difference between the two haplotypes. The ac9 haplotype showed a significant difference in the proportion of female and male specimens (0.6:1), but the same was not observed for ac8 (1.2:1). The morphometric analysis showed that male and female specimens isolated from ac8 haplotype were significantly larger with respect to body length, oesophagus length, spicule length (male) and distance from the anus to the rear end (female) compared to specimens from ac9. The morphological analysis by light microscopy showed little variation in the level of bifurcations at the lateral rays in the right lobe of the copulatory bursa between the two haplotypes. The biological, morphological and morphometric variations observed between the two haplotypes agree with the observed variation at the molecular level using the cytochrome oxidase subunit I marker and reinforce the possible influence of geographical isolation on the development of these haplotypes.

  11. The Acute Red Eye

    Directory of Open Access Journals (Sweden)

    Megan Boysen Osborn

    2016-09-01

    Full Text Available Audience: This modified team-based learning (mTBL exercise is appropriate for junior or senior emergency medicine learners. Introduction: The acute red eye is a common chief complaint in the emergency department. It is essential that the emergency physician be knowledgeable about the differential diagnosis for the acute red eye and be able to distinguish between benign and sinister causes of the acute red eye. Objectives: By the end of this educational session, the learner will: 1 list 10 major causes for an acute red eye; 2 describe historical features that help distinguish between benign and serious causes of the acute red eye; 3 describe physical examination features that help distinguish between benign and serious causes of the acute red eye; and 4 use historical and physical examination features to distinguish between the 10 different causes of the acute red eye. Method: This is an mTBL session.

  12. AC power generation from microbial fuel cells

    Science.gov (United States)

    Lobo, Fernanda Leite; Wang, Heming; Forrestal, Casey; Ren, Zhiyong Jason

    2015-11-01

    Microbial fuel cells (MFCs) directly convert biodegradable substrates to electricity and carry good potential for energy-positive wastewater treatment. However, the low and direct current (DC) output from MFC is not usable for general electronics except small sensors, yet commercial DC-AC converters or inverters used in solar systems cannot be directly applied to MFCs. This study presents a new DC-AC converter system for MFCs that can generate alternating voltage in any desired frequency. Results show that AC power can be easily achieved in three different frequencies tested (1, 10, 60 Hz), and no energy storage layer such as capacitors was needed. The DC-AC converter efficiency was higher than 95% when powered by either individual MFCs or simple MFC stacks. Total harmonic distortion (THD) was used to investigate the quality of the energy, and it showed that the energy could be directly usable for linear electronic loads. This study shows that through electrical conversion MFCs can be potentially used in household electronics for decentralized off-grid communities.

  13. Control of Power Converters in AC Microgrids

    DEFF Research Database (Denmark)

    Rocabert, Joan; Luna, Alvaro; Blaabjerg, Frede

    2012-01-01

    The enabling of ac microgrids in distribution networks allows delivering distributed power and providing grid support services during regular operation of the grid, as well as powering isolated islands in case of faults and contingencies, thus increasing the performance and reliability of the ele...

  14. http://spilplus.journals.ac.za/

    African Journals Online (AJOL)

    intuition and reason, not by perception and induction'. On the Platonist view, because sentences cannot have either spatial or temporal location, they cannot have material properties either. This timeless and 'spaceless' nature of sentences Katz and Postal (1989:7) illustrate with reference http://spilplus.journals.ac.za/ ...

  15. http://spilplus.journals.ac.za/

    African Journals Online (AJOL)

    deficiency, but to boorishness or ill-will. While grammatical error may reveal a speaker to be a less than proficient language- http://spilplus.journals.ac.za/ .... problems of meanlng, language use and the various linguistic aspects of interaction... contrastive analysis without a pragmalinguistic dimension is inadequate.".

  16. http://spilplus.journals.ac.za/

    African Journals Online (AJOL)

    in general terms,. ° what does Gutt see as significant conceptual consequences of his work? Needless to say, the framework for this talk will be Sperber and. Wilson's relevance theory of verbal communication, which was sketched in yesterday's contribution by Melinda Sinclair. Within http://spilplus.journals.ac.za/ ...

  17. Operating experience with factory-made air-insulated 1AC/2AC switchgear systems; Erste Betriebserfahrungen mit fabrikgefertigten, luftisolierten 1AC-/2AC-Schaltanlagen

    Energy Technology Data Exchange (ETDEWEB)

    Northe, J. [Balfour Beatty Rail GmbH, Offenbach (Germany); Loenard, D. [Bombardier Transportation GmbH, Mannheim (Germany)

    2007-07-01

    Today, factory-made air-insulated switchgear systems of the type TracFeed {sup registered} are available for all supply versions of 16.7 Hz and 50 Hz a.c. railways. These are supported by auxiliary equipment to ensure reliable railway operation through specific protective functions and a simplified line test. (orig.)

  18. Modeling of long High Voltage AC Underground

    DEFF Research Database (Denmark)

    Gudmundsdottir, Unnur Stella; Bak, Claus Leth; Wiechowski, W. T.

    2010-01-01

    This paper presents the work and findings of a PhD project focused on accurate high frequency modelling of long High Voltage AC Underground cables. The project is cooperation between Aalborg University and Energinet.dk. The objective of the project is to investigate the accuracy of most up to dat...

  19. Evaluation of Mercury Contamination in Fungi Boletus Species from Latosols, Lateritic Red Earths, and Red and Yellow Earths in the Circum-Pacific Mercuriferous Belt of Southwestern China

    OpenAIRE

    Falandysz, Jerzy; Zhang, Ji; Wang, Yuan-Zhong; Saba, Martyna; Krasi?ska, Gra?yna; Wiejak, Anna; Li, Tao

    2015-01-01

    For the first time, highly elevated levels of mercury (Hg) have been documented for several species of the edible Fungi genus Boletus growing in latosols, lateritic red earths, and red and yellow earths from the Yunnan province of China. Analysis of Hg concentrations in the genus suggests that geogenic Hg is the dominant source of Hg in the fungi, whereas anthropogenic sources accumulate largely in the organic layer of the forest soil horizon. Among the 21 species studied from 32 locations ac...

  20. Impedance Spectroscopy and AC Conductivity Studies of Bulk 3-Amino-7-(dimethylamino)-2-methyl-hydrochloride

    Science.gov (United States)

    El-Shabaan, M. M.

    2018-02-01

    Impedance spectroscopy and alternating-current (AC) conductivity (σ AC) studies of bulk 3-amino-7-(dimethylamino)-2-methyl-hydrochloride (neutral red, NR) have been carried out over the temperature (T) range from 303 K to 383 K and frequency (f) range from 0.5 kHz to 5 MHz. Dielectric data were analyzed using the complex impedance (Z *) and complex electric modulus (M *) for bulk NR at various temperatures. The impedance loss peaks were found to shift towards high frequencies, indicating an increase in the relaxation time (τ 0) and loss in the material, with increasing temperature. For each temperature, a single depressed semicircle was observed at high frequencies, originating from the bulk transport, and a spike in the low-frequency region, resulting from the electrode effect. Fitting of these curves yielded an equivalent circuit containing a parallel combination of a resistance R and constant-phase element (CPE) Q. The carrier transport in bulk NR is governed by the correlated barrier hopping (CBH) mechanism, some parameters of which, such as the maximum barrier height (W M), charge density (N), and hopping distance (r), were determined as functions of both temperature and frequency. The frequency dependence of σ AC at different temperatures indicated that the conduction in bulk NR is a thermally activated process. The σ AC value at different frequencies increased linearly with temperature.

  1. Digital model for harmonic interactions in AC/DC/AC systems

    Energy Technology Data Exchange (ETDEWEB)

    Guarini, A.P.; Rangel, R.D.; Pilotto, L.A.S.; Pinto, R.J.; Passos Junior, R. [Centro de Pesquisas de Energia Eletrica (CEPEL), Rio de Janeiro, RJ (Brazil)

    1994-12-31

    The main purpose of this paper is to present a model for calculation of HVdc converter harmonics taking into account the influence of the harmonic interactions between the ac systems in dc link transmissions. The ideas and methodologies used in the model development take into account the dc current ripple and ac voltage distortion in the ac systems. The theory of switching functions is applied to contemplate for the frequency conversions between the ac and dc sides, in an iterative process. It is possible then to obtain, even in balanced situations, non-characteristic harmonics that are produced by frequencies originated in the other terminal, which can be significant in a strongly coupled system, such as back-to-back configuration. (author) 9 refs., 3 figs.

  2. Approaches to building single-stage AC/AC conversion switch-mode audio power amplifiers

    Energy Technology Data Exchange (ETDEWEB)

    Ljusev, P.; Andersen, Michael A.E.

    2005-07-01

    This paper discusses the possible topologies and promising approaches towards direct single-phase AC-AC conversion of the mains voltage for audio applications. When compared to standard Class-D switching audio power amplifiers with a separate power supply, it is expected that direct conversion will provide better efficiency and higher level of integration, leading to lower component count, volume and cost, but at the expense of a minor performance deterioration. (au)

  3. Genetic assessment of captive red panda (Ailurus fulgens) population

    OpenAIRE

    Kumar, Arun; Rai, Upashna; Roka, Bhupen; Jha, Alankar K.; Reddy, P. Anuradha

    2016-01-01

    Red panda (Ailurus fulgens) is threatened across its range by detrimental human activities and rapid habitat changes necessitating captive breeding programs in various zoos globally to save this flagship species from extinction. One of the ultimate aims of ex situ conservation is reintroduction of endangered animals into their natural habitats while maintaining 90?% of the founder genetic diversity. Advances in molecular genetics and microsatellite genotyping techniques make it possible to ac...

  4. CTE Corrections for WFPC2 and ACS

    Science.gov (United States)

    Dolphin, Andrew

    2003-07-01

    The error budget for optical broadband photometry is dominated by three factors: CTE corrections, long-short anomaly corrections, and photometric zero points. Questions about the dependencies of the CTE have largely been resolved, and my CTE corrections have been included in the WFPC2 handbook and tutorial. What remains to be done is the determination of the "final" CTE correction at the end of the WFPC2 mission, which will increase the accuracy of photometry obtained in the final few cycles. The long-short anomaly is still the subject of much debate, as it remains unclear whethere or not this effect is real and, if so, what its size and nature is. Photometric zero points have likewise varied by over 0.05 magnitudes in the literature, and will likely remain unresolved until the long-short anomaly is addressed {given that most calibration exposures are short while most science exposures are long}. It is also becoming apparent that similar issues will affect the accuracy of ACS photometry, and consequently that an ACS CTE study analogous to my WFPC2 work would significantly improve the calibration of ACS. I therefore propose to use archival WFPC2 images of omega Cen and ACS images of 47 Tuc to continue my HST calibration work. I also propose to begin work on "next-generation" CTE corrections, in which corrections are applied to the images based on accurate charge-trapping models rather than to the reduced photometry. This technique will allow for more accurate CTE corrections in certain cases {such as a star above a bright star or on a variable background}, improved PSF-fitting photometry of faint stars, and image restoration for accurate analysis of extended objects.

  5. Cooperative Frequency Control for Autonomous AC Microgrids

    DEFF Research Database (Denmark)

    Shafiee, Qobad; Quintero, Juan Carlos Vasquez; Guerrero, Josep M.

    2015-01-01

    is then added to primary control, compensating the frequency drop caused by the droop mechanism. The proposed controller is fully distributed, meaning that each source exchange information with only its direct neighbors through a sparse communication network. This controller has a unique feature that it does...... not require measuring the system frequency as compared to the other presented methods. An ac Microgrid with four sources is used to verify the performance of the proposed control methodology....

  6. Collapse of DNA in ac Electric Fields

    Science.gov (United States)

    Zhou, Chunda; Reisner, Walter W.; Staunton, Rory J.; Ashan, Amir; Austin, Robert H.; Riehn, Robert

    2011-06-01

    We report that double-stranded DNA collapses in the presence of ac electric fields at frequencies of a few hundred Hertz, and does not stretch as commonly assumed. In particular, we show that confinement-stretched DNA can collapse to about one quarter of its equilibrium length. We propose that this effect is based on finite relaxation times of the counterion cloud, and the subsequent partitioning of the molecule into mutually attractive units. We discuss alternative models of those attractive units.

  7. Collapse of DNA in ac electric fields.

    Science.gov (United States)

    Zhou, Chunda; Reisner, Walter W; Staunton, Rory J; Ashan, Amir; Austin, Robert H; Riehn, Robert

    2011-06-17

    We report that double-stranded DNA collapses in the presence of ac electric fields at frequencies of a few hundred Hertz, and does not stretch as commonly assumed. In particular, we show that confinement-stretched DNA can collapse to about one quarter of its equilibrium length. We propose that this effect is based on finite relaxation times of the counterion cloud, and the subsequent partitioning of the molecule into mutually attractive units. We discuss alternative models of those attractive units.

  8. The LHC AC Dipole system: an introduction

    CERN Document Server

    Serrano, J; CERN. Geneva. BE Department

    2010-01-01

    The LHC AC Dipole is an instrument to study properties of the LHC lattice by inducing large transverse displacements in the beam. These displacements are generated by exciting the beam with an oscillating magnetic field at a frequency close to the tune. This paper presents the system requirements and the technical solution chosen to meet them, based of high-power audio amplifiers and a resonant parallel RLC circuit.

  9. Inquiring into Red/Red Inquiring

    Directory of Open Access Journals (Sweden)

    Ken Gale

    2013-05-01

    Full Text Available This layered account of an inquiry into ‘red’ emerged out of a collective biography workshop. In the middle of the Wiltshire countryside, an international and interdisciplinary group of scholars gathered together to write and make other things and marks on paper that asked questions of, and into, the spaces between words, people, things and their environments. We did not set out to workshop or write into or paint ‘red’ but, rather, it was red that slipped in, uninvited, and painted and wrote us. Red arose as a blush or a stain seeping amongst us that became referenced obliquely by material objects, metaphors and fairytales. The stain spread, became noticeable through our weekend together and beyond it, creating another (bright red artery vein of connection to write with.

  10. Direct amplitude detuning measurement with ac dipole

    Directory of Open Access Journals (Sweden)

    S. White

    2013-07-01

    Full Text Available In circular machines, nonlinear dynamics can impact parameters such as beam lifetime and could result in limitations on the performance reach of the accelerator. Assessing and understanding these effects in experiments is essential to confirm the accuracy of the magnetic model and improve the machine performance. A direct measurement of the machine nonlinearities can be obtained by characterizing the dependency of the tune as a function of the amplitude of oscillations (usually defined as amplitude detuning. The conventional technique is to excite the beam to large amplitudes with a single kick and derive the tune from turn-by-turn data acquired with beam position monitors. Although this provides a very precise tune measurement it has the significant disadvantage of being destructive. An alternative, nondestructive way of exciting large amplitude oscillations is to use an ac dipole. The perturbation Hamiltonian in the presence of an ac dipole excitation shows a distinct behavior compared to the free oscillations which should be correctly taken into account in the interpretation of experimental data. The use of an ac dipole for direct amplitude detuning measurement requires careful data processing allowing one to observe the natural tune of the machine; the feasibility of such a measurement is demonstrated using experimental data from the Large Hadron Collider. An experimental proof of the theoretical derivations based on measurements performed at injection energy is provided as well as an application of this technique at top energy using a large number of excitations on the same beam.

  11. UARS PEM Level 2 VMAG AC V001

    Data.gov (United States)

    National Aeronautics and Space Administration — The Particle Environment Monitor (PEM) level 2 Vector Magnetometer (VMAG) AC daily product contains the Vector Magnetic Field AC component. PEM was flown on the UARS...

  12. Importance of Attenuation Correction (AC) for Small Animal PET Imaging

    DEFF Research Database (Denmark)

    El Ali, Henrik H.; Bodholdt, Rasmus Poul; Jørgensen, Jesper Tranekjær

    2012-01-01

    was performed. Methods: Ten NMRI nude mice with subcutaneous implantation of human breast cancer cells (MCF-7) were scanned consecutively in small animal PET and CT scanners (MicroPETTM Focus 120 and ImTek’s MicroCATTM II). CT-based AC, PET-based AC and uniform AC methods were compared. Results: The activity...

  13. Development of a hardware-based AC microgrid for AC stability assessment

    Science.gov (United States)

    Swanson, Robert R.

    As more power electronic-based devices enable the development of high-bandwidth AC microgrids, the topic of microgrid power distribution stability has become of increased interest. Recently, researchers have proposed a relatively straightforward method to assess the stability of AC systems based upon the time-constants of sources, the net bus capacitance, and the rate limits of sources. In this research, a focus has been to develop a hardware test system to evaluate AC system stability. As a first step, a time domain model of a two converter microgrid was established in which a three phase inverter acts as a power source and an active rectifier serves as an adjustable constant power AC load. The constant power load can be utilized to create rapid power flow transients to the generating system. As a second step, the inverter and active rectifier were designed using a Smart Power Module IGBT for switching and an embedded microcontroller as a processor for algorithm implementation. The inverter and active rectifier were designed to operate simultaneously using a synchronization signal to ensure each respective local controller operates in a common reference frame. Finally, the physical system was created and initial testing performed to validate the hardware functionality as a variable amplitude and variable frequency AC system.

  14. http://spilplus.journals.ac.za/

    African Journals Online (AJOL)

    1989. Linguicism-. structures and ideologies in linguistic imperialism. In. Skutnabb-Kangas,. T. & J. Cummins (reds.): MINORITY. EDUCATION: FROM SHAME TO STRUGGLE. Clevedon: Multi- lingual Matters, pp. 339-358. SAVI. 1992. The professional status of translators and interpreters. In SAVI BULLETIN, 1/92, pp. 4-6,.

  15. MATHEMATICAL MODELING OF AC ELECTRIC POINT MOTOR

    Directory of Open Access Journals (Sweden)

    S. YU. Buryak

    2014-03-01

    Full Text Available Purpose. In order to ensure reliability, security, and the most important the continuity of the transportation process, it is necessary to develop, implement, and then improve the automated methods of diagnostic mechanisms, devices and rail transport systems. Only systems that operate in real time mode and transmit data on the instantaneous state of the control objects can timely detect any faults and thus provide additional time for their correction by railway employees. Turnouts are one of the most important and responsible components, and therefore require the development and implementation of such diagnostics system.Methodology. Achieving the goal of monitoring and control of railway automation objects in real time is possible only with the use of an automated process of the objects state diagnosing. For this we need to know the diagnostic features of a control object, which determine its state at any given time. The most rational way of remote diagnostics is the shape and current spectrum analysis that flows in the power circuits of railway automatics. Turnouts include electric motors, which are powered by electric circuits, and the shape of the current curve depends on both the condition of the electric motor, and the conditions of the turnout maintenance. Findings. For the research and analysis of AC electric point motor it was developed its mathematical model. The calculation of parameters and interdependencies between the main factors affecting the operation of the asynchronous machine was conducted. The results of the model operation in the form of time dependences of the waveform curves of current on the load on engine shaft were obtained. Originality. During simulation the model of AC electric point motor, which satisfies the conditions of adequacy was built. Practical value. On the basis of the constructed model we can study the AC motor in various mode of operation, record and analyze current curve, as a response to various changes

  16. DC injection into low voltage AC networks

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2005-07-01

    This report summarises the results of a study investigating the impact of levels of injected DC current injections on a low voltage AC distribution network systems in order to recommend acceptable limits of DC from microgeneration. Relevant literature is reviewed, and the impact of DC levels in distribution transformers, transformer modelling, and instrumental transformers are discussed. The impact of DC in residual current devices (RCD) and in domestic electricity watt hour meters is examined along with DC enhanced corrosion, corrosion failure, and the measurement of DC current injection. Sources of DC injection outlined include DC from computer power supplies, network faults, geomagnetic phenomena, lighting circuits/dimmers, and embedded generators.

  17. Flexible AC transmission systems modelling and control

    CERN Document Server

    Zhang, Xiao-Ping; Pal, Bikash

    2012-01-01

    The extended and revised second edition of this successful monograph presents advanced modeling, analysis and control techniques of Flexible AC Transmission Systems (FACTS). The book covers comprehensively a range of power-system control problems: from steady-state voltage and power flow control, to voltage and reactive power control, to voltage stability control, to small signal stability control using FACTS controllers. In the six years since the first edition of the book has been published research on the FACTS has continued to flourish while renewable energy has developed into a mature and

  18. GRID-CONNECTECD DOUBLE-STAGE AC-AC POWER CONVERTER FOR CSP RENEWABLE ENERGY SYSTEMS

    OpenAIRE

    Sorrentino, Vincenzo

    2015-01-01

    In the last years the renewable energy sources have known a state of their advanced diffusion considering their advantages compared to the traditional energy sources like fossil fuels. For this reason the combined heat and power (CHP) plant fueled by renewable sources are widely used. The purpose of this Ph.D. thesis is the design of a new Grid-connected Double-Stage AC-DC/DC-AC Power Converter (DSACPC) for a Concentrating Solar plant for Combined generation of Heat and Power (CS-CHP), th...

  19. Comportamento Acústico de Fachadas: Isolamento Acústico versus Permeabilidade ao Ar

    OpenAIRE

    Ferreira, Diogo Miguel do Rosário

    2016-01-01

    Nos dias de hoje, o conforto acústico dos edifícios revela-se como um factor muito importante no contexto da comodidade global dos seus habitantes. Para tanto, contribui de forma relevante o isolamento sonoro que as fachadas dos edifícios possam assegurar. Sendo as fachadas constituídas por uma parte opaca e uma outra translúcida, é esta última a que mais condiciona o isolamento acústico que o elemento fachada proporciona, o qual é influenciado tanto pela janela propriamente dita, como pelas ...

  20. Next generation red teaming

    CERN Document Server

    Dalziel, Henry

    2015-01-01

    Red Teaming is can be described as a type of wargaming.In private business, penetration testers audit and test organization security, often in a secretive setting. The entire point of the Red Team is to see how weak or otherwise the organization's security posture is. This course is particularly suited to CISO's and CTO's that need to learn how to build a successful Red Team, as well as budding cyber security professionals who would like to learn more about the world of information security. Teaches readers how to dentify systemic security issues based on the analysis of vulnerability and con

  1. Deletion of the AcMNPV core gene ac109 results in budded virions that are non-infectious

    International Nuclear Information System (INIS)

    Fang Minggang; Nie, Yingchao; Theilmann, David A.

    2009-01-01

    Autographa californica multiple nucleopolyhedrovirus (AcMNPV) ac109 is a core gene and its function in the virus life cycle is unknown. To determine its role in the baculovirus life cycle, we used the AcMNPV bacmid system to generate an ac109 deletion virus (vAc 109KO ). Fluorescence and light microscopy showed that transfection of vAc 109KO results in a single-cell infection phenotype. Viral DNA replication is unaffected and the development of occlusion bodies in vAc 109KO -transfected cells evidenced progression to the very late phases of viral infection. Western blot and confocal immunofluorescence analysis showed that AC109 is expressed in the cytoplasm and nucleus throughout infection. In addition, AC109 is a structural protein as it was detected in both budded virus (BV) and occlusion derived virus in both the envelope and nucleocapsid fractions. Titration assays by qPCR and TCID 50 showed that vAc 109KO produced BV but the virions are non-infectious. The vAc 109KO BV were indistinguishable from the BV of repaired and wild type control viruses as determined by negative staining and electron microscopy.

  2. Habitat Characteristics of Active and Abandoned Red-Cockaded Woodpecker Colonies

    Science.gov (United States)

    Susan C. Loeb; William D. Pepper; Arlene T. Doyle

    1992-01-01

    Active red-cockaded woodpecker (Picoides borealis) colonies in the Piedmont of Georgia are mature pine stands (mean age = 87 ± 1 yr old) with relatively sparse midstories (mean basal area = 31 ± 3 ft2/ac). Active and abandoned colony sites have similar overstory characteristics, but midstories are significantly denser in...

  3. Modeling and reliability analysis of three phase z-source AC-AC converter

    Directory of Open Access Journals (Sweden)

    Prasad Hanuman

    2017-12-01

    Full Text Available This paper presents the small signal modeling using the state space averaging technique and reliability analysis of a three-phase z-source ac-ac converter. By controlling the shoot-through duty ratio, it can operate in buck-boost mode and maintain desired output voltage during voltage sag and surge condition. It has faster dynamic response and higher efficiency as compared to the traditional voltage regulator. Small signal analysis derives different control transfer functions and this leads to design a suitable controller for a closed loop system during supply voltage variation. The closed loop system of the converter with a PID controller eliminates the transients in output voltage and provides steady state regulated output. The proposed model designed in the RT-LAB and executed in a field programming gate array (FPGA-based real-time digital simulator at a fixedtime step of 10 μs and a constant switching frequency of 10 kHz. The simulator was developed using very high speed integrated circuit hardware description language (VHDL, making it versatile and moveable. Hardware-in-the-loop (HIL simulation results are presented to justify the MATLAB simulation results during supply voltage variation of the three phase z-source ac-ac converter. The reliability analysis has been applied to the converter to find out the failure rate of its different components.

  4. Red Hill Updates

    Science.gov (United States)

    This and other periodic updates are intended to keep the public informed on major progress being made to protect public health and the environment at the Red Hill Underground Fuel Storage Facility in Hawaii.

  5. Adsorption behavior of direct red 80 and congo red onto activated carbon/surfactant: Process optimization, kinetics and equilibrium

    Science.gov (United States)

    Cheng, Zhengjun; Zhang, Lei; Guo, Xiao; Jiang, Xiaohui; Li, Tian

    2015-02-01

    Adsorptions of congo red and direct red 80 onto activated carbon/surfactant from aqueous solution were optimized. The Box-Behnken design (BBD) has been employed to analyze the effects of concentration of surfactant, temperature, pH, and initial concentration of the dye in the adsorption capacity. Their corresponding experimental data could be evaluated excellently by second order polynomial regression models and the two models were also examined based on the analysis of variance and t test statistics, respectively. The optimum conditions were obtained as follows: Cs = 34.10 μM, T = 50 °C, pH = 3.5, and CCR = 160 mg/L for the congo red system, and Cs = 34.10 μM, T = 50 °C, pH = 6.1, and CDR80 = 110 mg/L for the direct red 80 system. And in these conditions, the measured experimental maximum adsorption capacities for the congo red and direct red 80 removals were 769.48 mg/g and 519.90 mg/g, which were consistent with their corresponding predicted values, with small relative errors of -2.81% and -0.67%, respectively. The adsorption equilibrium and kinetics for the two dye adsorptions onto AC/DDAC were also investigated. The experimental data were fitted by four isotherm models, and Langmuir model presented the best fit. The kinetic studies indicated that the kinetic data followed the pseudo-second-order model.

  6. Alterations of red cell membrane properties in neuroacanthocytosis.

    Directory of Open Access Journals (Sweden)

    Claudia Siegl

    Full Text Available Neuroacanthocytosis (NA refers to a group of heterogenous, rare genetic disorders, namely chorea acanthocytosis (ChAc, McLeod syndrome (MLS, Huntington's disease-like 2 (HDL2 and pantothenate kinase associated neurodegeneration (PKAN, that mainly affect the basal ganglia and are associated with similar neurological symptoms. PKAN is also assigned to a group of rare neurodegenerative diseases, known as NBIA (neurodegeneration with brain iron accumulation, associated with iron accumulation in the basal ganglia and progressive movement disorder. Acanthocytosis, the occurrence of misshaped erythrocytes with thorny protrusions, is frequently observed in ChAc and MLS patients but less prevalent in PKAN (about 10% and HDL2 patients. The pathological factors that lead to the formation of the acanthocytic red blood cell shape are currently unknown. The aim of this study was to determine whether NA/NBIA acanthocytes differ in their functionality from normal erythrocytes. Several flow-cytometry-based assays were applied to test the physiological responses of the plasma membrane, namely drug-induced endocytosis, phosphatidylserine exposure and calcium uptake upon treatment with lysophosphatidic acid. ChAc red cell samples clearly showed a reduced response in drug-induced endovesiculation, lysophosphatidic acid-induced phosphatidylserine exposure, and calcium uptake. Impaired responses were also observed in acanthocyte-positive NBIA (PKAN red cells but not in patient cells without shape abnormalities. These data suggest an "acanthocytic state" of the red cell where alterations in functional and interdependent membrane properties arise together with an acanthocytic cell shape. Further elucidation of the aberrant molecular mechanisms that cause this acanthocytic state may possibly help to evaluate the pathological pathways leading to neurodegeneration.

  7. The sluggs survey: HST/ACS mosaic imaging of the NGC 3115 globular cluster system

    Energy Technology Data Exchange (ETDEWEB)

    Jennings, Zachary G.; Romanowsky, Aaron J.; Brodie, Jean P.; Arnold, Jacob A. [University of California Observatories, Santa Cruz, CA 95064 (United States); Strader, Jay [Department of Physics and Astronomy, Michigan State University, East Lansing, Michigan, MI 48824 (United States); Lin, Dacheng; Irwin, Jimmy A.; Wong, Ka-Wah [Department of Physics and Astronomy, University of Alabama, Box 870324, Tuscaloosa, AL 35487 (United States); Sivakoff, Gregory R., E-mail: zgjennin@ucsc.edu [Department of Physics, University of Alberta, Edmonton, Alberta T6G 2E1 (Canada)

    2014-08-01

    We present Hubble Space Telescope/Advanced Camera for Surveys (HST/ACS) g and z photometry and half-light radii R {sub h} measurements of 360 globular cluster (GC) candidates around the nearby S0 galaxy NGC 3115. We also include Subaru/Suprime-Cam g, r, and i photometry of 421 additional candidates. The well-established color bimodality of the GC system is obvious in the HST/ACS photometry. We find evidence for a 'blue tilt' in the blue GC subpopulation, wherein the GCs in the blue subpopulation get redder as luminosity increases, indicative of a mass-metallicity relationship. We find a color gradient in both the red and blue subpopulations, with each group of clusters becoming bluer at larger distances from NGC 3115. The gradient is of similar strength in both subpopulations, but is monotonic and more significant for the blue clusters. On average, the blue clusters have ∼10% larger R {sub h} than the red clusters. This average difference is less than is typically observed for early-type galaxies but does match that measured in the literature for the Sombrero Galaxy (M104), suggesting that morphology and inclination may affect the measured size difference between the red and blue clusters. However, the scatter on the R {sub h} measurements is large. We also identify 31 clusters more extended than typical GCs, which we term ultra-compact dwarf (UCD) candidates. Many of these objects are actually considerably fainter than typical UCDs. While it is likely that a significant number will be background contaminants, six of these UCD candidates are spectroscopically confirmed as NGC 3115 members. To explore the prevalence of low-mass X-ray binaries in the GC system, we match our ACS and Suprime-Cam detections to corresponding Chandra X-ray sources. We identify 45 X-ray-GC matches: 16 among the blue subpopulation and 29 among the red subpopulation. These X-ray/GC coincidence fractions are larger than is typical for most GC systems, probably due to the increased

  8. Fuzzy efficiency optimization of AC induction motors

    Science.gov (United States)

    Jani, Yashvant; Sousa, Gilberto; Turner, Wayne; Spiegel, Ron; Chappell, Jeff

    1993-01-01

    This paper describes the early states of work to implement a fuzzy logic controller to optimize the efficiency of AC induction motor/adjustable speed drive (ASD) systems running at less than optimal speed and torque conditions. In this paper, the process by which the membership functions of the controller were tuned is discussed and a controller which operates on frequency as well as voltage is proposed. The membership functions for this dual-variable controller are sketched. Additional topics include an approach for fuzzy logic to motor current control which can be used with vector-controlled drives. Incorporation of a fuzzy controller as an application-specific integrated circuit (ASIC) microchip is planned.

  9. Composite Based EHV AC Overhead Transmission Lines

    DEFF Research Database (Denmark)

    Sørensen, Thomas Kjærsgaard

    ) levels are still not seen as possibility, the future expansion of transmission grids are dependent on new solutions with lessened environment impact, especially with regard to the visual impact. In the present Thesis, composite materials and composite based overhead line components are presented...... and analysed with regard to the possibilities, limitations and risks widespread application of composite materials on EHV AC overhead transmission lines may present. To form the basis for evaluation of the useability of composite materials, dierent overhead line projects aimed at reducing the environmental...... impact are analysed with regard to their visual impact reducing design steps. These are used to form the basis for overhead line system design ideas, which are analysed with regard to application of composite materials and components. Composite materials and components, when applied in EHV systems...

  10. Calibration free method for measurement of the AC magnetization loss

    Energy Technology Data Exchange (ETDEWEB)

    Souc, Jan [Institute of Electrical Engineering, Slovak Academy of Sciences, Dubravska cesta 9, 842 39 Bratislava (Slovakia); Goemoery, Fedor [Institute of Electrical Engineering, Slovak Academy of Sciences, Dubravska cesta 9, 842 39 Bratislava (Slovakia); Vojenciak, Michal [Department of Power Electrical Systems, University of Zilina, Vel' ky diel, 010 26 Zilina (Slovakia)

    2005-05-01

    A calibration free measurement method for determination of the magnetization loss of superconducting samples exposed to the external AC magnetic field is presented. The idea is based on the measurement of the part of the power which is supplied by the AC source to the AC magnet generating the magnetic field, in which the sample is located. It uses a coil wound in parallel to the AC field magnet as the measurement coil. To achieve the necessary sensitivity, two identical systems are used, each consisting of an AC magnet and a measurement coil, one of them containing the sample and the other left empty. No measurement and/or calculation of the calibration constant is required. To confirm the suitability of this method, the loss of a Cu sample with known dissipation was measured. The applicability to the AC magnetization loss measurements of superconducting tapes is presented.

  11. Transition towards DC micro grids: From an AC to a hybrid AC and DC energy infrastructure

    Directory of Open Access Journals (Sweden)

    Evi Ploumpidou

    2017-12-01

    Full Text Available Our electricity is predominantly powered by alternating current (AC, ever since the War of Currents ended in the favor of Nicola Tesla at the end of the 19th century. However, lots of the appliances we use, such as electronics and lights with light-emitting diode (LED technology, work internally on direct current (DC and it is projected that the number of these appliances will increase in the near future. Another contributor to the increase in DC consumption is the ongoing electrification of mobility (Electric Vehicles (EVs. At the same time, photovoltaics (PV generate DC voltages, while the most common storage technologies also use DC. In order to integrate all these appliances and technologies to the existing AC grid, there is a need for converters which introduce power losses. By distributing DC power to DC devices instead of converting it to AC first, it is possible to avoid substantial energy losses that occur every time electricity is converted. This situation initiated the concept for the implementation of the DC-Flexhouse project. A prototype DC installation will be developed and tested in one of the buildings of the developing living lab area called the District of Tomorrow (De Wijk van Morgen which is located in Heerlen, the Netherlands. A neighborhood cooperative (Vrieheide cooperatie is also part of the consortium in order to address the aspect of social acceptance. Although DC seems to be a promising solution for a more sustainable energy system, the business case is still debatable due to both technology- and market-related challenges. The current energy infrastructure is predominantly based on AC, manufacturers produce devices based on AC standards and people are using many AC products across a long life span. This Smart Energy Buildings & Cities (SEB&C PDEng project is a contribution to the DC-Flexhouse project. The aim is to analyze the challenges in the transition to DC micro grids, assess the market potential of DC

  12. Control of high-frequency AC link electronic transformer

    OpenAIRE

    Krishnaswami, H; Ramanarayanan, V

    2005-01-01

    An isolated high-frequency link AC/AC converter is termed an electronic transformer.The electronic transformer has size and cost advantages over a conventional transformer because of high-frequency operation of the magnetic core. Of the various topologies of electronic transformer, the high-frequency AC link electronic transformer achieves high-frequency AC power transformation without a DC link. The circuit uses the standard H-bridge, one on either side of the high-frequency transformer. A n...

  13. AC electric motors control advanced design techniques and applications

    CERN Document Server

    Giri, Fouad

    2013-01-01

    The complexity of AC motor control lies in the multivariable and nonlinear nature of AC machine dynamics. Recent advancements in control theory now make it possible to deal with long-standing problems in AC motors control. This text expertly draws on these developments to apply a wide range of model-based control designmethods to a variety of AC motors. Contributions from over thirty top researchers explain how modern control design methods can be used to achieve tight speed regulation, optimal energetic efficiency, and operation reliability and safety, by considering online state var

  14. AC Own Motion Percentage of Randomly Sampled Cases

    Data.gov (United States)

    Social Security Administration — Longitudinal report detailing the numbers and percentages of Appeals Council (AC) own motion review actions taken on un-appealed favorable hearing level decisions...

  15. Wind-powered asynchronous AC/DC/AC converter system. [for electric power supply regulation

    Science.gov (United States)

    Reitan, D. K.

    1973-01-01

    Two asynchronous ac/dc/ac systems are modelled that utilize wind power to drive a variable or constant hertz alternator. The first system employs a high power 60-hertz inverter tie to the large backup supply of the power company to either supplement them from wind energy, storage, or from a combination of both at a preset desired current; rectifier and inverter are identical and operate in either mode depending on the silicon control rectifier firing angle. The second system employs the same rectification but from a 60-hertz alternator arrangement; it provides mainly dc output, some sinusoidal 60-hertz from the wind bus and some high harmonic content 60-hertz from an 800-watt inverter.

  16. Flexible AC transmission systems: the state of the art

    Energy Technology Data Exchange (ETDEWEB)

    Edris, Abdel-Aty [Electric Power Research Inst., Palo Alto, CA (United States). Electric Systems Division

    1994-12-31

    Flexible AC transmission systems (FACTS) is a concept promoting the use of power electronic controllers to enhance the controllability and usable capacity of AC transmission. This paper presents the state of the art of FACTS and the status of the current projects for the application of the FACTS controllers in transmission systems. (author) 8 refs., 8 figs.

  17. Muc5ac mucin expression during rat skin development

    Directory of Open Access Journals (Sweden)

    V. Ferretti

    2015-02-01

    Full Text Available Some mucin genes have been detected during human embryonic and fetal organ development; however, little is known about mucin expression in epidermal development, neither in humans nor in other species. The present research was developed to explore Muc5ac skin expression during prenatal and postnatal rat development. Immunohistochemistry (IHC, Western blotting (WB and RT-PCR were employed. By IHC, Muc5ac protein was found early in embryonic epidermis from day 13 of gestation until seven days after birth when the surface epidermis became negative and the reaction was restricted to secreting sebum cells. In coincidence with IHC findings, WB analysis showed a band at approximately 200KDa at the same periods of development. Results were also confirmed by RT-PCR. Muc5ac expression in rat embryonic epidermis suggests that Muc5ac may play a protective role in embryonic skin previous to birth which may be replaced by pile covering. To our knowledge, this is the first report which confirmed Muc5ac expression during skin development.Conclusion:  Muc5ac expression in rat embryonic epidermis suggests that Muc5ac may play a protective role in embryonic skin previous to birth which may be replaced by pile covering. To our knowledge, this is the first report which confirmed Muc5ac expression during skin development. 

  18. Muc5ac mucin expression during rat skin development.

    Science.gov (United States)

    Ferretti, V; Segal-Eiras, Á; Barbeito, C G; Croce, M V

    2015-02-20

    Some mucin genes have been detected during human embryonic and fetal organ development; however, little is known about mucin expression in epidermal development, neither in humans nor in other species. The present research was developed to explore Muc5ac skin expression during prenatal and postnatal rat development. Immunohistochemistry (IHC), Western blotting (WB) and RT-PCR were employed. By IHC, Muc5ac protein was found early in embryonic epidermis from day 13 of gestation until seven days after birth when the surface epidermis became negative and the reaction was restricted to secreting sebum cells. In coincidence with IHC findings, WB analysis showed a band at approximately 200KDa at the same periods of development. Results were also confirmed by RT-PCR. Muc5ac expression in rat embryonic epidermis suggests that Muc5ac may play a protective role in embryonic skin previous to birth which may be replaced by pile covering. To our knowledge, this is the first report which confirmed Muc5ac expression during skin development.   Muc5ac expression in rat embryonic epidermis suggests that Muc5ac may play a protective role in embryonic skin previous to birth which may be replaced by pile covering. To our knowledge, this is the first report which confirmed Muc5ac expression during skin development.

  19. Low ac loss geometries in YBCO coated conductors

    International Nuclear Information System (INIS)

    Duckworth, R.C.; List, F.A.; Paranthaman, M.P.; Rupich, M.W.; Zhang, W.; Xie, Y.Y.; Selvamanickam, V.

    2007-01-01

    Reduction of ac losses in applied ac fields can be accomplished through either the creation of filaments and bridging in YBCO coated conductors or by an assembly of narrow width YBCO tapes. The ac losses for each of these geometries were measured at 77 K in perpendicular ac fields up to 100 mT. Despite physical isolation of the filaments, coupling losses were still present in the samples when compared to the expected hysteretic loss. In addition to filamentary conductors the assembly of stacked YBCO conductor provides an alternative method of ac loss reduction. When compared to a 4-mm wide YBCO coated conductor with a critical current of 60 A, the ac loss in a stack of 2-mm wide YBCO coated conductors with a similar total critical current was reduced. While the reduction in ac loss in a 2-mm wide stack coincided with the reduction in the engineering current density of the conductor, further reduction of ac loss was obtained through the splicing of the 2-mm wide tapes with low resistance solders

  20. Low ac loss geometries in YBCO coated conductors

    Energy Technology Data Exchange (ETDEWEB)

    Duckworth, R.C. [Oak Ridge National Laboratory, One Bethel Valley Road, P.O. Box 2008, MS-6305, Oak Ridge, TN 37831-6305 (United States)], E-mail: duckworthrc@ornl.gov; List, F.A.; Paranthaman, M.P. [Oak Ridge National Laboratory, One Bethel Valley Road, P.O. Box 2008, MS-6305, Oak Ridge, TN 37831-6305 (United States); Rupich, M.W.; Zhang, W. [American Superconductor, Two Technology Drive, Westborough, MA 01581 (United States); Xie, Y.Y.; Selvamanickam, V. [SuperPower, 450 Duane Ave, Schenectady, NY 12304 (United States)

    2007-10-01

    Reduction of ac losses in applied ac fields can be accomplished through either the creation of filaments and bridging in YBCO coated conductors or by an assembly of narrow width YBCO tapes. The ac losses for each of these geometries were measured at 77 K in perpendicular ac fields up to 100 mT. Despite physical isolation of the filaments, coupling losses were still present in the samples when compared to the expected hysteretic loss. In addition to filamentary conductors the assembly of stacked YBCO conductor provides an alternative method of ac loss reduction. When compared to a 4-mm wide YBCO coated conductor with a critical current of 60 A, the ac loss in a stack of 2-mm wide YBCO coated conductors with a similar total critical current was reduced. While the reduction in ac loss in a 2-mm wide stack coincided with the reduction in the engineering current density of the conductor, further reduction of ac loss was obtained through the splicing of the 2-mm wide tapes with low resistance solders.

  1. Operation of AC Adapters Visualized Using Light-Emitting Diodes

    Science.gov (United States)

    Regester, Jeffrey

    2016-01-01

    A bridge rectifier is a diamond-shaped configuration of diodes that serves to convert alternating current(AC) into direct current (DC). In our world of AC outlets and DC electronics, they are ubiquitous. Of course, most bridge rectifiers are built with regular diodes, not the light-emitting variety, because LEDs have a number of disadvantages. For…

  2. AC Electrowetting of Polymer Aqueous Drops on Parallel Electrodes

    Science.gov (United States)

    Zhang, Lu; Chetwani, Nishant; Chang, Hsueh-Chia; Zhu, Yingxi Elaine

    2009-03-01

    We have recently observed the strong field dependence of AC-electrowetting of simple electrolyte aqueous drops on parallel gold electrodes, yet the detailed dynamic process of AC-field induced surface wetting remains unclear. In this work, we use fluorescence labeled DNA aqueous solution as a model system to directly visualize the wetting process of aqueous drops under varied AC electric fields by using combined fluorescence microscopy and contact angle goniometer. The electrowetting behavior of DNA aqueous drops is observed at AC-field frequency greater than the reciprocal of the RC time scale for electrode screening. And the onset of AC electrowetting is accompanied by the observed oscillation in drop contour shape and contact line. In addition, the ejection of nanodrops from the parent aqueous drop is observed when the threshold AC-field amplitude is exceeded. A scaling theory based on electrode interfacial screening is developed to quantify the AC-electrowetting behavior with the dependence of AC-field frequency, strength and medium conductivity.

  3. Low frequency ac conduction and dielectric relaxation in poly (N ...

    Indian Academy of Sciences (India)

    The ac conductivity and dielectric constant of poly(N-methyl pyrrole) thin films have been investigated in the temperature range 77–350 K and in the frequency range 102–106 Hz. The well defined loss peaks have been observed in the temperature region where measured ac conductivity approaches dc conductivity.

  4. Time-reversal symmetry breaking by ac field: Effect of ...

    Indian Academy of Sciences (India)

    possesses an interesting dualism: the periodic ac fields that are least effective in suppress- ing conductance fluctuations by dephasing, turn out to be the most effective in breaking the time-reversal symmetry. An important exception is the periodic ac field that is anti- symmetric with respect to a shift by a half-period τ/2.

  5. Effect of temperature on the AC impedance of protein and ...

    Indian Academy of Sciences (India)

    2016-08-26

    Aug 26, 2016 ... The depression parameter reveals the electrical equivalent circuit for the biopolymers. The AC electrical conductivity in the biopolymers follows the universal power law. From this, it is observed that the AC conductivity is frequency dependent and the biopolymer papain obeys large polaron tunnelling model ...

  6. Cosmic Shear With ACS Pure Parallels

    Science.gov (United States)

    Rhodes, Jason

    2002-07-01

    Small distortions in the shapes of background galaxies by foreground mass provide a powerful method of directly measuring the amount and distribution of dark matter. Several groups have recently detected this weak lensing by large-scale structure, also called cosmic shear. The high resolution and sensitivity of HST/ACS provide a unique opportunity to measure cosmic shear accurately on small scales. Using 260 parallel orbits in Sloan textiti {F775W} we will measure for the first time: beginlistosetlength sep0cm setlengthemsep0cm setlengthopsep0cm em the cosmic shear variance on scales Omega_m^0.5, with signal-to-noise {s/n} 20, and the mass density Omega_m with s/n=4. They will be done at small angular scales where non-linear effects dominate the power spectrum, providing a test of the gravitational instability paradigm for structure formation. Measurements on these scales are not possible from the ground, because of the systematic effects induced by PSF smearing from seeing. Having many independent lines of sight reduces the uncertainty due to cosmic variance, making parallel observations ideal.

  7. Ac and dc motor flooding times

    International Nuclear Information System (INIS)

    Crowley, D.A.; Hinton, J.H.

    1988-01-01

    Reactor safety studies, such as the emergency cooling system (ECS) limits analyses and the probabilistic risk assessment, require that the flood-out times be calculated for the ac and dc motors at the -40 foot level. New calculations are needed because dams of an improved design have been installed between the pump room and motor room, and because updated leak rate calculations have shown that the maximum possible leak rate is larger than that which had been previously calculated. The methodology for calculating the motor flood-out times has also been improved. A computer program has been written to calculate flood-out times for various leak rates and sump pump operabilities. For ECS limits analyses, the worst case dc motor flood-out times are 161 and 297 seconds in LKC and P-areas, respectively. These times are for a 135,468 gpm leak that first flows to the motor room and all of the sump pumps are off

  8. Improving Power Quality in AC Supply Grids

    Directory of Open Access Journals (Sweden)

    Piotr Fabijański

    2015-12-01

    Full Text Available This paper describes a digital and actual model of the UPQC (Unified Power Quality Conditioner integrated system for power quality improvement. The UPQC’s design and its connection to an AC supply grid, 1-phase and 3-phase alike, provide effective compensation of unwanted interferences in the waveforms of load supply voltages and non-linear load currents. This article presents an overview of topologies and control strategies. The study of the UPQC confirmed its positive impact on the power quality. The electricity parameters were significantly improved. Total harmonic distortion in supply voltage THDu decreased six-fold to 1.89%, and total harmonic distortion in load current THDi decreased more than ten-fold to 2.38% for a non-linear load (uncontrolled bridge rectifier with load L. Additionally, symmetrisation of supply voltages and reactive power compensation Q of linear load was obtained. The UPQC integrated system for power quality improvement can be used wherever high-quality and PN-EN 50160 standard – compliant electricity is required.

  9. Characterisation of AC1: a naturally decaffeinated coffee

    Directory of Open Access Journals (Sweden)

    Luciana Benjamim Benatti

    2012-01-01

    Full Text Available We compared the biochemical characteristics of the beans of a naturally decaffeinated Arabica coffee (AC1 discovered in 2004 with those of the widely grown Brazilian Arabica cultivar "Mundo Novo" (MN. Although we observed differences during fruit development, the contents of amino acids, organic acids, chlorogenic acids, soluble sugars and trigonelline were similar in the ripe fruits of AC1 and MN. AC1 beans accumulated theobromine, and caffeine was almost entirely absent. Tests on the supply of [2-14C] adenine and enzymatic analysis of theobromine synthase and caffeine synthase in the endosperm of AC1 confirmed that, as in the leaves, caffeine synthesis is blocked during the methylation of theobromine to caffeine. The quality of the final coffee beverage obtained from AC1 was similar to that of MN.

  10. Clover, Red (Trifolium pretense)

    Science.gov (United States)

    Genetic modification of plants by the insertion of transgenes can be a powerful experimental approach to answer basic questions about gene product function. This technology can also be used to make improved crop varieties for use in the field. To apply this powerful tool to red clover, an important ...

  11. red flour beetle

    African Journals Online (AJOL)

    STORAGESEVER

    2009-12-01

    Dec 1, 2009 ... Endogenous cellulases in animals: isolation of -1,4- endoglucanase genes from two species of plant-parasitic cyst nematodes. Proc. Natl. Acad. Sci. USA, 95: 4906-4911. Teather RM, Wood PJ (1982). Use of Congo red polysaccharide interactions in enumeration and characterization of cellulolytic bacteria ...

  12. The use of low frequency AC for offshore wind power

    Energy Technology Data Exchange (ETDEWEB)

    Schuette, T.; Stroem, M.; Gustavsson, Bo [Balfour Beatty Rail AB, Vaesteraas (Sweden)

    2001-07-01

    Low frequency AC, that means AC with a frequency well below the usual frequencies 50 or 60 Hz, has today its main use in single phase AC electrified railways in a number of European countries (16 2/3 Hz), USA (25 Hz) and Costa Rica (20 Hz). Offshore wind power is well suited to 'join the club' as low frequency AC has a number of advantages for that use: Low frequency AC better fits the low revolution frequency of wind power rotors. This can either be used for reduction of pole number for direct generation machines or for a reduction of the gear ratio for conventional machines, resulting in simpler, lighter and more reliable gearboxes. Low frequency AC gives rise to lower charging current/reactive power production, which restricts the maximum cable length for 50 - 60 Hz heavily due to the high specific capacitance of power cables. For low frequency AC, cables longer than 100 km are possible, which is necessary for many future offshore wind power sites. Low frequency AC enables for the use of (air insulated) transmission lines at loads well above their characteristic power, often up to their thermal maximum load. This means that weak 50 or 60 Hz lines between the shore and consumers or stronger parts of a national grid can transfer more power when operated with low frequency AC. On all aspects of low frequency AC, profound knowledge has been accumulated the last century in the railway sector and can be made available for wind power.

  13. Safe-commutation principle for direct single-phase AC-AC converters for use in audio power amplification

    DEFF Research Database (Denmark)

    Ljusev, Petar; Andersen, Michael Andreas E.

    2004-01-01

    This paper presents an alternative safe commutation principle for a single phase bidirectional bridge, for use in the new generation of direct single-stage AC-AC audio power amplifiers. As compared with the bridge commutation with load current or source voltage sensing, in this approach...

  14. AcMNPV ac143 (odv-e18) is essential for mediating budded virus production and is the 30th baculovirus core gene

    International Nuclear Information System (INIS)

    McCarthy, Christina B.; Theilmann, David A.

    2008-01-01

    Autographa californica multiple nucleopolyhedrovirus (AcMNPV) ac143 (odv-e18) is a late gene that encodes for a predicted 9.6 kDa structural protein that locates to the occlusion derived viral envelope and viral induced intranuclear microvesicles [Braunagel, S.C., He, H., Ramamurthy, P., and Summers, M.D. (1996). Transcription, translation, and cellular localization of three Autographa californica nuclear polyhedrosis virus structural proteins: ODV-E18, ODV-E35, and ODV-EC27. Virology 222, 100-114.]. In this study we demonstrate that ac143 is actually a previously unrecognized core gene and that it is essential for mediating budded virus production. To examine the role of ac143 in the baculovirus life cycle, we used the AcMNPV bacmid system to generate an ac143 knockout (KO) virus (AcBAC ac142REP-ac143KO ). Fluorescence and light microscopy showed that infection by AcBAC ac142REP-ac143KO is limited to a single cell and titration assays confirmed that AcBAC ac142REP-ac143KO was unable to produce budded virus (BV). Progression to very late phases of the viral infection was evidenced by the development of occlusion bodies in the nuclei of transfected cells. This correlated with the fact that viral DNA replication was unaffected in AcBAC ac142REP-ac143KO transfected cells. The entire ac143 promoter, which includes three late promoter motifs, is contained within the ac142 open reading frame. Different deletion mutants of this region showed that the integrity of the ac142-ac143 core gene cluster was required for the bacmids to display wild-type patterns of viral replication, BV production and RNA transcription

  15. An AC modulated near infrared gain calibration system for a "Violin-Mode" transimpedance amplifier, intended for advanced LIGO suspensions.

    Science.gov (United States)

    Lockerbie, N A; Tokmakov, K V

    2016-07-01

    The background to this work was a prototype shadow sensor, which was designed for retro-fitting to an advanced LIGO (Laser Interferometer Gravitational wave Observatory) test-mass/mirror suspension, in which a 40 kg test-mass/mirror is suspended by four approximately 600 mm long by 0.4 mm diameter fused-silica suspension fibres. The shadow sensor comprised a LED source of Near InfraRed (NIR) radiation, and a "tall-thin" rectangular silicon photodiode detector, which together were to bracket the fibre under test. The photodiode was positioned so as to be sensitive (primarily) to transverse "Violin-Mode" vibrations of such a fibre, via the oscillatory movement of the shadow cast by the fibre, as this moved across the face of the detector. In this prototype shadow sensing system the photodiode was interfaced to a purpose-built transimpedance amplifier, this having both AC and DC outputs. A quasi-static calibration was made of the sensor's DC responsivity, i.e., incremental rate of change of output voltage versus fibre position, by slowly scanning a fused-silica fibre sample transversely through the illuminating beam. The work reported here concerns the determination of the sensor's more important AC (Violin-Mode) responsivity. Recognition of the correspondence between direct AC modulation of the source, and actual Violin-Mode signals, and of the transformative role of the AC/DC gain ratio for the amplifier, at any modulation frequency, f, resulted in the construction of the AC/DC calibration source described here. A method for determining in practice the transimpedance AC/DC gain ratio of the photodiode and amplifier, using this source, is illustrated by a specific numerical example, and the gain ratio for the prototype sensing system is reported over the frequency range 1 Hz-300 kHz. In fact, a maximum DC responsivity of 1.26 kV.m(-1) was measured using the prototype photodiode sensor and amplifier discussed here. Therefore, the measured AC/DC transimpedance gain

  16. An AC modulated near infrared gain calibration system for a "Violin-Mode" transimpedance amplifier, intended for advanced LIGO suspensions

    Science.gov (United States)

    Lockerbie, N. A.; Tokmakov, K. V.

    2016-07-01

    The background to this work was a prototype shadow sensor, which was designed for retro-fitting to an advanced LIGO (Laser Interferometer Gravitational wave Observatory) test-mass/mirror suspension, in which a 40 kg test-mass/mirror is suspended by four approximately 600 mm long by 0.4 mm diameter fused-silica suspension fibres. The shadow sensor comprised a LED source of Near InfraRed (NIR) radiation, and a "tall-thin" rectangular silicon photodiode detector, which together were to bracket the fibre under test. The photodiode was positioned so as to be sensitive (primarily) to transverse "Violin-Mode" vibrations of such a fibre, via the oscillatory movement of the shadow cast by the fibre, as this moved across the face of the detector. In this prototype shadow sensing system the photodiode was interfaced to a purpose-built transimpedance amplifier, this having both AC and DC outputs. A quasi-static calibration was made of the sensor's DC responsivity, i.e., incremental rate of change of output voltage versus fibre position, by slowly scanning a fused-silica fibre sample transversely through the illuminating beam. The work reported here concerns the determination of the sensor's more important AC (Violin-Mode) responsivity. Recognition of the correspondence between direct AC modulation of the source, and actual Violin-Mode signals, and of the transformative role of the AC/DC gain ratio for the amplifier, at any modulation frequency, f, resulted in the construction of the AC/DC calibration source described here. A method for determining in practice the transimpedance AC/DC gain ratio of the photodiode and amplifier, using this source, is illustrated by a specific numerical example, and the gain ratio for the prototype sensing system is reported over the frequency range 1 Hz-300 kHz. In fact, a maximum DC responsivity of 1.26 kV.m-1 was measured using the prototype photodiode sensor and amplifier discussed here. Therefore, the measured AC/DC transimpedance gain ratio

  17. An AC/AC Direct Power Conversion Topology Having Multiple Power Grid Connections with Adjustable Loading

    DEFF Research Database (Denmark)

    Klumpner, Christian; Blaabjerg, Frede

    2004-01-01

    these fraction power will be a necessary feature on a deregulated energy market. This paper presents a new topology of a power converter based on the Direct Power Conversion concept, which is able to connect to multiple grids and provide complete decoupling between without circulating power between the grids......Normally, a power converter has one supply port to connect to the power grid and one or multiple output ports to connect to AC loads that require variable voltage and variable frequency. As the trend on the energy market is towards deregulation, new converter topologies are needed to allow...

  18. Preparation of low cost activated carbon from Myrtus communis and pomegranate and their efficient application for removal of Congo red from aqueous solution

    Science.gov (United States)

    Ghaedi, Mehrorang; Tavallali, Hossein; Sharifi, Mahdi; Kokhdan, Syamak Nasiri; Asghari, Alireza

    2012-02-01

    In this research, the potential applicability of activated carbon prepared from Myrtus communis (AC-MC) and pomegranate (AC-PG) as useful adsorbents for the removal of Congo red (CR) from aqueous solutions in batch method was investigated. The effects of pH, contact time, agitation time and amount of adsorbents on removal percentage of Congo red on both adsorbents were examined. Increase in pH up to 6 for AC-MC and pH 7 for AC-PG increase the adsorption percentage (capacity) and reach equilibrium within 30 min of contact time. Fitting the experimental data to conventional isotherm models like Freundlich, Langmuir, Tempkin and Dubinin-Radushkevich show that the experimental data fitted very well to the Freundlich isotherm for AC-MC and Langmuir isotherm for AC-PG. Fitting the experimental data to different kinetic models such as pseudo first-order, pseudo second-order, Elovich and intraparticle diffusion mechanism showed the applicability of a pseudo second-order with involvement of intraparticle diffusion model for interpretation of experimental data for both adsorbents. The adsorption capacity of AC-PG and AC-MC for the removal of CR was found to be 19.231 and 10 mg g -1. These results clearly indicate the efficiency of adsorbents as a low cost adsorbent for treatment of wastewater containing CR.

  19. Skin quality in red potatoes

    Science.gov (United States)

    Attractive appearance is a highly desirable characteristic of fresh market red-skinned potatoes. The ideal red potato has a rich, uniform, deep red color. Color fading, netting, browning, and discoloration caused by skinning and disease decrease marketability and may reduce profits to growers and pa...

  20. Electron transport through ac driven graphene p-n junctions

    Science.gov (United States)

    Zhang, Zhi-Qiang; Kang, Yan-Zhuo; Ding, Kai-He

    2018-02-01

    We study the electronic transport through ac driven graphene p-n junctions under a perpendicular magnetic field. It is found that subject to the transversely or longitudinally polarized ac field, in the p-n region, the conductance versus the on-site energy of the right electrode exhibits a characteristic structure with a zero value plateau and the followed oscillation peaks, whose widths are greatly suppressed by the ac field. In the n-n region, the conductance plateaus at G = (n + 1 / 2) (4e2 / h) (n is an integer) shrink for the transversely polarized ac field, whereas accompanied with the addition of the new quantized plateaus at G = n (4e2 / h) for the longitudinally polarized ac field. The combined influence of the ac field with the disorder can trigger a change in the mixing of the hole and electron states at the p-n interface, which leads to a destruction of the plateaus structure in the conductance versus the disorder strength with the emergence of new ones. The influence of the elliptically and circularly polarized ac field on the conductance is also shown.

  1. AC loss characteristics of CORC® cable with a Cu former

    Science.gov (United States)

    Terzioğlu, R.; Vojenčiak, M.; Sheng, J.; Gömöry, F.; Çavuş, T. F.; Belenli, İ.

    2017-08-01

    High-temperature superconductors from the REBCO (RE = rare earth) family have attained industrial production and their performance is continuously being enhanced. However, cabling technology for high-current (kA range) cables for magnet technology is still challenging and there are only few cable concepts available (CORC®, Roebel cable, twisted stack cable). Each of them exhibits different characteristics. In this paper we experimentally investigate CORC® cable produced in-house utilizing a copper tube former. Such a former offers a central cooling channel for partial or complete cable cooling by forced flow of coolant. We focus mainly on AC loss due to transporting AC current, an external applied AC magnetic field and their simultaneous action. In the case of transporting AC current we found indications that a large part of the total loss has its origin in eddy currents due to an axial magnetic field. For the investigation of magnetization AC loss, we prepared several samples with different configurations. In this case we found direct evidence for increasing AC loss due to losses in the metallic former. However, we also found that at low field amplitudes the magnetization AC loss of the complete cable is lower than the loss in the bare former. This is caused by shielding of the magnetic field by a superconductor, which was also confirmed by numerical simulations.

  2. dc Arc Fault Effect on Hybrid ac/dc Microgrid

    Science.gov (United States)

    Fatima, Zahra

    The advent of distributed energy resources (DER) and reliability and stability problems of the conventional grid system has given rise to the wide spread deployment of microgrids. Microgrids provide many advantages by incorporating renewable energy sources and increasing the reliability of the grid by isolating from the main grid in case of an outage. AC microgrids have been installed all over the world, but dc microgrids have been gaining interest due to the advantages they provide over ac microgrids. However the entire power network backbone is still ac and dc microgrids require expensive converters to connect to the ac power network. As a result hybrid ac/dc microgrids are gaining more attention as it combines the advantages of both ac and dc microgrids such as direct integration of ac and dc systems with minimum number of conversions which increases the efficiency by reducing energy losses. Although dc electric systems offer many advantages such as no synchronization and no reactive power, successful implementation of dc systems requires appropriate protection strategies. One unique protection challenge brought by the dc systems is dc arc faults. A dc arc fault is generated when there is a gap in the conductor due to insulation degradation and current is used to bridge the gap, resulting in an arc with very high temperature. Such a fault if it goes undetected and is not extinguished can cause damage to the entire system and cause fires. The purpose of the research is to study the effect of the dc arc fault at different locations in the hybrid ac/dc microgrid and provide insight on the reliability of the grid components when it is impacted by arc faults at various locations in the grid. The impact of dc arc fault at different locations on the performance of the PV array, wind generation, and constant power loads (CPL) interfaced with dc/dc converters is studied. MATLAB/Simulink is used to model the hybrid ac/dc microgrid and arc fault.

  3. A Switched Capacitor Based AC/DC Resonant Converter for High Frequency AC Power Generation

    Directory of Open Access Journals (Sweden)

    Cuidong Xu

    2015-09-01

    Full Text Available A switched capacitor based AC-DC resonant power converter is proposed for high frequency power generation output conversion. This converter is suitable for small scale, high frequency wind power generation. It has a high conversion ratio to provide a step down from high voltage to low voltage for easy use. The voltage conversion ratio of conventional switched capacitor power converters is fixed to n, 1/n or −1/n (n is the switched capacitor cell. In this paper, A circuit which can provide n, 1/n and 2n/m of the voltage conversion ratio is presented (n is stepping up the switched capacitor cell, m is stepping down the switching capacitor cell. The conversion ratio can be changed greatly by using only two switches. A resonant tank is used to assist in zero current switching, and hence the current spike, which usually exists in a classical switching switched capacitor converter, can be eliminated. Both easy operation and efficiency are possible. Principles of operation, computer simulations and experimental results of the proposed circuit are presented. General analysis and design methods are given. The experimental result verifies the theoretical analysis of high frequency AC power generation.

  4. Multiplicar la red

    Directory of Open Access Journals (Sweden)

    John Young

    2015-01-01

    Full Text Available La tecnología comunicacional nos ha conducido precipitadamente a una existencia completamente nueva. En la carrera por crear una sociedad sustentable, una "red de redes mundiales" de computadoras personales que puedan ofrecer la primera esperanza real de acelerar ampliamente las comunicaciones. Las redes computacionales no solo sirven como un sistema de comunicación interactivo, rápido sino también como una herramienta de investigación de poderes insospechados.

  5. Study on radioimmunoassay of Bt Cry1Ac protein

    International Nuclear Information System (INIS)

    Pan Jiarong; Zhang Wei; Lin Min; Zhang Jie; Qiao Yanhong

    2006-01-01

    Bt Cry1Ac protein was extracted from incubation of Bacillus thuringiensis HD-73, and cutting into more specific protein segment with high insect-resistance. High-affinity multi-colonial antibodies of Bt Cry1 Ac protein were obtained after injected it into New Zealand rabbits. By 125 I labeling of Bt Cry1 Ac protein, a RIA kit was established. In this method, centrifuge for separation was not necessary due to the use of magnetic micro-particle and the specifications of the kit were found equal to those of imported ELISA. (authors)

  6. Advanced DC/AC inverters applications in renewable energy

    CERN Document Server

    Luo, Fang Lin

    2013-01-01

    DC/AC inversion technology is of vital importance for industrial applications, including electrical vehicles and renewable energy systems, which require a large number of inverters. In recent years, inversion technology has developed rapidly, with new topologies improving the power factor and increasing power efficiency. Proposing many novel approaches, Advanced DC/AC Inverters: Applications in Renewable Energy describes advanced DC/AC inverters that can be used for renewable energy systems. The book introduces more than 100 topologies of advanced inverters originally developed by the authors,

  7. Systémový pohled na klub AC Sparta

    OpenAIRE

    Čečák, František

    2015-01-01

    Title: The system approach of the club AC Sparta Praha Objectives: Elaboration of financial analysis of the club AC Sparta Praha in season 2010/2011.Comparing the results of the financial analysis with the results of clubs FC Viktoria Plzeň and SK Slavia Praha. Prognosis of the club AC Sparta Praha until year 2020. Methods: In the elaboration of the analysis have been used these methods: vertical analysis, horizontal analysis and analysis of the financial ratios. For forecasting have been use...

  8. Systémový pohled na klub AC Sparta

    OpenAIRE

    Čečák, František

    2014-01-01

    Title: The system approach of the club AC Sparta Praha Aim of the paper: Elaboration of financial analysis of the club AC Sparta Praha in season 2010/2011.Comparing the results of the financial analysis with the results of clubs FC Viktoria Plzeň and SK Slavia Praha. Prognosis of the club AC Sparta Praha until year 2020. Methods: In the elaboration of the analysis have been used these methods: vertical analysis, horizontal analysis and analysis of the financial ratios. For forecasting have be...

  9. Motion Control and Implementation for an AC Servomotor System

    Directory of Open Access Journals (Sweden)

    L. Canan Dülger

    2007-01-01

    Full Text Available This paper presents a study on trajectory tracking problem for an AC synchronous servomotor. A mathematical model for the system including AC synchronous servomotor, gearbox, and a load is developed to examine the systems dynamic behavior. The system is controlled by a traditional PID (proportional + integral + derivative controller. The required values for the controller settings are found experimentally. Different motion profiles are designed, and trapezoidal ones are implemented. Thus, the experimental validation of the model is achieved using the experimental setup. The simulation and experimental results are presented. The tracking performance of an AC servomotor system is illustrated with proposed PID controller.

  10. Study of ac loss in Bi-2223/Ag tape under the simultaneous action of ac transport current and ac magnetic field shifted in phase

    International Nuclear Information System (INIS)

    Vojenciak, M; Souc, J; Ceballos, J M; Goemoery, F; Klincok, B; Pardo, E; Grilli, F

    2006-01-01

    Investigation of ac loss under the simultaneous action of the transport ac current and the external ac magnetic field is of prime importance for the reliable prediction of dissipation in electric power devices such as motors/generators, transformers and transmission cables. An experimental rig allowing us to perform ac loss measurements in such conditions, on short (10 cm) tape samples of high-temperature superconductor Bi-2223/Ag, was designed and tested. Both the electromagnetic and thermal methods were incorporated, allowing us to combine the better sensitivity of the former and the higher reliability of the latter. Our main aim was to see how the ac loss depends on the phase shift between the transport current and the external magnetic field. Such a shift could have different values in various applications. While in a transformer winding, the maximum phase shift at full load will probably not exceed a few degrees, in a three phase transmission cable in tri-axial configuration it is around 120 0 . Therefore, we explored the whole range of phase shifts from 0 to 360 0 . Surprisingly, the maxima of dissipation did not coincide with zero shift as expected from qualitative considerations

  11. [Role of protein kinases of human red cell membrane in deformability and aggregation changes].

    Science.gov (United States)

    Murav'ev, A V; Maĭmistova, A A; Tikhomirova, I A; Bulaeva, S V; Mikhaĭlov, P V; Murav'ev, A A

    2012-01-01

    The proteomic analysis has showed that red cell membrane contains several kinases and phosphatases. Therefore the aim of this study was to investigate the role of protein kinases of human red cell membrane in deformability and aggregation changes. Exposure of red blood cells (RBCs) to some chemical compounds led to change in the RBC microrheological properties. When forskolin (10 microM), an adenylyl cyclase (AC) and a protein kinase A (PKA) stimulator was added to RBC suspension, the RBC deformability (RBCD) was increased by 20% (p RBCA) was significantly decreased under these conditions (p RBCA lowering. The similar effect was found when cells were incubated with cisplatin as a tyrosine protein kinase (TPK) activator. It is important to note that a selective TPK inhibitor--lavendustin eliminated the above mention effects. On the whole the total data clearly show that the red cell aggregation and deformation changes were connected with an activation of the different intracellular signaling pathways.

  12. AC impedance technique in PEM fuel cell diagnosis - A review

    Energy Technology Data Exchange (ETDEWEB)

    Yuan, Xiaozi; Wang, Haijiang; Colin Sun, Jian; Zhang, Jiujun [Institute for Fuel Cell Innovation, National Research Council (Canada)

    2007-12-15

    Because the AC impedance technique, also known as electrochemical impedance spectroscopy (EIS), is being utilized by more and more researchers in proton exchange membrane (PEM) fuel cell studies, the technique has developed into a primary tool in such research. In this paper the recent work on PEM fuel cells using the AC impedance technique is reviewed. Both in situ and ex situ impedance measurements are discussed, with primary focus on the in situ measurements. Within the domain of in situ studies, various methods for measuring the impedance of a PEM fuel cell are examined, and typical impedance spectra in several common scenarios are presented. Representative applications of the AC impedance technique in PEM fuel cell research are also discussed. Finally, the necessity of a time domain rapid AC impedance technique is briefly discussed. (author)

  13. Detection of Genetic Modification 'ac2' in Potato Foodstuffs

    Directory of Open Access Journals (Sweden)

    Petr Kralik

    2009-01-01

    Full Text Available The genetic modification 'ac2' is based on the insertion and expression of ac2 gene, originally found in seeds of amaranth (Amaranthus caudatus, into the genome of potatoes (Solanum tuberosum. The purpose of the present study is to develop a PCR method for the detection of the mentioned genetically modified potatoes in various foodstuffs. The method was used to test twenty different potato-based products; none of them was positive for the genetic modification 'ac2'. The European Union legislation requires labelling of products made of or containing more than 0.9 % of genetically modified organisms. The genetic modification 'ac2' is not allowed on the European Union market. For that reason it is suitable to have detection methods, not only for the approved genetic modifications, but also for the 'unknown' ones, which could still occur in foodstuffs.

  14. American Community Survey (ACS) 5-Year Estimates for Coastal Geographies

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The American Community Survey (ACS) is an ongoing statistical survey that samples a small percentage of the population every year. These data have been apportioned...

  15. Scaling and universality of ac conduction in disordered solids

    DEFF Research Database (Denmark)

    Schrøder, Thomas; Dyre, Jeppe

    2000-01-01

    Recent scaling results for the ac conductivity of ionic glasses by Roling et al. [Phys. Rev. Lett. 78, 2160 (1997)] and Sidebottom [Phys. Rev. Lett. 82, 3653 (1999)] are discussed. We prove that Sidebottom's version of scaling is completely general. A new approximation to the universal ac conduct...... conductivity arising in the extreme disorder limit of the symmetric hopping model, the "diffusion cluster approximation," is presented and compared to computer simulations and experiments.......Recent scaling results for the ac conductivity of ionic glasses by Roling et al. [Phys. Rev. Lett. 78, 2160 (1997)] and Sidebottom [Phys. Rev. Lett. 82, 3653 (1999)] are discussed. We prove that Sidebottom's version of scaling is completely general. A new approximation to the universal ac...

  16. Determination of {sup 227}Ac by {alpha}-particle spectrometry

    Energy Technology Data Exchange (ETDEWEB)

    Martin, P. [Environmental Research Inst. of the Supervising Scientist, Jabiru, NT (Australia); Hancock, G.J. [Commonwealth Scientific and Industrial Research Organization, Canberra, ACT (Australia). Div. of Water Resources; Paulka, S. [Australian Radiation Lab., Yallambie, VIC (Australia); Akber, R.A. [Queensland Univ. of Technology, Brisbane, QLD (Australia)

    1995-10-01

    A method is described for the determination of {sup 227}Ac concentration in environmental samples. Actinium is separated from the sample digest by co-precipitation with lead sulphate, purified using anion and cation exchange techniques, and electrodeposited onto a stainless-steel disc. The chemical yield is monitored by addition of a {sup 229}Th/{sup 225}Ra/{sup 225}Ac tracer before sample dissolution. {sup 225}Ac recovery is determined from an initial count by measurement of its {alpha}-emitting daughter, {sup 217}At. The disc is then stored for 2-3 months and recounted. The {sup 227}Ac activity is obtained by measurement of the ingrown {sup 227}Th and {sup 223}Ra activities in the 5.38-6.10 MeV region. Co-precipitation with lead sulphate enables the convenient determination of actinium, thorium and radium on the same sample digest. (author).

  17. Initial tests of an AC dipole for the Tevatron

    Energy Technology Data Exchange (ETDEWEB)

    Miyamoto, R.; /Texas U.; Jansson, A.; /Fermilab; Kopp, S.; /Texas U.; Syphers, M.; /Fermilab

    2006-06-01

    The AC dipole is a device to diagnose transverse motions of a beam. It can achieve large-amplitude oscillations without two inevitable problems of conventional kicker/pinger magnets: decoherence and emittance growth. While not the first synchrotron to operate with an AC dipole, the Tevatron can now make use of its recently upgraded BPM system, providing unprecedented resolution for use with an AC dipole, to measure both linear and nonlinear properties of the accelerator. Plans are to provide AC dipole systems for both transverse degrees of freedom. Preliminary tests have been done using an audio power amplifier with an existing vertical pinger magnet, producing oscillation amplitudes up to 2{sigma} at 150 GeV. In this paper, we will present the configuration of this system. We also show the analysis of a first few data sets, including the direct measurement of beta functions at BPM locations.

  18. National Fuel Cell Bus Program : Accelerated Testing Report, AC Transit

    Science.gov (United States)

    2009-01-01

    This is an evaluation of hydrogen fuel cell transit buses operating at AC Transit in revenue service since March 20, 2006 compared to similar diesel buses operating from the same depot. This evaluation report includes results from November 2007 throu...

  19. High-Frequency ac Power-Distribution System

    Science.gov (United States)

    Hansen, Irving G.; Mildice, James

    1987-01-01

    Loads managed automatically under cycle-by-cycle control. 440-V rms, 20-kHz ac power system developed. System flexible, versatile, and "transparent" to user equipment, while maintaining high efficiency and low weight. Electrical source, from dc to 2,200-Hz ac converted to 440-V rms, 20-kHz, single-phase ac. Power distributed through low-inductance cables. Output power either dc or variable ac. Energy transferred per cycle reduced by factor of 50. Number of parts reduced by factor of about 5 and power loss reduced by two-thirds. Factors result in increased reliability and reduced costs. Used in any power-distribution system requiring high efficiency, high reliability, low weight, and flexibility to handle variety of sources and loads.

  20. Determining Attributes Contributing to Success in Army Civil Schooling (ACS)

    National Research Council Canada - National Science Library

    Ottinger, Maurice A

    2006-01-01

    ...) in the Army and Defense Comptrollership Program Classes of 1998-2005 at Syracuse University which represent a specialized aspect of ACS where participants follow substantially the same program and earn the same degrees...

  1. Extension to AC Loss Minimisation in High Temperature Superconductors

    National Research Council Canada - National Science Library

    Campbell, Archie

    2004-01-01

    ...: (a) Measure the AC losses of appropriate Yttrium Barium Copper Oxide (YBCO) samples with strong potential for minimizing losses at high frequencies and magnetic fields with the existing equipment. (b...

  2. EHV AC undergrounding electrical power performance and planning

    CERN Document Server

    Benato, Roberto

    2014-01-01

    Analytical methods of cable performance in EHV AC electrical power are discussed in this comprehensive reference. Descriptions of energization, power quality, cable safety constraints and more, guide readers in cable planning and power network operations.

  3. Muc5ac Mucin Expression During Rat Skin Development

    OpenAIRE

    Ferretti, V.; Segal-Eiras, A.; Barbeito, C.G.; Croce, M.V.

    2015-01-01

    Some mucin genes have been detected during human embryonic and fetal organ development; however, little is known about mucin expression in epidermal development, neither in humans nor in other species. The present research was developed to explore Muc5ac skin expression during prenatal and postnatal rat development. Immunohistochemistry (IHC), Western blotting (WB) and RT-PCR were employed. By IHC, Muc5ac protein was found early in embryonic epidermis from day 13 of gestation until seven days...

  4. Comparison of costs and benefits for dc and ac transmission

    Energy Technology Data Exchange (ETDEWEB)

    Stovall, J.P.; Bowles, J.P.; Diemond, C.C.; Eaton, R.A.; Gnadt, P.A.; Heyer, S.V.; Lasseter, R.H.; Lebow, M.A.; Long W.F.; McIver, J.C.

    1987-02-01

    The purpose of the study reported here was to examine generic cost differences between direct current (dc) and alternating current (ac) systems and to identify situations in which dc is clearly advantageous for long distance and bulk power transport. The study was also designed to determine the value of the dc technology when applied to transmission systems. This report presents cost comparisons between ac and dc substations and transmission lines as a function of capacity and voltage. It also presents a comparison of dc versus ac for increasing the capacity of existing corridors. Direct-current link operating stategies for enhancing the performance of the associated ac network are illustrated. Possible opportunities for simplification and cost reduction of dc converter stations are described. Both current and expected future enhancements for ac system operation are also identified to assist in making comparisons between equivalent systems. Information is presented to enable comparisons sufficiently detailed to determine ''cost break-even distance,'' which is the transmission length at which the savings in dc line costs (compared to ac) equals the additional costs of the dc converter stations (compared to ac substations). However, it is emphasized that proper use of the concept requires the inclusion of all costs of implementation of those attributes available in the two technologies which are of sufficient value to the power system to be included in determining equivalent systems. The report attempts to bring together useful cost and performance information on ac and dc power transmission for the use of electric utility system in achieving economic and reliable power system designs when considering system additions, expansions, or modifications.

  5. Response of Magnetic Force Microscopy Probes under AC Magnetic Field

    Science.gov (United States)

    Sungthong, A.; Ruksasakchai, P.; Saengkaew, K.; Cheowanish, I.; Damrongsak, B.

    2017-09-01

    In this paper, magnetic force microscopy (MFM) probes with different coating materials were characterized under AC magnetic field. A perpendicular magnetic write head similar to those used in hard disk drives was employed as the AC magnetic field generator. In order to measure a response of MFM probes to AC magnetic field, a MFM probe under test was scanned, at a scan height of 10 nm, across the surface of the magnetic write head. During MFM imaging, the write head was biased by a sufficient magnitude of AC current, approximately 30 mA. A spectral analysis for a frequency sweep from 1 kHz to 100 MHz was extracted from post-processing MFM images. As expected, a MFM probe coated with hard magnetic alloys, i.e. FePt, has the lowest response to AC magnetic fields. MFM probes coated with soft magnetic alloys, i.e. NiFe and NiCoCr, have a relatively high and flat response across the frequency range. Ni coated MFM probe has the highest response to AC magnetic fields. In addition, CoCr and NiCo coated MFM probes show lower response than NiFe and NiCoCr probes at low frequencies; however, theirs response to AC magnetic field increase for the AC magnetic field with a frequency above 50 kHz. This can be implied that those MFM probes are a good candidate for being used to study the high-frequency performance of perpendicular magnetic write heads. Noting that response of all MFM probes significantly decreased when driven frequencies above 1 MHz due to the limitation of the hardware, i.e. response of quadrant photodiode and op-amp in a pre-amplifier.

  6. Autonomous Operation of Hybrid Microgrid With AC and DC Subgrids

    DEFF Research Database (Denmark)

    Chiang Loh, Poh; Li, Ding; Kang Chai, Yi

    2013-01-01

    This paper investigates on power-sharing issues of an autonomous hybrid microgrid. Unlike existing microgrids which are purely ac, the hybrid microgrid studied here comprises dc and ac subgrids interconnected by power electronic interfaces. The main challenge here is to manage power flows among all...... converters. Suitable control and normalization schemes are now developed for controlling them with the overall hybrid microgrid performance already verified in simulation and experiment....

  7. Mixed mobile ion effect on ac conductivity of boroarsenate glasses

    Indian Academy of Sciences (India)

    In this article we report the study of mixed mobile ion effect (MMIE) in boroarsenate glasses. DSC and a.c. electrical conductivity studies have been carried out for MgO–(25−)Li2O–50B2O3–25As2O3 glasses. It is observed that strength of MMIE in a.c. conductivity is less pronounced with increase in temperature and ...

  8. AC Calorimetric Design for Dynamic of Biological Materials

    OpenAIRE

    Shigeo Imaizumi

    2006-01-01

    We developed a new AC calorimeter for the measurement of dynamic specific heat capacity in liquids, including aqueous suspensions of biological materials. This method has several advantages. The first is that a high-resolution measurement of heat capacity, inmillidegrees, can be performed as a function of temperature, even with a very small sample. Therefore, AC calorimeter is a powerful tool to study critical behavior a tphase transition in biological materials. The second advantage is that ...

  9. Diagnostics of the Fermilab Tevatron using an AC dipole

    Science.gov (United States)

    Miyamoto, Ryoichi

    The Fermilab Tevatron is currently the world's highest energy colliding beam facility. Its counter-rotating proton and antiproton beams collide at 2 TeV center-of-mass. Delivery of such intense beam fluxes to experiments has required improved knowledge of the Tevatron's beam optical lattice. An oscillating dipole magnet, referred to as an AC dipole, is one of such a tool to non-destructively assess the optical properties of the synchrotron. We discusses development of an AC dipole system for the Tevatron, a fast-oscillating (f˜20 kHz) dipole magnet which can be adiabatically turned on and off to establish sustained coherent oscillations of the beam particles without affecting the transverse emittance. By utilizing an existing magnet and a higher power audio amplifier, the cost of the Tevatron AC dipole system became relatively inexpensive. We discuss corrections which must be applied to the driven oscillation measurements to obtain the proper interpretation of beam optical parameters from AC dipole studies. After successful operations of the Tevatron AC dipole system, AC dipole systems, similar to that in the Tevatron, will be build for the CERN LHC. We present several measurements of linear optical parameters (beta function and phase advance) for the Tevatron, as well as studies of non-linear perturbations from sextupole and octupole elements.

  10. AC quantum voltmeter for the industry; AC-Quantenvoltmeter fuer die Industrie

    Energy Technology Data Exchange (ETDEWEB)

    Behr, Ralf [Physikalisch-Technische Bundesanstalt (PTB), Braunschweig (Germany). Arbeitsgruppe 2.63 ' ' Josephson-Effekt, Spannung' ' ; Smandek, Bernhard [Physikalisch-Technische Bundesanstalt (PTB), Braunschweig (Germany). Arbeitsgruppe Q.33 ' ' Technologietransfer' '

    2016-09-15

    In a first part difficulties and challenges of the novel operation principle, the ''differential scanning system'' are discussed and explained, how with highest metrological precision the proof of principle succeeded. By common research with other national metrology institutes the concept was consolidated and improved. In a second part it was exemplarically illuminated, how by an efficient dovetailing of European and national promotion programs with different application neighbourhood consolidated knowledge of basic metrological research could be transferred to economy and especially small and medium companies. With an AC quantum voltmeter up to 10 V and 1 kHz already a unique commercial device is available. How the development foreseeable goes on illuminates the final part of the article.

  11. Adsorption behavior of direct red 80 and congo red onto activated carbon/surfactant: process optimization, kinetics and equilibrium.

    Science.gov (United States)

    Cheng, Zhengjun; Zhang, Lei; Guo, Xiao; Jiang, Xiaohui; Li, Tian

    2015-02-25

    Adsorptions of congo red and direct red 80 onto activated carbon/surfactant from aqueous solution were optimized. The Box-Behnken design (BBD) has been employed to analyze the effects of concentration of surfactant, temperature, pH, and initial concentration of the dye in the adsorption capacity. Their corresponding experimental data could be evaluated excellently by second order polynomial regression models and the two models were also examined based on the analysis of variance and t test statistics, respectively. The optimum conditions were obtained as follows: Cs=34.10 μM, T=50°C, pH=3.5, and CCR=160 mg/L for the congo red system, and Cs=34.10 μM, T=50°C, pH=6.1, and CDR80=110 mg/L for the direct red 80 system. And in these conditions, the measured experimental maximum adsorption capacities for the congo red and direct red 80 removals were 769.48 mg/g and 519.90 mg/g, which were consistent with their corresponding predicted values, with small relative errors of -2.81% and -0.67%, respectively. The adsorption equilibrium and kinetics for the two dye adsorptions onto AC/DDAC were also investigated. The experimental data were fitted by four isotherm models, and Langmuir model presented the best fit. The kinetic studies indicated that the kinetic data followed the pseudo-second-order model. Copyright © 2014 Elsevier B.V. All rights reserved.

  12. Realidad Virtual Acústica: El Abordaje de las Redes Neuronales Artificiales

    Directory of Open Access Journals (Sweden)

    Jose Francisco Lucio

    2015-05-01

    Full Text Available En este trabajo se presenta un nuevo abordaje para obtener las respuestas impulsivas biauriculares (BIRs para un sistema de aurilización utilizando un conjunto de redes neuronales artificiales (RNAs. El método propuesto es capaz de reconstruir las respuestas impulsivas asociadas a la cabeza humana (HRIRs por medio de modificación espectral y de interpolación espacial. Para poder cubrir todo el espacio auditivo de recepción, sin aumentar la complejidad de la arquitectura de la red, una estructura con varias RNAs (conjunto fue adoptada, donde cada red opera en una región específica del espacio (gomo. El error de modelaje en el dominio de la frecuencia es investigado considerando la naturaleza logarítmica de la audición humana. A través de la metodología propuesta se obtuvo un ahorro del tiempo de procesamiento computacional de aproximadamente 62% en relación al método tradicional de procesamiento de señales utilizado para aurilización. La aplicabilidad del nuevo método en sistemas de aurilización es reforzada mediante un análisis comparativo de los resultados, que incluyen la generación de las BIRs y el cálculo de un parámetro acústico biauricular (IACF, los cuales muestran errores con magnitudes reducidas.

  13. Deep Red (Profondo Rosso)

    CERN Multimedia

    Cine Club

    2015-01-01

    Wednesday 29 April 2015 at 20:00 CERN Council Chamber    Deep Red (Profondo Rosso) Directed by Dario Argento (Italy, 1975) 126 minutes A psychic who can read minds picks up the thoughts of a murderer in the audience and soon becomes a victim. An English pianist gets involved in solving the murders, but finds many of his avenues of inquiry cut off by new murders, and he begins to wonder how the murderer can track his movements so closely. Original version Italian; English subtitles

  14. Red DirCom

    Directory of Open Access Journals (Sweden)

    Joan Costa

    2007-01-01

    Full Text Available Catorce países congregados de manera activa, a través de una plataforma de encuentro donde se comparten conocimiento y experiencias en la gestión estratégica de la comunicación en las organizaciones. La red reconoce en el DirCom una figura clave del desarrollo corporativo en el nuevo contexto de los negocios, impulsa la exigencia ética a través de la formación y consolida la proyección profesional para posicionar la gestión integral del DirCom en Iberoamérica.

  15. Safe-commutation principle for direct single-phase AC-AC converters for use in audio power amplification

    Energy Technology Data Exchange (ETDEWEB)

    Ljusev, P.; Andersen, Michael A.E.

    2005-07-01

    This paper presents an alternative safe commutation principle for a single phase bidirectional bridge, for use in the new generation of direct single-stage AC-AC audio power amplifiers. As compared with the bridge commutation with load current or source voltage sensing, in this approach it is not required to do any measurements, thus making it more reliable. Initial testing made on the prototype prove the feasibility of the approach. (au)

  16. THE HST/ACS COMA CLUSTER SURVEY. II. DATA DESCRIPTION AND SOURCE CATALOGS

    International Nuclear Information System (INIS)

    Hammer, Derek; Verdoes Kleijn, Gijs; Den Brok, Mark; Peletier, Reynier F.; Hoyos, Carlos; Balcells, Marc; Aguerri, Alfonso L.; Ferguson, Henry C.; Goudfrooij, Paul; Carter, David; Guzman, Rafael; Smith, Russell J.; Lucey, John R.; Graham, Alister W.; Trentham, Neil; Peng, Eric; Puzia, Thomas H.; Jogee, Shardha; Batcheldor, Dan; Bridges, Terry J.

    2010-01-01

    The Coma cluster, Abell 1656, was the target of an HST-ACS Treasury program designed for deep imaging in the F475W and F814W passbands. Although our survey was interrupted by the ACS instrument failure in early 2007, the partially completed survey still covers ∼50% of the core high-density region in Coma. Observations were performed for 25 fields that extend over a wide range of cluster-centric radii (∼1.75 Mpc or 1 0 ) with a total coverage area of 274 arcmin 2 . The majority of the fields are located near the core region of Coma (19/25 pointings) with six additional fields in the southwest region of the cluster. In this paper, we present reprocessed images and SEXTRACTOR source catalogs for our survey fields, including a detailed description of the methodology used for object detection and photometry, the subtraction of bright galaxies to measure faint underlying objects, and the use of simulations to assess the photometric accuracy and completeness of our catalogs. We also use simulations to perform aperture corrections for the SEXTRACTOR Kron magnitudes based only on the measured source flux and its half-light radius. We have performed photometry for ∼73,000 unique objects; approximately one-half of our detections are brighter than the 10σ point-source detection limit at F814W = 25.8 mag (AB). The slight majority of objects (60%) are unresolved or only marginally resolved by ACS. We estimate that Coma members are 5%-10% of all source detections, which consist of a large population of unresolved compact sources (primarily globular clusters but also ultra-compact dwarf galaxies) and a wide variety of extended galaxies from a cD galaxy to dwarf low surface brightness galaxies. The red sequence of Coma member galaxies has a color-magnitude relation with a constant slope and dispersion over 9 mag (-21 F814W < -13). The initial data release for the HST-ACS Coma Treasury program was made available to the public in 2008 August. The images and catalogs described

  17. Listening to Red

    Directory of Open Access Journals (Sweden)

    Sinazo Mtshemla

    Full Text Available Following a distinction John Mowitt draws between hearing (and phonics, and listening (and sonics, this article argues that the dominant notion of listening to sound was determined by the disciplinary framework of South African history and by the deployment of a cinematic documentary apparatus, both of which have served to disable the act of listening. The conditions of this hearing, and a deafness to a reduced or bracketed listening (Chion via Schaeffer that would enable us to think the post in post-apartheid differently, is thus at the centre of our concerns here. We stage a series of screenings of expected possible soundtracks for Simon Gush's film and installation Red, simultaneously tracking the ways that sound - and particularly music and dialogue - can be shown to hold a certain way of thinking both the political history of South Africa and the politics of South African history. We conclude by listening more closely to hiss and murmur in the soundtrack to Red and suggest this has major implications for considering ways of thinking and knowing.

  18. AC susceptibility as a characterization tool for coated conductor tapes

    Science.gov (United States)

    Gömöry, F.; Vojenčiak, M.; Solovyov, M.; Frolek, L.; Šouc, J.; Seiler, E.; Bauer, M.; Falter, M.

    2017-11-01

    The measurement and analysis of magnetic AC susceptibility is a useful tool in the study of superconductor (SC) materials. Exposure of a sample to a magnetic field changing in time generates loops of electrical currents that are detectable in a contactless way with the help of a suitable pick-up system. In this paper the applicability of this technique in the characterization and quality control of coated conductor (CC) tapes is evaluated. First we recollect the essential results of the analytical theory derived for thin SC strips and their extrapolation to strips with finite thickness. From the analytical expressions one can see how the properties of CC tape that are important for application in electric power devices, namely its critical current and AC loss, can be deduced from AC susceptibility data in straightforward way. The main focus of our study is to investigate the influence that various cases of non-uniformities in SC layer exhibit on the magnetic properties examined in an AC regime. Numerical computations were used to explore the consequences of lateral variation in the critical current density. Predictions derived for some model cases were compared with experimental findings. A dedicated experiment was also carried out to demonstrate that a transverse scratch that would be detrimental for DC transport could sneak unobserved through the AC magnetic experiment on a long sample. Our study shows that the analysis of both parts of the complex magnetic susceptibility in place of a mere AC loss determination in a common AC magnetization experiment is worth the additional effort.

  19. AC power flow importance measures considering multi-element failures

    International Nuclear Information System (INIS)

    Li, Jian; Dueñas-Osorio, Leonardo; Chen, Changkun; Shi, Congling

    2017-01-01

    Quantifying the criticality of individual components of power systems is essential for overall reliability and management. This paper proposes an AC-based power flow element importance measure, while considering multi-element failures. The measure relies on a proposed AC-based cascading failure model, which captures branch overflow, bus load shedding, and branch failures, via AC power flow and optimal power flow analyses. Taking the IEEE 30, 57 and 118-bus power systems as case studies, we find that N-3 analyses are sufficient to measure the importance of a bus or branch. It is observed that for a substation bus, its importance is statistically proportional to its power demand, but this trend is not observed for power plant buses. While comparing with other reliability, functionality, and topology-based importance measures popular today, we find that a DC power flow model, although better correlated with the benchmark AC model as a whole, still fails to locate some critical elements. This is due to the focus of DC-based models on real power that ignores reactive power. The proposed importance measure is aimed to inform decision makers about key components in complex systems, while improving cascading failure prevention, system backup setting, and overall resilience. - Highlights: • We propose a novel importance measure based on joint failures and AC power flow. • A cascading failure model considers both AC power flow and optimal power flow. • We find that N-3 analyses are sufficient to measure the importance of an element. • Power demand impacts the importance of substations but less so that of generators. • DC models fail to identify some key elements, despite correlating with AC models.

  20. An electrochemical study of corrosion protection by primer-topcoat systems on 4130 steel with ac impedance and dc methods

    Science.gov (United States)

    Mendrek, M. J.; Higgins, R. H.; Danford, M. D.

    1988-01-01

    To investigate metal surface corrosion and the breakdown of metal protective coatings, the ac impedance method is applied to six systems of primer coated and primer topcoated 4130 steel. Two primers were used: a zinc-rich epoxy primer and a red lead oxide epoxy primer. The epoxy-polyamine topcoat was used in four of the systems. The EG and G-PARC Model 368 ac impedance measurement system, along with dc measurements with the same system using the polarization resistance method, were used to monitor changing properties of coated 4230 steel disks immersed in 3.5 percent NaCl solutions buffered at pH 5.4 over periods of 40 to 60 days. The corrosion system can be represented by an electronic analog called an equivalent circuit consisting of resistors and capacitors in specific arrangements. This equivalent circuit parallels the impedance behavior of the corrosion system during a frequency scan. Values for the resistors and capacitors, that can be assigned in the equivalent circuit following a least-squares analysis of the data, describe changes that occur on the corroding metal surface and in the protective coatings. Two equivalent circuits have been determined that predict the correct Bode phase and magnitude of the experimental sample at different immersion times. The dc corrosion current density data are related to equivalent circuit element parameters. Methods for determining corrosion rate with ac impedance parameters are verified by the dc method.

  1. Seeing red on the road.

    Science.gov (United States)

    Díaz-Romnán, Amparo; Megías, Alberto; Díaz-Piedra, Carolina; Catena, Andrés; Di Stasi, Leandro L

    2015-01-01

    Human and animal research has found that red perception is associated with specific behavioral reactions, generally characterized by intense responses. Here, we explored whether red cars are perceived as more dangerous than other colored cars. One hundred Spanish drivers examined several road scenarios which involved hazardous cars with different colors: red, green, yellow, black, gray, and white. Driver's behavior (response time and probability of braking) and the perceived level of risk for each scenario were analyzed. Although car color affected participants' response times, contrary to expectations, red cars did not elicit faster responses or higher perceived levels of risk.

  2. Accounting for Readout Dark in ACS/WFC Superbiases

    Science.gov (United States)

    Ryon, J. E.; Grogin, N. A.; Coe, D.

    2017-12-01

    We investigate the properties of excess dark current accumulated during the 100-second full-frame readout of the Advanced Camera for Surveys (ACS) Wide Field Channel (WFC) detectors. This excess dark current, called "readout dark", gives rise to ambient background gradients and hot columns in each ACS/WFC image. We present an analysis of simulated readout dark images developed in ACS ISR 2014-02, and find that the results from the simulated data cannot be fully reconciled with the results from observed bias images. We develop a new method to estimate the readout dark noise properties in ACS/WFC observations instead of using simulated images. While readout dark signal is removed from science images during the bias correction step in CALACS, the additional noise from the readout dark is currently not taken into account. We will update the ERR extensions of superbias images to include the appropriate noise from the ambient readout dark gradient and stable hot columns. We will also flag unstable hot columns in the DQ extensions of the superbiases. A new reference file pipeline for ACS/WFC that will implement these changes is currently under construction.

  3. AC propulsion system for an electric vehicle, phase 2

    Science.gov (United States)

    Slicker, J. M.

    1983-01-01

    A second-generation prototype ac propulsion system for a passenger electric vehicle was designed, fabricated, tested, installed in a modified Mercury Lynx vehicle and track tested at the Contractor's site. The system consisted of a Phase 2, 18.7 kw rated ac induction traction motor, a 192-volt, battery powered, pulse-width-modulated, transistorized inverter packaged for under rear seat installation, a 2-axis, 2-speed, automatically-shifted mechanical transaxle and a microprocessor-based powertrain/vehicle controller. A diagnostics computer to assist tuning and fault finding was fabricated. Dc-to-mechanical-system efficiency varied from 78% to 82% as axle speed/torque ranged from 159 rpm/788 nm to 65 rpm/328 nm. Track test efficiency results suggest that the ac system will be equal or superior to dc systems when driving urban cycles. Additional short-term work is being performed under a third contract phase (AC-3) to raise transaxle efficiency to predicted levels, and to improve starting and shifting characteristics. However, the long-term challenge to the system's viability remains inverter cost. A final report on the Phase 2 system, describing Phase 3 modifications, will be issued at the conclusion of AC-3.

  4. Aragonite coating solutions (ACS) based on artificial seawater

    Science.gov (United States)

    Tas, A. Cuneyt

    2015-03-01

    Aragonite (CaCO3, calcium carbonate) is an abundant biomaterial of marine life. It is the dominant inorganic phase of coral reefs, mollusc bivalve shells and the stalactites or stalagmites of geological sediments. Inorganic and initially precipitate-free aragonite coating solutions (ACS) of pH 7.4 were developed in this study to deposit monolayers of aragonite spherules or ooids on biomaterial (e.g., UHMWPE, ultrahigh molecular weight polyethylene) surfaces soaked in ACS at 30 °C. The ACS solutions of this study have been developed for the surface engineering of synthetic biomaterials. The abiotic ACS solutions, enriched with calcium and bicarbonate ions at different concentrations, essentially mimicked the artificial seawater composition and started to deposit aragonite after a long (4 h) incubation period at the tropical sea surface temperature of 30 °C. While numerous techniques for the solution deposition of calcium hydroxyapatite (Ca10(PO4)6(OH)2), of low thermodynamic solubility, on synthetic biomaterials have been demonstrated, procedures related to the solution-based surface deposition of high solubility aragonite remained uncommon. Monolayers of aragonite ooids deposited at 30 °C on UHMWPE substrates soaked in organic-free ACS solutions were found to possess nano-structures similar to the mortar-and-brick-type botryoids observed in biogenic marine shells. Samples were characterized using SEM, XRD, FTIR, ICP-AES and contact angle goniometry.

  5. Design and synthesis of {sup 225}Ac radioimmunopharmaceuticals

    Energy Technology Data Exchange (ETDEWEB)

    McDevitt, Michael R.; Ma, Dangshe; Simon, Jim; Frank, R. Keith; Scheinberg, David A. E-mail: d-scheinberg@ski.mskcc.org

    2002-12-01

    The alpha-particle-emitting radionuclides {sup 213}Bi, {sup 211}At, {sup 224}Ra are under investigation for the treatment of leukemias, gliomas, and ankylosing spondylitis, respectively. {sup 213}Bi and {sup 211}At were attached to monoclonal antibodies and used as targeted immunotherapeutic agents while unconjugated {sup 224}Ra chloride selectively seeks bone. {sup 225}Ac possesses favorable physical properties for radioimmunotherapy (10 d half-life and 4 net alpha particles), but has a history of unfavorable radiolabeling chemistry and poor metal-chelate stability. We selected functionalized derivatives of DOTA as the most promising to pursue from out of a group of potential {sup 225}Ac chelate compounds. A two-step synthetic process employing either MeO-DOTA-NCS or 2B-DOTA-NCS as the chelating moiety was developed to attach {sup 225}Ac to monoclonal antibodies. This method was tested using several different IgG systems. The chelation reaction yield in the first step was 93{+-}8% radiochemically pure (n=26). The second step yielded {sup 225}Ac-DOTA-IgG constructs that were 95{+-}5% radiochemically pure (n=27) and the mean percent immunoreactivity ranged from 25% to 81%, depending on the antibody used. This process has yielded several potential novel targeted {sup 225}Ac-labeled immunotherapeutic agents that may now be evaluated in appropriate model systems and ultimately in humans.

  6. Innovative application of AC-voltammetry in the characterization of oxides nanolayers formed on metals, under the effect of AC-perturbations

    Energy Technology Data Exchange (ETDEWEB)

    Bueno, V.; Lazzari, L.; Ormellesse, M. [Politecnico di Milano, Milan (Italy). Dept. of Chemistry, Materials and Chemical Engineering; Spinelli, P. [Politecnico di Torino, Torino (Italy). Dept. of Materials Science and Chemical Engineering

    2008-07-01

    Stray AC-currents have been reported to cause many cases of unwanted corrosion on metallic structures. This study characterized the formation and stability of the surface oxide film formed on mild steel under the effect of AC voltage in a very basic environment. The response of the system to DC signals was examined, along with its reversibility to AC perturbations. SEM analysis was used to complement AC-Voltammetry. Reaction mechanisms responsible for the AC-corrosion were formulated. AC-Voltammetry involves the application of a controlled sinusoidal voltage onto a solid working electrode while it is being swept in a DC-voltage range, with the faradaic or capacitative components of the resulting AC-current being recorded. The innovative aspect is the application of AC-V to characterize its nano-surface while it is being affected by AC-signals. It was concluded that the AC-V can be useful for the study of redox processes occurring at the surface of a reactive electrode and for the application of a considerable AC perturbation to the electrode in a potentiostatically controlled way. According to the electrochemistry of the double layer, there are 3 main reactions in the NaOH 1M media that are not reversible to DC nor to AC perturbations in the range of cathodic protection of mild steel. When designing metallic systems susceptible to stray currents, the AC-V could quantify the final faradaic, resistive and capacitative responses. 6 refs., 1 fig.

  7. Signaling pathways regulating red blood cell aggregation.

    Science.gov (United States)

    Muravyov, Alexei; Tikhomirova, Irina

    2014-01-01

    The exposure of red blood cells (RBC) to some hormones (epinephrine, insulin and glucagon) and agonists of α- and β-adrenergic receptors (phenylephrine, clonidine and isoproterenol) may modify RBC aggregation (RBCA). Prostaglandin E1 (PGE1) significantly decreased RBCA, and PGE2 had a similar but lesser effect. Adenylyl cyclase (AC) stimulator forskolin added to RBC suspension, caused a decrease of RBCA. More marked lowering of RBCA occurred after RBC treatment by dB-cAMP. Phosphodiesterase (PDE) inhibitors markedly reduced RBCA. Ca2+ influx stimulated by A23187 was accompanied by an increase of RBCA. The blocking of Ca2+ entry into the RBC by verapamil or the chelation of Ca2+ by EGTA led to a significant RBCA decrease. Lesser changes of aggregation were found after RBC incubation with protein kinase C stimulator phorbol 12-myristate 13-acetate (PMA). A significant inhibitory effect of tyrosine protein kinase (TPK) activator cisplatin on RBCA was revealed, while selective TPK inhibitor, lavendustin, eliminated the above mentioned effect. Taken together, the data demonstrate that changes in RBCA are connected with activation of different intracellular signaling pathways. We suggest that alterations in RBCA are mainly associated with the crosstalk between the adenylyl cyclase-cAMP system and Ca2+ control mechanisms.

  8. RedNemo

    DEFF Research Database (Denmark)

    Alkan, Ferhat; Erten, Cesim

    2017-01-01

    MOTIVATION: Analysis of protein-protein interaction (PPI) networks provides invaluable insight into several systems biology problems. High-throughput experimental techniques together with computational methods provide large-scale PPI networks. However, a major issue with these networks is their e......MOTIVATION: Analysis of protein-protein interaction (PPI) networks provides invaluable insight into several systems biology problems. High-throughput experimental techniques together with computational methods provide large-scale PPI networks. However, a major issue with these networks...... material including source code, useful scripts, experimental data and the results are available at http://webprs.khas.edu.tr/∼cesim/Red Nemo. tar.gz CONTACT: cesim@khas.edu.tr Supplementary information: Supplementary data are available at Bioinformatics online....

  9. Pulsating red variables

    International Nuclear Information System (INIS)

    Whitelock, P.A.

    1990-01-01

    The observational characteristics of pulsating red variables are reviewed with particular emphasis on the Miras. These variables represent the last stage in the evolution of stars on the Asymptotic Giant Branch (AGB). A large fraction of the IRAS sources in the Bulge are Mira variables and a subset of these are also OH/IR sources. Their periods range up to 720 days, though most are between 360 and 560 days. At a given period those stars with the highest pulsation amplitudes have the highest mass-loss rates; this is interpreted as evidence for a causal connection between mass-loss and pulsation. It is suggested that once an AGB star has become a Mira it will evolve with increasing pulsation amplitude and mass-loss, but with very little change of luminosity or logarithmic period. 26 refs

  10. Superconducting shielded core reactor with reduced AC losses

    Science.gov (United States)

    Cha, Yung S.; Hull, John R.

    2006-04-04

    A superconducting shielded core reactor (SSCR) operates as a passive device for limiting excessive AC current in a circuit operating at a high power level under a fault condition such as shorting. The SSCR includes a ferromagnetic core which may be either closed or open (with an air gap) and extends into and through a superconducting tube or superconducting rings arranged in a stacked array. First and second series connected copper coils each disposed about a portion of the iron core are connected to the circuit to be protected and are respectively wound inside and outside of the superconducting tube or rings. A large impedance is inserted into the circuit by the core when the shielding capability of the superconducting arrangement is exceeded by the applied magnetic field generated by the two coils under a fault condition to limit the AC current in the circuit. The proposed SSCR also affords reduced AC loss compared to conventional SSCRs under continuous normal operation.

  11. AC Application of HTS Conductors in Highly Dynamic Electric Motors

    International Nuclear Information System (INIS)

    Oswald, B; Best, K-J; Setzer, M; Duffner, E; Soell, M; Gawalek, W; Kovalev, L K

    2006-01-01

    Based on recent investigations we design highly dynamic electric motors up to 400 kW and linear motors up to 120 kN linear force using HTS bulk material and HTS tapes. The introduction of HTS tapes into AC applications in electric motors needs fundamental studies on double pancake coils under transversal magnetic fields. First theoretical and experimental results on AC field distributions in double-pancake-coils and corresponding AC losses will be presented. Based on these results the simulation of the motor performance confirms extremely high power density and efficiency of both types of electric motors. Improved characteristics of rare earth permanent magnets used in our motors at low temperatures give an additional technological benefit

  12. Reliability of emergency ac power systems at nuclear power plants

    Energy Technology Data Exchange (ETDEWEB)

    Battle, R E; Campbell, D J

    1983-07-01

    Reliability of emergency onsite ac power systems at nuclear power plants has been questioned within the Nuclear Regulatory Commission (NRC) because of the number of diesel generator failures reported by nuclear plant licensees and the reactor core damage that could result from diesel failure during an emergency. This report contains the results of a reliability analysis of the onsite ac power system, and it uses the results of a separate analysis of offsite power systems to calculate the expected frequency of station blackout. Included is a design and operating experience review. Eighteen plants representative of typical onsite ac power systems and ten generic designs were selected to be modeled by fault trees. Operating experience data were collected from the NRC files and from nuclear plant licensee responses to a questionnaire sent out for this project.

  13. On the Application of TLS Techniques to AC Electrical Drives

    Directory of Open Access Journals (Sweden)

    M. Cirrincione

    2005-03-01

    Full Text Available This paper deals with the application of a new neuron, the TLS EXIN neuron, to AC induction motor drives. In particular, it addresses two important subjects of AC induction motor drives: the on-line estimation of the electrical parameters of the machine and the speed estimation in sensorless drives. On this basis, this work summarizes the parameter estimation and sensorless techniques already developed by the authors over these last few years, all based on the TLS EXIN. With regard to sensorless, two techniques are proposed: one based on the MRAS and the other based on the full-order Luenberger observer. The work show some of the most significant results obtained by the authors in these fields and stresses the important potentiality of this new neural technique in AC induction machine drives.

  14. Objectives and status of development of AC600

    International Nuclear Information System (INIS)

    Zhao Chengkun

    1997-01-01

    AC600 is a medium power capability nuclear power station of next generation, which is developed based on world nuclear power improving tendency, requirements of custom with considering China situation and technical foundation. Its main technical characteristics are as following: advanced core and passive safety system, double loop standard design and international popular equipment. Meanwhile, it a simplification of present system, using advanced control room and pattern construction thus developed the operation reliability of nuclear power station, lower construction and operating cost. In order to accelerate the development of next generation advanced reactor, cooperating with Westinghouse Electric Corporation, the joint economic technical research has been established. Based on AC600, the CAP600 is developed on further improving safety and reliability, economical and electric network adoption of AC600

  15. Recurrent Security Gaps In 802.11ac Routers

    Directory of Open Access Journals (Sweden)

    Mohammed Farik

    2015-08-01

    Full Text Available Abstract In comparison to earlier IEEE 802.11 standard abgn routers todays popular 802.11ac standard routers have enhanced security. However 802.11ac router still has major security vulnerabilities. The novelty of this paper is that we not only highlight multiple security vulnerabilities in 802.11ac router technologies that still have not been secured since the earlier standards but also present some new ideas with solutions. We believe that our line of thoughts on security vulnerabilities gaps and on new solutions will provide network security researchers router manufacturers and network administrators with new disclosures to redesign even better security mechanisms in routers to counter attacks on networks via routers.

  16. DC and AC conductivity properties of bovine dentine hydroxyapatite (BDHA)

    Science.gov (United States)

    Dumludag, F.; Gunduz, O.; Kılıc, O.; Ekren, N.; Kalkandelen, C.; Ozbek, B.; Oktar, F. N.

    2017-12-01

    Bovine dentine bio-waste may be used as a potential natural source of hydroxyapatite (BDHA), thus extraction of bovine dentin hydroxyapatite (BDHA) from bio-waste is significantly important to fabricate in a simple, economically and environmentally preferable. DC and AC conductivity properties of BDHA were investigated depending on sintering temperature (1000ºC - 1300°C) in air and vacuum (<10-2 mbar) ambient at room temperature. DC conductivity measurements performed between -1 and 1 V. AC conductivity measurements performed in the frequency range of 40 Hz – 100 kHz. DC conductivity results showed that dc conductivity values of the BDHA decrease with increasing sintering temperature in air ambient. It is not observed remarkable/systematic behavior for ac conductivity depending on sintering temperature.

  17. Skeleton decay in red cedar

    Science.gov (United States)

    Kevin T. Smith; Jessie A. Glaeser

    2013-01-01

    Eastern red cedar (Juniperus virginiana) is a common tree species throughout the eastern United States and the Great Plains. Although “cedar” is in the common name, the scientifc name shows a botanical kinship to the juniper species of the American southwest. Red cedar can survive and thrive within a broad range of soil conditions, seasonal...

  18. Red Dot Basal Cell Carcinoma

    Science.gov (United States)

    2017-01-01

    Red dot basal cell carcinoma, a distinctive morphologic variant of basal cell carcinoma that presents as a small red macule (dot) or papule, is described on a woman’s thigh. A high index of suspicion is necessary to consider the diagnosis since the tumor mimics a telangiectasia or an angioma. PMID:28670359

  19. Hybrid AC-High Voltage DC Grid Stability and Controls

    Science.gov (United States)

    Yu, Jicheng

    The growth of energy demands in recent years has been increasing faster than the expansion of transmission facility construction. This tendency cooperating with the continuous investing on the renewable energy resources drives the research, development, and construction of HVDC projects to create a more reliable, affordable, and environmentally friendly power grid. Constructing the hybrid AC-HVDC grid is a significant move in the development of the HVDC techniques; the form of dc system is evolving from the point-to-point stand-alone dc links to the embedded HVDC system and the multi-terminal HVDC (MTDC) system. The MTDC is a solution for the renewable energy interconnections, and the MTDC grids can improve the power system reliability, flexibility in economic dispatches, and converter/cable utilizing efficiencies. The dissertation reviews the HVDC technologies, discusses the stability issues regarding the ac and HVDC connections, proposes a novel power oscillation control strategy to improve system stability, and develops a nonlinear voltage droop control strategy for the MTDC grid. To verify the effectiveness the proposed power oscillation control strategy, a long distance paralleled AC-HVDC transmission test system is employed. Based on the PSCAD/EMTDC platform simulation results, the proposed power oscillation control strategy can improve the system dynamic performance and attenuate the power oscillations effectively. To validate the nonlinear voltage droop control strategy, three droop controls schemes are designed according to the proposed nonlinear voltage droop control design procedures. These control schemes are tested in a hybrid AC-MTDC system. The hybrid AC-MTDC system, which is first proposed in this dissertation, consists of two ac grids, two wind farms and a five-terminal HVDC grid connecting them. Simulation studies are performed in the PSCAD/EMTDC platform. According to the simulation results, all the three design schemes have their unique salient

  20. Active Power Regulation based on Droop for AC Microgrid

    DEFF Research Database (Denmark)

    Li, Chendan; Coelho, Ernane A. A.; Firoozabadi, Mehdi Savaghebi

    2015-01-01

    In this paper, two different control strategies are proposed to address the active power regulation issue in AC microgrids. The principle of power regulation in the droop controller is firstly introduced. Frequency scheduling and droop gain scheduling on top of droop control is proposed to succes......In this paper, two different control strategies are proposed to address the active power regulation issue in AC microgrids. The principle of power regulation in the droop controller is firstly introduced. Frequency scheduling and droop gain scheduling on top of droop control is proposed...

  1. EXT-II: a second generation advanced ac propulsion system

    Energy Technology Data Exchange (ETDEWEB)

    Bates, B.; Patil, P.B.; Ciccarelli, M.F.

    1986-01-01

    This paper discusses the characteristics of the concept and includes discussion of the system constraints, including traction battery constraints, and brief descriptions of the major subsystems being developed. The components discussed include: the system controller, dc to ac inverter, an internal permanent magnet ac motor and a two-speed automatic transmission with an integral final drive and differential. The motor and transmission are on a common axis and are integrated into one compact unit that is integral with the rear axle of the vehicle.

  2. Productos «Celotex» para acondicionamientos Acústicos

    Directory of Open Access Journals (Sweden)

    Editorial, Equipo

    1958-02-01

    Full Text Available Not availableBajo la denominación general «Celotex», que es un nombre registrado, la Casa Americana The Celotex Corporation, cuyo domicilio social es 120 South, La Salle Street, Chicago J. lllinois, fabrica diversos materiales para fines de acondicionamiento acústico elaborados, según los tipos de que se trate, con fibra de caña de azúcar, lanas minerales, acero, amianto, etc., perforados o no y de acuerdo con el efecto estético y acústico que se desee obtener.

  3. Patient Adviser What to Do About AC Joint Injuries.

    Science.gov (United States)

    Johnson, R J

    2001-11-01

    The muscles, joints, and bones of the shoulders form a base of support that allows your arms to swing, lift, or throw (figure 1). One of these bones, the collarbone, is also called the clavicle. Above your arm is an extension of the shoulder blade called the acromion. Where these two bones meet at the top of the shoulder is the acromioclavicular (AC) joint. The AC joint is not the shoulder joint. The shoulder joint is where the bone of the upper arm (humerus) meets a shallow socket that is also part of the shoulder blade.

  4. The ac propulsion system for an electric vehicle, phase 1

    Science.gov (United States)

    Geppert, S.

    1981-01-01

    A functional prototype of an electric vehicle ac propulsion system was built consisting of a 18.65 kW rated ac induction traction motor, pulse width modulated (PWM) transistorized inverter, two speed mechanically shifted automatic transmission, and an overall drive/vehicle controller. Design developmental steps, and test results of individual components and the complex system on an instrumented test frame are described. Computer models were developed for the inverter, motor and a representative vehicle. A preliminary reliability model and failure modes effects analysis are given.

  5. The minimization of ac phase noise in interferometric systems

    DEFF Research Database (Denmark)

    Filinski, Ignacy; Gordon, R A

    1994-01-01

    A simple step-by-step procedure, including several novel techniques discussed in the Appendices, is given for minimizing ac phase noise in typical interferometric systems such as two-beam interferometers, holographic setups, four-wave mixers, etc. Special attention is given to index of refraction...... fluctuations, direct mechanical coupling, and acoustic coupling, whose importance in determining ac phase noise in interferometric systems has not been adequately treated. The minimization procedure must be carried out while continuously monitoring the phase noise which can be done very simply by using...

  6. Programmable Power Supply for AC Switching Magnet of Proton Accelerator

    CERN Document Server

    Jeong, Seong-Hun; Kang Heung Sik; Lee, Chi-Hwan; Lee, Hong-Gi; Park, Ki-Hyeon; Ryu, Chun-Kil; Sik Han, Hong; Suck Suh, Hyung

    2005-01-01

    The 100-MeV PEFP proton linac has two proton beam extraction lines for user' experiment. Each extraction line has 5 beamlines and has 5 Hz operating frequency. An AC switching magnet is used to distribute the proton beam to the 5 beamlines, An AC switching magnet is powered by PWM-controlled bipolar switching-mode converters. This converter is designed to operate at ±350A, 5 Hz programmable step output. The power supply is employed IGBT module and has controlled by a DSP (Digital Signal Process). This paper describes the design and test results of the power supply.

  7. Adsorption of Acid Red 57 from aqueous solutions onto polyacrylonitrile/activated carbon composite.

    Science.gov (United States)

    El-Bindary, Ashraf A; Diab, Mostafa A; Hussien, Mostafa A; El-Sonbati, Adel Z; Eessa, Ahmed M

    2014-04-24

    The adsorption of Acid Red 57 (AR57) onto Polyacrylonitrile/activated carbon (PAN/AC) composite was investigated in aqueous solution in a batch system with respect to contact time, pH and temperature. Physical characteristics of (PAN/AC) composite such as fourier transform infrared (FTIR) spectroscopy and scanning electron microscopy (SEM) were obtained. Langmuir and Freundlich adsorption models were applied to describe the equilibrium isotherms and the isotherm constants were determined. The activation energy of adsorption was also evaluated for the adsorption of AR57 onto (PAN/AC) composite. The pseudo-first-order and pseudo-second-order kinetic models were used to describe the kinetic data. The dynamic data fitted the pseudo-second-order kinetic model well. The activation energy, change of free energy, enthalpy and entropy of adsorption were also evaluated for the adsorption of AR57 onto (PAN/AC) composite. The thermodynamics of the adsorption indicated spontaneous and exothermic nature of the process. The results indicate that (PAN/AC) composite could be employed as low-cost material for the removal of acid dyes from textile effluents. Copyright © 2014 Elsevier B.V. All rights reserved.

  8. Temas de Física para Ingeniería: Acústica

    OpenAIRE

    Beléndez Vázquez, Augusto

    1992-01-01

    Acústica, fluidos y termodinámica: "Acústica". Ondas sonoras, propagación. Sonidos puros, sonidos complejos y ruidos. Velocidad de propagación del sonido. Intensidad del sonido y potencia acústica. Impedancia acústica y transmisión del sonido. Medición del campo acústico: niveles. Audición. Interferencia de ondas sonoras y pulsaciones. Tubos sonoros. Efecto Doppler.

  9. Isolation of MA-ACS Gene Family and Expression Study of MA-ACS1 Gene in Musa acuminata Cultivar Pisang Ambon Lumut

    Directory of Open Access Journals (Sweden)

    LISTYA UTAMI KARMAWAN

    2009-03-01

    Full Text Available Musa acuminata cultivar pisang ambon lumut is a native climacteric fruit from Indonesia. Climacteric fruit ripening process is triggered by the gaseous plant hormone ethylene. The rate limiting enzyme involved in ethylene biosynthesis is ACC synthase (ACS which is encoded by ACS gene family. The objective of this study is to identify MA-ACS gene family in M. acuminata cultivar pisang ambon lumut and to study the MA-ACS1 gene expression. The result showed that there were nine M. acuminata ACS gene family members called MA-ACS1–9. Two of them (MA-ACS1 and MA-ACS2 were assessed using reverse transcriptase PCR (RT-PCR for gene expression study and it was only MA-ACS1 correlated with fruit ripening. The MA-ACS1 gene fragment has been successfully isolated and characterized and it has three introns, four exons, and one stop codon. It also shows highest homology with MACS1 gene from M. acuminata cultivar Hsian Jien Chiao (GenBank accession number AF056164. Expression analysis of MA-ACS1 using quantitative PCR (qPCR showed that MA-ACS1 gene expression increased significantly in the third day, reached maximum at the fifth day, and then decreased in the seventh day after harvesting. The qPCR expression analysis result correlated with the result of physical analysis during fruit ripening.

  10. Characterization of Optical Attenuation by Colored Dissolved Organic Matter (CDOM) in the Red Sea

    KAUST Repository

    Tiwari, Surya Prakash

    2016-02-01

    Optical properties of colored dissolved organic matter (CDOM) control the downward irradiance in the ultraviolet and visible range of the electromagnetic radiation. CDOM is a strong absorber in shorter wavelengths (ultraviolet light) with steeper spectral slopes in the open ocean. Despite the importance of CDOM in understanding physical and biogeochemical processes in the marine environment, in situ measurements of optical properties in the Red Sea are sparse. This study comprises CDOM absorption from two different instruments (i.e. a spectrophotometer and WET Labs ac-s sensor), and assesses the variations in optical properties of CDOM in the Red Sea using data collected in 2014 and 2015. Three global inversion algorithms (Garver-Siegel-Maritorena model - GSM, Quasi-Analytical Algorithm - QAA, and the Constrained Linear-Matrix inversion model - CLM) were applied to recent data collected in the Red Sea, providing the comparison at five key selected wavelengths (412, 443, 490, 510, and 555 nm) demonstrated that in situ aCDOM values were higher than the values predicted from the three inversion algorithms and leads to underestimating in situ measurements. This finding is consistent with the conclusion of Brewin et al. (2015) that overestimation of chlorophyll in the Red Sea could be due to excessive CDOM.

  11. HST/ACS Imaging of Omega Centauri: Optical Counterparts of Chandra X-Ray Sources

    Science.gov (United States)

    Cool, Adrienne M.; Haggard, Daryl; Arias, Tersi; Brochmann, Michelle; Dorfman, Jason; Gafford, April; White, Vivian; Anderson, Jay

    2013-02-01

    We present results of a search for optical counterparts of X-ray sources in and toward the globular cluster Omega Centauri (NGC 5139) using the Advanced Camera for Surveys (ACS) on the Hubble Space Telescope. The ACS data consist of a mosaic of Wide Field Channel images obtained using F625W, F435W, and F658N filters; with nine pointings we cover the central ~10' × 10' of the cluster and encompass 109 known Chandra sources. We find promising optical counterparts for 59 of the sources, ~40 of which are likely to be associated with the cluster. These include 27 candidate cataclysmic variables (CVs), 24 of which are reported here for the first time. Fourteen of the CV candidates are very faint, with absolute magnitudes in the range M 625 =10.4-12.6, making them comparable in brightness to field CVs near the period minimum discovered in the Sloan Digital Sky Survey. Additional optical counterparts include three BY Dra candidates, a possible blue straggler, and a previously reported quiescent low-mass X-ray binary. We also identify 3 foreground stars and 11 probable active galactic nuclei. Finally, we report the discovery of a group of seven stars whose X-ray properties are suggestive of magnetically active binaries, and whose optical counterparts lie on or very near the metal-rich anomalous giant and subgiant branches in ω Cen. If the apparent association between these seven stars and the RGB/SGB-a stars is real, then the frequency of X-ray sources in this metal-rich population is enhanced by a factor of at least five relative to the other giant and subgiant populations in the cluster. If these stars are not members of the metal-rich population, then they bring the total number of red stragglers (also known as sub-subgiants) that have been identified in ω to Cen 20, the largest number yet known in any globular cluster.

  12. AC loss characteristics of Bi-2223 HTS tapes under bending

    International Nuclear Information System (INIS)

    Kim, Hae-Joon; Kim, J.H.; Cho, J.W.; Sim, K.D.; Kim, S.; Oh, S.S.; Kwag, D.S.; Kim, H.J.; Bae, J.H.; Seong, K.C.

    2006-01-01

    Superconductor is developed for applications in high-power devices such as power-transmission cables, transformers, motors and generators. In such applications, HTS tapes are subjected to various kinds of stress or strain. AC loss is also important consideration for many large-scale superconducting devices. In the fabrication of the devices, the critical current (I c ) of the high temperature superconductor degrades due to many reasons including the tension applied by bending and thermal contraction. These mechanical loads reduce the I c of superconducting wire and the I c degradation affects the AC loss of the wire. The I c degradation and AC loss of Bi-2223 HTS tape were measured under tension and bending conditions at 77 K and self-field. Moreover, the frequency characteristics of AC loss was measured at the 30-480 Hz. As a result, self-field penetrates the deeper into the conductor at the lower frequency, which means higher self-field losses per cycle

  13. Effect of temperature on the AC impedance of protein and ...

    Indian Academy of Sciences (India)

    increased with temperature for all the biopolymers which corresponds to high polarization effect in these biopoly- mers. The AC impedance parameters for papain, gum aca- cia, gum tragacanth and gum guar are given for four different temperatures in table 1 for comparison. The conductivity of papain increases from 1·65× ...

  14. Parameter Sensitivity In Vector Controlled Ac Motor Drives

    Science.gov (United States)

    Krishnan, R.; Pillay, P.

    1987-10-01

    The relatively recent development of the theory of vector control has enabled ac machines to be transformed, performance wise, into equivalent separately excited dc machines while retaining the many advantages that ac machines have over dc. The ac machines used include the induction and permanent magnet synchronous motors. A precise knowledge of the machine parameters is needed in order to implement indirect vector control on induction motor drive systems where the position of the rotor flux is not measured. If the machine parameters change relative to the preset values in the vector controller, then the decoupling of the torque and flux channels, which is the object of vector control, is lost. Low frequency torque and speed oscillations can result with a consequent degradation in the drive performance. The PMSM drive system is also parameter sensitive although not depending on the same parameters as the induction motor drive. It is well known that machine parameters change with temperature, saturation and on the frequency of operation. An assessment of the overall performance of an ac motor drive must therefore include a study of its parameter sensitivity. In this paper, a detailed steady state study of parameter sensitivity for both the induction and permanent magnet machines is done. Comparisons are also made based on the results of this investigation.

  15. Self-field AC losses in Bi-2223 superconducting tapes

    International Nuclear Information System (INIS)

    Mueller, K. H.; Leslie, K.E.

    1996-01-01

    Full text: The self-field AC loss in Bi-2223 silver sheathed tapes for AC currents of up to 100 A was measured at 77 K and frequencies of 60 Hz and 600 Hz using a lock-in amplifier. The frequency dependence indicated a purely hysteretic loss which can be well described in terms of the critical state model for a flat superconducting strip. The only parameter needed to predict the self-field AC loss is the critical current of the critical state. Because the loss voltage is extremely small compared with the inductive voltage, a very high accuracy of the lock-in amplifier phase setting is required. Unlike in loss measurements on cylindrical superconducting samples, in the case of the tape the measuring circuit leads have to be brought out from the surface forming a loop where the changing magnetic field induces an additional voltage. Only if the loop formed by the leads at the voltage tabs is large enough will the apparent power dissipation approach the real AC loss associated with the length of the sample probed

  16. Structural and frequency dependencies of a.c. and dielectric ...

    Indian Academy of Sciences (India)

    Abstract. In this work, heterojunction of InSb/InP was grown by liquid phase epitaxy (LPE). Surface morphology and crystalline structure of the heterojunction were characterized by scanning electron microscopy (SEM) and. X-ray diffraction (XRD). The frequency and temperature dependences of a.c. conductivity and ...

  17. Ammonia treated Mo/AC catalysts for CO hydrogenation with ...

    Indian Academy of Sciences (India)

    A series of ammonia treated Mo/Activated Carbon (AC) catalysts were synthesized by wet impregnation method by nominal incorporation of 5, 10 and 15 wt% of molybdenum. The calcined catalysts (500◦C, 4 h, N₂ flow) were subjected to a stepwise ammonia treatment at temperatures from 25 up to 700◦C. This work ...

  18. Electrostatic suppression of the Leidenfrost state using AC electric fields

    Science.gov (United States)

    Ozkan, Onur; Shahriari, Arjang; Bahadur, Vaibhav

    2017-10-01

    The formation of a vapor layer at the solid-liquid interface at high temperatures (Leidenfrost phenomenon) degrades heat transfer substantially. Application of an electric field in this vapor layer can fundamentally eliminate the Leidenfrost state by electrostatically attracting liquid towards the surface. This study analyzes the influence of AC electric fields on electrostatic suppression of the Leidenfrost state; previous studies have only utilized DC electric fields. In particular, the influence of the frequency of the AC waveform on Leidenfrost state suppression is analyzed using high speed visualization of liquid-vapor instabilities and heat transfer measurements of evaporating droplets. It is seen that the extent of suppression is reduced with increasing AC frequency. At sufficiently high frequencies, the influence of an applied voltage is completely negated, and electrostatic suppression of the Leidenfrost state can be completely eliminated. A first-order electromechanical model is used to explain the frequency-dependent reduction in the electrostatic attraction force on the Leidenfrost droplet. Overall, this work highlights the importance of AC frequency as a tool to control the extent of suppression and the boiling heat transfer rate.

  19. Evaluation of ac conductivity behaviour of graphite filled ...

    Indian Academy of Sciences (India)

    Home; Journals; Bulletin of Materials Science; Volume 27; Issue 3. Evaluation of a.c. conductivity behaviour of graphite filled polysulphide modified epoxy composites ... Author Affiliations. Navin Chand1 Deepak Jain1. Regional Research Laboratory, Hoshangabad Road, Habibganj Naka, Bhopal 462 026, India ...

  20. AC-coupled front-end for biopotential measurements.

    Science.gov (United States)

    Spinelli, Enrique Mario; Pallàs-Areny, Ramon; Mayosky, Miguel Angel

    2003-03-01

    AC coupling is essential in biopotential measurements. Electrode offset potentials can be several orders of magnitude larger than the amplitudes of the biological signals of interest, thus limiting the admissible gain of a dc-coupled front end to prevent amplifier saturation. A high-gain input stage needs ac input coupling. This can be achieved by series capacitors, but in order to provide a bias path, grounded resistors are usually included, which degrade the common mode rejection ratio (CMRR). This paper proposes a novel balanced input ac-coupling network that provides a bias path without any connection to ground, thus resulting in a high CMRR. The circuit being passive, it does not limit the differential dc input voltage. Furthermore, differential signals are ac coupled, whereas common-mode voltages are dc coupled, thus allowing the closed-loop control of the dc common mode voltage by means of a driven-right-leg circuit. This makes the circuit compatible with common-mode dc shifting strategies intended for single-supply biopotential amplifiers. The proposed circuit allows the implementation of high-gain biopotential amplifiers with a reduced number of parts, thus resulting in low power consumption. An electrocardiogram amplifier built according to the proposed design achieves a CMRR of 123 dB at 50 Hz.

  1. Rethinking Rectification: AC-DC Power Supply in Package

    DEFF Research Database (Denmark)

    Pejtersen, Jens; Knott, Arnold; Jørgensen, Ivan Harald Holger

    Rectification of AC mains voltage is almost exclusively implemented with passive diode bridge rectifiers for power applications below 100 W. The diode bridge rectifier is reliable, cost effective and easy to use. But it is also lossy, nonlinear and passive. Thus reducing the power conversion effi...

  2. Evaluation of ac conductivity behaviour of graphite filled

    Indian Academy of Sciences (India)

    Composites of epoxy resin having different amounts of graphite particles have been prepared by solution casting method. Temperature dependence of dielectric constant, tan and a.c. conductivity was measured in the frequency range, 1–20 kHz, temperature range, 40–180°C for 0.99, 1.96 and 2.91 wt% graphite filled ...

  3. Stretched exponential relaxation and ac universality in disordered dielectrics

    DEFF Research Database (Denmark)

    Milovanov, Alexander V.; Rypdal, Kristoffer; Juul Rasmussen, Jens

    2007-01-01

    are stretched exponential character of dielectric relaxation, power-law power spectral density, and anomalous dependence of ac conduction coefficient on frequency. We propose a self-consistent model of dielectric relaxation in which the relaxations are described by a stretched exponential decay function...

  4. A THREE-PHASE BOOST DC-AC CONVERTER

    African Journals Online (AJOL)

    - strate the feasibility of the proposed three-phase inverter. The inverter is intended to be used in three-phase electric drives and uninterruptible power supply (UPS) systems. Keywords: Boost converter, three-phase dc-ac converter, sliding ...

  5. The Shortest Competition Judgment Ever : AC-Treuhand II

    NARCIS (Netherlands)

    Vedder, Hans; Busscher, Rick Johannes; Herz, Martin

    2015-01-01

    Competition law judgments are notorious for their length. An extreme example is the 5134 paragraph judgment in Cement. In most cases the appeal judgment is significantly shorter, as with the 391 paragraphs in the appeal in Cement. AC-Treuhand is no exception to that rule, but it takes it to the

  6. AC loss in a high-temperature superconducting coil

    NARCIS (Netherlands)

    Chevtchenko, O.A.; Rabbers, J.J.; Godeke, A.; ten Haken, Bernard; ten Kate, Herman H.J.

    1998-01-01

    In a typical superconducting coil made of BSCCO/Ag tape, both amplitude and direction of the magnetic field determine the critical current, resistive voltage and AC loss. The distribution of the magnetic field along and across the superconducting tape in a coil is rather complex. This gives rise to

  7. Efficient method for AC transmission network expansion planning

    Energy Technology Data Exchange (ETDEWEB)

    Rahmani, M. [Electrical Engineering Department, Shahid Bahonar University of Kerman, Kerman (Iran); Faculdade de Engenharia de Ilha Solteira, UNESP - Univ Estadual Paulista, Departamento de Engenharia Eletrica, Ilha Solteira, SP (Brazil); Rashidinejad, M. [Electrical Engineering Department, Shahid Bahonar University of Kerman, Kerman (Iran); Carreno, E.M. [Centro de Engenharia, Universidade Estadual do Oeste de Parana, UNIOESTE, Foz do Iguacu - PR (Brazil); Romero, R. [Faculdade de Engenharia de Ilha Solteira, UNESP - Univ Estadual Paulista, Departamento de Engenharia Eletrica, Ilha Solteira, SP (Brazil)

    2010-09-15

    A combinatorial mathematical model in tandem with a metaheuristic technique for solving transmission network expansion planning (TNEP) using an AC model associated with reactive power planning (RPP) is presented in this paper. AC-TNEP is handled through a prior DC model while additional lines as well as VAr-plants are used as reinforcements to cope with real network requirements. The solution of the reinforcement stage can be obtained by assuming all reactive demands are supplied locally to achieve a solution for AC-TNEP and by neglecting the local reactive sources, a reactive power planning (RPP) will be managed to find the minimum required reactive power sources. Binary GA as well as a real genetic algorithm (RGA) are employed as metaheuristic optimization techniques for solving this combinatorial TNEP as well as the RPP problem. High quality results related with lower investment costs through case studies on test systems show the usefulness of the proposal when working directly with the AC model in transmission network expansion planning, instead of relaxed models. (author)

  8. AC conductivity of a quantum Hall line junction

    International Nuclear Information System (INIS)

    Agarwal, Amit; Sen, Diptiman

    2009-01-01

    We present a microscopic model for calculating the AC conductivity of a finite length line junction made up of two counter- or co-propagating single mode quantum Hall edges with possibly different filling fractions. The effect of density-density interactions and a local tunneling conductance (σ) between the two edges is considered. Assuming that σ is independent of the frequency ω, we derive expressions for the AC conductivity as a function of ω, the length of the line junction and other parameters of the system. We reproduce the results of Sen and Agarwal (2008 Phys. Rev. B 78 085430) in the DC limit (ω→0), and generalize those results for an interacting system. As a function of ω, the AC conductivity shows significant oscillations if σ is small; the oscillations become less prominent as σ increases. A renormalization group analysis shows that the system may be in a metallic or an insulating phase depending on the strength of the interactions. We discuss the experimental implications of this for the behavior of the AC conductivity at low temperatures.

  9. 21 CFR 880.5500 - AC-powered patient lift.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 8 2010-04-01 2010-04-01 false AC-powered patient lift. 880.5500 Section 880.5500 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED... powered device either fixed or mobile, used to lift and transport patients in the horizontal or other...

  10. Dielectric relaxation and ac conductivity of sodium tungsten ...

    Indian Academy of Sciences (India)

    Abstract. Studies of dielectric relaxation and ac conductivity have been made on three samples of sodium tungsten phosphate glasses over a temperature range of 77–420 K. Complex relative permit- tivity data have been analyzed using dielectric modulus approach. Conductivity relaxation frequency increases with the ...

  11. AC impedance and dielectric spectroscopic studies of Mg ion ...

    Indian Academy of Sciences (India)

    Mater. Sci., Vol. 34, No. 5, August 2011, pp. 1063–1067. c Indian Academy of Sciences. AC impedance and dielectric spectroscopic studies of Mg. 2+ ion conducting PVA–PEG blended polymer electrolytes. ANJI REDDY POLU. ∗ and RANVEER KUMAR. Department of Physics, Dr H S Gour University, Sagar 470 003, India.

  12. Time-reversal symmetry breaking by ac field: Effect of ...

    Indian Academy of Sciences (India)

    Time-reversal symmetry breaking by ac field: Effect of commensurability in the frequency domain. V E KRAVTSOV. Present address: The Abdus Salam International Centre for Theoretical Physics, P.O. Box 586, 34100. Trieste, Italy. Landau Institute for Theoretical Physics, 2 Kosygina Street, 117940 Moscow, Russia.

  13. 78 FR 39345 - ACS Wireless, Inc.; Notice of Application

    Science.gov (United States)

    2013-07-01

    ... will transfer to AWN all remaining tangible and intangible assets owned, leased or held by ACS Wireless...'') agreed to form a joint venture in which each would contribute substantially all the assets used in its... transport assets to a newly formed limited liability company, The Alaska Wireless Network, LLC (``AWN...

  14. Calculation of AC losses in large HTS stacks and coils

    DEFF Research Database (Denmark)

    Zermeno, Victor; Abrahamsen, Asger Bech; Mijatovic, Nenad

    2012-01-01

    In this work, we present a homogenization method to model a stack of HTS tapes under AC applied transport current or magnetic field. The idea is to find an anisotropic bulk equivalent for the stack of tapes, where the internal alternating structures of insulating, metallic, superconducting and su...

  15. Investigations on gradient a.c. conductivity characteristics of bamboo ...

    Indian Academy of Sciences (India)

    Unknown

    Electrical measurements were carried out in the temperature range 24–120°C and in the frequency range 4–100 kHz. It was observed that the a.c. conductivity increased initially and then decreased with increase of temperature and frequencies. The increase of distance from outer surface to the inner surface side increased ...

  16. Trends in the development of ehv ac tower lines

    Energy Technology Data Exchange (ETDEWEB)

    McMurtrie, N.J.

    1966-01-01

    Some of the more important current trends in the development of EHV ac tower lines are outlined. The emphasis is primarily on the design and construction aspects of such items as towers, foundations, conductors, insulators and hardware, and the growing integration of the new designs with construction methods. Particular attention is given to the role played by Canadian utilities, manufacturers and engineers.

  17. International Federation of Red Cross and Red Crescent Societies

    Science.gov (United States)

    ... fight pneumonic plague, releases global emergency funds Madagascar: Red Cross scaling up efforts as plague crisis worsens Medical teams in Cox’s Bazar report rise in diarrhoeal diseases, raising fears of outbreak Lesotho’s ...

  18. Red meat and colorectal cancer

    Directory of Open Access Journals (Sweden)

    Nuri Faruk Aykan

    2015-12-01

    Full Text Available Colorectal cancer (CRC is the third most common cancer in men and the second in women worldwide. More than half of cases occur in more developed countries. The consumption of red meat (beef, pork, lamb, veal, mutton is high in developed countries and accumulated evidence until today demonstrated a convincing association between the intake of red meat and especially processed meat and CRC risk. In this review, meta-analyses of prospective epidemiological studies addressed to this association, observed link of some subtypes of red meat with CRC risk, potential carcinogenic compounds, their mechanisms and actual recommendations of international guidelines are presented.

  19. THE ACS SURVEY OF GALACTIC GLOBULAR CLUSTERS. IX. HORIZONTAL BRANCH MORPHOLOGY AND THE SECOND PARAMETER PHENOMENON

    International Nuclear Information System (INIS)

    Dotter, Aaron; Sarajedini, Ata; Anderson, Jay; Bedin, Luigi R.; Paust, Nathaniel; Reid, I. Neill; Aparicio, Antonio; MarIn-Franch, A.; Rosenberg, Alfred; Chaboyer, Brian; Majewski, Steven; Milone, Antonino; Piotto, Giampaolo; Siegel, Michael

    2010-01-01

    The horizontal branch (HB) morphology of globular clusters (GCs) is most strongly influenced by metallicity. The second parameter phenomenon, first described in the 1960s, acknowledges that metallicity alone is not enough to describe the HB morphology of all GCs. In particular, astronomers noticed that the outer Galactic halo contains GCs with redder HBs at a given metallicity than are found inside the solar circle. Thus, at least a second parameter was required to characterize HB morphology. While the term 'second parameter' has since come to be used in a broader context, its identity with respect to the original problem has not been conclusively determined. Here we analyze the median color difference between the HB and the red giant branch, hereafter denoted as Δ(V - I), measured from Hubble Space Telescope (HST) Advanced Camera for Surveys (ACS) photometry of 60 GCs within ∼20 kpc of the Galactic center. Analysis of this homogeneous data set reveals that, after the influence of metallicity has been removed from the data, the correlation between Δ(V - I) and age is stronger than that of any other parameter considered. Expanding the sample to include HST ACS and Wide Field Planetary Camera 2 photometry of the six most distant Galactic GCs lends additional support to the correlation between Δ(V - I) and age. This result is robust with respect to the adopted metallicity scale and the method of age determination, but must bear the caveat that high-quality, detailed abundance information is not available for a significant fraction of the sample. Furthermore, when a subset of GCs with similar metallicities and ages is considered, a correlation between Δ(V - I) and central luminosity density is exposed. With respect to the existence of GCs with anomalously red HBs at a given metallicity, we conclude that age is the second parameter and central density is most likely the third. Important problems related to HB morphology in GCs, notably multi-modal distributions

  20. Flame spread over inclined electrical wires with AC electric fields

    KAUST Repository

    Lim, Seung J.

    2017-07-21

    Flame spread over polyethylene-insulated electrical wires was studied experimentally with applied alternating current (AC) by varying the inclination angle (θ), applied voltage (VAC), and frequency (fAC). For the baseline case with no electric field applied, the flame spread rate and the flame width of downwardly spreading flames (DSFs) decreased from the horizontal case for −20° ≤ θ < 0° and maintained near constant values for −90° ≤ θ < −20°, while the flame spread rate increased appreciably as the inclination angle of upwardly spreading flames (USFs) increased. When an AC electric field was applied, the behavior of flame spread rate in DSFs (USFs) could be classified into two (three) sub-regimes characterized by various functional dependences on VAC, fAC, and θ. In nearly all cases of DSFs, a globular molten polyethylene formed ahead of the spreading flame edge, occasionally dripping onto the ground. In these cases, an effective flame spread rate was defined to represent the burning rate by measuring the mass loss due to dripping. This effective spread rate was independent of AC frequency, while it decreased linearly with voltage and was independent of the inclination angle. In DSFs, when excessively high voltage and frequency were applied, the dripping led to flame extinction during propagation and the extinction frequency correlated well with applied voltage. In USFs, when high voltage and frequency were applied, multiple globular molten PEs formed at several locations, leading to ejections of multiple small flame segments from the main flame, thereby reducing the flame spread rate, which could be attributed to the electrospray phenomenon.

  1. Reorganization of microfilament structure induced by ac electric fields

    Energy Technology Data Exchange (ETDEWEB)

    Cho, M.R.; Thatte, H.S.; Golan, D.E. [Harvard Medical School, Boston, MA (United States); Lee, R.C. [Univ. of Chicago, IL (United States)

    1996-11-01

    AC electric fields induce redistribution of integral membrane proteins. Cell-surface receptor redistribution does not consistently follow electric field lines and depends critically on the frequency of the applied ac electric fields, suggesting that mechanisms other than electroosmosis are involved. We hypothesized that cytoskeletal reorganization is responsible for electric field-induced cell-surface receptor redistribution, and used fluorescence video microscopy to study the reorganization of microfilaments in human hepatoma (Hep3B) cells exposed to low-frequency electric fields ranging in strength from 25 mV/cm to 20 V/cm (peak to peak). The frequency of the applied electric field was varied from 1 to 120 Hz and the field exposure duration from 1 to 60 min. In control cells, cytoplasmic microfilaments were aligned in the form of continuous parallel cables along the longitudinal axis of the cell. Exposure of cells to ac electric fields induced alterations in microfilament structure in a manner that depended on the frequency of the applied field. A 1 or 10 Hz ac field caused microfilament reorganization from continuous, aligned cable structures to discontinuous globular patches. In contrast, the structure of microfilaments in cells exposed to 20-120 Hz electric fields did not offer from that in control cells. The extent of microfilament reorganization increased nonlinearly with the electric field strength. The characteristic time for microfilament reorganization in cells exposed to a 1 Hz, 20 V/cm electric field was {approx} 5 min. Applied ac electric fields could initiate signal transduction cascades, which in turn cause reorganization of cytoskeletal structures. 39 refs., 5 figs., 1 tab.

  2. Aragonite coating solutions (ACS) based on artificial seawater

    Energy Technology Data Exchange (ETDEWEB)

    Tas, A. Cuneyt, E-mail: c_tas@hotmail.com

    2015-03-01

    Graphical abstract: - Highlights: • Developed completely inorganic solutions for the deposition of monolayers of aragonite spherules (or ooids). • Solutions mimicked the artificial seawater. • Biomimetic crystallization was performed at the tropical sea surface temperature of 30 °C. - Abstract: Aragonite (CaCO{sub 3}, calcium carbonate) is an abundant biomaterial of marine life. It is the dominant inorganic phase of coral reefs, mollusc bivalve shells and the stalactites or stalagmites of geological sediments. Inorganic and initially precipitate-free aragonite coating solutions (ACS) of pH 7.4 were developed in this study to deposit monolayers of aragonite spherules or ooids on biomaterial (e.g., UHMWPE, ultrahigh molecular weight polyethylene) surfaces soaked in ACS at 30 °C. The ACS solutions of this study have been developed for the surface engineering of synthetic biomaterials. The abiotic ACS solutions, enriched with calcium and bicarbonate ions at different concentrations, essentially mimicked the artificial seawater composition and started to deposit aragonite after a long (4 h) incubation period at the tropical sea surface temperature of 30 °C. While numerous techniques for the solution deposition of calcium hydroxyapatite (Ca{sub 10}(PO{sub 4}){sub 6}(OH){sub 2}), of low thermodynamic solubility, on synthetic biomaterials have been demonstrated, procedures related to the solution-based surface deposition of high solubility aragonite remained uncommon. Monolayers of aragonite ooids deposited at 30 °C on UHMWPE substrates soaked in organic-free ACS solutions were found to possess nano-structures similar to the mortar-and-brick-type botryoids observed in biogenic marine shells. Samples were characterized using SEM, XRD, FTIR, ICP-AES and contact angle goniometry.

  3. Aragonite coating solutions (ACS) based on artificial seawater

    International Nuclear Information System (INIS)

    Tas, A. Cuneyt

    2015-01-01

    Graphical abstract: - Highlights: • Developed completely inorganic solutions for the deposition of monolayers of aragonite spherules (or ooids). • Solutions mimicked the artificial seawater. • Biomimetic crystallization was performed at the tropical sea surface temperature of 30 °C. - Abstract: Aragonite (CaCO 3 , calcium carbonate) is an abundant biomaterial of marine life. It is the dominant inorganic phase of coral reefs, mollusc bivalve shells and the stalactites or stalagmites of geological sediments. Inorganic and initially precipitate-free aragonite coating solutions (ACS) of pH 7.4 were developed in this study to deposit monolayers of aragonite spherules or ooids on biomaterial (e.g., UHMWPE, ultrahigh molecular weight polyethylene) surfaces soaked in ACS at 30 °C. The ACS solutions of this study have been developed for the surface engineering of synthetic biomaterials. The abiotic ACS solutions, enriched with calcium and bicarbonate ions at different concentrations, essentially mimicked the artificial seawater composition and started to deposit aragonite after a long (4 h) incubation period at the tropical sea surface temperature of 30 °C. While numerous techniques for the solution deposition of calcium hydroxyapatite (Ca 10 (PO 4 ) 6 (OH) 2 ), of low thermodynamic solubility, on synthetic biomaterials have been demonstrated, procedures related to the solution-based surface deposition of high solubility aragonite remained uncommon. Monolayers of aragonite ooids deposited at 30 °C on UHMWPE substrates soaked in organic-free ACS solutions were found to possess nano-structures similar to the mortar-and-brick-type botryoids observed in biogenic marine shells. Samples were characterized using SEM, XRD, FTIR, ICP-AES and contact angle goniometry

  4. AC Electroluminescent Processes in Pr3+-Activated (Ba0.4Ca0.6TiO3 Diphase Polycrystals

    Directory of Open Access Journals (Sweden)

    Nan Gao

    2017-05-01

    Full Text Available We investigated the properties of alternating current (AC-driven electroluminescence from (Ba0.4Ca0.6TiO3:Pr3+ diphase polycrystal-based device. The results of crystal phases and micrographs, and the symmetrical dual emissions in one AC cycle, indicate the spontaneous formation of a dielectric/phosphor/dielectric sandwich microstructure in (Ba0.4Ca0.6TiO3:Pr3+. The electroluminescent device emits a red light of 617 nm, which is attributed to the 1D2-3H4 transition of Pr3+ in the phosphor phase. At a fixed AC frequency, the intensity of electroluminescence exhibits a steep enhancement when applying an increased driving electric field that is beyond a threshold. In a fixed driving electric field, the intensity of electroluminescence shows a rapid rise at low frequencies, but reaches saturation at high frequencies. Based on a double-injection model, we discussed systematically the electroluminescent processes in a whole cycle of AC electric field, which matched well with the experimental data. Our investigation is expected to expand our understanding of such a diphase electroluminescent device, thereby promoting their applications in lighting and displays.

  5. Complete Mitochondrial Genome of the Red Fox (Vuples vuples) and Phylogenetic Analysis with Other Canid Species.

    Science.gov (United States)

    Zhong, Hua-Ming; Zhang, Hong-Hai; Sha, Wei-Lai; Zhang, Cheng-De; Chen, Yu-Cai

    2010-04-01

    The whole mitochondrial genome sequence of red fox (Vuples vuples) was determined. It had a total length of 16 723 bp. As in most mammal mitochondrial genome, it contained 13 protein coding genes, two ribosome RNA genes, 22 transfer RNA genes and one control region. The base composition was 31.3% A, 26.1% C, 14.8% G and 27.8% T, respectively. The codon usage of red fox, arctic fox, gray wolf, domestic dog and coyote followed the same pattern except for an unusual ATT start codon, which initiates the NADH dehydrogenase subunit 3 gene in the red fox. A long tandem repeat rich in AC was found between conserved sequence block 1 and 2 in the control region. In order to confirm the phylogenetic relationships of red fox to other canids, phylogenetic trees were reconstructed by neighbor-joining and maximum parsimony methods using 12 concatenated heavy-strand protein-coding genes. The result indicated that arctic fox was the sister group of red fox and they both belong to the red fox-like clade in family Canidae, while gray wolf, domestic dog and coyote belong to wolf-like clade. The result was in accordance with existing phylogenetic results.

  6. Two very long chain fatty acid acyl-CoA synthetase genes, acs-20 and acs-22, have roles in the cuticle surface barrier in Caenorhabditis elegans.

    Directory of Open Access Journals (Sweden)

    Eriko Kage-Nakadai

    Full Text Available In multicellular organisms, the surface barrier is essential for maintaining the internal environment. In mammals, the barrier is the stratum corneum. Fatty acid transport protein 4 (FATP4 is a key factor involved in forming the stratum corneum barrier. Mice lacking Fatp4 display early neonatal lethality with features such as tight, thick, and shiny skin, and a defective skin barrier. These symptoms are strikingly similar to those of a human skin disease called restrictive dermopathy. FATP4 is a member of the FATP family that possesses acyl-CoA synthetase activity for very long chain fatty acids. How Fatp4 contributes to skin barrier function, however, remains to be elucidated. In the present study, we characterized two Caenorhabditis elegans genes, acs-20 and acs-22, that are homologous to mammalian FATPs. Animals with mutant acs-20 exhibited defects in the cuticle barrier, which normally prevents the penetration of small molecules. acs-20 mutant animals also exhibited abnormalities in the cuticle structure, but not in epidermal cell fate or cell integrity. The acs-22 mutants rarely showed a barrier defect, whereas acs-20;acs-22 double mutants had severely disrupted barrier function. Moreover, the barrier defects of acs-20 and acs-20;acs-22 mutants were rescued by acs-20, acs-22, or human Fatp4 transgenes. We further demonstrated that the incorporation of exogenous very long chain fatty acids into sphingomyelin was reduced in acs-20 and acs-22 mutants. These findings indicate that C. elegans Fatp4 homologue(s have a crucial role in the surface barrier function and this model might be useful for studying the fundamental molecular mechanisms underlying human skin barrier and relevant diseases.

  7. Pensar la ciudad en red

    OpenAIRE

    Fábio Duarte

    2006-01-01

    El paradigma de la sociedad contemporánea es la red, como afirma Manuel Castells (1999) cuándo propone este concepto para que se piense el mundo frente a las tecnologías de información y comunicación. ¿Más como pensar la ciudad en red?  Cuando vemos una imagen aérea de una ciudad, con sus rutas que articulan puntos y regiones, tenemos una imagen perfecta de una red. Pero la evidencia absoluta entre la forma geométrica de una red no puede nos dejar iludirnos: esto no presupone el entendimie...

  8. Red Yeast Rice: An Introduction

    Science.gov (United States)

    ... Yeast Rice For More Information Key References Acknowledgments © asian-ingredients Red yeast rice is a traditional Chinese ... products varies depending on the yeast strains and culture conditions used to manufacture them. The strains and ...

  9. Context based computational analysis and characterization of ARS consensus sequences (ACS of Saccharomyces cerevisiae genome

    Directory of Open Access Journals (Sweden)

    Vinod Kumar Singh

    2016-09-01

    Full Text Available Genome-wide experimental studies in Saccharomyces cerevisiae reveal that autonomous replicating sequence (ARS requires an essential consensus sequence (ACS for replication activity. Computational studies identified thousands of ACS like patterns in the genome. However, only a few hundreds of these sites act as replicating sites and the rest are considered as dormant or evolving sites. In a bid to understand the sequence makeup of replication sites, a content and context-based analysis was performed on a set of replicating ACS sequences that binds to origin-recognition complex (ORC denoted as ORC-ACS and non-replicating ACS sequences (nrACS, that are not bound by ORC. In this study, DNA properties such as base composition, correlation, sequence dependent thermodynamic and DNA structural profiles, and their positions have been considered for characterizing ORC-ACS and nrACS. Analysis reveals that ORC-ACS depict marked differences in nucleotide composition and context features in its vicinity compared to nrACS. Interestingly, an A-rich motif was also discovered in ORC-ACS sequences within its nucleosome-free region. Profound changes in the conformational features, such as DNA helical twist, inclination angle and stacking energy between ORC-ACS and nrACS were observed. Distribution of ACS motifs in the non-coding segments points to the locations of ORC-ACS which are found far away from the adjacent gene start position compared to nrACS thereby enabling an accessible environment for ORC-proteins. Our attempt is novel in considering the contextual view of ACS and its flanking region along with nucleosome positioning in the S. cerevisiae genome and may be useful for any computational prediction scheme.

  10. An AC modulated near infrared gain calibration system for a “Violin-Mode” transimpedance amplifier, intended for advanced LIGO suspensions

    International Nuclear Information System (INIS)

    Lockerbie, N. A.; Tokmakov, K. V.

    2016-01-01

    The background to this work was a prototype shadow sensor, which was designed for retro-fitting to an advanced LIGO (Laser Interferometer Gravitational wave Observatory) test-mass/mirror suspension, in which a 40 kg test-mass/mirror is suspended by four approximately 600 mm long by 0.4 mm diameter fused-silica suspension fibres. The shadow sensor comprised a LED source of Near InfraRed (NIR) radiation, and a “tall-thin” rectangular silicon photodiode detector, which together were to bracket the fibre under test. The photodiode was positioned so as to be sensitive (primarily) to transverse “Violin-Mode” vibrations of such a fibre, via the oscillatory movement of the shadow cast by the fibre, as this moved across the face of the detector. In this prototype shadow sensing system the photodiode was interfaced to a purpose-built transimpedance amplifier, this having both AC and DC outputs. A quasi-static calibration was made of the sensor’s DC responsivity, i.e., incremental rate of change of output voltage versus fibre position, by slowly scanning a fused-silica fibre sample transversely through the illuminating beam. The work reported here concerns the determination of the sensor’s more important AC (Violin-Mode) responsivity. Recognition of the correspondence between direct AC modulation of the source, and actual Violin-Mode signals, and of the transformative role of the AC/DC gain ratio for the amplifier, at any modulation frequency, f, resulted in the construction of the AC/DC calibration source described here. A method for determining in practice the transimpedance AC/DC gain ratio of the photodiode and amplifier, using this source, is illustrated by a specific numerical example, and the gain ratio for the prototype sensing system is reported over the frequency range 1 Hz–300 kHz. In fact, a maximum DC responsivity of 1.26 kV.m −1 was measured using the prototype photodiode sensor and amplifier discussed here. Therefore, the measured AC

  11. An AC modulated near infrared gain calibration system for a “Violin-Mode” transimpedance amplifier, intended for advanced LIGO suspensions

    Energy Technology Data Exchange (ETDEWEB)

    Lockerbie, N. A.; Tokmakov, K. V. [SUPA (Scottish Universities Physics Alliance) Department of Physics, University of Strathclyde, 107 Rottenrow, Glasgow G4 0NG (United Kingdom)

    2016-07-15

    The background to this work was a prototype shadow sensor, which was designed for retro-fitting to an advanced LIGO (Laser Interferometer Gravitational wave Observatory) test-mass/mirror suspension, in which a 40 kg test-mass/mirror is suspended by four approximately 600 mm long by 0.4 mm diameter fused-silica suspension fibres. The shadow sensor comprised a LED source of Near InfraRed (NIR) radiation, and a “tall-thin” rectangular silicon photodiode detector, which together were to bracket the fibre under test. The photodiode was positioned so as to be sensitive (primarily) to transverse “Violin-Mode” vibrations of such a fibre, via the oscillatory movement of the shadow cast by the fibre, as this moved across the face of the detector. In this prototype shadow sensing system the photodiode was interfaced to a purpose-built transimpedance amplifier, this having both AC and DC outputs. A quasi-static calibration was made of the sensor’s DC responsivity, i.e., incremental rate of change of output voltage versus fibre position, by slowly scanning a fused-silica fibre sample transversely through the illuminating beam. The work reported here concerns the determination of the sensor’s more important AC (Violin-Mode) responsivity. Recognition of the correspondence between direct AC modulation of the source, and actual Violin-Mode signals, and of the transformative role of the AC/DC gain ratio for the amplifier, at any modulation frequency, f, resulted in the construction of the AC/DC calibration source described here. A method for determining in practice the transimpedance AC/DC gain ratio of the photodiode and amplifier, using this source, is illustrated by a specific numerical example, and the gain ratio for the prototype sensing system is reported over the frequency range 1 Hz–300 kHz. In fact, a maximum DC responsivity of 1.26 kV.m{sup −1} was measured using the prototype photodiode sensor and amplifier discussed here. Therefore, the measured AC

  12. Measured losses in superconductor magnets for 60-Hertz ac operation.

    Science.gov (United States)

    Hamlet, I. L.; Kilgore, R. A.

    1971-01-01

    Results of an experimental study of electrical losses in superconductor magnets. Preliminary 60-Hz ac loss data are presented for coils constructed of Nb3Sn ribbon, Nb-Ti cable, and multifilament Nb-Ti. Losses have been measured for different size coils up to approximately 20 cm in diameter. Of the conductor types tested, Nb3Sn ribbon has the lowest losses for ac operation. In Nb3Sn-ribbon coils of different sizes, the loss per unit length of conductor is shown to decrease with a decrease in the rate of change of current and to increase, in general, with increase in coil size. An important aspect of the study is the high degree of repeatability of the data.

  13. Fiber Materials AC Impedance Characteristics and Principium Analysis

    Science.gov (United States)

    Wang, Jianjun; Li, Xiaofeng

    With an invariable amplitude and variable frequency inspiriting, impedance of fiber materials rapidly decrease at first and then increase speedy followed with increasing of signal frequency. For the impedance curve of frequency is section of bathtub, this phenomenon is defined as alternating current electric conductive bathtub effect of fiber material. With analysis tools,of circuit theory and medium polarization theory, the phenomenon can be deeply detected that in AC electric field there are four different kind of currents in fiber material: absorbing current, conductance current, charging current and superficial current. With more analyzing it's discovered this phenomenon can be explained by medium polarize theory. Make using of fiber AC electric conductivity bathtub effect, fast testing equipment on fiber moisture regain can be invent, and disadvantages of conventional impedance technique, such as greatness test error and electrode polarization easily. This paper affords directions to design novel speediness fiber moisture test equipments in theory.

  14. Development of AC-DC power system simulator

    International Nuclear Information System (INIS)

    Ichikawa, Tatsumi; Ueda, Kiyotaka; Inoue, Toshio

    1984-01-01

    A modeling and realization technique is described for realtime plant dynamics simulation of nuclear power generating unit in AC-DC power system simulator. Dynamic behavior of reactor system and steam system is important for investigation a further adequate unit control and protection system to system faults in AC and DC power system. Each unit of two nuclear power generating unit in the power system simulator consists of micro generator, DC motors, flywheels and process computer. The DC motor and flywheel simulates dynamic characteristics of steam turbine, and process computer simulates plant dynamics by digital simulation. We have realized real-time plant dynamics simulation by utilizing a high speed process I/O and a high speed digital differential analyzing processor (DDA) in which we builted a newly developed simple plant model. (author)

  15. On-Chip AC self-test controller

    Science.gov (United States)

    Flanagan, John D [Rhinebeck, NY; Herring, Jay R [Poughkeepsie, NY; Lo, Tin-Chee [Fishkill, NY

    2009-09-29

    A system for performing AC self-test on an integrated circuit that includes a system clock for normal operation is provided. The system includes the system clock, self-test circuitry, a first and second test register to capture and launch test data in response to a sequence of data pulses, and a logic circuit to be tested. The self-test circuitry includes an AC self-test controller and a clock splitter. The clock splitter generates the sequence of data pulses including a long data capture pulse followed by an at speed data launch pulse and an at speed data capture pulse followed by a long data launch pulse. The at speed data launch pulse and the at speed data capture pulse are generated for a common cycle of the system clock.

  16. A controlled ac Stark echo for quantum memories.

    Science.gov (United States)

    Ham, Byoung S

    2017-08-09

    A quantum memory protocol of controlled ac Stark echoes (CASE) based on a double rephasing photon echo scheme via controlled Rabi flopping is proposed. The double rephasing scheme of photon echoes inherently satisfies the no-population inversion requirement for quantum memories, but the resultant absorptive echo remains a fundamental problem. Herein, it is reported that the first echo in the double rephasing scheme can be dynamically controlled so that it does not affect the second echo, which is accomplished by using unbalanced ac Stark shifts. Then, the second echo is coherently controlled to be emissive via controlled coherence conversion. Finally a near perfect ultralong CASE is presented using a backward echo scheme. Compared with other methods such as dc Stark echoes, the present protocol is all-optical with advantages of wavelength-selective dynamic control of quantum processing for erasing, buffering, and channel multiplexing.

  17. ac power control in the Core Flow Test Loop

    International Nuclear Information System (INIS)

    McDonald, D.W.

    1980-01-01

    This work represents a status report on a development effort to design an ac power controller for the Core Flow Test Loop. The Core Flow Test Loop will be an engineering test facility which will simulate the thermal environment of a gas-cooled fast-breeder reactor. The problems and limitations of using sinusoidal ac power to simulate the power generated within a nuclear reactor are addressed. The transformer-thyristor configuration chosen for the Core Flow Test Loop power supply is presented. The initial considerations, design, and analysis of a closed-loop controller prototype are detailed. The design is then analyzed for improved performance possibilities and failure modes are investigated at length. A summary of the work completed to date and a proposed outline for continued development completes the report

  18. Indoor Air Pollution in Non Ac Passenger Bus

    Science.gov (United States)

    El Husna, Iksiroh; Unzilatirrizqi, Rizal D. Yan El; Karyanto, Yudi; Sunoko, Henna R.

    2018-02-01

    Passenger buses have been one of favorite means of transportation in Indonesia due to its affordability and flexibility. Intensity of human activities during the trip in the buses have a potential of causing indoor air pollution (polusi udara dalam ruang; PUDR). The indoor air pollution has an impact of 1000-time bigger than outdoor air pollution (polusi udara luar ruang; PULR) on lung. This study aimed to find out indoor air pollution rate of non air conditioned buses using an approach to biological agent pollutant source. The study applied an analysis restricted to microorganisms persistence as one of the sources of the indoor air pollution. The media were placed in different parts of the non AC buses. This study revealed that fungs were found in the non AC buses. They became contaminants and developed pathogenic bacteria that caused air pollution.

  19. Indoor Air Pollution in Non Ac Passenger Bus

    Directory of Open Access Journals (Sweden)

    El Husna Iksiroh

    2018-01-01

    Full Text Available Passenger buses have been one of favorite means of transportation in Indonesia due to its affordability and flexibility. Intensity of human activities during the trip in the buses have a potential of causing indoor air pollution (polusi udara dalam ruang; PUDR. The indoor air pollution has an impact of 1000-time bigger than outdoor air pollution (polusi udara luar ruang; PULR on lung. This study aimed to find out indoor air pollution rate of non air conditioned buses using an approach to biological agent pollutant source. The study applied an analysis restricted to microorganisms persistence as one of the sources of the indoor air pollution. The media were placed in different parts of the non AC buses. This study revealed that fungs were found in the non AC buses. They became contaminants and developed pathogenic bacteria that caused air pollution.

  20. SNL software manual for the ACS Data Analytics Project.

    Energy Technology Data Exchange (ETDEWEB)

    Stearley, Jon R.; McLendon, William Clarence, III; Rodrigues, Arun F.; Williams, Aaron S.; Hooper, Russell Warren; Robinson, David Gerald; Stickland, Michael G.

    2011-10-01

    In the ACS Data Analytics Project (also known as 'YumYum'), a supercomputer is modeled as a graph of components and dependencies, jobs and faults are simulated, and component fault rates are estimated using the graph structure and job pass/fail outcomes. This report documents the successful completion of all SNL deliverables and tasks, describes the software written by SNL for the project, and presents the data it generates. Readers should understand what the software tools are, how they fit together, and how to use them to reproduce the presented data and additional experiments as desired. The SNL YumYum tools provide the novel simulation and inference capabilities desired by ACS. SNL also developed and implemented a new algorithm, which provides faster estimates, at finer component granularity, on arbitrary directed acyclic graphs.

  1. Ac magnetic susceptibility study of in vivo nanoparticle biodistribution

    Energy Technology Data Exchange (ETDEWEB)

    Gutierrez, L; Veintemillas-Verdaguer, S; Serna, C J; Morales, M P [Instituto de Ciencia de Materiales de Madrid, ICMM-CSIC, Sor Juana Ines de la Cruz 3, Cantoblanco 28049, Madrid (Spain); MejIas, R; Barber, D F [Centro Nacional de BiotecnologIa, CNB-CSIC, Darwin 3, Cantoblanco 28049, Madrid (Spain); Lazaro, F J, E-mail: lucia@icmm.csic.es [Departamento de Ciencia y Tecnologia de Materiales y Fluidos, Universidad de Zaragoza, Maria de Luna 3, 50018, Zaragoza (Spain)

    2011-06-29

    We analysed magnetic nanoparticle biodistribution, before and after cytokine conjugation, in a mouse model by ac susceptibility measurements of the corresponding resected tissues. Mice received repeated intravenous injections of nanoparticle suspension for two weeks and they were euthanized 1 h after the last injection. In general, only 10% of the total injected nanoparticles after multiple exposures were found in tissues. The rest of the particles may probably be metabolized or excreted by the organism. Our findings indicate that the adsorption of interferon to DMSA-coated magnetic nanoparticles changes their biodistribution, reducing the presence of nanoparticles in lungs and therefore their possible toxicity. The specific targeting of the particles to tumour tissues by the use of an external magnetic field has also been studied. Magnetic nanoparticles were observed by transmission electron microscopy in the targeted tissue and quantified by ac magnetic susceptibility.

  2. AC system stabilization via phase shift transformer with thyristor commutation

    Energy Technology Data Exchange (ETDEWEB)

    Oliveira, Jose Carlos de; Guimaraes, Geraldo Caixeta; Moraes, Adelio Jose [Uberlandia Univ., MG (Brazil); Abreu, Jose Policarpo G. de [Escola Federal de Engenharia de Itajuba, MG (Brazil); Oliveira, Edimar Jose de [Juiz de Fora Univ., MG (Brazil)

    1994-12-31

    This article aims to present initially the constructive and operative forms of a phase-shift autotransformer which provides both magnitude and phase angle change through thyristor commutation, including a technic to reduce the number of thyristors. Following, it is proposed a control system to make such equipment an efficient AC system stabilizing tool. It is presented some simulation results to show the operation of this transformer in an electrical system. (author) 3 refs., 11 figs., 3 tabs.

  3. Lamin A/C and polymeric actin in genome organization

    Czech Academy of Sciences Publication Activity Database

    Ondřej, V.; Lukášová, Emilie; Kroupová, Jana; Matula, P.; Kozubek, Stanislav

    2008-01-01

    Roč. 26, č. 4 (2008), s. 356-361 ISSN 1016-8478 R&D Projects: GA AV ČR(CZ) 1QS500040508; GA MŠk(CZ) LC535 Institutional research plan: CEZ:AV0Z50040507; CEZ:AV0Z50040702 Keywords : lamin A/C * polymeric actin * chromosome territories Subject RIV: BO - Biophysics Impact factor: 2.023, year: 2008

  4. Hybrid immersed interface-immersed boundary methods for AC dielectrophoresis

    Science.gov (United States)

    Hossan, Mohammad Robiul; Dillon, Robert; Dutta, Prashanta

    2014-08-01

    Dielectrophoresis, a nonlinear electrokinetic transport mechanism, has become popular in many engineering applications including manipulation, characterization and actuation of biomaterials, particles and biological cells. In this paper, we present a hybrid immersed interface-immersed boundary method to study AC dielectrophoresis where an algorithm is developed to solve the complex Poisson equation using a real variable formulation. An immersed interface method is employed to obtain the AC electric field in a fluid media with suspended particles and an immersed boundary method is used for the fluid equations and particle transport. The convergence of the proposed algorithm as well as validation of the hybrid scheme with experimental results is presented. In this paper, the Maxwell stress tensor is used to calculate the dielectrophoretic force acting on particles by considering the physical effect of particles in the computational domain. Thus, this study eliminates the approximations used in point dipole methods for calculating dielectrophoretic force. A comparative study between Maxwell stress tensor and point dipole methods for computing dielectrophoretic forces are presented. The hybrid method is used to investigate the physics of dielectrophoresis in microfluidic devices using an AC electric field. The numerical results show that with proper design and appropriate selection of applied potential and frequency, global electric field minima can be obtained to facilitate multiple particle trapping by exploiting the mechanism of negative dielectrophoresis. Our numerical results also show that electrically neutral particles form a chain parallel to the applied electric field irrespective of their initial orientation when an AC electric field is applied. This proposed hybrid numerical scheme will help to better understand dielectrophoresis and to design and optimize microfluidic devices.

  5. A controlled ac Stark echo for quantum memories

    OpenAIRE

    Ham, Byoung S.

    2017-01-01

    A quantum memory protocol of controlled ac Stark echoes (CASE) based on a double rephasing photon echo scheme via controlled Rabi flopping is proposed. The double rephasing scheme of photon echoes inherently satisfies the no-population inversion requirement for quantum memories, but the resultant absorptive echo remains a fundamental problem. Herein, it is reported that the first echo in the double rephasing scheme can be dynamically controlled so that it does not affect the second echo, whic...

  6. Pancreatectomy risk calculator: an ACS-NSQIP resource

    Science.gov (United States)

    Parikh, Purvi; Shiloach, Mira; Cohen, Mark E; Bilimoria, Karl Y; Ko, Clifford Y; Hall, Bruce L; Pitt, Henry A

    2010-01-01

    Background The morbidity of pancreatoduodenectomy remains high and the mortality may be significantly increased in high-risk patients. However, a method to predict post-operative adverse outcomes based on readily available clinical data has not been available. Therefore, the objective was to create a ‘Pancreatectomy Risk Calculator’ using the American College of Surgeons-National Surgical Quality Improvement Program (ACS-NSQIP) database. Methods The 2005–2008 ACS-NSQIP data on 7571 patients undergoing proximal (n =4621), distal (n =2552) or total pancreatectomy (n =177) as well as enucleation (n =221) were analysed. Pre-operative variables (n =31) were assessed for prediction of post-operative mortality, serious morbidity and overall morbidity using a logistic regression model. Statistically significant variables were ranked and weighted to create a common set of predictors for risk models for all three outcomes. Results Twenty pre-operative variables were statistically significant predictors of post-operative mortality (2.5%), serious morbidity (21%) or overall morbidity (32%). Ten out of 20 significant pre-operative variables were employed to produce the three mortality and morbidity risk models. The risk factors included age, gender, obesity, sepsis, functional status, American Society of Anesthesiologists (ASA) class, coronary heart disease, dyspnoea, bleeding disorder and extent of surgery. Conclusion The ACS-NSQIP ‘Pancreatectomy Risk Calculator’ employs 10 easily assessable clinical parameters to assist patients and surgeons in making an informed decision regarding the risks and benefits of undergoing pancreatic resection. A risk calculator based on this prototype will become available in the future as on online ACS-NSQIP resource. PMID:20815858

  7. Effective AC needleless and collectorless electrospinning for yarn production.

    Science.gov (United States)

    Pokorny, P; Kostakova, E; Sanetrnik, F; Mikes, P; Chvojka, J; Kalous, T; Bilek, M; Pejchar, K; Valtera, J; Lukas, D

    2014-12-28

    Nanofibrous materials are essential components for a wide range of applications, particularly in the fields of medicine and material engineering. These include protective materials, sensors, cosmetics, hygiene, filtration and energy storage. The most widely used and researched technology in these fields is electrospinning. This method for producing fibers yields highly promising results thanks to its versatility and simplicity. Electrospinning is employed in multiple forms, among which needle and needleless direct current (DC) variants are the most distinctive. The former is based on the generation of just one single jet from a nozzle; hence this fabrication process is not very productive. The latter uses the destabilization of free liquid surfaces by means of an electric field, which enhances the throughput since it produces numerous jets, emitted from the surfaces of rollers, spheres, strings and spirals. However, although some progress in total producibility has been achieved, the efficiency of the DC method still remains relatively low. A further drawback of DC electrospinning is that both variants need a collector, which makes it difficult to combine DC electrospinning easily with other technologies due to the presence of the high field strength within the entire spinning zone. This paper describes our experiments with AC electrospinning. We show that alternating current (AC) electrospinning based on a needleless spinning-electrode provides a highly productive smoke-like aerogel composed of nanofibers. This aerogel rises rapidly from the electrode like a thin plume of smoke, without any need for a collector. Our work shows that AC needleless electrospinning gains its efficiency and collector-less feature thanks to the creation of a perpetually charge-changing virtual counter-electrode composed of the nanofibers emitted. High-speed camera recordings demonstrate the formation mechanism of the nanofibrous plume, which is wafted by an electric wind. This wind

  8. DIAGNOSTIC FEATURES RESEARCH OF AC ELECTRIC POINT MOTORS

    Directory of Open Access Journals (Sweden)

    S. YU. Buryak

    2014-05-01

    Full Text Available Purpose.Considerable responsibility for safety of operation rests on signal telephone and telegraph department of railway. One of the most attackable nodes (both automation systems, and railway in whole is track switches. The aim of this investigation is developing such system for monitoring and diagnostics of track switches, which would fully meet the requirements of modern conditions of high-speed motion and heavy trains and producing diagnostics, collection and systematization of data in an automated way. Methodology. In order to achieve the desired objectives research of a structure and the operating principle description of the switch electric drive, sequence of triggering its main units were carried out. The operating characteristics and settings, operating conditions, the causes of failures in the work, andrequirements for electric drives technology and their service were considered and analyzed. Basic analysis principles of dependence of nature of the changes the current waveform, which flows in the working circuit of AC electric point motor were determined. Technical implementation of the monitoring and diagnosing system the state of AC electric point motors was carried out. Findings. Signals taken from serviceable and defective electric turnouts were researched. Originality. Identified a strong interconnectionbetween the technical condition of the track switchand curve shape that describes the current in the circuit of AC electric point motor during operation which is based on the research processes that have influence on it during operation. Practical value. Shown the principles of the technical approach to the transition from scheduled preventive maintenance to maintenance of real condition for a more objective assessment and thus more rapid response to emerging or failures when they occur gradually, damages and any other shortcomings in the work track switch AC drives.

  9. MD 349: Impedance Localization with AC-dipole

    CERN Document Server

    Biancacci, Nicolo; Metral, Elias; Salvant, Benoit; Papotti, Giulia; Persson, Tobias Hakan Bjorn; Tomas Garcia, Rogelio; CERN. Geneva. ATS Department

    2016-01-01

    The purpose of this MD is to measure the distribution of the transverse impedance of the LHC by observing the phase advance variation with intensity between the machine BPMs. Four injected bunches with different intensities are excited with an AC dipole and the turn by turn data is acquired from the BPM system. Through post-processing analysis the phase variation along the machine is depicted and, from this information, first conclusions of the impedance distribution can be drawn.

  10. The ACS-NUCL Division 50th Anniversary: Introduction

    Energy Technology Data Exchange (ETDEWEB)

    Hobart, David E. [Los Alamos National Lab. (LANL), Los Alamos, NM (United States)

    2016-01-10

    The ACS Division of Nuclear Chemistry and Technology was initiated in 1955 as a subdivision of the Division of Industrial and Engineering Chemistry. Probationary divisional status was lifted in 1965. The Division’s first symposium was held in Denver in 1964 and it is fitting that we kicked-off the 50th Anniversary in Denver in the spring of 2015. Listed as a small ACS Division with only about 1,000 members, NUCL’s impact over the past fifty years has been remarkable. National ACS meetings have had many symposia sponsored or cosponsored by NUCL that included Nobel Laureates, U.S. Senators, other high-ranking officials and many students as speakers. The range of subjects has been exceptional as are the various prestigious awards established by the Division. Of major impact has been the past 30 years of the NUCL Nuclear Chemistry Summer Schools to help fill the void of qualified nuclear scientists and technicians. In celebrating the 50th Anniversary we honor the past, celebrate the present and shape the future of the Division and nuclear science and technology. To celebrate this auspicious occasion a commemorative lapel pin has been designed for distribution to NUCL Division members.

  11. AC electric field induced vortex in laminar coflow diffusion flames

    KAUST Repository

    Xiong, Yuan

    2014-09-22

    Experiments were performed by applying sub-critical high-voltage alternating current (AC) to the nozzle of laminar propane coflow diffusion flames. Light scattering, laser-induced incandescence and laser-induced fluorescence techniques were used to identify the soot zone, and the structures of OH and polycyclic aromatic hydrocarbons (PAHs). Particle image velocimetry was adopted to quantify the velocity field. Under certain AC conditions of applied voltage and frequency, the distribution of PAHs and the flow field near the nozzle exit were drastically altered, leading to the formation of toroidal vortices. Increased residence time and heat recirculation inside the vortex resulted in appreciable formation of PAHs and soot near the nozzle exit. Decreased residence time along the jet axis through flow acceleration by the vortex led to a reduction in the soot volume fraction in the downstream sooting zone. Electromagnetic force generated by AC was proposed as a viable mechanism for the formation of the toroidal vortex. The onset conditions for the vortex formation supported the role of an electromagnetic force acting on charged particles in the flame zone. (C) 2014 The Combustion Institute. Published by Elsevier Inc. All rights reserved.

  12. AC-600 passive containment cooling system performance research

    International Nuclear Information System (INIS)

    Jia Baoshan; Yu Jiyang; Shi Junying

    1997-01-01

    a code named PCCSAC which is able to predict both the evaporating film on the outside surface of the vessel and the condensed film on its inside is developed successfully. It is a special software tool to analyze the passive containment cooling system (PCCS) performance in the design of AC-600. The author includes the establishment of physical models, selection of numerical methods, debugging and verification of the code and application of the code in the AC-600 PCCS. In physical models, the fundamental conservation equations about various areas and heat conduction equations are established. In order to make the equations to meet the closed form of solution, a lot of structure formulae are complemented. After repeated selection and demonstration of the numerical methods, the backward difference method Gear which is generally used for stiff problem is chosen for the solution of ordinary differential equations derived from the physical models. The results of standard example calculated by the PCCSAC code and the COMMIX code which is used to analyze westinghouse AP-600 are same in the main. The reliability and validity are verified from the calculations. The PCCSAC code is applied in the calculations of two important LOCA used in the containment safety analyses. The sensitivity of main parameters in the system based on LOCA are studied. All the results are reasonable and in agreement with the theoretical analyses. It can be concluded that the PCCSAC code is able to be used for the analyses of AC-600 PCCS performance

  13. Effects of AC Electric Field on Small Laminar Nonpremixed Flames

    KAUST Repository

    Xiong, Yuan

    2015-04-01

    Electric field can be a viable method in controlling various combustion properties. Comparing to traditional actuators, an application of electric field requires very small power consumption. Especially, alternating current (AC) has received attention recently, since it could modulate flames appreciably even for the cases when direct current (DC) has minimal effects. In this study, the effect of AC electric fields on small coflow diffusion flames is focused with applications of various laser diagnostic techniques. Flow characteristics of baseline diffusion flames, which corresponds to stationary small coflow diffusion flames when electric field is not applied, were firstly investigated with a particular focus on the flow field in near-nozzle region with the buoyancy force exerted on fuels due to density differences among fuel, ambient air, and burnt gas. The result showed that the buoyancy force exerted on the fuel as well as on burnt gas significantly distorted the near-nozzle flow-fields. In the fuels with densities heavier than air, recirculation zones were formed very close to the nozzle exit. Nozzle heating effect influenced this near-nozzle flow-field particularly among lighter fuels. Numerical simulations were also conducted and the results showed that a fuel inlet boundary condition with a fully developed velocity profile for cases with long fuel tubes should be specified inside the fuel tube to obtain satisfactory agreement in both the flow and temperature fields with those from experiment. With sub-critical AC applied to the baseline flames, particle image velocimetry (PIV), light scattering, laser-induced incandescence (LII), and laser-induced fluores- cence (LIF) techniques were adopted to identify the flow field and the structures of OH, polycyclic aromatic hydrocarbons (PAHs), soot zone. Under certain AC condi- tions of applied voltage and frequency, the distribution of PAHs and the flow field near the nozzle exit were drastically altered from the

  14. Simulation of the AC corona phenomenon with experimental validation

    Science.gov (United States)

    Villa, Andrea; Barbieri, Luca; Marco, Gondola; Malgesini, Roberto; Leon-Garzon, Andres R.

    2017-11-01

    The corona effect, and in particular the Trichel phenomenon, is an important aspect of plasma physics with many technical applications, such as pollution reduction, surface and medical treatments. This phenomenon is also associated with components used in the power industry where it is, in many cases, the source of electro-magnetic disturbance, noise and production of undesired chemically active species. Despite the power industry to date using mainly alternating current (AC) transmission, most of the studies related to the corona effect have been carried out with direct current (DC) sources. Therefore, there is technical interest in validating numerical codes capable of simulating the AC phenomenon. In this work we describe a set of partial differential equations that are comprehensive enough to reproduce the distinctive features of the corona in an AC regime. The model embeds some selectable chemical databases, comprising tens of chemical species and hundreds of reactions, the thermal dynamics of neutral species and photoionization. A large set of parameters—deduced from experiments and numerical estimations—are compared, to assess the effectiveness of the proposed approach.

  15. Simulation of the AC corona phenomenon with experimental validation

    International Nuclear Information System (INIS)

    Villa, Andrea; Barbieri, Luca; Marco, Gondola; Malgesini, Roberto; Leon-Garzon, Andres R

    2017-01-01

    The corona effect, and in particular the Trichel phenomenon, is an important aspect of plasma physics with many technical applications, such as pollution reduction, surface and medical treatments. This phenomenon is also associated with components used in the power industry where it is, in many cases, the source of electro-magnetic disturbance, noise and production of undesired chemically active species. Despite the power industry to date using mainly alternating current (AC) transmission, most of the studies related to the corona effect have been carried out with direct current (DC) sources. Therefore, there is technical interest in validating numerical codes capable of simulating the AC phenomenon. In this work we describe a set of partial differential equations that are comprehensive enough to reproduce the distinctive features of the corona in an AC regime. The model embeds some selectable chemical databases, comprising tens of chemical species and hundreds of reactions, the thermal dynamics of neutral species and photoionization. A large set of parameters—deduced from experiments and numerical estimations—are compared, to assess the effectiveness of the proposed approach. (paper)

  16. UARS PEM Level 2 VMAG AC V001 (UARPE2VMAGAC) at GES DISC

    Data.gov (United States)

    National Aeronautics and Space Administration — The Particle Environment Monitor (PEM) level 2 Vector Magnetometer (VMAG) AC daily product contains the Vector Magnetic Field AC component. PEM was flown on the UARS...

  17. Pengembangan Sistem Otomatisasi AC dan Lampu Menggunakan Fuzzy dan Raspberry Pi

    Directory of Open Access Journals (Sweden)

    Rudy Ariyanto

    2017-11-01

    Full Text Available Otomatisasi AC dan lampu dilakukan untuk menghemat energi yang digunakan pada kehidupan sehari-hari. Dalam pengembangan otomatisasi AC dan lampu perlu menerapkan sebuah perangkat yang memiliki fungsi maksimal dengan harga yang minimal. Raspberry Pi merupakan perangkat atau modul dengan harga rendah yang mampu melakukan komunikasi wireless tanpa bantuan modul lain. Dalam pengembangan otomatisasi AC dan lampu juga diperlukan sebuah metode yang mampu melakukan kontrol terhadap nyala AC dan lampu. Penerapan metode fuzzy dapat dilakukan untuk menghimpun informasi keadaan ruang yang didapat dari sensor untuk menentukan nyala AC dan lampu secara otomatis. Oleh sebab itu pada penelitian ini mengusulkan pengembangan otomatisasi AC dan lampu menggunakan Raspberry Pi dan Fuzzy. Otomatisasi AC dan lampu menggunakan Raspberry Pi yang menerapkan metode Fuzzy dapat menghemat energi hingga 59,87% dalam hal lama waktu nyala AC dan 57,47% untuk lumenasi lampu

  18. Pensar la ciudad en red

    Directory of Open Access Journals (Sweden)

    Fábio Duarte

    2006-01-01

    Full Text Available El paradigma de la sociedad contemporánea es la red, como afirma Manuel Castells (1999 cuándo propone este concepto para que se piense el mundo frente a las tecnologías de información y comunicación. ¿Más como pensar la ciudad en red? Cuándo vemos una imagen aérea de una ciudad, con sus rutas que articulan puntos y regiones, tenemos una imagen perfecta de una red. Pero la evidencia absoluta entre la forma geométrica de una red no puede nos dejar iludirnos: esto no presupone el entendimiento de la sociedad urbana como red. El matemático Nikos Salingaros (2003 argumentó que “las fuerzas que hacen que la ciudad funcione son generadas por la diversidad y necesidad de cambio de información entre diferentes tipos de nodos”, y Gabriel Dupuy (1985 escribió que “si buscamos localizar partes de un sistema, debemos hacerlo en espacios abstractos, espacios topológicos, espacios de n dimensiones, inhabituales en el planeamiento y que no corresponden a la percepción inmediata de la ‘redes clásicas’. Así, las redes son, más que nada, una manera de pensar. Una manera de leer el mundo, una manera de actuar en el mundo.

  19. [Genetic polymorphism of AcP, EsD, 6-PGD and GPT in eleven ethnic groups of China].

    Science.gov (United States)

    Xu, J J; Tan, Q A; Zhao, X X; Du, R F

    1989-01-01

    The genetic polymorphism of red cell acid phosphatase (AcP), Esterase D (EsD), 6-phosphogluconate dehydrogenase (6-PGD) and Glutamic pyruvic transaminase (GPT) in eleven ethnic groups of China was studied by starch gel electrophoresis. The results of 2272 tested showed that the gene frequencies of AcPB1 in Dong, Hui, Bai, Tujia, Miao, Yi, Tibetan, Man, Yao, Hani, Buyi, etc. were 0.7835, 0.7958, 0.8137, 0.7750, 0.7624, 0.8038, 0.8075, 0.8035, 0.7725, 0.6488, 0.6896, EsD1 gene frequencies were 0.6418, 0.7315, 0.6005, 0.6025, 0.6411, 0.6411, 0.6558, 0.6305, 0.6020, 0.6023, 0.6368. 6-PGDA gene frequencies 0.9279, 0.9381, 0.9387, 0.9150, 0.9356, 0.9014, 0.7764, 0.8818, 0.9851, 0.9233, 0.9410. GPT1 gene frequencies 0.4075, 0.5367, 0.5049, 0.4824, 0.5322, 0.6106, 0.6313, 0.6400, 0.3985, 0.4930, 0.3976, respectively. In addition, some rare variants were found.

  20. Altıntop Suyundaki Acılığın Naringinaz Enzimi ile Giderilmesi

    Directory of Open Access Journals (Sweden)

    Zuhal Çeviker

    2015-02-01

    Full Text Available Bu çalışmada MarshSeedless ve Rio Red çeşiti altıntoplardan elde edilen meyve sularındaki acılığın giderilmesi araştırılmıştır. Acılık giderme işlemi farklı naringinaz konsantrasyonlarında (0.25, 0.50, 0.75 ve 1.00 g/L ve farklı sıcaklıklarda (25, 35 ve 40oC gerçekleştirilmiştir. Naringin giderimi, naringinaz miktarı ve sıcaklıktaki artışa paralel olarak artmıştır. Her iki çeşitte de en yüksek naringin giderimi 1 g/L naringinaz konsantrasyonunda 40oC’de ve 6 saatlik inkübasyon sonunda elde edilmiştir. Duyusal değerlendirmede panelistler kontrol örneklerini enzimle muamele edilmiş örneklerden ayırt edebilmişlerdir.

  1. Investigation and comparison of AC losses on stabilizer-free and copper stabilizer HTS tapes

    Science.gov (United States)

    Shen, Boyang; Li, Jing; Geng, Jianzhao; Fu, Lin; Zhang, Xiuchang; Li, Chao; Zhang, Heng; Dong, Qihuan; Ma, Jun; Coombs, T. A.

    2017-10-01

    This paper presents the measurement and simulation of Alternating Current (AC) losses on the Stabilizer-free and Copper Stabilizer High Temperature Superconducting (HTS) Tapes: SuperPower SF12100 and SCS12050. The AC loss measurement utilised electrical method to obtain overall losses with AC transport currents. The 2D H-formulation by COMSOL Multiphysics has been used to simulate the real geometry and multi-layer HTS tapes. Ferromagnetic AC losses of substrate have been assumed to be ignored as the substrates of SF12100 and SCS12050 are non-magnetic. Hysteresis AC losses in the superconducting layer, and eddy-current AC losses in copper stabilizer, silver overlayer and substrate were concerned in this investigation. The measured AC losses were compared to the AC losses from simulation, with 3 cases of different AC frequency 10, 100, and 1000 Hz. The eddy-current AC losses of copper stabilizer at frequency 1000 Hz were determined from both experiment and simulation. The estimation of AC losses with frequency at 10,000 Hz was also carried out using simulation method. Finally, the frequency dependence of AC losses from Stabilizer-free Tape and Copper Stabilizer Tape were compared and analysed.

  2. A direct power conversion topology for grid integrations of hybrid AC/DC resources

    DEFF Research Database (Denmark)

    Liu, Xiong; Loh, Poh Chiang; Wang, Peng

    2012-01-01

    and modulation schemes are proposed to extract the commanded current from the input ac/dc sources to the grid and guarantee high quality ac/dc inputs and ac output current waveforms with unity power factors. The proposed modulation scheme for sinusoidal outputs of the VMC is mathematically proved...

  3. Autographa californica multiple nucleopolyhedrovirus ac53 plays a role in nucleocapsid assembly

    International Nuclear Information System (INIS)

    Liu Chao; Li Zhaofei; Wu Wenbi; Li Lingling; Yuan Meijin; Pan Lijing; Yang Kai; Pang Yi

    2008-01-01

    Autographa californica multiple nucleopolyhedrovirus (AcMNPV) orf53 (ac53) is a highly conserved gene existing in all sequenced Lepidoptera and Hymenoptera baculoviruses, but its function remains unknown. To investigate its role in the baculovirus life cycle, an ac53 deletion virus (vAc ac53KO-PH-GFP ) was generated through homologous recombination in Escherichia coli. Fluorescence and light microscopy and titration analysis revealed that vAc ac53KO-PH-GFP could not produce infectious budded virus in infected Sf9 cells. Real-time PCR demonstrated that the ac53 deletion did not affect the levels of viral DNA replication. Electron microscopy showed that many lucent tubular shells devoid of the nucleoprotein core are present in the virogenic stroma and ring zone, indicating that the ac53 knockout affected nucleocapsid assembly. With a recombinant virus expressing an Ac53-GFP fusion protein, we observed that Ac53 was distributed within the cytoplasm and nucleus at 24 h post-infection, but afterwards accumulated predominantly near the nucleus-cytoplasm boundary. These data demonstrate that ac53 is involved in nucleocapsid assembly and is an essential gene for virus production

  4. DAVs: Red Edge and Outbursts

    Science.gov (United States)

    Luan, Jing

    2018-04-01

    As established by ground based surveys, white dwarfs with hydrogen atmospheres pulsate as they cool across the temperature range, 12500Kred edge is a two-decade old puzzle. Recently, Kepler discovered a number of cool DAVs exhibiting sporadic outbursts separated by days, each lasting several hours, and releasing \\sim 10^{33}-10^{34} {erg}. We provide quantitative explanations for both the red edge and the outbursts. The minimal frequency for overstable modes rises abruptly near the red edge. Although high frequency overstable modes exist below the red edge, their photometric amplitudes are generally too small to be detected by ground based observations. Nevertheless, these overstable parent modes can manifest themselves through nonlinear mode couplings to damped daughter modes which generate limit cycles giving rise to photometric outbursts.

  5. Challenges and solutions in medically managed ACS in the Asia-Pacific region: expert recommendations from the Asia-Pacific ACS Medical Management Working Group.

    Science.gov (United States)

    Huo, Yong; Thompson, Peter; Buddhari, Wacin; Ge, Junbo; Harding, Scott; Ramanathan, Letchuman; Reyes, Eugenio; Santoso, Anwar; Tam, Li-Wah; Vijayaraghavan, Govindan; Yeh, Hung-I

    2015-03-15

    Acute coronary syndromes (ACS) remain a leading cause of mortality and morbidity in the Asia-Pacific (APAC) region. International guidelines advocate invasive procedures in all but low-risk ACS patients; however, a high proportion of ACS patients in the APAC region receive solely medical management due to a combination of unique geographical, socioeconomic, and population-specific barriers. The APAC ACS Medical Management Working Group recently convened to discuss the ACS medical management landscape in the APAC region. Local and international ACS guidelines and the global and APAC clinical evidence-base for medical management of ACS were reviewed. Challenges in the provision of optimal care for these patients were identified and broadly categorized into issues related to (1) accessibility/systems of care, (2) risk stratification, (3) education, (4) optimization of pharmacotherapy, and (5) cost/affordability. While ACS guidelines clearly represent a valuable standard of care, the group concluded that these challenges can be best met by establishing cardiac networks and individual hospital models/clinical pathways taking into account local risk factors (including socioeconomic status), affordability and availability of pharmacotherapies/invasive facilities, and the nature of local healthcare systems. Potential solutions central to the optimization of ACS medical management in the APAC region are outlined with specific recommendations. Copyright © 2014 Elsevier Ireland Ltd. All rights reserved.

  6. Small-Signal Analysis of Single-Phase and Three-phase DC/AC and AC/DC PWM Converters with the Frequency-Shift Technique

    DEFF Research Database (Denmark)

    Blaabjerg, Frede; Aquila, A. Dell’; Liserre, Marco

    2004-01-01

    of dc/dc converters via a 50 Hz frequency-shift. The input admittance is calculated and measured for two study examples (a three-phase active rectifier and a single-phase photovoltaic inverter). These examples show that the purpose of a well designed controller for grid-connected converters......A systematic approach to study dc/ac and ac/dc converters without the use of synchronous transformation is proposed. The use of a frequency-shift technique allows a straightforward analysis of single-phase and three-phase systems. The study of dc/ac and of ac/dc converters is reported to the study...

  7. Carcinogen metabolism genes, red meat and poultry intake, and colorectal cancer risk.

    Science.gov (United States)

    Wang, Jun; Joshi, Amit D; Corral, Román; Siegmund, Kimberly D; Marchand, Loïc Le; Martinez, Maria Elena; Haile, Robert W; Ahnen, Dennis J; Sandler, Robert S; Lance, Peter; Stern, Mariana C

    2012-04-15

    Diets high in red meat are established risk factors for colorectal cancer (CRC). Carcinogenic compounds generated during meat cooking have been implicated as causal agents. We conducted a family-based case-control study to investigate the association between polymorphisms in carcinogen metabolism genes (CYP1A2 -154A>C, CYP1B1 Leu432Val, CYP2E1 -1054C>T, GSTP1 Ile105Val, PTGS2 5UTR -765, EPHX1 Tyr113His, NAT2 Ile114Thr, NAT2 Arg197Gln and NAT2 Gly286Glu) and CRC risk. We tested for gene-environment interactions using case-only analyses (N = 577) and compared statistically significant results to those obtained using case-unaffected sibling comparisons (N = 307 sibships). Our results suggested that CYP1A2 -154A>C might modify the association between intake of red meat cooked using high temperature methods and well done on the inside and CRC risk (case-only interaction OR = 1.53; 95% CI = 1.19-1.97; p = 0.0008) and the association between intake of red meat heavily browned on the outside and rectal cancer risk (case-only interaction OR = 0.65; 95% CI = 0.48-0.86; p = 0.003). We also found that GSTP1 Ile105Val might modify the association between intake of poultry cooked with high temperature methods and CRC risk (p = 0.0035), a finding that was stronger among rectal cancer cases. Our results support a role for heterocyclic amines that form in red meat as a potential explanation for the observed association between diets high in red meat and CRC. Our findings also suggest a possible role for diets high in poultry cooked at high temperatures in CRC risk. Copyright © 2011 UICC.

  8. Red de senderos universitarios inteligentes

    OpenAIRE

    Ibarra-Berrocal, I.J.; Romero, J.; Pérez, J.

    2017-01-01

    Introducción: El Proyecto de red de senderos universitarios inteligentes UR se inspira en tres realidades, la red de senderos europeos ya existentes y su importancia en el fomento de la actividad deportiva y los hábitos saludables, la creciente importancia de la implantación, intercambio y difusión de políticas y planes de acción en materia de sostenibilidad ambiental en el ámbito universitario europeo, y por último, el uso y desarrollo de infraestructuras y aplicaciones, cada vez más impresc...

  9. Betelgeuse and the Red Supergiants

    Science.gov (United States)

    van Loon, J. Th.

    2013-05-01

    Betelgeuse is one of the most magnificent stars in the sky, and one of the nearest red supergiants. Astronomers gathered in Paris in the Autumn of 2012 to decide what we know about its structure, behaviour, and past and future evolution, and how to place this in the general context of the class of red supergiants. Here I reflect on the discussions and propose a synthesis of the presented evidence. I believe that, in those four days, we have achieved to solve a few riddles.

  10. Established and potential physiological roles of bicarbonatesensing soluble adenylyl cyclase (sAC) in aquatic animals

    OpenAIRE

    Tresguerres, M; Barott, KL; Barron, ME; Roa, JN

    2014-01-01

    Soluble adenylyl cyclase (sAC) is a recently recognized source of the signaling molecule cyclic AMP (cAMP) that is genetically and biochemically distinct from the classic G-protein-regulated transmembrane adenylyl cyclases (tmACs). Mammalian sAC is distributed throughout the cytoplasm and it may be present in the nucleus and inside mitochondria. sAC activity is directly stimulated by HCO 3 - , and sAC has been confirmed to be a HCO 3 - sensor in a variety of mammalian cell types. In addition...

  11. Working with the American Community Survey in R a guide to using the acs package

    CERN Document Server

    Glenn, Ezra Haber

    2016-01-01

    This book serves as a hands-on guide to the "acs" R package for demographers, planners, and other researchers who work with American Community Survey (ACS) data. It gathers the most common problems associated with using ACS data and implements functions as a package in the R statistical programming language. The package defines a new "acs" class object (containing estimates, standard errors, and metadata for tables from the ACS) with methods to deal appropriately with common tasks (e.g., creating and combining subgroups or geographies, automatic fetching of data via the Census API, mathematical operations on estimates, tests of significance, plots of confidence intervals).

  12. Dicty_cDB: FC-AC21 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AC21 (Link to dictyBase) - - - Contig-U15104-1 FC-AC21E (Li...nk to Original site) - - - - - - FC-AC21E 527 Show FC-AC21 Library FC (Link to library) Clone ID FC-AC21 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U15104-1 Original site URL http://dict...ce KDSLDVIIFPEMVKLVGLTPNTMEKVLTYFQDNDTIDLSTFPMEIQVEQLSGKYIFICTH KQKDQRCGYCGPILVDQLRDQIKERSLEKEIQVFGTSHVGGHKY... Frames) Frame A: KDSLDVIIFPEMVKLVGLTPNTMEKVLTYFQDNDTIDLSTFPMEIQVEQLSGKYIFICTH KQ

  13. Advances in Red VCSEL Technology

    Directory of Open Access Journals (Sweden)

    Klein Johnson

    2012-01-01

    Full Text Available Red VCSELs offer the benefits of improved performance and lower power consumption for medical and industrial sensing, faster printing and scanning, and lower cost, higher speed interconnects based upon plastic optical fiber (POF. However, materials challenges make it more difficult to achieve the desired performance than at the well-developed wavelength of 850 nm. This paper will describe the state of the art of red VCSEL performance and the results of development efforts to achieve improved output power and a broader temperature range of operation. It will also provide examples of the applications of red VCSELs and the benefits they offer. In addition, the packaging flexibility offered by VCSELs, and some examples of non-Hermetic package demonstrations will be discussed. Some of the red VCSEL performance demonstrations include output power of 14 mW CW at room temperature, a record maximum temperature of 115∘C for CW operation at an emission wavelength of 689 nm, time to 1% failure at room temperature of approximately 200,000 hours, lifetime in a 50∘C, 85% humidity environment in excess of 3500 hours, digital data rate of 3 Gbps, and peak pulsed array power of greater than 100 mW.

  14. The red-blue conundrum

    DEFF Research Database (Denmark)

    Nørtoft, Mikkel Johansen

    2017-01-01

    Plants from the Rubiaceae family (Rubia, Galium, and Asperula) are often grouped together as madder because they have been used for dyeing red since at least the Bronze Age. The English plant name madder can be traced through the Germanic language all the way back to Proto-Indo-European (PIE), as...

  15. Germination of red alder seed.

    Science.gov (United States)

    M.A. Radwan; D.S. DeBell

    1981-01-01

    Red alder seeds were collected from six locations throughout the natural range of the species. Each seed lot was obtained from a single tree, and the seeds were used to determine germination with and without stratification treatment. Irrespective of treatment, germination varied significantly (P

  16. Residential Proximity to Major Roadways Is Associated With Increased Levels of AC133+ Circulating Angiogenic Cells.

    Science.gov (United States)

    DeJarnett, Natasha; Yeager, Ray; Conklin, Daniel J; Lee, Jongmin; O'Toole, Timothy E; McCracken, James; Abplanalp, Wes; Srivastava, Sanjay; Riggs, Daniel W; Hamzeh, Ihab; Wagner, Stephen; Chugh, Atul; DeFilippis, Andrew; Ciszewski, Tiffany; Wyatt, Brad; Becher, Carrie; Higdon, Deirdre; Ramos, Kenneth S; Tollerud, David J; Myers, John A; Rai, Shesh N; Shah, Jasmit; Zafar, Nagma; Krishnasamy, Sathya S; Prabhu, Sumanth D; Bhatnagar, Aruni

    2015-11-01

    Previous studies have shown that residential proximity to a roadway is associated with increased cardiovascular disease risk. Yet, the nature of this association remains unclear, and its effect on individual cardiovascular disease risk factors has not been assessed. The objective of this study was to determine whether residential proximity to roadways influences systemic inflammation and the levels of circulating angiogenic cells. In a cross-sectional study, cardiovascular disease risk factors, blood levels of C-reactive protein, and 15 antigenically defined circulating angiogenic cell populations were measured in participants (n=316) with moderate-to-high cardiovascular disease risk. Attributes of roadways surrounding residential locations were assessed using geographic information systems. Associations between road proximity and cardiovascular indices were analyzed using generalized linear models. Close proximity (proximity to a major roadway (CD31(+)/AC133(+), AC133(+), CD34(+)/AC133(+), and CD34(+)/45(dim)/AC133(+) cells) and positively associated with road segment distance (CD31(+)/AC133(+), AC133(+), and CD34(+)/AC133(+) cells), traffic intensity (CD31(+)/AC133(+) and AC133(+) cells), and distance-weighted traffic intensity (CD31(+)/34(+)/45(+)/AC133(+) cells). Living close to a major roadway is associated with elevated levels of circulating cells positive for the early stem marker AC133(+). This may reflect an increased need for vascular repair. Levels of these cells in peripheral blood may be a sensitive index of cardiovascular injury because of residential proximity to roadways. © 2015 American Heart Association, Inc.

  17. AC Power Local Network with Multiple Power Routers

    Directory of Open Access Journals (Sweden)

    Ryo Takahashi

    2013-12-01

    Full Text Available Controlling power flow and achieving appropriate matching between power sources and loads according to the quality of energy is expected to be one of the approaches to reduce wasted energy consumption. A power router, proposed recently, has the capability of realizing circuit switching in a power distribution network. This study focuses on the feasibility of an AC power routing network system composed of multiple power routers. To evaluate the feasibility, we experimentally confirm the circuit switching operation of the parallel and series configurations of the power routers, so that the network system can be designed by the combination of parallel and series configurations.

  18. Total synthesis and allelopathic activity of cytosporones A-C

    Energy Technology Data Exchange (ETDEWEB)

    Zamberlam, Charles E.M.; Meza, Alisson; Lima, Denis P. de; Beatriz, Adilson [Centro de Ciencias Exatas e Tecnologia, Universidade Federal de Mato Grosso do Sul, Campo Grande, MS (Brazil); Leite, Carla Braga; Marques, Maria Rita [Centro de Ciencias Biologicas e da Saude, Universidade Federal de Mato Grosso do Sul, Campo Grande, MS (Brazil)

    2012-07-01

    The search for efficient, environmentally friendly herbicides has been the focus of numerous studies on the organic synthesis of compounds isolated from natural sources. Cytosporones, which are phenolic lipids isolated from fungi, exhibit noteworthy biological properties. This paper reports the preparation of cytosporones A-C from the same starting material through a short synthetic route, with good yields. All compounds were tested for allelopathic activity on lettuce (Lactuca sativa L) seeds. Cytosporone A and its methylated precursor showed remarkable allelopathic activity, inhibiting seed germination and plantule growth. (author)

  19. Aspectos acústicos do comportamento dos golfinhos

    OpenAIRE

    Santos, Manuel Eduardo dos

    1989-01-01

    Este artigo pretende apresentar uma recolha bibliográfica de alguns dados e hipóteses relativos a adaptações sensoriais e comunicativas dos cetáceos, particularmente dos golfinhos. São consideradas as suas capacidades perceptivas e as potencialidades dos canais de comunicação de que dispõem, sendo realçada a sua considerável especialização na utilização do canal acústico. Depois de uma breve referência às suas capacidades auditivas concretas e às teorias explicativa...

  20. Warning: safety risk with some Apple AC Wall Plug Adapters

    CERN Multimedia

    CERN IT department

    2016-01-01

    Dear Mac and iOS Users, Apple has determined that some of its two prong Apple AC wall plug adapters may break and create a risk of electrical shock.   CERN users can now exchange their affected Apple wall plug adapters at the Service Desk. To find out if your adapter is affected and for any further information concerning the procedure to follow to exchange it, please check the following URL: https://cern.service-now.com/service-portal/view-outage.do?n=OTG0028639.

  1. Distributed energy resources in grid interactive AC microgrids

    DEFF Research Database (Denmark)

    Wang, Xiongfei; Guerrero, Josep; Chen, Zhe

    2010-01-01

    Increased penetration of distributed energy resources (DER) and large-scale deployment of renewable energy sources are challenging the entire architecture of traditional power system. Microgrid, featuring higher flexibility and reliability, becomes an attractive candidate for the configuration...... of future electrical power system. This paper gives an overview of DER units in the grid interactive ac microgrid. The options in structures and control methods of power electronics interfaced DER units are described. Instantaneous load sharing strategies among DER units in the islanded microgrid operations...

  2. Propiedades acústicas de los paneles de carrizo

    Directory of Open Access Journals (Sweden)

    Díaz, César

    2012-03-01

    Full Text Available Reed is a plant species very similar to common cane which is widespread all over the Earth. It is an ecological and sustainable material which is low-cost, aesthetically attractive, easy to obtain and install, and can be used in different construction systems. This work analyses the acoustic properties of reed panels from the point of view of sound absorption and sound insulation against airborne noise, according to the corresponding EN ISO standards. The experimental results obtained point to the conclusion that reed panels are suitable construction systems for controlling reverberant sound within a space, and that the sound reduction index values for different thicknesses of reed panels, or reed panels used in combination with wood particle boards, demonstrate the possibility of using them in construction as an element on the facades and roofs of buildings and for interior partitions.

    El carrizo es una especie vegetal, parecida a la caña común, que se encuentra ampliamente distribuida en la superficie terrestre. Es un material ecológico y sostenible de bajo coste, estéticamente aceptable, fácil de obtener y colocar, que permite generar diferentes sistemas constructivos. En este trabajo se analizan las propiedades acústicas de los paneles de carrizo en lo referente a la absorción acústica y al aislamiento acústico a ruido aéreo, para ello se han aplicado los procedimientos de las normas EN ISO correspondientes. De los resultados experimentales obtenidos se concluye que los paneles de carrizo son unos sistemas constructivos adecuados para el control del sonido reverberante en un recinto y que los valores del índice de reducción acústica de paneles de diferentes espesores o en combinación con tableros de partículas de madera muestran la posibilidad de utilizarlos en la edificación como elemento de fachada, en cubiertas de edificios y particiones interiores.

  3. Scaling laws for AC gas breakdown and implications for universality

    Science.gov (United States)

    Loveless, Amanda M.; Garner, Allen L.

    2017-10-01

    The reduced dependence on secondary electron emission and electrode surface properties makes radiofrequency (RF) and microwave (MW) plasmas advantageous over direct current (DC) plasmas for various applications, such as microthrusters. Theoretical models relating molecular constants to alternating current (AC) breakdown often fail due to incomplete understanding of both the constants and the mechanisms involved. This work derives simple analytic expressions for RF and MW breakdown, demonstrating the transition between these regimes at their high and low frequency limits, respectively. We further show that the limiting expressions for DC, RF, and MW breakdown voltage all have the same universal scaling dependence on pressure and gap distance at high pressure, agreeing with experiment.

  4. Offshore windfarm connection with low frequency AC transmission technology

    DEFF Research Database (Denmark)

    Qin, Nan; Xu, Zhao; You, Shi

    2009-01-01

    to the conventional AC solution at the nominal frequency, e.g. 50 Hz or 60 Hz. and reduces the investment cost compared to the HVDC solution. It is estimated that the LFAC system is competitive in the transmission distance of about 30-150 km. The simulation model of the wind integration using the LFAC system has been...... developed, which consists of three parts, the fixed-speed wind turbine representing a wind farm, the transmission line and the frequency converter. Although the transmission capability is greatly improved by the LFAC system, simulation shows it gives negative influences on the wind turbine operation due...

  5. Soliton ratchetlike dynamics by ac forces with harmonic mixing

    DEFF Research Database (Denmark)

    Salerno, Mario; Zolotaryuk, Yaroslav

    2002-01-01

    in the system. Effective soliton transport is achieved when the internal mode and the external force get phase locked. We find that for kinks driven by biharmonic drivers consisting of the superposition of a fundamental driver with its first odd harmonic, the transport arises only due to this internal mode......The possibility of unidirectional motion of a kink (topological soliton) of a dissipative sine-Gordon equation in the presence of ac forces with harmonic mixing (at least biharmonic) and of zero mean, is presented. The dependence of the kink mean velocity on system parameters is investigated...

  6. Materials for Powder-Based AC-Electroluminescence

    Directory of Open Access Journals (Sweden)

    Hubert Schulze Dieckhoff

    2010-02-01

    Full Text Available At present, thick film (powder based alternating current electroluminescence (AC-EL is the only technology available for the fabrication of large area, laterally structured and coloured light sources by simple printing techniques. Substrates for printing may be based on flexible polymers or glass, so the final devices can take up a huge variety of shapes. After an introduction of the underlying physics and chemistry, the review highlights the technical progress behind this development, concentrating on luminescent and dielectric materials used. Limitations of the available materials as well as room for further improvement are also discussed.

  7. Current Control of Grid Converters Connected with Series AC Capacitor

    DEFF Research Database (Denmark)

    Wang, Xiongfei; Blaabjerg, Frede; Loh, Poh Chiang

    2015-01-01

    The series ac capacitor has recently been used with the transformerless grid-connected converters in the distribution power grids. The capacitive characteristic of the resulting series LC filter restricts the use of conventional synchronous integral or stationary resonant current controllers. Thus...... this paper proposes a fourth-order resonant controller in the stationary frame, which guarantees a zero steady-state current tracking error for the grid converters with series LC filter. This method is then implemented in a three-phase experimental system for verification, where the current harmonics below...

  8. A PWM transistor inverter for an ac electric vehicle drive

    Science.gov (United States)

    Slicker, J. M.

    1981-01-01

    A prototype system consisting of closely integrated motor, inverter, and transaxle has been built in order to demonstrate the feasibility of a three-phase ac transistorized inverter for electric vehicle applications. The microprocessor-controlled inverter employs monolithic power transistors to drive an oil-cooled, three-phase induction traction motor at a peak output power of 30 kW from a 144 V battery pack. Transistor safe switching requirements are discussed, and a circuit is presented for recovering trapped snubber inductor energy at transistor turn-off.

  9. A New Understanding on AC Corrosion of Pipeline Steel in Alkaline Environment

    Science.gov (United States)

    Zhu, M.; Du, C. W.

    2017-01-01

    In this work, the corrosion behavior of X80 pipeline steel at various frequencies AC was investigated in carbonate/bicarbonate solution using the polarization curve, EIS test, Mott-Schottky curve and immersion tests. A new understanding on AC corrosion of the steel in alkaline environment is proposed. Decreasing AC frequency negatively shifts the corrosion potential and increases the corrosion rate of steel, as well as corrosion pits occur more readily. The superimposed AC shifts the critical pitting potential negatively and degrades the passivity of the steel. AC reduces the compactness and uniformity of the passive film formed on the steel and increases the possibility of the breakdown of the film, as well decreases the film thickness. The application of AC could prevent the passive film forming on the surface of X80 steel and result in a destructive effect on the film formed on the steel surface, especially at the low-frequency AC.

  10. HST/ACS IMAGING OF OMEGA CENTAURI: OPTICAL COUNTERPARTS OF CHANDRA X-RAY SOURCES

    International Nuclear Information System (INIS)

    Cool, Adrienne M.; Arias, Tersi; Brochmann, Michelle; Dorfman, Jason; Gafford, April; White, Vivian; Haggard, Daryl; Anderson, Jay

    2013-01-01

    We present results of a search for optical counterparts of X-ray sources in and toward the globular cluster Omega Centauri (NGC 5139) using the Advanced Camera for Surveys (ACS) on the Hubble Space Telescope. The ACS data consist of a mosaic of Wide Field Channel images obtained using F625W, F435W, and F658N filters; with nine pointings we cover the central ∼10' × 10' of the cluster and encompass 109 known Chandra sources. We find promising optical counterparts for 59 of the sources, ∼40 of which are likely to be associated with the cluster. These include 27 candidate cataclysmic variables (CVs), 24 of which are reported here for the first time. Fourteen of the CV candidates are very faint, with absolute magnitudes in the range M 625 =10.4-12.6, making them comparable in brightness to field CVs near the period minimum discovered in the Sloan Digital Sky Survey. Additional optical counterparts include three BY Dra candidates, a possible blue straggler, and a previously reported quiescent low-mass X-ray binary. We also identify 3 foreground stars and 11 probable active galactic nuclei. Finally, we report the discovery of a group of seven stars whose X-ray properties are suggestive of magnetically active binaries, and whose optical counterparts lie on or very near the metal-rich anomalous giant and subgiant branches in ω Cen. If the apparent association between these seven stars and the RGB/SGB-a stars is real, then the frequency of X-ray sources in this metal-rich population is enhanced by a factor of at least five relative to the other giant and subgiant populations in the cluster. If these stars are not members of the metal-rich population, then they bring the total number of red stragglers (also known as sub-subgiants) that have been identified in ω to Cen 20, the largest number yet known in any globular cluster.

  11. Isolation of an acetyl-CoA synthetase gene (ZbACS2) from Zygosaccharomyces bailii.

    Science.gov (United States)

    Rodrigues, Fernando; Zeeman, Anne-Marie; Cardoso, Helena; Sousa, Maria João; Steensma, H Yde; Côrte-Real, Manuela; Leão, Cecília

    2004-03-01

    A gene homologous to Saccharomyces cerevisiae ACS genes, coding for acetyl-CoA synthetase, has been cloned from the yeast Zygosaccharomyces bailii ISA 1307, by using reverse genetic approaches. A probe obtained by PCR amplification from Z. bailii DNA, using primers derived from two conserved regions of yeast ACS proteins, RIGAIHSVVF (ScAcs1p; 210-219) and RVDDVVNVSG (ScAcs1p; 574-583), was used for screening a Z. bailii genomic library. Nine clones with partially overlapping inserts were isolated. The sequenced DNA fragment contains a complete ORF of 2027 bp (ZbACS2) and the deduced polypeptide shares significant homologies with the products of ACS2 genes from S. cerevisiae and Kluyveromyces lactis (81% and 82% identity and 84% and 89% similarity, respectively). Phylogenetic analysis shows that the sequence of Zbacs2 is more closely related to the sequences from Acs2 than to those from Acs1 proteins. Moreover, this analysis revealed that the gene duplication producing Acs1 and Acs2 proteins has occurred in the common ancestor of S. cerevisiae, K. lactis, Candida albicans, C. glabrata and Debaryomyces hansenii lineages. Additionally, the cloned gene allowed growth of S. cerevisiae Scacs2 null mutant, in medium containing glucose as the only carbon and energy source, indicating that it encodes a functional acetyl-CoA synthetase. Also, S. cerevisiae cells expressing ZbACS2 have a shorter lag time, in medium containing glucose (2%, w/v) plus acetic acid (0.1-0.35%, v/v). No differences in cell response to acetic acid stress were detected both by specific growth and death rates. The mode of regulation of ZbACS2 appears to be different from ScACS2 and KlACS2, being subject to repression by a glucose pulse in acetic acid-grown cells. Copyright 2004 John Wiley & Sons, Ltd.

  12. Validation of the Peel Plate™ AC for Detection of Total Aerobic Bacteria in Dairy and Nondairy Products.

    Science.gov (United States)

    Salter, Robert S; Durbin, Gregory W; Bird, Patrick; Fisher, Kiel; Crowley, Erin; Hammack, Thomas; Chen, Yi; Clark, Dorn; Ziemer, Wayne

    2016-01-01

    Peel Plate™ AC (aerobic count) is a low-profile plastic 47 mm culture dish with adhesive top that contains a dried standard plate count medium with oxidation/reduction indicator triphenyl tetrazolium chloride (TTC) that turns red with dehydrogenase enzyme activity of growing aerobic bacteria. The method provides a conventional quantitative count with simple rehydration and incubation for 48 ± 3 h at 35 ± 1°C for most food matrixes and 32 ± 1°C for 48 ± 3 h for dairy products. Dairy matrixes claimed and supported with total aerobic count data are whole milk, skim milk, chocolate milk (2% fat), light cream (20% fat), pasteurized whole goat milk, ultra-high temperature pasteurized milk, nonfat dried milk, lactose-reduced milk, strawberry milk, raw cow milk, raw goat milk, raw sheep milk, condensed skim milk, and vanilla ice cream. Food matrixes claimed for aerobic count detection are raw ground beef, environmental sponge of stainless steel, raw ground turkey, dry dog food, liquid whole pasteurized eggs, milk chocolate, poultry carcass rinse, and large animal carcass sponge. The method has been independently evaluated for aerobic count in dairy products: whole milk, skim milk, chocolate milk, and light cream. The method was also independently evaluated for aerobic count in food matrixes: ground beef and sponge rinse from stainless steel surfaces. In the matrix study, each matrix was assessed separately at each contamination level in comparison to an appropriate reference method. Colony counts were determined for each level and then log10-transformed. The transformed data were evaluated for repeatability, mean comparison between methods with 95% confidence interval (CI), and r(2). A CI range of (-0.5, 0.5) on the mean difference was used as the acceptance criterion to establish significant statistical differences between methods. The evaluations demonstrate that the Peel Plate AC provides no statistical differences across most of the matrixes with r(2) > 0

  13. Bacillus thuringiensis delta-endotoxin Cry1Ac domain III enhances activity against Heliothis virescens in some, but not all Cry1-Cry1Ac hybrids

    NARCIS (Netherlands)

    Karlova, R.B.; Weemen, W.M.J.; Naimov, S.; Ceron, J.; Dukiandjiev, S.; Maagd, de R.A.

    2005-01-01

    We investigated the role of domain III of Bacillus thuringiensis d-endotoxin Cry1Ac in determining toxicity against Heliothis virescens. Hybrid toxins, containing domain III of Cry1Ac with domains I and II of Cry1Ba, Cry1Ca, Cry1Da, Cry1Ea, and Cry1Fb, respectively, were created. In this way Cry1Ca,

  14. Removal of nitrate ions from water by activated carbons (ACs)—Influence of surface chemistry of ACs and coexisting chloride and sulfate ions

    Science.gov (United States)

    Ota, Kazunari; Amano, Yoshimasa; Aikawa, Masami; Machida, Motoi

    2013-07-01

    Adsorptive removal of nitrate ions in aqueous solution using activated carbons (ACs) was examined. After ash was removed from Filtrasorb 400 AC, oxidation and outgassing and several heat treatments were carried out to modify the textural and surface properties of ACs. AC oxidized with 8 M nitric acid followed by outgassing at 900 °C (Ox-9OG) exhibited the greatest Langmuir adsorption capacity and affinity for nitrate removal among the total 7 ACs examined. Influence of coexisting chloride and sulfate ions was investigated as well to inspect the nitrate adsorption sites. The highest amount of sites which adsorbed nitrate ions exclusively could be observed for Ox-9OG adsorbent even though as great as 250 times greater number of chloride or sulfate ions over nitrate ions were present in the same aqueous system. Some basic oxygen species on carbon were estimated to work as selective adsorption sites for nitrate ions.

  15. SOLAR TO AC POWER SOURCE FOR REMOTE AREAS USING SEIG

    Directory of Open Access Journals (Sweden)

    MEHMET AKBABA

    2012-02-01

    Full Text Available Photovoltaic generators (PVG are increasingly used to provide electricity in remote areas. However, in many applications the DC generated electricity by a PVG need to be converted to AC. Traditionally DC to AC inverters have been widely used for this purpose. In this paper, a different system is proposed in which a self excited induction generator (SEIG driven by a permanent magnet DC motor (DCM and powered from a PVG through a maximum power point tracker (MPPT are used. A step-up chopper is utilized as an MPPT unit. The proposed system is modelled in time domain, and a detailed transient and steady-state analysis are presented. The main reason behind analyzing the system in the time domain is because of the fact that for unknown speeds, the methods developed for steady-state analysis of SEIGs can not be applied. The presented work shows that the full available power of the PVG can be harnessed by selecting suitable values for the duty cycle and the frequency of the step up chopper and the excitation capacitor of the SEIG. It is also shown that with such a combination power utilization efficiency of more than 83% can be achieved.

  16. Research on the Plasma Anemometer Based on AC Glow Discharge

    Directory of Open Access Journals (Sweden)

    Bing Yu

    2017-01-01

    Full Text Available A new plasma anemometer based on AC glow discharge is designed in this article. Firstly, theoretical analysis of plasma anemometer working principle is introduced to prove the feasibility of the experimental measurement method. Then the experiments are carried out to study the effects of different parameters on the static discharge characteristics of the plasma anemometer system, by which the system optimization methods are obtained. Finally, several groups of appropriate parameters are selected to build the plasma anemometer system based on resistance capacitance coupling negative feedback AC glow discharge, and different airflow speeds are applied to obtain the achievable velocity measurement range. The results show that there is a linear relationship between airflow velocity and discharge current in an allowable error range, which can be applied for airflow velocity measurement. Negative feedback coupling module, which is composed of the coupling resistance and the coupling capacitance, has good effects on improving the system stability. The measurement range of the airflow velocity is significantly increased when the electrode gap is 3 mm, coupling resistance is 470 Ω, and coupling capacitance is 220 pF.

  17. Aspectos económicos del aislamiento acústico

    Directory of Open Access Journals (Sweden)

    Amarilla, Beatriz C.

    1990-12-01

    Full Text Available The general objective of this study was to analyze the soundproofing/cost ratio with different building alternatives for interior walls and floors. This technical-economic study was divided into three parts: — Dividing walls (environmental noises — Floors (impact noises — Special Solutions (double walls, floating floors, etcetera The results show that in developing countries the most costly solutions are not always the best for housing, as far as soundproofing is concerned. A good knowledge of the economic aspects related to this matter allows obtaining a good quality at a moderate cost, which is a priority in this type of country.

    El objetivo general de este trabajo fue el de analizar el comportamiento de la relación costo-aislamiento acústico en soluciones constructivas alternativas para muros interiores y entrepisos. Este estudio técnico-económico comprende tres partes: * Muros divisorios (ruidos aéreos. * Entrepisos (ruidos de impacto. * Soluciones especiales (muros de doble hoja, pisos flotantes, etc. Se llega a la conclusión que, en los países en desarrollo, no siempre las mejores soluciones para la vivienda, desde el punto de vista acústico, son las de mayor costo. Conocer en profundidad los aspectos económicos de esta cuestión significa poder lograr una buena calidad con costos moderados, lo cual constituye una prioridad en este tipo de países.

  18. Production of medically useful nitric monoxide using AC arc discharge.

    Science.gov (United States)

    Li, S R; Huang, Y F; Liu, Z; Sui, M H; Liu, J M; Yan, K P

    2018-02-28

    Inhaled nitric monoxide (iNO) is increasingly used as a medical treatment for acute respiratory distress syndrome. A course of the existing nitric monoxide (NO) therapy with gas cylinders could cost up to approximately $15,000 for an average of 30.2 h. Moreover, a gas cylinder containing a mixture of N 2 and NO may potentially leak NO. The objective of this study is to develop an efficient and cost-effective on-site iNO generation system. In the present setup, NO was generated by using dry air or mixed oxygen/nitrogen (O 2 /N 2 ) and an AC power source with an output power level of 5-30 W at atmospheric pressure. The simultaneously produced NO 2 was eliminated with an ammonium sulfite ((NH 4 ) 2 SO 3 ) solution. The effects of the O 2 /N 2 ratio, gas flow rate, discharge gap distance, output energy density and electrode structure on NO x concentration and the NO/NO 2 ratio are reported. The concentrations of NO and NO 2 reached 62 ppm and 3 ppm, respectively, after absorption and dilution at a gas flow rate of 6 L/min. With the present setup, the AC arc discharge produced NO x at a stable concentration for at least 6 h using dry air. Copyright © 2017 Elsevier Inc. All rights reserved.

  19. Adaptive Sliding Mode Control of MEMS AC Voltage Reference Source

    Directory of Open Access Journals (Sweden)

    Ehsan Ranjbar

    2017-01-01

    Full Text Available The accuracy of physical parameters of a tunable MEMS capacitor, as the major part of MEMS AC voltage reference, is of great importance to achieve an accurate output voltage free of the malfunctioning noise and disturbance. Even though strenuous endeavors are made to fabricate MEMS tunable capacitors with desiderated accurate physical characteristics and ameliorate exactness of physical parameters’ values, parametric uncertainties ineluctably emerge in fabrication process attributable to imperfections in micromachining process. First off, this paper considers applying an adaptive sliding mode controller design in the MEMS AC voltage reference source so that it is capable of giving off a well-regulated output voltage in defiance of jumbling parametric uncertainties in the plant dynamics and also aggravating external disturbance imposed on the system. Secondly, it puts an investigatory comparison with the designed model reference adaptive controller and the pole-placement state feedback one into one’s prospective. Not only does the tuned adaptive sliding mode controller show remarkable robustness against slow parameter variation and external disturbance being compared to the pole-placement state feedback one, but also it immensely gets robust against the external disturbance in comparison with the conventional adaptive controller. The simulation results are promising.

  20. l-Glucitol Catabolism in Stenotrophomonas maltophilia Ac

    Science.gov (United States)

    Brechtel, Elke; Huwig, Alexander; Giffhorn, Friedrich

    2002-01-01

    The carbohydrate catabolism of the bacterium Stenotrophomonas maltophilia Ac (previously named Pseudomonas sp. strain Ac), which is known to convert the unnatural polyol l-glucitol to d-sorbose during growth on the former as the sole source of carbon and energy, was studied in detail. All enzymes operating in a pathway that channels l-glucitol via d-sorbose into compounds of the intermediary metabolism were demonstrated, and for some prominent reactions the products of conversion were identified. d-Sorbose was converted by C-3 epimerization to d-tagatose, which, in turn, was isomerized to d-galactose. d-Galactose was the initial substrate of the De Ley-Doudoroff pathway, involving reactions of NAD-dependent oxidation of d-galactose to d-galactonate, its dehydration to 2-keto-3-deoxy-d-galactonate, and its phosphorylation to 2-keto-3-deoxy-d-galactonate 6-phosphate. Finally, aldol cleavage yielded pyruvate and d-glycerate 3-phosphate as the central metabolic intermediates. PMID:11823194

  1. AC-arbejdskraft i den vestlige del af Region Midtjylland

    DEFF Research Database (Denmark)

    Filges, Trine; Holt, Helle

    Denne rapport belyser muligheder og barrierer for AC-arbejdskraft i den vestlige del af Region Midtjylland. Undersøgelsen viser, at ca. 8 pct. af virksomhederne, der indgår i undersøgelsen, på interviewtidspunktet ønsker at rekruttere AC-arbejdskraft inden for 6 måneder. Undersøgelsen viser desuden......, at mange af virksomhederne forventer, at AC’eren møder på arbejdspladsen hver dag – og gerne, at de flytter til lokalområdet. Virksomhederne vurderer, at det er en barriere, at AC’erne har svært ved at se en videre karriere i lokalområdet, og at de foretrækker at pendle til arbejdspladsen. Dårlig...... infrastruktur nævnes i den forbindelse også som en barriere. Undersøgelsen bygger på en spørgeskemaundersøgelse blandt virksomheder i kommunerne: Lemvig, Holstebro, Herning, Ringkøbing-Skjern og Struer. Undersøgelsen er bestilt af Beskæftigelsesregion Midtjylland og er finansieret af Region Midtjylland og...

  2. AC-driven organic light emission devices with carbon nanotubes

    Science.gov (United States)

    Jeon, So-Yeon; Yu, SeGi

    2017-02-01

    We have investigated alternating current (AC)-driven organic light-emitting devices (OLEDs), with carbon nanotubes (CNTs) incorporated within the emission layer. With CNT incorporation, the brightness of the OLEDs was substantially improved, and the turn-on voltage was reduced by at least a factor of five. Furthermore, the current levels of the CNT-incorporated OLEDs were lower than that of the reference device. A roughly 70% decrease in the current level was obtained for a CNT concentration of 0.03 wt%. This was accomplished by keeping the concentration of CNTs low and the length of CNTs short, which helped to suppress the percolation networking of CNTs within the emitting layer. Strong local electric fields near the end-tips of CNTs and micro-capacitors formed by dispersed CNTs might have caused this high brightness and these low currents. CNT incorporation in the emitting layer can improve the characteristics of AC-driven OLEDs, which are considered to be one of the candidates for flat panel displays and lightning devices.

  3. SQUIDs De-fluxing Using a Decaying AC Magnetic Field

    Energy Technology Data Exchange (ETDEWEB)

    Matlashov, Andrei Nikolaevich [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Semenov, Vasili Kirilovich [State Univ. of New York (SUNY), Plattsburgh, NY (United States); Anderson, Bill [Senior Scientific, LLC, Albuquerque, NM (United States)

    2016-06-08

    Flux trapping is the Achilles’ heel of all superconductor electronics. The most direct way to avoid flux trapping is a prevention of superconductor circuits from exposure to magnetic fields. Unfortunately this is not feasible if the circuits must be exposed to a strong DC magnetic field even for a short period of time. For example, such unavoidable exposures take place in superparamagnetic relaxation measurements (SPMR) and ultra-low field magnetic resonance imaging (ULF MRI) using unshielded thin-film SQUID-based gradiometers. Unshielded SQUIDs stop working after being exposed to DC magnetic fields of only a few Gauss in strength. In this paper we present experimental results with de-fluxing of planar thin-film LTS SQUID-based gradiometers using a strong decaying AC magnetic field. We used four commercial G136 gradiometers for SPMR measurements with up to a 10 mT magnetizing field. Strong 12.9 kHz decaying magnetic field pulses reliably return SQUIDs to normal operation 50 ms after zeroing the DC magnetizing field. This new AC de-fluxing method was also successfully tested with seven other different types of LTS SQUID sensors and has been shown to dissipate extremely low energy.

  4. Offline detection of broken rotor bars in AC induction motors

    Science.gov (United States)

    Powers, Craig Stephen

    ABSTRACT. OFFLINE DETECTION OF BROKEN ROTOR BARS IN AC INDUCTION MOTORS. The detection of the broken rotor bar defect in medium- and large-sized AC induction machines is currently one of the most difficult tasks for the motor condition and monitoring industry. If a broken rotor bar defect goes undetected, it can cause a catastrophic failure of an expensive machine. If a broken rotor bar defect is falsely determined, it wastes time and money to physically tear down and inspect the machine only to find an incorrect diagnosis. Previous work in 2009 at Baker/SKF-USA in collaboration with the Korea University has developed a prototype instrument that has been highly successful in correctly detecting the broken rotor bar defect in ACIMs where other methods have failed. Dr. Sang Bin and his students at the Korea University have been using this prototype instrument to help the industry save money in the successful detection of the BRB defect. A review of the current state of motor conditioning and monitoring technology for detecting the broken rotor bar defect in ACIMs shows improved detection of this fault is still relevant. An analysis of previous work in the creation of this prototype instrument leads into the refactoring of the software and hardware into something more deployable, cost effective and commercially viable.

  5. AC operation and runaway electron behaviour in HT-7 tokamak

    International Nuclear Information System (INIS)

    Hong-Wei, Lu; Li-Qun, Hu; Rui-Jie, Zhou; Shi-Yao, Lin; Guo-Qiang, Zhong; Shao-Feng, Wang; Kai-Yun, Chen; Ping, Xu; Ji-Zong, Zhang; Bi-Li, Ling; Song-Tao, Mao; Yan-Min, Duan

    2010-01-01

    Operation of HT-7 tokamak in a multicycle alternating square wave plasma current regime is reported. A set of AC operation experiments, including LHW heating to enhance plasma ionization during the current transition and current sustainment, is described. The behaviour of runaway electrons is analysed by four HXR detectors tangentially viewing the plasma in the equatorial plane, within energy ranges 0.3–1.2 MeV and 0.3–7 MeV, separately. High energy runaway electrons (∼MeV) are found to circulate predominantly in the opposite direction to the plasma current, while the number of low energy runaway electrons (∼tens to hundreds of keV) circulating along the plasma current is comparable to that in the direction opposite to the plasma current. AC operation with lower hybrid current drive (LHCD) is observed to have an additional benefit of suppressing the runaway electrons if the drop of the loop voltage is large enough. (fluids, plasmas and electric discharges)

  6. Equivalence of Primary Control Strategies for AC and DC Microgrids

    Directory of Open Access Journals (Sweden)

    Eneko Unamuno

    2017-01-01

    Full Text Available Microgrid frequency and voltage regulation is a challenging task, as classical generators with rotational inertia are usually replaced by converter-interfaced systems that inherently do not provide any inertial response. The aim of this paper is to analyse and compare autonomous primary control techniques for alternating current (AC and direct current (DC microgrids that improve this transient behaviour. In this context, a virtual synchronous machine (VSM technique is investigated for AC microgrids, and its behaviour for different values of emulated inertia and droop slopes is tested. Regarding DC microgrids, a virtual-impedance-based algorithm inspired by the operation concept of VSMs is proposed. The results demonstrate that the proposed strategy can be configured to have an analogous behaviour to VSM techniques by varying the control parameters of the integrated virtual-impedances. This means that the steady-state and transient behaviour of converters employing these strategies can be configured independently. As shown in the simulations, this is an interesting feature that could be, for instance, employed for the integration of different dynamic generation or storage systems, such as batteries or supercapacitors.

  7. Three-phase AC-AC power converters based on matrix converter topology matrix-reactance frequency converters concept

    CERN Document Server

    Szczesniak, Pawel

    2013-01-01

    AC voltage frequency changes is one of the most important functions of solid state power converters. The most desirable features in frequency converters are the ability to generate load voltages with arbitrary amplitude and frequency, sinusoidal currents and voltages waveforms; the possibility of providing unity power factor for any load; and, finally, a simple and compact power circuit. Over the past decades, a number of different frequency converter topologies have appeared in the literature, but only the converters with either a voltage or current DC link are commonly used in industrial app

  8. Determination of dyes in foodstuffs by capillary zone electrophoresis.

    Science.gov (United States)

    Pérez-Urquiza, M; Beltrán, J L

    2000-11-17

    A rapid method based on capillary zone electrophoresis coupled with photodiode-array detection has been developed to determine the dyes Tartrazine E-102, Sunset Yellow FCF E110, Amaranth E-123, New Coccine E-124, Patent Blue V calcium salt E-131 and Allura Red AC E-129 in foodstuffs. Separation was done by using a Bare CElect-FS75 CE column, using a 10 mM phosphate buffer at pH 11.0. Hydrodynamic injections at 0.5 p.s.i. for 4 s (21 nl of sample) and 20 kV separation voltage were used. The quantitation limits for the six dyes ranged from 3 to 6 microg/ml. A linear relationship between 3 to 95 microg/ml, with correlation coefficient better than 0.995 was obtained. This method has been applied to the determination of the studied dyes in beverages, jellies and syrups.

  9. First successful automated red cell exchange (erythrocytapheresis ...

    African Journals Online (AJOL)

    Frequent blood transfusion carries significant complications especially iron overload. Red cell exchange offers a better control both as prophylaxis and therapy for some complications. METHOD: A 32years old male SCD patient had priapism as an indication for Red Cell exchange. A total of 1850ml of his red cells was ...

  10. 21 CFR 184.1121 - Red algae.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 3 2010-04-01 2009-04-01 true Red algae. 184.1121 Section 184.1121 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) FOOD FOR HUMAN... Substances Affirmed as GRAS § 184.1121 Red algae. (a) Red algae are seaweeds of the species Gloiopeltis...

  11. 76 FR 22033 - Safety Zone; Red River Safety Zone, Red River, MN

    Science.gov (United States)

    2011-04-20

    ... SECURITY Coast Guard 33 CFR Part 165 RIN 1625-AAOO Safety Zone; Red River Safety Zone, Red River, MN AGENCY... Safety Unit Duluth, MN is establishing a temporary safety zone on the Red River, MN. This safety zone is... entering all navigable waters of the Red River in the State of Minnesota north of a line drawn across...

  12. Gamma-irradiation produces active chlorine species (ACS) in physiological solutions: Secoisolariciresinol diglucoside (SDG) scavenges ACS - A novel mechanism of DNA radioprotection.

    Science.gov (United States)

    Mishra, Om P; Popov, Anatoliy V; Pietrofesa, Ralph A; Christofidou-Solomidou, Melpo

    2016-09-01

    Secoisolariciresinol diglucoside (SDG), the main lignan in whole grain flaxseed, is a potent antioxidant and free radical scavenger with known radioprotective properties. However, the exact mechanism of SDG radioprotection is not well understood. The current study identified a novel mechanism of DNA radioprotection by SDG in physiological solutions by scavenging active chlorine species (ACS) and reducing chlorinated nucleobases. The ACS scavenging activity of SDG was determined using two highly specific fluoroprobes: hypochlorite-specific 3'-(p-aminophenyl) fluorescein (APF) and hydroxyl radical-sensitive 3'-(p-hydroxyphenyl) fluorescein (HPF). Dopamine, an SDG structural analog, was used for proton (1)H NMR studies to trap primary ACS radicals. Taurine N-chlorination was determined to demonstrate radiation-induced generation of hypochlorite, a secondary ACS. DNA protection was assessed by determining the extent of DNA fragmentation and plasmid DNA relaxation following exposure to ClO(-) and radiation. Purine base chlorination by ClO(-) and γ-radiation was determined by using 2-aminopurine (2-AP), a fluorescent analog of 6-aminopurine. Chloride anions (Cl(-)) consumed >90% of hydroxyl radicals in physiological solutions produced by γ-radiation resulting in ACS formation, which was detected by (1)H NMR. Importantly, SDG scavenged hypochlorite- and γ-radiation-induced ACS. In addition, SDG blunted ACS-induced fragmentation of calf thymus DNA and plasmid DNA relaxation. SDG treatment before or after ACS exposure decreased the ClO(-) or γ-radiation-induced chlorination of 2-AP. Exposure to γ-radiation resulted in increased taurine chlorination, indicative of ClO(-) generation. NMR studies revealed formation of primary ACS radicals (chlorine atoms (Cl) and dichloro radical anions (Cl2¯)), which were trapped by SDG and its structural analog dopamine. We demonstrate that γ-radiation induces the generation of ACS in physiological solutions. SDG treatment scavenged

  13. Red nodule on the breast

    Directory of Open Access Journals (Sweden)

    Roberta Colucci

    2012-01-01

    Full Text Available A 63-year-old woman living in the countryside referred to our department with a 2-month history of a red nodule localized on the right breast. Histological examination, immunohistochemical analyses and serologic evaluation conducted with ELISA and Western blot were performed. Clinical diagnosis of borrelial lymphocytoma was not possible solely on the clinical presentation of a classical nodular form without lymphoadenopathy. An absence of a referred prior tick bite and a previous or concomitant erythema migrans at clinical presentation rendered a more challenging diagnosis. The fact that the patient lived in the countryside, the appearance of the breast nodule in September, and serologic, histologic, and immunohistochemical analysis facilitated the diagnosis of borrelial lymphocytoma. We report this case to highlight the importance of an investigation of Lyme borreliosis when a patient living in the countryside presents with a red nodule of the nipple and areola.

  14. Allergic reactions in red tattoos

    DEFF Research Database (Denmark)

    Hutton Carlsen, K; Køcks, M; Sepehri, M

    2016-01-01

    AIM: The aim of this study was to assess the feasibility of Raman spectroscopy as a screening technique for chemical characterisation of tattoo pigments in pathologic reacting tattoos and tattoo ink stock products to depict unsafe pigments and metabolites of pigments. MATERIALS/METHODS: Twelve...... to be feasible for chemical analysis of red pigments in allergic reactions. Raman spectroscopy has a major potential for fingerprint screening of problematic tattoo pigments in situ in skin, ex vivo in skin biopsies and in tattoo ink stock products, thus, to eliminate unsafe ink products from markets....... dermatome shave biopsies from allergic reactions in red tattoos were analysed with Raman spectroscopy (A 785-nm 300 mW diode laser). These were referenced to samples of 10 different standard tattoo ink stock products, three of these identified as the culprit inks used by the tattooist and thus by history...

  15. Green synthesis of Ag-Cr-AC nanocomposites by Azadirachta indica and its application for the simultaneous removal of binary mixture of dyes by ultrasonicated assisted adsorption process using Response Surface Methodology.

    Science.gov (United States)

    Saad, Muhammad; Tahir, Hajira; Ali, Duaa

    2017-09-01

    In the present studies the Ag-Cr-AC nanocomposites were synthesized by Azadirachta indica leaves extract. They were inoculated on the amorphous surface of activated carbon. The surface morphology and structural identification was determined by SEM, FTIR and XRD techniques. The simultaneous removal of binary dye system of Reactive Red and Crystal Violet were performed by ultrasonicated assisted adsorption process utilizing Ag-Cr-AC nanocomposites. Central Composite Design (CCD) having 5 factors of time, pH, amount of Ag-Cr-AC (adsorbent), concentrations of Reactive Red (RR) and Crystal Violet (CV) was employed. Response Surface Methodology was applied to study the Optimum Operating Parameters (OOP) for the adsorption process. The current studies showed that they can be efficiently employed to remove the coloured effluent from aqueous media as the simultaneous removal of dyes was observed to be 64.92% and 82.47% for RR and CV dyes respectively. Adsorption equilibrium was studied by Freundlich, Langmuir, Dubinin-Radushkevich, Temkin and Harkins-Jura Isotherm Models. The Langmuir isotherm was observed to be followed by the RR-Ag-Cr-AC system while CV-Ag-Cr-AC followed Harkins-Jura Isotherm model. For the binary system, the removal of CV and RR dyes by the nanocomposites obeyed Harkins-Jura model at temperature of 40°C. Thermodynamics studies affirmed the spontaneous nature of adsorption process. pH pzc was evaluated to be 6.29. The purification cost per cubic meter of the effluent was evaluated to be US$ 85.08. The proposed method might prove to be an efficient and cost effective way to eradicate color from the binary mixture of RR and CV dyes. Copyright © 2017 Elsevier B.V. All rights reserved.

  16. Red fox sightings in Rome

    Directory of Open Access Journals (Sweden)

    Bruno Cignini

    1997-12-01

    Full Text Available Abstract In this study preliminary data on the presence of Red fox in Rome (an area of 360 km² within the Rome ringroad. G.R.A. since 1980 are presented. The data were mapped on a UTM 1 sq. km. grid. Data were analysed and correlated, for each City district, with the prevalent environment (green, built-up, river-side areas and with the density of inhabitants.

  17. Resveratrol: Chemoprevention with red wine

    OpenAIRE

    Arısan, Elif Damla; Palavan-Ünsal, Narçin

    2007-01-01

    According to epidemiological studies, western diet has disadvantages because of cancer prevalence more than Mediterranean or Asia people who consume more vegetables and fruits. Resveratrol (trans-3,4,5-trihydroxystilbene) which is highly found in grapes, berries has received attention for its potential chemopreventive and antitumor effects in experimental systems. Because of high resveratrol content, researchers noted that red wine has multidimensional benefits for ...

  18. Red cell DAMPs and inflammation.

    Science.gov (United States)

    Mendonça, Rafaela; Silveira, Angélica A A; Conran, Nicola

    2016-09-01

    Intravascular hemolysis, or the destruction of red blood cells in the circulation, can occur in numerous diseases, including the acquired hemolytic anemias, sickle cell disease and β-thalassemia, as well as during some transfusion reactions, preeclampsia and infections, such as those caused by malaria or Clostridium perfringens. Hemolysis results in the release of large quantities of red cell damage-associated molecular patterns (DAMPs) into the circulation, which, if not neutralized by innate protective mechanisms, have the potential to activate multiple inflammatory pathways. One of the major red cell DAMPs, heme, is able to activate converging inflammatory pathways, such as toll-like receptor signaling, neutrophil extracellular trap formation and inflammasome formation, suggesting that this DAMP both activates and amplifies inflammation. Other potent DAMPs that may be released by the erythrocytes upon their rupture include heat shock proteins (Hsp), such as Hsp70, interleukin-33 and Adenosine 5' triphosphate. As such, hemolysis represents a major inflammatory mechanism that potentially contributes to the clinical manifestations that have been associated with the hemolytic diseases, such as pulmonary hypertension and leg ulcers, and likely plays a role in specific complications of sickle cell disease such as endothelial activation, vaso-occlusive processes and tissue injury.

  19. Red Wine and Resveratrol: Good for Your Heart?

    Science.gov (United States)

    Red wine and resveratrol: Good for your heart? Red wine and something in red wine called resveratrol might be heart healthy. Find out the facts, and hype, regarding red wine and its impact on your heart. By Mayo ...

  20. Strongly nonlinear dynamics of electrolytes in large ac voltages

    DEFF Research Database (Denmark)

    Olesen, Laurits Højgaard; Bazant, Martin Z.; Bruus, Henrik

    2010-01-01

    , ignoring any transverse instability or fluid flow. We analyze the resulting one-dimensional problem by matched asymptotic expansions in the limit of thin double layers and extend previous work into the strongly nonlinear regime, which is characterized by two features—significant salt depletion...... in the electrolyte near the electrodes and, at very large voltage, the breakdown of the quasiequilibrium structure of the double layers. The former leads to the prediction of “ac capacitive desalination” since there is a time-averaged transfer of salt from the bulk to the double layers, via oscillating diffusion...... to suppress the strongly nonlinear regime in the limit of concentrated electrolytes, ionic liquids, and molten salts. Beyond the model problem, our reduced equations for thin double layers, based on uniformly valid matched asymptotic expansions, provide a useful mathematical framework to describe additional...

  1. Downlink interference suppression of 802.11ac wireless network

    Directory of Open Access Journals (Sweden)

    WANG Huan

    2016-04-01

    Full Text Available In the 802.11ac wireless local area network,wireless intelligent devices(WID need to be connected to the network through the wireless access point(AP,and other wireless APs in the downlink transmission process will cause interference to the target WID.In this paper,we propose a method based on iterative minimum mean square error interference alignment,which can suppress the interference from the other wireless APs to the target WIDs.The wireless access terminal and wireless smart devices have designed linear precode and decode respectively.Under the minimum mean square error criterion and limitation the power constraint,optimal precode and decode can be received.Simulation results show that the proposed method,when the signal to noise ratio is 5 dB,the transmission rate of the unit bandwidth transmission rate is increased by 1 bit/s compared with the traditional Max-SINR algorithm.

  2. Team-oriented Adaptive Droop Control for Autonomous AC Microgrids

    DEFF Research Database (Denmark)

    Shafiee, Qobad; Nasirian, Vahidreza; Guerrero, Josep M.

    2014-01-01

    This paper proposes a distributed control strategy for voltage and reactive power regulation in ac Microgrids. First, the control module introduces a voltage regulator that maintains the average voltage of the system on the rated value, keeping all bus voltages within an acceptable range. Dynamic....... The proposed controllers are fully distributed; i.e., each source requires information exchange with only a few other sources, those in direct contact through the communication infrastructure. A Microgrid test bench is used to verify the proposed controlmethodology, where different test scenarios such as load...... consensus protocol is used to estimate the average voltage across the Microgrid. This estimation is further utilized by the voltage regulator to elevate/lower the voltage-reactive power (Q-E) droop characteristic, compensating the drop caused by the droop mechanism. The second module, the reactive power...

  3. Measurement of AC losses in different former materials

    DEFF Research Database (Denmark)

    Olsen, Søren Krüger; Træholt, Chresten; Kühle, Anders Van Der Aa

    1998-01-01

    A high temperature superconducting cable may be based on a centrally located cylindrical support, a so-called former. If electrically conductive, the former can contribute to the AC losses through eddy current losses caused by unbalanced axial and tangential magnetic fields. With these measurements...... we aim at investigating the eddy current losses of commonly used former materials. A one layer cable conductor was wound on a glass fibre reinforced polymer (GRFP) former. By inserting a variety of materials into this, it was possible to measure the eddy current losses of each of the former...... candidates separately; for example copper tubes, stainless steel braid, copper braid, corrugated stainless steel tubes, etc. The measured data are compared with the predictions of a theoretical model. Our results show that in most cases, the losses induced by eddy currents in the former are negligible...

  4. Study of the AC machines winding having fractional q

    Science.gov (United States)

    Bespalov, V. Y.; Sidorov, A. O.

    2018-02-01

    The winding schemes with a fractional numbers of slots per pole and phase q have been known and used for a long time. However, in the literature on the low-noise machines design there are not recommended to use. Nevertheless, fractional q windings have been realized in many applications of special AC electrical machines, allowing to improve their performance, including vibroacoustic one. This paper deals with harmonic analysis of windings having integer and fractional q in permanent magnet synchronous motors, a comparison of their characteristics is performed, frequencies of subharmonics are revealed. Optimal winding pitch design is found giving reduce the amplitudes of subharmonics. Distribution factors for subharmonics, fractional and high-order harmonics are calculated, results analysis is represented, allowing for giving recommendations how to calculate distribution factors for different harmonics when q is fractional.

  5. Development of Electromechanical Architectures for AC Voltage Metrology

    Directory of Open Access Journals (Sweden)

    Alexandre BOUNOUH

    2010-12-01

    Full Text Available This paper presents results of work undertaken for exploring MEMS capabilities to fabricate AC voltage references for electrical metrology and high precision instrumentation through the mechanical-electrical coupling in MEMS. From first MEMS test structures previously realized, a second set of devices with improved characteristics has been developed and fabricated with Silicon on Insulator (SOI Surface Micromachining process. These MEMS exhibit pull-in voltages of 5 V and 10 V to match with the best performance of the read-out electronics developed for driving the MEMS. Deep Level Transient Spectroscopy measurements carried out on the new design show resonance frequencies of about only some kHz, and the stability of the MEMS output voltage measured at 100 kHz has been found very promising for the best samples where the relative deviation from the mean value over almost 12 hours showed a standard deviation of about 6.3 ppm.

  6. Preparation of 227Ac by neutron irradiation of 226Ra

    International Nuclear Information System (INIS)

    Kukleva, E.; Kozempel, J.; Vlk, M.; Micolova, P.; Vopalka, D.

    2015-01-01

    Radium-223 is prospective alpha-emitting therapeutic radionuclide for targeted radionuclide therapy. Although 223 Ra is formed naturally by the decay of 235 U, for practical reasons its preparation involves neutron irradiation of 226 Ra. The α-decay of the 227 Ra (T 12 = 43 min.) produced via 226 Ra(n,γ) 227 Ra reaction leads to 227 Ac, a mother nuclide of 227 Th and 223 Ra subsequently. Irradiation target radium material is generally available in multi-gram quantities from historical stock. Main aim of this study was to experimentally and theoretically evaluate and verify available literature data on production of 223 Ra. According to data obtained from γ-spectra, the approximate yield values were determined and effective cross-section for the 223 Ra production was calculated. (authors)

  7. Water treatment by the AC gliding arc air plasma

    Science.gov (United States)

    Gharagozalian, Mehrnaz; Dorranian, Davoud; Ghoranneviss, Mahmood

    2017-09-01

    In this study, the effects of gliding arc (G Arc) plasma system on the treatment of water have been investigated experimentally. An AC power supply of 15 kV potential difference at 50 Hz frequency was employed to generate plasma. Plasma density and temperature were measured using spectroscopic method. The water was contaminated with staphylococcus aureus (Gram-positive) and salmonella bacteria (Gram-negative), and Penicillium (mold fungus) individually. pH, hydrogen peroxide, and nitride contents of treated water were measured after plasma treatment. Decontamination of treated water was determined using colony counting method. Results indicate that G Arc plasma is a powerful and green tool to decontaminate water without producing any byproducts.

  8. Dielectric response and ac conductivity analysis of hafnium oxide nanopowder

    International Nuclear Information System (INIS)

    Karahaliou, P K; Xanthopoulos, N; Krontiras, C A; Georga, S N

    2012-01-01

    The dielectric response of hafnium oxide nanopowder was studied in the frequency range of 10 -2 -10 6 MHz and in the temperature range of 20-180 °C. Broadband dielectric spectroscopy was applied and the experimental results were analyzed and discussed using the electric modulus (M*) and alternating current (ac) conductivity formalisms. The analyses of the dc conductivity and electric modulus data revealed the presence of mechanisms which are thermally activated, both with almost the same activation energy of 1.01 eV. A fitting procedure involving the superposition of the thermally activated dc conductivity, the universal dielectric responce and the near constant loss terms has been used to describe the frequency evolution of the real part of the specific electrical conductivity. The conductivity master curve was obtained, suggesting that the time-temperature superposition principle applies for the studied system, thus implying that the conductivity mechanisms are temperature independent.

  9. Models of AC losses for superconducting cable conductors

    International Nuclear Information System (INIS)

    Oestergaard, J.

    1996-12-01

    Three models are set up for calculating AC losses in superconducting cable conductors. The focus is on understanding the losses and derivation of the formulas in the models. The hysteresis losses are treated according to the Beans model, and the following three models are derived: cylinder ring model; mono-block model; uniform current distribution (UCD) model. The results show that the losses may be reduced substantially by transposing the layers and maybe twisting the filaments. The losses are determined by the critical current density irrespective of the applied model. The larger the critical density the smaller the loss. The losses get smaller if a cable conductor is constructed more solidly, i.e. with a tight winding and a large superconductor/silver ratio. The size of the losses is, however, independent of the winding tightness if the layers are transposed. Neither the superconductor/silver ratio affects the losses if the filaments are twisted. (ln)

  10. Spin-torque switching and control using chirped AC currents

    Science.gov (United States)

    Klughertz, Guillaume; Friedland, Lazar; Hervieux, Paul-Antoine; Manfredi, Giovanni

    2017-10-01

    We propose to use oscillating spin currents with slowly varying frequency (chirp) to manipulate and control the magnetization dynamics in a nanomagnet. By recasting the Landau-Lifshitz-Slonczewski equation in a quantum-like two-level formalism, we show that a chirped spin current polarized in the direction normal to the anisotropy axis can induce a stable precession of the magnetic moment at any angle (up to 90^\\circ ) with respect to the anisotropy axis. The drive current can be modest (10^6~A~cm-2 or lower) provided the chirp rate is sufficiently slow. The induced precession is stable against thermal noise, even for small nano-objects at room temperature. Complete reversal of the magnetization can be achieved by adding a small external magnetic field antiparallel to the easy axis. Alternatively, a combination of chirped ac and dc currents with different polarization directions can also be used to trigger the reversal.

  11. AC impedance studies of V2O5 containing glasses

    Science.gov (United States)

    Szu, Sungping; Lu, Shing-Gwo

    2007-04-01

    Glasses with composition V2O5-BaO-MO-B2O3(MO=SiO2,GeO2,P2O5) were studied using AC impedance analyzer. The measurements show that conductivities increase with V2O5 contents, and the P2O5 containing glasses have higher conductivities. The electric modulus was analyzed based on the Kohlrausch-Williams-Watts (KWW) relaxation function, φ(t)=exp[-(t/τ0)]. The exponent n increases with V2O5 content. In addition, as the temperature approaches glass transition temperature, n increases with temperature. The results are interpreted in terms of Ngai's coupling model when applied to polaron conductivity relaxation.

  12. Droop-free Distributed Control for AC Microgrids

    DEFF Research Database (Denmark)

    Nasirian, Vahidreza; Shafiee, Qobad; Guerrero, Josep M.

    2016-01-01

    A cooperative distributed secondary/primary control paradigm for AC microgrids is proposed. This solution replaces the centralized secondary control and the primary-level droop mechanism of each inverter with three separate regulators: voltage, reactive power, and active power regulators. A sparse...... active power of each inverter with its neighbors’ and uses the difference to update the frequency and, accordingly, the phase angle of that inverter. The global dynamic model of the microgrid, including distribution grid, regulator modules, and the communication network, is derived, and controller design...... communication network is spanned across the microgrid to facilitate limited data exchange among inverter controllers. Each controller processes its local and neighbors’ information to update its voltage magnitude and frequency (or, equivalently, phase angle) set points. A voltage estimator finds the average...

  13. Control of hybrid AC/DC microgrid under islanding operational conditions

    DEFF Research Database (Denmark)

    Ding, G.; Gao, F.; Zhang, S.

    2014-01-01

    This paper presents control methods for hybrid AC/DC microgrid under islanding operation condition. The control schemes for AC sub-microgrid and DC sub-microgrid are investigated according to the power sharing requirement and operational reliability. In addition, the key control schemes...... of interlinking converter with DC-link capacitor or energy storage, which will devote to the proper power sharing between AC and DC sub-microgrids to maintain AC and DC side voltage stable, is reviewed. Combining the specific control methods developed for AC and DC sub-microgrids with interlinking converter......, the whole hybrid AC/DC microgrid can manage the power flow transferred between sub-microgrids for improving on the operational quality and efficiency....

  14. Linear AC transport in T-stub and crossed silicene nanosystems

    Science.gov (United States)

    Sun, Yun-Lei; Ye, En-Jia

    2018-01-01

    In this work, we theoretically study the linear AC transport properties in T-stub and crossed zigzag silicene nanosystems. The DC conductance and AC emittance are numerically calculated based on the tight-binding approach and AC transport theory, by considering the nearest-neighbor hopping, second-nearest-neighbor spin-orbit interaction (SOI) and external electric field. The relatively strong SOI of silicene was demonstrated to induce a topological quantum edge state in the nanosystems by the local density of states, which eliminates the AC emittance response at the Dirac point. Further investigations suggest that the SOI-induced AC transport is topologically protected from the changes of geometrical size. Moreover, the AC transport properties of these nanosystems can be tuned by the external electric field, which would open an energy gap and destroy the topological quantum state, making them trivial band insulators.

  15. Moderately nonlinear diffuse-charge dynamics under an ac voltage

    Science.gov (United States)

    Stout, Robert F.; Khair, Aditya S.

    2015-09-01

    The response of a symmetric binary electrolyte between two parallel, blocking electrodes to a moderate amplitude ac voltage is quantified. The diffuse charge dynamics are modeled via the Poisson-Nernst-Planck equations for a dilute solution of point-like ions. The solution to these equations is expressed as a Fourier series with a voltage perturbation expansion for arbitrary Debye layer thickness and ac frequency. Here, the perturbation expansion in voltage proceeds in powers of Vo/(kBT /e ) , where Vo is the amplitude of the driving voltage and kBT /e is the thermal voltage with kB as Boltzmann's constant, T as the temperature, and e as the fundamental charge. We show that the response of the electrolyte remains essentially linear in voltage amplitude at frequencies greater than the RC frequency of Debye layer charging, D /λDL , where D is the ion diffusivity, λD is the Debye layer thickness, and L is half the cell width. In contrast, nonlinear response is predicted at frequencies below the RC frequency. We find that the ion densities exhibit symmetric deviations from the (uniform) equilibrium density at even orders of the voltage amplitude. This leads to the voltage dependence of the current in the external circuit arising from the odd orders of voltage. For instance, the first nonlinear contribution to the current is O (Vo3) which contains the expected third harmonic but also a component oscillating at the applied frequency. We use this to compute a generalized impedance for moderate voltages, the first nonlinear contribution to which is quadratic in Vo. This contribution predicts a decrease in the imaginary part of the impedance at low frequency, which is due to the increase in Debye layer capacitance with increasing Vo. In contrast, the real part of the impedance increases at low frequency, due to adsorption of neutral salt from the bulk to the Debye layer.

  16. Moderately nonlinear diffuse-charge dynamics under an ac voltage.

    Science.gov (United States)

    Stout, Robert F; Khair, Aditya S

    2015-09-01

    The response of a symmetric binary electrolyte between two parallel, blocking electrodes to a moderate amplitude ac voltage is quantified. The diffuse charge dynamics are modeled via the Poisson-Nernst-Planck equations for a dilute solution of point-like ions. The solution to these equations is expressed as a Fourier series with a voltage perturbation expansion for arbitrary Debye layer thickness and ac frequency. Here, the perturbation expansion in voltage proceeds in powers of V_{o}/(k_{B}T/e), where V_{o} is the amplitude of the driving voltage and k_{B}T/e is the thermal voltage with k_{B} as Boltzmann's constant, T as the temperature, and e as the fundamental charge. We show that the response of the electrolyte remains essentially linear in voltage amplitude at frequencies greater than the RC frequency of Debye layer charging, D/λ_{D}L, where D is the ion diffusivity, λ_{D} is the Debye layer thickness, and L is half the cell width. In contrast, nonlinear response is predicted at frequencies below the RC frequency. We find that the ion densities exhibit symmetric deviations from the (uniform) equilibrium density at even orders of the voltage amplitude. This leads to the voltage dependence of the current in the external circuit arising from the odd orders of voltage. For instance, the first nonlinear contribution to the current is O(V_{o}^{3}) which contains the expected third harmonic but also a component oscillating at the applied frequency. We use this to compute a generalized impedance for moderate voltages, the first nonlinear contribution to which is quadratic in V_{o}. This contribution predicts a decrease in the imaginary part of the impedance at low frequency, which is due to the increase in Debye layer capacitance with increasing V_{o}. In contrast, the real part of the impedance increases at low frequency, due to adsorption of neutral salt from the bulk to the Debye layer.

  17. Nonlinearity exponent of ac conductivity in disordered systems

    International Nuclear Information System (INIS)

    Nandi, U N; Sircar, S; Karmakar, A; Giri, S

    2012-01-01

    We measured the real part of ac conductance Σ(x,f) or Σ(T,f) of iron-doped mixed-valent polycrystalline manganite oxides LaMn 1-x Fe x O 3 as a function of frequency f by varying initial conductance Σ 0 by quenched disorder x at a fixed temperature T (room) and by temperature T at a fixed quenched disorder x. At a fixed temperature T, Σ(x,f) of a sample with fixed x remains almost constant at its zero-frequency dc value Σ 0 at lower frequency. With increase in f, Σ(x,f) increases slowly from Σ 0 and finally increases rapidly following a power law with an exponent s at high frequency. Scaled appropriately, the data for Σ(T,f) and Σ(x,f) fall on the same universal curve, indicating the existence of a general scaling formalism for the ac conductivity in disordered systems. The characteristic frequency f c at which Σ(x,f) or Σ(T,f) increases for the first time from Σ 0 scales with initial conductance Σ 0 as f c ∼ Σ 0 x f , where x f is the onset exponent. The value of x f is nearly equal to one and is found to be independent of x and T. Further, an inverse relationship between x f and s provides a self-consistency check of the systematic description of Σ(x,f) or Σ(T,f). This apparent universal value of x f is discussed within the framework of existing theoretical models and scaling theories. The relevance to other similar disordered systems is also highlighted. (paper)

  18. AC relaxation in the iron(8) molecular magnet

    Science.gov (United States)

    Rose, Geordie

    2000-11-01

    We investigate the low energy magnetic relaxation characteristics of the ``iron eight'' (Fe8) molecular magnet. Each molecule in this material contains a cluster of eight Fe 3+ ions surrounded by organic ligands. The molecules arrange themselves into a regular lattice with triclinic symmetry. At sufficiently low energies, the electronic spins of the Fe3+ ions lock together into a ``quantum rotator'' with spin S = 10. We derive a low energy effective Hamiltonian for this system, valid for temperatures less than Tc ~ 360 mK , where Tc is the temperature at which the Fe8 system crosses over into a ``quantum regime'' where relaxation characteristics become temperature independent. We show that in this regime the dominant environmental coupling is to the environmental spin bath in the molecule. We show how to explicitly calculate these couplings, given crystallographic information about the molecule, and do this for Fe8. We use this information to calculate the linewidth, topological decoherence and orthogonality blocking parameters. All of these quantities are shown to exhibit an isotope effect. We demonstrate that orthogonality blocking in Fe8 is significant and suppresses coherent tunneling. We then use our low energy effective Hamiltonian to calculate the single-molecule relaxation rate in the presence of an external magnetic field with both AC and DC components by solving the Landau-Zener problem in the presence of a nuclear spin bath. Both sawtooth and sinusoidal AC fields are analyzed. This single-molecule relaxation rate is then used as input into a master equation in order to take into account the many-molecule nature of the full system. Our results are then compared to quantum regime relaxation experiments performed on the Fe8 system.

  19. AcEST(EST sequences of Adiantum capillus-veneris and their annotation) - AcEST | LSDB Archive [Life Science Database Archive metadata

    Lifescience Database Archive (English)

    Full Text Available List Contact us AcEST AcEST(EST sequences of Adiantum capillus-veneris and their annotation) Data detail Dat...a name AcEST(EST sequences of Adiantum capillus-veneris and their annotation) DOI 10.18908/lsdba.nbdc00839-0...01 Description of data contents EST sequence of Adiantum capillus-veneris and its annotation (clone ID, libr...le search URL http://togodb.biosciencedbc.jp/togodb/view/archive_acest#en Data acquisition method Capillary ...ainst UniProtKB/Swiss-Prot and UniProtKB/TrEMBL databases) Number of data entries Adiantum capillus-veneris

  20. Interlink Converter with Linear Quadratic Regulator Based Current Control for Hybrid AC/DC Microgrid

    Directory of Open Access Journals (Sweden)

    Dwi Riana Aryani

    2017-11-01

    Full Text Available A hybrid alternate current/direct current (AC/DC microgrid consists of an AC subgrid and a DC subgrid, and the subgrids are connected through the interlink bidirectional AC/DC converter. In the stand-alone operation mode, it is desirable that the interlink bidirectional AC/DC converter manages proportional power sharing between the subgrids by transferring power from the under-loaded subgrid to the over-loaded one. In terms of system security, the interlink bidirectional AC/DC converter takes an important role, so proper control strategies need to be established. In addition, it is assumed that a battery energy storage system is installed in one subgrid, and the coordinated control of interlink bidirectional AC/DC converter and battery energy storage system converter is required so that the power sharing scheme between subgrids becomes more efficient. For the purpose of designing a tracking controller for the power sharing by interlink bidirectional AC/DC converter in a hybrid AC/DC microgrid, a droop control method generates a power reference for interlink bidirectional AC/DC converter based on the deviation of the system frequency and voltages first and then interlink bidirectional AC/DC converter needs to transfer the power reference to the over-loaded subgrid. For efficiency of this power transferring, a linear quadratic regulator with exponential weighting for the current regulation of interlink bidirectional AC/DC converter is designed in such a way that the resulting microgrid can operate robustly against various uncertainties and the power sharing is carried out quickly. Simulation results show that the proposed interlink bidirectional AC/DC converter control strategy provides robust and efficient power sharing scheme between the subgrids without deteriorating the secure system operation.

  1. Power flow analysis for droop controlled LV hybrid AC-DC microgrids with virtual impedance

    DEFF Research Database (Denmark)

    Li, Chendan; Chaudhary, Sanjay; Vasquez, Juan Carlos

    2014-01-01

    The AC-DC hybrid microgrid is an effective form of utilizing different energy resources and the analysis of this system requires a proper power flow algorithm. This paper proposes a suitable power flow algorithm for LV hybrid AC-DC microgrid based on droop control and virtual impedance. Droop...... algorithm makes it a potential method for planning, dispatching and operation of droop controlled LV hybrid AC-DC....

  2. AC Induced Corrosion of Carbon Steel in 3.5wt% NaCl Electrolyte

    OpenAIRE

    Strandheim, Espen Oldeide

    2012-01-01

    This paper deals with alternating current (AC) corrosion of low alloy carbon steel in 3.5 wt% NaCl electrolyte. Accelerated corrosion rates have been reported when exposed to AC and the corrosion mechanism is not well understood. Electrical heating of subsea pipelines, applied to avoid hydrate formation and waxing of multiphase hydrocarbon well streams has made this topic increasingly relevant in recent years. To study the effect of AC on corrosion rates, weight loss experiments under a wide ...

  3. Preliminary design of reactor coolant pump canned motor for AC600

    International Nuclear Information System (INIS)

    Deng Shaowen

    1998-01-01

    The reactor coolant pump canned motor of AC600 PWR is the kind of shielded motors with high moment of inertia, high reliability, high efficiency and nice starting performance. The author briefly presents the main feature, design criterion and technical requirements, preliminary design, computation results and analysis of performance of AC600 reactor coolant pump canned motor, and proposes some problems to be solved for study and design of AC600 reactor coolant pump canned motor

  4. ac-dc voltage profile and four point impedance of a quantum driven system

    Science.gov (United States)

    Foieri, Federico; Arrachea, Liliana

    2010-09-01

    We investigate the behavior of the time-dependent voltage drop in a periodically driven quantum conductor sensed by weakly coupled dynamical voltages probes. We introduce the concepts of ac-dc local voltage and four point impedance in an electronic system driven by ac fields. We discuss the properties of the different components of these quantities in a simple model of a quantum pump, where two ac voltages oscillating with a phase lag are applied at the walls of a quantum dot.

  5. Extra- and intracellular signaling pathways under red blood cell aggregation and deformability changes.

    Science.gov (United States)

    Muravyov, Alexei V; Tikhomirova, Irina A; Maimistova, Alla A; Bulaeva, Svetlana V

    2009-01-01

    Exposure of red blood cells (RBCs) to catecholamines (epinephrine, phenylephrine, an agonist of alpha1-adrenergic receptors, clonidine, an agonist of alpha2-adrenergic receptors and isoproterenol, an agonist of beta-adrenergic receptors) led to change in the RBC microrheological properties. When forskolin (10 microM), an AC stimulator was added to RBC suspension, the RBC deformability (RBCD) was increased by 17% (pRBCA) was significantly decreased under these conditions (pRBCA reduction effect was found under cell incubation with pentoxifylline and inhibitor PDE1-vinpocetine. On the whole RBCA reduction averaged 36% (pRBCA, whereas red cell deformability was changed insignificantly. At the same time Ca2+ entry blocking into the red cells by verapamil or its chelating in medium by EGTA led to significant RBCA decrease and deformability rise (pRBCA decrease was mainly associated with an activation of the adenylyl-cyclase-cAMP system, while the red cell deformability was closely associated with Ca2+ control mechanisms.

  6. Polymorphisms in xenobiotic metabolizing genes, intakes of heterocyclic amines and red meat, and postmenopausal breast cancer.

    Science.gov (United States)

    Lee, Hae-Jeung; Wu, Kana; Cox, David G; Hunter, David; Hankinson, Susan E; Willett, Walter C; Sinha, Rashmi; Cho, Eunyoung

    2013-01-01

    Heterocyclic amines (HCAs) are mutagenic compounds generated when meats are cooked at high temperature and for long duration. The findings from previous studies on the relation between HCAs and breast cancer are inconsistent, possibly because of genetic variations in the enzymes metabolizing HCAs. To evaluate whether the associations of intakes of estimated HCAs, meat-derived mutagenicity (MDM), and red meat with risk of postmenopausal breast cancer were modified by N-acetyltransferase 2 (NAT2) acetylator genotype or cytochrome P450 1A2-164 A/C (CYP1A2) polymorphism, we conducted a nested case-control study with 579 cases and 981 controls within a prospective cohort, the Nurses' Health Study. HCAs and MDM intakes were derived using a cooking method questionnaire administered in 1996. NAT2acetylator genotype, the CYP1A2 polymorphism, and intakes of HCAs, MDM, and red meat were not associated with risk of postmenopausal breast cancer. There was also no interaction between NAT2 acetylator genotype or CYP1A2 polymorphism and HCAs and MDM and red meat intake in relation to breast cancer. These results do not support the hypothesis that genetic polymorphisms of xenobiotic enzymes involved in the metabolism of HCAs may modify the associations between intakes of red meat or meat-related mutagens and breast cancer risk.

  7. Investigation of the transition of multicycle AC operation in ISTTOK under edge electrode biasing

    Science.gov (United States)

    Malaquias, A.; Henriques, R. B.; Silva, C.; Figueiredo, H.; Nedzelskiy, I. S.; Fernandes, H.; Sharma, R.; Plyusnin, V. V.

    2017-11-01

    In this paper we present recent results obtained on plasma edge electrode biasing during AC discharges. The goal is to obtain experimental evidence on a number of plasma parameters that can play a role during the AC transition on the repeatability and reproducibility of AC operation. The control of the plasma density in the quiescent phase is made just before the AC transition by means of positive edge biasing leading to a transitory improved of density (30%-40%). Gas puff experiments show that the increase of background gas pressure during discharge led to a better success of the AC transition. The experimental results indicate that the increase of density during the AC transition induced by edge biasing is followed by an electron temperature drop. The drop in electron temperature leads in most cases the formation of runaway electrons. It has been observed that the runaway population during discharge flattop depends on the interplay between gas content and plasma density and temperature. The results also confirm that the correct balance of external magnetic fields is crucial during the AC transition phase where drift electron currents are formed. The results from the heavy ion beam diagnostic show that the formation of plasma current during consecutive AC transitions is asymmetric. Numerical simulations indicate that for some particular conditions this result could be reproduced from assuming the presence of two counter-currents during AC transition.

  8. A New Design Method of AC Filter for Static Var Compensator

    Science.gov (United States)

    Tamura, Yuji; Irokawa, Shoichi; Takeda, Hideo; Takagi, Kikuo; Noro, Yasuhiro; Ametani, Akihiro

    A new approach of the AC filter design for the SVC (Static Var Compensator) is proposed in this paper. When the SVC consists of TCR(s) (Thyristor Controlled Reactor(s)) or TCT(s) (Thyristor Controlled Transformer(s)) and the AC filter(s), it is required to design AC filter(s) carefully to meet regulation level of harmonic voltage and current at the connection point of the SVC. In general, the AC filter design may require many iterative calculations of the harmonic performance by changing electrical parameters of the AC filter until all the harmonic voltage and current performances at the connection point of the SVC meet the regulation level on various conditions in terms of the filter de-tuning cases and the AC power system conditions. In this respect a new AC filter design approach is proposed, which is innovative on evaluation method of the performance to predetermine the permissible range of the AC filter harmonic impedance on the complex plane. By using this method, the iterations of the calculation can be reduced and it enables more efficient process of the design providing clear accountability of the decision of AC filter parameters.

  9. Analytical theory and possible detection of the ac quantum spin Hall effect.

    Science.gov (United States)

    Deng, W Y; Ren, Y J; Lin, Z X; Shen, R; Sheng, L; Sheng, D N; Xing, D Y

    2017-07-11

    We develop an analytical theory of the low-frequency ac quantum spin Hall (QSH) effect based upon the scattering matrix formalism. It is shown that the ac QSH effect can be interpreted as a bulk quantum pumping effect. When the electron spin is conserved, the integer-quantized ac spin Hall conductivity can be linked to the winding numbers of the reflection matrices in the electrodes, which also equal to the bulk spin Chern numbers of the QSH material. Furthermore, a possible experimental scheme by using ferromagnetic metals as electrodes is proposed to detect the topological ac spin current by electrical means.

  10. Low ac loss geometries in YBCO coated conductors and impact on conductor stability

    Energy Technology Data Exchange (ETDEWEB)

    Duckworth, Robert C [ORNL; List III, Frederick Alyious [ORNL; Paranthaman, Mariappan Parans [ORNL; Rupich, M. W. [American Superconductor Corporation, Westborough, MA; Zhang, W. [American Superconductor Corporation, Westborough, MA; Xie, Y. Y. [SuperPower Incorporated, Schenectady, New York; Selvamanickam, V. [SuperPower Incorporated, Schenectady, New York

    2007-01-01

    Reduction of ac losses in applied ac fields can be accomplished through either the creation of filaments and bridging in YBCO coated conductors or an assembly of narrow width YBCO tapes. The ac losses for each of these geometries were measured at 77 K in perpendicular ac fields up to 100 mT. While ac loss reduction was achieved with YBCO filaments created through laser scribing and inkjet deposition, the assembly of stacked YBCO conductor provides an alternative method of ac loss reduction. When compared to a 4-mm wide YBCO coated conductor with a critical current of 60 A, the ac loss in a stack of 2-mm wide YBCO coated conductors with a similar total critical current was reduced. While the reduction in ac loss in a 2-mm wide stack coincided with the reduction in the engineering current density of the conductor, further reduction of ac loss was obtained through the splicing of the 2-mm wide tapes with low resistance solders. To better determine the practicality of these methods from a stability point of view, a numerical analysis was carried out to determine the influence of bridging and splicing on stability of a YBCO coated conductor for both liquid nitrogen-cooled and conduction cooled geometries.

  11. Research on key technology of planning and design for AC/DC hybrid distribution network

    Science.gov (United States)

    Shen, Yu; Wu, Guilian; Zheng, Huan; Deng, Junpeng; Shi, Pengjia

    2018-04-01

    With the increasing demand of DC generation and DC load, the development of DC technology, AC and DC distribution network integrating will become an important form of future distribution network. In this paper, the key technology of planning and design for AC/DC hybrid distribution network is proposed, including the selection of AC and DC voltage series, the design of typical grid structure and the comprehensive evaluation method of planning scheme. The research results provide some ideas and directions for the future development of AC/DC hybrid distribution network.

  12. A low capacitance single-phase AC-DC converter with inherent power ripple decoupling

    OpenAIRE

    Gottardo, Davide; De Lillo, Liliana; Empringham, Lee; Costabeber, Alessando

    2016-01-01

    This paper proposes a new single-phase AC-DC conversion topology with inherent power ripple decoupling, based on the combination of a PWM H-bridge inverter, an AC side LC filter and a ZVS line commutated H-bridge. A capacitor on the AC side is used as power decoupling element. By appropriate selection of the capacitor voltage, the power ripple at twice the AC frequency can be cancelled from the DC side instantaneous power, achieving negligible DC voltage ripple using a smaller total capacitan...

  13. Effect of AC electric fields on the stabilization of premixed bunsen flames

    KAUST Repository

    Kim, Minkuk

    2011-01-01

    The stabilization characteristics of laminar premixed bunsen flames have been investigated experimentally for stoichiometric methane-air mixture by applying AC voltage to the nozzle with the single-electrode configuration. The detachment velocity either at blowoff or partial-detachment has been measured by varying the applied voltage and frequency of AC. The result showed that the detachment velocity increased with the applied AC electric fields, such that the flame could be nozzle-attached even over five times of the blowoff velocity without having electric fields. There existed four distinct regimes depending on applied AC voltage and frequency. In the low voltage regime, the threshold condition of AC electric fields was identified, below which the effect of electric fields on the detachment velocity is minimal. In the moderate voltage regime, the flame base oscillated with the frequency synchronized to AC frequency and the detachment velocity increased linearly with the applied AC voltage and nonlinearly with the frequency. In the high voltage regime, two different sub-regimes depending on AC frequency were observed. For relatively low frequency, the flame base oscillated with the applied AC frequency together with the half frequency and the variation of the detachment velocity was insensitive to the applied voltage. For relatively high frequency, the stabilization of the flame was significantly affected by the generation of streamers and the detachment velocity decreased with the applied voltage. © 2010 Published by Elsevier Inc. on behalf of The Combustion Institute. All rights reserved.

  14. Effect of the valence electron concentration on the bulk modulus and chemical bonding in Ta2AC and Zr2AC (A=Al, Si, and P)

    International Nuclear Information System (INIS)

    Schneider, Jochen M.; Music, Denis; Sun Zhimei

    2005-01-01

    We have studied the effect of the valence electron concentration, on the bulk modulus and the chemical bonding in Ta 2 AC and Zr 2 AC (A=Al, Si, and P) by means of ab initio calculations. Our equilibrium volume and the hexagonal ratio (c/a) agree well (within 2.7% and 1.2%, respectively) with previously published experimental data for Ta 2 AlC. The bulk moduli of both Ta 2 AC and Zr 2 AC increase as Al is substituted with Si and P by 13.1% and 20.1%, respectively. This can be understood since the substitution is associated with an increased valence electron concentration, resulting in band filling and an extensive increase in cohesion

  15. Six switches solution for single-phase AC/DC/AC converter with capability of second-order power mitigation in DC-link capacitor

    DEFF Research Database (Denmark)

    Liu, Xiong; Wang, Peng; Loh, Poh Chiang

    2011-01-01

    This paper proposes an approach for DC-link second-order harmonic power cancellation in single-phase AC/DC/AC converter with reduced number of switches. The proposed six-switch converter has two bridges with three switches in each of them, where the middle switch in each bridge is shared by the AC....../DC rectifier and DC/AC inverter. A small size DC-link capacitor can be achieved through coordination control of rectifier and inverter to cancel the second-order oscillation power. Maximum available phase difference between rectifier’s and inverter’s modulation references is investigated to be dependent...... on their modulation indices of the six-switch converter, and high modulation indices are proved to be feasible for second-order power cancellation in the DC-link based on the phase difference analysis. Both reduced switch numbers and DC electrolytic capacitor size can be achieved using the proposed converter...

  16. Red blood cells in thrombosis.

    Science.gov (United States)

    Byrnes, James R; Wolberg, Alisa S

    2017-10-19

    Red blood cells (RBCs) have historically been considered passive bystanders in thrombosis. However, clinical and epidemiological studies have associated quantitative and qualitative abnormalities in RBCs, including altered hematocrit, sickle cell disease, thalassemia, hemolytic anemias, and malaria, with both arterial and venous thrombosis. A growing body of mechanistic studies suggests that RBCs can promote thrombus formation and enhance thrombus stability. These findings suggest that RBCs may contribute to thrombosis pathophysiology and reveal potential strategies for therapeutically targeting RBCs to reduce thrombosis. © 2017 by The American Society of Hematology.

  17. Variability for grain mold resistance in sorghum F3 progenies of red × red and red × white grain crosses

    OpenAIRE

    Vinay patted, M. Y. Kamatar and S. K. Deshpande

    2011-01-01

    The present investigation was carried out to estimate the nature and magnitude of genetic variability for yield and grain moldresistance in 99 sorghum F3 progenies of red × red and red × white crosses including parents and checks. Variation for grain moldassociated traits was analyzed with respect to grain hardness, panicle compactness, grain colour, glume length and glume colour.Among 99 F3 progenies 30 progenies exhibited partly hard grains and 19 progenies had hard grains and which exhibit...

  18. Adsorption of procion red and congo red dyes using microalgae Spirulina sp

    Directory of Open Access Journals (Sweden)

    Risfidian Mohadi

    2017-10-01

    Full Text Available Adsorption of procion red and congo red dyes using microalgae Spirulina sp was conducted. Spirulina sp was obtained by cultivation and production in laboratory scale. Spirulina sp was used as adsorbent for adsorption of dyes. Adsorption process was studied by kinetic and thermodynamic in order to know the adsorption phenomena. The results showed that kinetically congo red is reactive than procion red on Spirulina sp. On the other hand, thermodynamically procion red was stable than congo red on Spirulina sp which was indicated by adsorption capacity, enthalpy, and entropy.

  19. A red orange extract modulates the vascular response to a recreational dive: a pilot study on the effect of anthocyanins on the physiological consequences of scuba diving.

    Science.gov (United States)

    Balestra, C; Cimino, F; Theunissen, S; Snoeck, T; Provyn, S; Canali, R; Bonina, A; Virgili, F

    2016-09-01

    Nutritional antioxidants have been proposed as an expedient strategy to counter the potentially deleterious effects of scuba diving on endothelial function, flow-mediated dilation (FMD) and heart function. Sixteen volunteers performing a single standard dive (20 min at 33 m) according to US Navy diving procedures were randomly assigned to two groups: one was administered with two doses of 200 mg of an anthocyanins (AC)-rich extract from red oranges, 12 and 4 h before diving. Anthocyanins supplementation significantly modulated the effects of diving on haematocrit, body water distribution and FMD. AC administration significantly reduces the potentially harmful endothelial effects of a recreational single dive. The lack of any significant effect on the most common markers of plasma antioxidant capacity suggests that the mechanism underlying this protective activity is independent of the putative antioxidant effect of AC and possibly involves cellular signalling modulation of the response to high oxygen.

  20. Similarly potent inhibition of adenylyl cyclase by P-site inhibitors in hearts from wild type and AC5 knockout mice.

    Directory of Open Access Journals (Sweden)

    Joerg H Braeunig

    Full Text Available Adenylyl cyclase type 5 (AC5 was described as major cardiac AC isoform. The knockout of AC5 (AC5KO exerted cardioprotective effects in heart failure. Our study explored the impact of AC5KO on mouse heart AC activities and evaluated putative AC5-selective inhibitors. In cardiac membranes from AC5KO mice, basal AC activity was decreased, while AC stimulation was intact. The putative AC5-selective P-site inhibitors SQ22,536 [9-(tetra-hydro-2-furanyl-9H-purin-6-amine], vidarabine (9-β-D-arabinosyladenine and NKY80 [2-amino-7-(2-furanyl-7,8-dihydro-5(6H-quinazolinone] inhibited recombinant AC5 more potently than AC2 and AC1, but selectivity was only modest (∼4-40-fold. These compounds inhibited cardiac AC from WT and AC5KO mice with similar potencies. In conclusion, AC regulation in AC5KO hearts was unimpaired, questioning the supposed dominant role of AC5 in the heart. Moreover, the AC inhibitors SQ22,536, NKY80 and vidarabine lack adequate selectivity for AC5 and, therefore, do not present suitable tools to study AC5-specific functions.

  1. Spin models for the single molecular magnet Mn12-AC

    Science.gov (United States)

    Al-Saqer, Mohamad A.

    2005-11-01

    The single molecular magnet (SMM) Mn12-AC attracted the attention of scientists since the discovery of its magnetic hystereses which are accompanied by sudden jumps in magnetic moments at low temperature. Unlike conventional bulk magnets, hysteresis in SMMs is of molecular origin. This qualifies them as candidates for next generation of high density storage media where a molecule which is at most few nanometers in size can be used to store a bit of information. However, the jumps in these hystereses, due to spin tunneling, can lead to undesired loss of information. Mn12-AC molecule contains twelve magnetic ions antiferromagnetically coupled by exchanges leading to S = 10 ground state manifold. The magnetic ions are surrounded by ligands which isolate them magnetically from neighboring molecules. The lowest state of S = 9 manifold is believed to lie at about 40 K above the ground state. Therefore, at low temperatures, the molecule is considered as a single uncoupled moment of spin S = 10. Such model has been used widely to understand phenomena exhibited by the molecule at low temperatures including the tunneling of its spin, while a little attention has been paid for the multi-spin nature of the molecule. Using the 8-spin model, we demonstrate that in order to understand the phenomena of tunneling, a full spin description of the molecule is required. We utilized a calculation scheme where a fraction of energy levels are used in the calculations and the influence of levels having higher energy is neglected. From the dependence of tunnel splittings on the number of states include, we conclude that models based on restricting the number of energy levels (single-spin and 8-spin models) lead to unreliable results of tunnel splitting calculations. To attack the full 12-spin model, we employed the Davidson algorithm to calculated lowest energy levels produced by exchange interactions and single ion anisotropies. The model reproduces the anisotropy properties at low

  2. AC impedance electrochemical modeling of lithium-ion positive electrodes

    International Nuclear Information System (INIS)

    Dees, D.; Gunen, E.; Abraham, D.; Jansen, A.; Prakash, J.

    2004-01-01

    Under Department of Energy's Advanced Technology Development Program,various analytical diagnostic studies are being carried out to examine the lithium-ion battery technology for hybrid electric vehicle applications, and a series of electrochemical studies are being conducted to examine the performance of these batteries. An electrochemical model was developed to associate changes that were observed in the post-test analytical diagnostic studies with the electrochemical performance loss during testing of lithium ion batteries. While both electrodes in the lithium-ion cell have been studied using a similar electrochemical model, the discussion here is limited to modeling of the positive electrode. The positive electrode under study has a composite structure made of a layered nickel oxide (LiNi 0.8 Co 0.15 Al 0.05 O 2 ) active material, a carbon black and graphite additive for distributing current, and a PVDF binder all on an aluminum current collector. The electrolyte is 1.2M LiPF 6 dissolved in a mixture of EC and EMC and a Celgard micro-porous membrane is used as the separator. Planar test cells (positive/separator/negative) were constructed with a special fixture and two separator membranes that allowed the placement of a micro-reference electrode between the separator membranes (1). Electrochemical studies including AC impedance spectroscopy were then conducted on the individual electrodes to examine the performance and ageing effects in the cell. The model was developed by following the work of Professor Newman at Berkeley (2). The solid electrolyte interface (SEI) region, based on post-test analytical results, was assumed to be a film on the oxide and an oxide layer at the surface of the oxide. A double layer capacity was added in parallel with the Butler-Volmer kinetic expression. The pertinent reaction, thermodynamic, and transport equations were linearized for a small sinusoidal perturbation (3). The resulting system of differential equations was solved

  3. Red blood cell alloimmunization after blood transfusion

    OpenAIRE

    Schonewille, Henk

    2008-01-01

    Current pretransfusion policy requires the patients’ serum to be tested for the presence of irregular red blood cell antibodies. In case of an antibody, red blood cells lacking the corresponding antigen are transfused after an antiglobulin crossmatch. The aim of the studies in this thesis is primarily to investigate whether this policy should change to improve transfusion safety. This thesis explores the risk on red blood cell alloimmunization after blood transfusion in oncohematologic patien...

  4. Antibacterial Compounds from Red Seaweeds (Rhodophyta)

    OpenAIRE

    Noer Kasanah; Triyanto Triyanto; Drajad Sarwo Seto; Windi Amelia; Alim Isnansetyo

    2015-01-01

    Seaweeds produce great variety of metabolites benefit for human. Red seaweeds (Rhodophyta) are well known as producer of phycocolloids such agar, agarose, carragenan and great variety of secondary metabolites. This review discusses the red algal secondary metabolites with antibacterial activity. The chemical constituents of red algae are steroid, terpenoid, acetogenin and dominated by halogenated compounds mainly brominated compounds. Novel compounds with intriguing skeleton are also reported...

  5. The Red-Blue Transportation Problem

    OpenAIRE

    Vancroonenburg, Wim; Della Croce, Federico; Goossens, Dries; Spieksma, Frits

    2014-01-01

    This paper considers the Red-Blue Transportation Problem (Red-Blue TP), a generalization of the transportation problem where supply nodes are partitioned into two sets and so-called exclusionary constraints are imposed. We encountered a special case of this problem in a hospital context, where patients need to be assigned to rooms. We establish the problem's complexity, and we compare two integer programming formulations. Furthermore, a maximization variant of Red-Blue TP is presented, for...

  6. Critical current density measurement of thin films by AC susceptibility based on the penetration parameter h

    DEFF Research Database (Denmark)

    Li, Xiao-Fen; Grivel, Jean-Claude; Abrahamsen, Asger B.

    2012-01-01

    current density Jc of superconducting thin films by AC susceptibility. Compared with the normally used method based on the peak of the imaginary part, our method uses a much larger range of the AC susceptibility curve, thus allowing determination of the temperature (T) dependence of Jc from a normally...

  7. The HST/ACS Coma Cluster Survey : II. Data Description and Source Catalogs

    NARCIS (Netherlands)

    Hammer, Derek; Kleijn, Gijs Verdoes; Hoyos, Carlos; den Brok, Mark; Balcells, Marc; Ferguson, Henry C.; Goudfrooij, Paul; Carter, David; Guzman, Rafael; Peletier, Reynier F.; Smith, Russell J.; Graham, Alister W.; Trentham, Neil; Peng, Eric; Puzia, Thomas H.; Lucey, John R.; Jogee, Shardha; Aguerri, Alfonso L.; Batcheldor, Dan; Bridges, Terry J.; Chiboucas, Kristin; Davies, Jonathan I.; del Burgo, Carlos; Erwin, Peter; Hornschemeier, Ann; Hudson, Michael J.; Huxor, Avon; Jenkins, Leigh; Karick, Arna; Khosroshahi, Habib; Kourkchi, Ehsan; Komiyama, Yutaka; Lotz, Jennifer; Marzke, Ronald O.; Marinova, Irina; Matkovic, Ana; Merritt, David; Miller, Bryan W.; Miller, Neal A.; Mobasher, Bahram; Mouhcine, Mustapha; Okamura, Sadanori; Percival, Sue; Phillipps, Steven; Poggianti, Bianca M.; Price, James; Sharples, Ray M.; Tully, R. Brent; Valentijn, Edwin

    2010-01-01

    The Coma cluster, Abell 1656, was the target of an HST-ACS Treasury program designed for deep imaging in the F475W and F814W passbands. Although our survey was interrupted by the ACS instrument failure in early 2007, the partially completed survey still covers ~50% of the core high-density region in

  8. Performance Analysis of Phase Controlled Unidirectional and Bidirectional AC Voltage Controllers

    Directory of Open Access Journals (Sweden)

    Abdul Sattar Larik

    2011-01-01

    Full Text Available AC voltage controllers are used to vary the output ac voltage from a fixed ac input source. They are also commonly called ac voltage regulators or ac choppers. The output voltage is either controlled by PAC (Phase Angle Control method or on-off control method. Due to various advantages of ac voltage controllers, such as high efficiency, simplicity, low cost and ability to control large amount of power they efficiently control the speed of ac motors, light dimming and industrial heating, etc. These converters are variable structure systems and generate harmonics during the operation which will affect the power quality when connected to system network. During the last couple of years, a number of new semiconductor devices and various power electronic converters has been introduced. Accordingly the subject of harmonics and its problems are of great concern to power industry and customers. In this research work, initially the simulation models of single phase unidirectional and bidirectional ac voltage controllers were developed by using MATLAB software. The harmonics of these models are investigated by simulation. In the end, the harmonics were also analyzed experimentally. The simulated as well as experimental results are presented.

  9. An NPV and AC Analysis of a Stochastic Inventory System with Joint Manufacturing and Remanufacturing

    NARCIS (Netherlands)

    E.A. van der Laan (Erwin)

    2000-01-01

    textabstractWhile the net present value (NPV) approach is widely accepted as the right framework for studying production and inventory control systems, average cost (AC) models are more widely used. For the well known EOQ model it can be veri_ed that (under certain conditions) the AC approach gives

  10. Intra-wire resistance and AC loss in multi-filamentary MgB2 wires

    NARCIS (Netherlands)

    Zhou, Chao; Offringa, Wietse; Bergen, Anne-Henriette; Wessel, Wilhelm A.J.; Krooshoop, Hendrikus J.G.; Dhalle, Marc M.J.; Sumption, M.D.; Collings, E.W.; Rindfleisch, M.; Tomsic, M.; ten Kate, Herman H.J.; Nijhuis, Arend

    2013-01-01

    Intra-wire resistance and AC loss of various multi-filamentary MgB2 wires with filaments surrounded by Nb barriers have been measured and analyzed. The intra-wire resistance is measured with a direct four-probe voltage–current method at various temperatures. The AC loss is acquired by both vibrating

  11. AC-Specific Heat and Heat Conductivity Derived from Thermal Effusivity Measurements

    DEFF Research Database (Denmark)

    Christensen, Tage Emil

    It is shown how the 3-omega technique of AC-calorimetry applied to a plane heater with finite dimensions can be improved by including boundary effects.......It is shown how the 3-omega technique of AC-calorimetry applied to a plane heater with finite dimensions can be improved by including boundary effects....

  12. Self-field loss of BSCCOrAg tape in external AC magnetic field

    NARCIS (Netherlands)

    Rabbers, J.J.; ten Haken, Bernard; Gömöry, F.; ten Kate, Herman H.J.

    1998-01-01

    The self-field loss of BSCCOrAg tapes has been measured in combination with an external AC magnetic field. This situation occurs when conductors are used in applications such as coils or cables. An increase of the self-field loss due to external AC magnetic field is observed. An increase of the

  13. Measuring transport current loss of BSCCO/Ag tapes exposed to external AC magnetic field

    NARCIS (Netherlands)

    Rabbers, J.J.; ten Haken, Bernard; ten Kate, Herman H.J.

    1998-01-01

    BSCCO/Ag tape superconductors are developed for electrical power applications at liquid nitrogen temperatures. In these applications, e.g., superconducting transformers and power cables, an AC transport current and an AC magnetic field are present at the same time. A set-up to measure the influence

  14. Improved Tribological Performance of Amorphous Carbon (a-C Coating by ZrO2 Nanoparticles

    Directory of Open Access Journals (Sweden)

    Jinzhu Tang

    2016-09-01

    Full Text Available Nanomaterials, such as Graphene, h-BN nanoparticles and MoS2 nanotubes, have shown their ability in improving the tribological performance of amorphous carbon (a-C coatings. In the current study, the effectiveness of ZrO2 nanoparticles (ZrO2-NPs in lubricating the self-mated nonhydrogenated a-C contacts was investigated in boundary lubrication regime. The results showed that 13% less friction and 50% less wear compared to the base oil were achieved by employing ZrO2-NPs in the base oil in self-mated a-C contacts. Via analyzing the ZrO2-NPs and the worn a-C surface after tests, it was found that the improved lubrication by ZrO2-NPs was based on “polishing effects”, which is a new phenomenon observed between a-C and nanoparticles. Under the “polishing effect”, micro-plateaus with extremely smooth surface and uniform height were produced on the analyzed a-C surface. The resulting topography of the a-C coating is suitable for ZrO2-NPs to act as nano-bearings between rubbing surfaces. Especially, the ZrO2-NPs exhibited excellent mechanical and chemical stability, even under the severe service condition, suggesting that the combination of nonhydrogenated a-C coating with ZrO2-NPs is an effective, long lasting and environment-friendly lubrication solution.

  15. A Correction Formula for the ST Segment Measurements for the AC-coupled Electrocardiograms

    DEFF Research Database (Denmark)

    Schmid, Ramun; Isaksen, Jonas; Leber, Remo

    2017-01-01

    Goal: The ST segment of an electrocardiogram (ECG) is very important for the correct diagnosis of an acute myocardial infarction. Most clinical ECGs are recorded using an AC-coupled ECG amplifier. It is well known, that first-order high-pass filters used for the AC coupling can affect the ST...

  16. A Cloud-Based Scavenger Hunt: Orienting Undergraduates to ACS National Meetings

    Science.gov (United States)

    Kubasik, Matthew A.; Van Dyke, Aaron R.; Harper-Leatherman, Amanda S.; Miecznikowski, John R.; Steffen, L. Kraig; Smith-Carpenter, Jillian

    2016-01-01

    American Chemical Society (ACS) National Meetings are valuable for the development of undergraduate researchers but can be overwhelming for first-time attendees. To orient and engage students with the range of offerings at an ACS meeting, we developed a cloud-based scavenger hunt. Using their mobile devices, teams of undergraduates…

  17. Ac hopping conduction at extreme disorder takes place on the percolating cluster

    DEFF Research Database (Denmark)

    Schrøder, Thomas; Dyre, J. C.

    2008-01-01

    Simulations of the random barrier model show that ac currents at extreme disorder are carried almost entirely by the percolating cluster slightly above threshold; thus contributions from isolated low activation-energy clusters are negligible. The effective medium approximation in conjunction...... with the Alexander-Orbach conjecture lead to an excellent analytical fit to the universal ac conductivity with no nontrivial fitting parameters....

  18. Fe-aminoclay-entrapping electrospun polyacrylonitrile nanofibers (FeAC-PAN NFs) for environmental engineering applications

    Energy Technology Data Exchange (ETDEWEB)

    Lee, Jae Young [Korea Railroad Research Institute, Uiwang (Korea, Republic of); Choi, Saehae [Korea Research Institute of Bioscience and Biotechnology, Daejeon (Korea, Republic of); Park, Seung Bin [KAIST, Daejeon (Korea, Republic of); Kim, Mooon Il; Lee, Young Chul [Gachon Univ., Seongnam (Korea, Republic of); Lee, Go Woon [KIER, Daejeon (Korea, Republic of); Lee, Hyun Uk [Korea Basic Science Institute, Daejeon (Korea, Republic of)

    2015-09-15

    Electrospun polyacrylonitrile nanofibers (PAN NFs) with entrapped water-soluble Fe-aminoclay (FeAC) [FeAC-PAN NFs] were prepared. Slow dropwise addition of water-soluble FeAC into a PAN solution, less aggregated of FeAC into electrospun PAN NFs was one-pot evolved without FeAC post-decoration onto as-prepared PAN NFs. Taking into consideration both the Fe{sup 3+} source in FeAC and the improved surface hydrophilicity, the feasibility of Fentonlike reaction for decolorization of cationic model dye methylene blue (MB) under 6 hrs UV-light irradiation was established. In the case where FeAC-PAN NFs were enhanced by hydrogen peroxide (H{sub 2}O{sub 2}) injection, the apparent kinetic reaction rates were increased relative to those for the PAN NFs. Thus, our flexible FeAC-PAN NF mats can be effectively utilized in water/waste treatment and other environmental engineering applications.

  19. Variable-frequency inverter controls torque, speed, and braking in ac induction motors

    Science.gov (United States)

    Nola, F. J.

    1974-01-01

    Dc to ac inverter provides optimum frequency and voltage to ac induction motor, in response to different motor-load and speed requirements. Inverter varies slip frequency of motor in proportion to required torque. Inverter protects motor from high current surges, controls negative slip to apply braking, and returns energy stored in momentum of load to dc power source.

  20. Celebrating the intellectual legacy of A.C. Jordan | Ndlela | South ...

    African Journals Online (AJOL)

    The paucity or dearth of scholarship around A.C. Jordan's contributions as teacher, visionary, scholar and political activist in South Africa is as disconcerting as it is disillusioning. This paper seeks to take A.C. Jordan's rich and eclectic oeuvre from the peripheral position which it seems to occupy in contemporary academic ...

  1. Control of AC–DC grid side converter with single AC current sensor

    Indian Academy of Sciences (India)

    Conventionally, two AC side current sensors are needed in vector control of grid side converter for AC–DC bidirectional power conversion. The present paper proposes a technique where the control can be achieved with the use of only one AC side current sensor. The control principle utilises the information of ...

  2. Recovery of consciousness in broilers following combined dc and ac stunning

    Science.gov (United States)

    Broilers in the United States are typically electrically stunned using low voltage-high frequency pulsed DC water bath stunners and in the European Union broilers are electrocuted using high voltage-low frequency AC. DC stunned broilers regain consciousness in the absence of exsanguination and AC st...

  3. The HST/ACS Coma Cluster Survey : II. Data Description and Source Catalogs

    NARCIS (Netherlands)

    Hammer, Derek; Kleijn, Gijs Verdoes; Hoyos, Carlos; den Brok, Mark; Balcells, Marc; Ferguson, Henry C.; Goudfrooij, Paul; Carter, David; Guzman, Rafael; Peletier, Reynier F.; Smith, Russell J.; Graham, Alister W.; Trentham, Neil; Peng, Eric; Puzia, Thomas H.; Lucey, John R.; Jogee, Shardha; Aguerri, Alfonso L.; Batcheldor, Dan; Bridges, Terry J.; Chiboucas, Kristin; Davies, Jonathan I.; del Burgo, Carlos; Erwin, Peter; Hornschemeier, Ann; Hudson, Michael J.; Huxor, Avon; Jenkins, Leigh; Karick, Arna; Khosroshahi, Habib; Kourkchi, Ehsan; Komiyama, Yutaka; Lotz, Jennifer; Marzke, Ronald O.; Marinova, Irina; Matkovic, Ana; Merritt, David; Miller, Bryan W.; Miller, Neal A.; Mobasher, Bahram; Mouhcine, Mustapha; Okamura, Sadanori; Percival, Sue; Phillipps, Steven; Poggianti, Bianca M.; Price, James; Sharples, Ray M.; Tully, R. Brent; Valentijn, Edwin

    The Coma cluster, Abell 1656, was the target of an HST-ACS Treasury program designed for deep imaging in the F475W and F814W passbands. Although our survey was interrupted by the ACS instrument failure in early 2007, the partially completed survey still covers ~50% of the core high-density region in

  4. ACCE/ACS National Educator and Leader of the Year Winners: AEC Congratulates These Outstanding Educators

    Science.gov (United States)

    Australian Educational Computing, 2012

    2012-01-01

    This article presents the ACCE/ACS National Educator and Leader of the Year winners. Anne Mirtschin is the recipient of the ACCE/ACS 2012 Educator of the Year Award. Mirtschin is an innovative teacher at Hawkesdale P-12 College a small rural school that is isolated culturally and geographically. She uses online tools and technology to create…

  5. Application of Cry1Ab/Ac Bt strip for screening of resistance for ...

    African Journals Online (AJOL)

    In this study, the efficacy of using Cry1Ab/Ac Bt strip for detecting Maruca resistant transgene in transgenic cowpea was systematically investigated for the first time through field derived progenies. The results show ... Keywords: Bacillus thuriengiensis, Cry1Ab/Ac Bt strips, transgenic cowpea, Maruca vitrata. African Journal of ...

  6. Nuclear Structure Effects in the Exotic Decay of $^{225}$Ac via $^{14}$C Emission

    CERN Multimedia

    2002-01-01

    % IS323 \\\\ \\\\ We propose to build at Isolde a high intensity $^{225}$Ac source by $\\beta$-decay of $^{225}$(Ra+Fr) beam, to be used at the superconducting spectrometer SOLENO of IPN-Orsay in order to study a possible fine structure in the spectrum of $^{14}$C ions spontaneously emitted by $^{225}$Ac.

  7. Low frequency ac conduction and dielectric relaxation in poly(N ...

    Indian Academy of Sciences (India)

    The ac conductivity and dielectric constant of poly(N-methyl pyrrole) thin films have been investigated in the temperature range 77–350 K and in the frequency range 102–106 Hz. The well defined loss peaks have been observed in the temperature region where measured ac conductivity approaches dc conductivity.

  8. Qualitative and Quantitative Coronary Angiography in patients with Acute Coronary Syndrome (ACS

    Directory of Open Access Journals (Sweden)

    Ahmed H.H. El-Adawey

    2012-07-01

    Conclusion: The qualitative angiographic assessment represents an essential tool in the evaluation and risk stratification of patients with ACS, through the demonstration of the presence of thrombus and lumen irregularity that correlated more with ACS than the other studded criteria. In addition, QCA although added accurate assessment of the degree of luminal narrowing, thus helping in assessment of the severity of the disease.

  9. Reducing AC-Winding Losses in High-Current High-Power Inductors

    DEFF Research Database (Denmark)

    Nymand, Morten; Madawala, Udaya K.; Andersen, Michael Andreas E.

    2009-01-01

    Foil windings are preferable in high-current high-power inductors to realize compact designs and to reduce dc-current losses. At high frequency, however, proximity effect will cause very significant increase in ac resistance in multi-layer windings, and lead to high ac winding losses. This paper ...

  10. A dual-stage pwm dc to ac inverter with reduced harmonic distorsion ...

    African Journals Online (AJOL)

    In conventional pulse width modulated full bridge dc to ac inverters, all power devices are switched at high frequency and are consequently subject to significant power losses. This paper presents a modified dc to ac inverter topology where the high frequency switching is performed by a single device in a pre-converter ...

  11. Electrocardiographic left ventricular hypertrophy in GUSTO IV ACS: an important risk marker of mortality in women

    DEFF Research Database (Denmark)

    Westerhout, Cynthia M; Lauer, Michael S; Fu, Yuling

    2007-01-01

    AIM: To examine the association of left ventricular hypertrophy (LVH) on admission electrocardiography with adverse outcomes in acute coronary syndrome (ACS) patients. METHODS AND RESULTS: A total of 7443 non-ST-elevation ACS patients in Global Utilization of STrategies to Open occluded arteries ...

  12. Vector control of three-phase AC/DC front-end converter

    Indian Academy of Sciences (India)

    Ac-dc conversion; controlled rectification; power factor correction;. PWM converter; synchronous reference frame control; vector control. 1. Introduction. A three-phase AC to DC converter is an essential part of many power electronic systems such as uninterruptible power supplies (UPS), battery chargers and motor drives.

  13. Measuring ac-loss in high temperature superconducting cable-conductors using four probe methods

    DEFF Research Database (Denmark)

    Kühle (fratrådt), Anders Van Der Aa; Træholt, Chresten; Olsen, Søren Krüger

    1999-01-01

    Measuring the ac-loss of superconducting cable conductors have many aspects in common with measuring the ac-loss of single superconducting tapes. In a cable conductor all tapes are connected to each other and to the test circuit through normal metal joints in each end. This makes such measurement...

  14. Radio emission from the nova-like variable AC Cancri and the symbiotic variable AG Draconis

    International Nuclear Information System (INIS)

    Torbett, M.V.; Campbell, B.; Mount Wilson and Las Campanas Observatories, Pasadena, CA)

    1987-01-01

    Radio emission at 6 cm has been detected from the nova-like cataclysmic variable AC Cnc and the symbiotic variable AG Dra. The AC Cnc observation constitutes the first radio detection in this class of objects. The AG Dra source is probably resolved and appears to show asymmetric, extended structure. The radio emission can best be explained by thermal bremsstrahlung. 26 references

  15. Vector control of three-phase AC machines system development in the practice

    CERN Document Server

    Quang, Nguyen Phung

    2008-01-01

    Covers the area of vector control of 3-phase AC machines, in particular induction motors with squirrel-cage rotor, permanent excited synchronous motors and doubly-fed induction machines. This title summarizes the basic structure of a field-oriented controlled 3-phase AC drive and grid voltage orientated controlled wind power plant.

  16. Antifibrotic effect of Ac-SDKP and angiotensin-converting enzyme inhibition in hypertension

    NARCIS (Netherlands)

    Rasoul, S; Carretero, OA; Peng, HM; Cavasin, MA; Zhuo, JL; Sanchez-Mendoza, A; Brigstock, DR; Rhaleb, NE

    Objective N-acetyl-seryl-aspartyl-lysyl-proline (Ac-SDKP) is a potent natural inhibitor of hematopoietic stem cell proliferation which is degraded mainly by angiotensin-converting enzyme (ACE). In vitro, Ac-SDKP inhibits collagen production by cardiac fibroblasts; while in vivo it blocks collagen

  17. Cloning and characterization of a salt responsive gene AcPsbQ1 from Atriplex canescens.

    Science.gov (United States)

    Xinhua, Sun; Pan, Jia; Jichao, Zhang; Hongyu, Pan

    2015-01-01

    PsbQ is an extrinsic subunit of the photosystem II in eukaryotic photosynthetic organisms. Numerous studies have demonstrated that PsbQ can stabilize the inorganic cofactors and enhance the oxygen release in PSII. The decrease of photosynthesis rate under salinity condition is normally attributed to the high concentration of injurious ions, such as Na(+) and Cl(-), which accumulate in the chloroplast and damage thylakoid membrane under salinity stress. In this study, AcPsbQ1 was isolated from a halophyte Atriplex canescens cDNA library. The AcPsbQ1 contains an open reading frame of 699 bp encoding a 233 amino acid protein. In order to investigate its function, AcPsbQ1 was cloned and transformed into Saccharomyces cerevisiae INVSc1. The heterologous expression of AcPsbQ1 in transgenic yeast significantly helped to increase the adapting and recovery ability of yeast cells under the salt and drought. Quantitative real-time PCR assay was performed to reveal the expression pattern of AcPsbQ1 under different abiotic stresses. On exposure to NaCl stress, the transcript level of AcPsbQ1 was significantly enhanced. AcPsbQ1 expression level was also up-regulated under drought stress. These results indicated that AcPsbQ1 might involve in the response to salt stress in A. canescens.

  18. Red Sesbania Distribution - lines [ds81

    Data.gov (United States)

    California Natural Resource Agency — This layer conatains line data for the red sesbania (Sesbania punicea) database. The database represents historic and current observations by various individuals of...

  19. Antibacterial Compounds from Red Seaweeds (Rhodophyta

    Directory of Open Access Journals (Sweden)

    Noer Kasanah

    2015-07-01

    Full Text Available Seaweeds produce great variety of metabolites benefit for human. Red seaweeds (Rhodophyta are well known as producer of phycocolloids such agar, agarose, carragenan and great variety of secondary metabolites. This review discusses the red algal secondary metabolites with antibacterial activity. The chemical constituents of red algae are steroid, terpenoid, acetogenin and dominated by halogenated compounds mainly brominated compounds. Novel compounds with intriguing skeleton are also reported such as bromophycolides and neurymenolides. In summary, red seaweeds are potential sources for antibacterial agents and can serve as lead in synthesis of new natural medicines.

  20. Red Sesbania Distribution - points [ds80

    Data.gov (United States)

    California Natural Resource Agency — This layer contains point data for the red sesbania (Sesbania punicea) database. The database represents historic and current observations by various individuals of...

  1. AC Electric Field Activated Shape Memory Polymer Composite

    Science.gov (United States)

    Kang, Jin Ho; Siochi, Emilie J.; Penner, Ronald K.; Turner, Travis L.

    2011-01-01

    Shape memory materials have drawn interest for applications like intelligent medical devices, deployable space structures and morphing structures. Compared to other shape memory materials like shape memory alloys (SMAs) or shape memory ceramics (SMCs), shape memory polymers (SMPs) have high elastic deformation that is amenable to tailored of mechanical properties, have lower density, and are easily processed. However, SMPs have low recovery stress and long response times. A new shape memory thermosetting polymer nanocomposite (LaRC-SMPC) was synthesized with conductive fillers to enhance its thermo-mechanical characteristics. A new composition of shape memory thermosetting polymer nanocomposite (LaRC-SMPC) was synthesized with conductive functionalized graphene sheets (FGS) to enhance its thermo-mechanical characteristics. The elastic modulus of LaRC-SMPC is approximately 2.7 GPa at room temperature and 4.3 MPa above its glass transition temperature. Conductive FGSs-doped LaRC-SMPC exhibited higher conductivity compared to pristine LaRC SMP. Applying an electric field at between 0.1 Hz and 1 kHz induced faster heating to activate the LaRC-SMPC s shape memory effect relative to applying DC electric field or AC electric field at frequencies exceeding1 kHz.

  2. Cosmic Shear With ACS Pure Parallels. Targeted Portion.

    Science.gov (United States)

    Rhodes, Jason

    2002-07-01

    Small distortions in the shapes of background galaxies by foreground mass provide a powerful method of directly measuring the amount and distribution of dark matter. Several groups have recently detected this weak lensing by large-scale structure, also called cosmic shear. The high resolution and sensitivity of HST/ACS provide a unique opportunity to measure cosmic shear accurately on small scales. Using 260 parallel orbits in Sloan i {F775W} we will measure for the first time: the cosmic shear variance on scales Omega_m^0.5, with signal-to-noise {s/n} 20, and the mass density Omega_m with s/n=4. They will be done at small angular scales where non-linear effects dominate the power spectrum, providing a test of the gravitational instability paradigm for structure formation. Measurements on these scales are not possible from the ground, because of the systematic effects induced by PSF smearing from seeing. Having many independent lines of sight reduces the uncertainty due to cosmic variance, making parallel observations ideal.

  3. Two-Gyro Pointing Stability of HST measured with ACS

    Science.gov (United States)

    Koekemoer, Anton M.; Kozhurina-Platais, Vera; Riess, Adam; Sirianni, Marco; Biretta, John; Pavlovsky

    2005-06-01

    We present the results of the pointing stability tests for HST, as measured with the ACS/ HRC during the Two-Gyro test program conducted in February 2005. We measure the shifts of 185 exposures of the globular clusters NGC6341 and Omega Centauri, obtained over a total of 13 orbits, and compare the measured pointings to those that were commanded in the observing program. We find in all cases that the measured shifts and rotations have the same level of accuracy as those that were commanded in three-gyro mode. Specifically, the pointing offsets during an orbit relative to the first exposure can be characterized with distributions having a dispersion of 2.3 milliarcseconds for shifts and 0.00097 degrees for rotations, thus less than 0.1 HRC pixels, and agree extremely well with similar values measured for comparable exposures obtained in three-gyro mode. In addition, we successfully processed these two-gyro test data through the MultiDrizzle software which is used in the HST pipeline to perform automated registration, cosmic ray rejection and image combination for multiple exposure sequences, and we find excellent agreement with similar exposures obtained in three-gyro mode. In summary, we find no significant difference between the quality of HST pointing as measured from these two-gyro test data, relative to the nominal behavior of HST in regular three-gyro operations.

  4. Microfabricated Thin Film Impedance Sensor & AC Impedance Measurements

    Science.gov (United States)

    Yu, Jinsong; Liu, Chung-Chiun

    2010-01-01

    Thin film microfabrication technique was employed to fabricate a platinum based parallel-electrode structured impedance sensor. Electrochemical impedance spectroscopy (EIS) and equivalent circuit analysis of the small amplitude (±5 mV) AC impedance measurements (frequency range: 1 MHz to 0.1 Hz) at ambient temperature were carried out. Testing media include 0.001 M, 0.01 M, 0.1 M NaCl and KCl solutions, and alumina (∼3 μm) and sand (∼300 μm) particulate layers saturated with NaCl solutions with the thicknesses ranging from 0.6 mm to 8 mm in a testing cell, and the results were used to assess the effect of the thickness of the particulate layer on the conductivity of the testing solution. The calculated resistances were approximately around 20 MΩ, 4 MΩ, and 0.5 MΩ for 0.001 M, 0.01 M, and 0.1 M NaCl solutions, respectively. The presence of the sand particulates increased the impedance dramatically (6 times and 3 times for 0.001 M and 0.1 M NaCl solutions, respectively). A cell constant methodology was also developed to assess the measurement of the bulk conductivity of the electrolyte solution. The cell constant ranged from 1.2 to 0.8 and it decreased with the increase of the solution thickness. PMID:22219690

  5. Particle Agglomeration in Bipolar Barb Agglomerator Under AC Electric Field

    International Nuclear Information System (INIS)

    Huang Chao; Ma Xiuqin; Sun Youshan; Wang Meiyan; Zhang Changping; Lou Yueya

    2015-01-01

    The development of an efficient technology for removing fine particles in flue gas is essential as the haze is becoming more and more serious. To improve agglomeration effectiveness of fine particles, a dual zone electric agglomeration device consisting of a charging chamber and an agglomeration chamber with bipolar barb electrodes was developed. The bipolar barb electric agglomerator with a polar distance of 200 mm demonstrates good agglomeration effectiveness for particles with a size less than 8.0 μm under applied AC electric field. An optimal condition for achieving better agglomeration effectiveness was found to be as follows: flue gas flow velocity of 3.00 m/s, particle concentration of 2.00 g/m 3 , output voltage of 35 kV and length of the barb of 16 mm. In addition, 4.0–6.0 μm particles have the best effectiveness with the variation of particle volume occupancy of −3.2. (paper)

  6. Spin-transfer effect with an AC current

    Science.gov (United States)

    Jones, B. A.; Bazaliy, Ya. B.

    2003-03-01

    Current-induced switching based on the spin-transfer effect was so far investigated with a DC current or with current pulses [1-5]. We solve the modified Landau-Lifshits equations in the presence of an AC current in order to see which configurations can be stabilized in this situation. 1. M. Tsoi et al., PRL, 80, 4281 (1998); Nature, 406, 46 (2000);PRL, 89, 246803 (2002) 2. J.-E. Wegrowe et al., Europhys.Lett., 45, 626 (1999); PRB, 62, 1141 (2000); J.Appl.Phys., 91, 6806 (2002) 3. E.B. Myers et al., Science, 285, 867 (1999); J.A. Katine et al., PRL, 84, 3149 (2000); F. J. Albert et al., Appl.Phys.Lett., 77, 3809 (2000); PRL, 89, 226802 (2002) 4. J.Z. Sun et al., J.Magn.Magn.Mater., 202, 157 (1999); Appl.Phys.Lett., 81, 2202 (2002) 5. J. Grollier et al., Appl.Phys.Lett., 78, 3663 (2001)

  7. Insulation coordination workstation for AC and DC substations

    International Nuclear Information System (INIS)

    Booth, R.R.; Hileman, A.R.

    1990-01-01

    The Insulation Coordination Workstation was designed to aid the substation design engineer in the insulation coordination process. The workstation utilizes state of the art computer technology to present a set of tools necessary for substation insulation coordination, and to support the decision making process for all aspects of insulation coordination. The workstation is currently being developed for personal computers supporting OS/2 Presentation Manager. Modern Computer-Aided Software Engineering (CASE) technology was utilized to create an easily expandable framework which currently consists of four modules, each accessing a central application database. The heart of the workstation is a library of user-friendly application programs for the calculation of important voltage stresses used for the evaluation of insulation coordination. The Oneline Diagram is a graphic interface for data entry into the EPRI distributed EMTP program, which allows the creation of complex systems on the CRT screen using simple mouse clicks and keyboard entries. Station shielding is graphically represented in the Geographic Viewport using a three-dimensional substation model, and the interactive plotting package allows plotting of EPRI EMTP output results on the CRT screen, printer, or pen plotter. The Insulation Coordination Workstation was designed by Advanced Systems Technology (AST), a division of ABB Power Systems, Inc., and sponsored by the Electric Power Research Institute under RP 2323-5, AC/DC Insulation Coordination Workstation

  8. Fuzzy Controlled Parallel AC-DC Converter for PFC

    Directory of Open Access Journals (Sweden)

    M Subba Rao

    2011-01-01

    Full Text Available Paralleling of converter modules is a well-known technique that is often used in medium-power applications to achieve the desired output power by using smaller size of high frequency transformers and inductors. In this paper, a parallel-connected single-phase PFC topology using flyback and forward converters is proposed to improve the output voltage regulation with simultaneous input power factor correction (PFC and control. The goal of the control is to stabilize the output voltage of the converter against the load variations. The paper presents the derivation of fuzzy control rules for the dc/dc converter circuit and control algorithm for regulating the dc/dc converter. This paper presents a design example and circuit analysis for 200 W power supply. The proposed approach offers cost effective, compact and efficient AC/DC converter by the use of parallel power processing. MATLAB/SIMULINK is used for implementation and simulation results show the performance improvement.

  9. Effect of Water on Cellulose - EMIM Ac - DMSO Solution

    Science.gov (United States)

    Zhang, Xin; Mao, Yimin; Henderson, Doug; Briber, R. M.; Wang, Howard

    Mixtures of ionic liquids (IL) and polar aprotic solvents are found to be effective for dissolving cellulose to form a molecular solution. Cellulose is naturally hygroscopic and water is generally detrimental to the processing of cellulose using ionic liquids. It is important to understand the role of water in the dissolution and processing of cellulose. The effect of water on the dissolution process of cellulose in the solvent mixture - DMSO - 1-Ethyl-3-methylimidazolium acetate (EMIM Ac) has been examined by polarized microscopy, small angle neutron scattering (SANS), small angle X-ray scattering (SAXS) and cloud point measurements. It was found that the presence of small amounts of water led to clustering of cellulose that could be disrupted by increasing temperature. However at high cellulose concentration, addition of water can facilitate the formation clear solutions and gels. Liquid crystalline behavior was observed in solutions with 1%wt of water and 20 %wt of cellulose. A structural repeat distance around 1.2 nm has been observed by SAXS, presumably from the alignment of cellulose chains. Phase diagrams of the solutions will also be presented.

  10. Universal features of particle motion in ac electric fields

    Science.gov (United States)

    Niemeyer, L.; Seeger, M.

    2015-11-01

    Mobile particles present as contaminants in high voltage gas insulated switchgear (GIS) may constitute a risk for insulation failure. The understanding of their motion in the electric field of the insulation gap is therefore essential for quality control in manufacturing, commissioning and in service monitoring. Published research on particle motion in ac electric fields has shown that this rather complex process depends on numerous parameters, many of which remain unknown under practical conditions. This renders modelling, generalization of experimental data and practical application difficult. The scope of this paper therefore is to develop a unified description of particle motion which minimizes the number of controlling parameters, enables the comparison of experimental data and allows simple interpretation relations to be derived. This is achieved by making the controlling equations dimensionless with an appropriate choice of reference values and by using simplifying assumptions for the specific conditions prevailing in GIS. The resulting generalized description of the process can then be summarized in the form of 2D patterns (dynamic maps). Approximate scaling relations are derived between specific features of these patterns and particle-related parameters. A reference case is discussed in detail. The non-linear character of the equation of motion suggests that the particle motion may be a deterministic process with chaotic features. This is confirmed by a preliminary chaos-theoretical analysis of the process.

  11. Efficient relaxations for joint chance constrained AC optimal power flow

    Energy Technology Data Exchange (ETDEWEB)

    Baker, Kyri; Toomey, Bridget

    2017-07-01

    Evolving power systems with increasing levels of stochasticity call for a need to solve optimal power flow problems with large quantities of random variables. Weather forecasts, electricity prices, and shifting load patterns introduce higher levels of uncertainty and can yield optimization problems that are difficult to solve in an efficient manner. Solution methods for single chance constraints in optimal power flow problems have been considered in the literature, ensuring single constraints are satisfied with a prescribed probability; however, joint chance constraints, ensuring multiple constraints are simultaneously satisfied, have predominantly been solved via scenario-based approaches or by utilizing Boole's inequality as an upper bound. In this paper, joint chance constraints are used to solve an AC optimal power flow problem while preventing overvoltages in distribution grids under high penetrations of photovoltaic systems. A tighter version of Boole's inequality is derived and used to provide a new upper bound on the joint chance constraint, and simulation results are shown demonstrating the benefit of the proposed upper bound. The new framework allows for a less conservative and more computationally efficient solution to considering joint chance constraints, specifically regarding preventing overvoltages.

  12. Low Cost Fabrication of 2G Wires for AC Applications

    Energy Technology Data Exchange (ETDEWEB)

    Kodenkandath, T.; List, F.A., III

    2005-09-15

    Ink-jet printing has been demonstrated as an adaptable technology for printing YBCO filaments using a Metal Organic (MO) YBCO precursor. The technology was demonstrated using AMSC's proprietary metal organic TFA-based YBCO precursor and a commercial piezoelectric print-head on RABiTS templates. Filaments with a width of 100 um and spacing of 200 um were successfully printed, decomposed and processed to YBCO. Critical currents of {approx} 200 A/cm-w were achieved in a series of filaments with a 2 mm width. The single nozzle laboratory printer used in the Phase 1 program is capable of printing {approx} 100 um wide single filaments at a rate of 8-10 cm/sec. The electrical stabilization of filaments with a Ag ink was also evaluated using ink-jet printing. The overall objective of the Phase 1 Project was the evaluation and demonstration of inkjet-printing for depositing YBCO filaments on textured templates (RABiTS, IBAD, ISD, etc. substrates) with properties appropriate for low loss ac conductors. Goals of the Phase 1 program included development of an appropriate precursor ink, demonstration of the printing process, processing and characterization of printed YBCO filaments and evaluation of the process for further development.

  13. Influence of compression forces on tablets disintegration by AC Biosusceptometry.

    Science.gov (United States)

    Corá, Luciana A; Fonseca, Paulo R; Américo, Madileine F; Oliveira, Ricardo B; Baffa, Oswaldo; Miranda, José Ricardo A

    2008-05-01

    Analysis of physical phenomena that occurs during tablet disintegration has been studied by several experimental approaches; however none of them satisfactorily describe this process. The aim of this study was to investigate the influence of compression force on the tablets by associating the AC Biosusceptometry with consolidated methods in order to validate the biomagnetic technique as a tool for quality control in pharmaceutical processes. Tablets obtained at five compression levels were submitted to mechanical properties tests. For uncoated tablets, water uptake and disintegration force measurements were performed in order to compare with magnetic data. For coated tablets, magnetic measurements were carried out to establish a relationship between physical parameters of the disintegration process. According to the results, differences between the compression levels were found for water uptake, force development and magnetic area variation measurements. ACB method was able to estimate the disintegration properties as well as the kinetics of disintegration process for uncoated and coated tablets. This study provided a new approach for in vitro investigation and validated this biomagnetic technique as a tool for quality control for pharmaceutical industry. Moreover, using ACB will also be possible to test these parameters in humans allowing to establish an in vitro/in vivo correlation (IVIVC).

  14. Inhibition of acrolein-stimulated MUC5AC production by fucoidan in human bronchial epithelial cells.

    Science.gov (United States)

    Pokharel, Yuba Raj; Yoon, Se Young; Kim, Sang Kyum; Li, Jian-Dong; Kang, Keon Wook

    2008-10-01

    Fucoidan, a marine sulfated polysaccharide has both antithrombotic and anti-inflammatory effects. We determined the effect of fucoidan on MUC5AC expression in a human bronchial epithelial cell line, NCI-H292. Reverse transcription-polymerase chain reaction (RT-PCR) analysis showed that fucoidan inhibited MUC5AC expression and protein secretion in cells stimulated with acrolein, a toxic aldehyde present in tobacco smoke. The activation of both nuclear factor-kappa B (NF-kappa B) and activator protein 1 (AP-1) are key steps in the transcriptional activation of MUC5AC. We found that the acrolein-mediated transactivation of MUC5AC was selectively dependent on AP-1 activation and was suppressed by fucoidan. Fucoidan-induced AP-1 inhibition and MUC5AC repression might be associated with fucoidan's protective effects against respiratory diseases.

  15. Reducing AC-Winding Losses in High-Current High-Power Inductors

    DEFF Research Database (Denmark)

    Nymand, Morten; Madawala, Udaya K.; Andersen, Michael Andreas E.

    2009-01-01

    Foil windings are preferable in high-current high-power inductors to realize compact designs and to reduce dc-current losses. At high frequency, however, proximity effect will cause very significant increase in ac resistance in multi-layer windings, and lead to high ac winding losses. This paper...... designed with low ac resistance and leakage inductance to carry the ac current while the outer winding is designed for the large dc current. Detailed analysis and design of a 350 A, 10 kW inductor with the proposed technique are presented with discussions. Experimental results of a prototype 350 A inductor...... presents design, analysis and experimental verification of a two winding technique, which significantly reduces ac winding losses without compromising dc losses. The technique uses an inner auxiliary winding, which is connected in parallel with an outer main winding. The auxiliary winding is optimally...

  16. High-frequency AC electrospray ionization source for mass spectrometry of biomolecules.

    Science.gov (United States)

    Chetwani, Nishant; Cassou, Catherine A; Go, David B; Chang, Hsueh-Chia

    2010-11-01

    A novel high-frequency alternating current (AC) electrospray ionization (ESI) source has been developed for applications in mass spectrometry. The AC ESI source operates in a conical meniscus mode, analogous to the cone-jet mode of direct current (DC) electrosprays but with significant physical and mechanistic differences. In this stable conical-meniscus mode at frequencies greater than 50 kHz, the low mobility ions, which can either be cations or anions, are entrained within the liquid cone and ejected as droplets that eventually form molecular ions, thus making AC ESI a viable tool for both negative and positive mode mass spectrometry. The performance of the AC ESI source is qualitatively shown to be frequency-dependent and, for larger bio-molecules, the AC ESI source produced an ion signal intensity that is an order of magnitude higher than its DC counterpart. Copyright © 2010. Published by Elsevier Inc.

  17. Application of a flow generated by IR laser and AC electric field in micropumping and micromixing

    International Nuclear Information System (INIS)

    Nakano, M; Mizuno, A

    2008-01-01

    In this paper, it is described that measurement of fluid flow generated by simultaneous operation of an infrared (IR) laser and AC electric field in a microfabricated channel. When an IR laser (1026 nm) was focused under an intense AC electric field, a circulating flow was generated around the laser focus. The IR laser and the electric field generate two flow patterns of the electrohydrodynamicss. When the laser focus is placed at the center of the gap between electrodes, the flow pattern is parallel to the AC electric field toward electrodes from the centre. On the other hand, when the laser focus is placed close to one of the electrodes, one directional flow is generated. First flow pattern can be used as a micromixer and the second one as a micropump. Flow velocity profiles of the two flow patterns were measured as a function of the laser power, intensity of the AC electric field and AC frequency.

  18. pH sensing via bicarbonate-regulated ‘soluble’ adenylyl cyclase (sAC

    Directory of Open Access Journals (Sweden)

    Nawreen eRahman

    2013-11-01

    Full Text Available Soluble adenylyl cyclase (sAC is a source of the second messenger cyclic adenosine 3',5' monophosphate (cAMP. sAC is directly regulated by bicarbonate (HCO3- ions. In living cells, HCO3- ions are in nearly instantaneous equilibrium with carbon dioxide (CO2 and pH due to the ubiquitous presence of carbonic anhydrases. Numerous biological processes are regulated by CO2, HCO3-, and/or pH, and in a number of these, sAC has been shown to function as a physiological CO2/HCO3/pH sensor. In this review, we detail the known pH sensing functions of sAC, and we discuss two highly-studied, pH-dependent pathways in which sAC might play a role.

  19. The effect of ac magnetic fields on the lifting power of levitating superconductors

    International Nuclear Information System (INIS)

    Smolyak, B M; Ermakov, G V; Chubraeva, L I

    2007-01-01

    This study deals with the decrease in the levitation force under the action of an ac field up to the frequency at which oscillations of the superconducting suspension are limited by inertia. The lifting force was measured as a function of the ac field amplitude and the exposure time. It was shown that the force quickly decreased at the moment the ac field was applied and then continued diminishing, but at a lower rate. A qualitative model was proposed, taking into account two effects of the ac field on the magnetization of the levitating superconductor: a complete destruction of the critical state in some section of the superconductor (to a depth λ ac ) and the initiation of a faster magnetic relaxation in the region where the induction gradient is preserved

  20. AC loss properties of MgB{sub 2} multifilament wires

    Energy Technology Data Exchange (ETDEWEB)

    Tanaka, Kazuhide; Funaki, Kazuo; Sueyoshi, Takahiro; Sasashige, Yushi; Kajikawa, Kazuhiro; Iwakuma, Masataka [Kyushu University Graduate School of Information Science and Electrical Engineering, 744 Moto-oka, Nishi-ku, Fukuoka 819-0395 (Japan); Okada, Michiya [HRL Hitachi, Ltd, 7-1-1 Oomika, Hitachi 319-1292 (Japan); Kumakura, Hiroaki [National Institute for Materials Science, 1-2-1 Sengen, Tsukuba 305-0047 (Japan); Hayashi, Hidemi [Kyushu Electric Power Co., Incorporated, 2-1-47 Shiobaru, Minami-ku, Fukuoka 815-8520 (Japan)], E-mail: kazuhide.tanaka.je@hitachi.com

    2008-09-15

    We designed and fabricated two types of composite wires with 6 MgB{sub 2} filaments. One is a Cu-sheathed Nb-barrier wire and the other is a CuNi-sheathed Ta-barrier wire. The transverse-field losses of the trial wires were measured with a standardized pickup coil system in liquid helium. We evaluated the observed AC losses using two structural models, a multifilament conductor model and a hollow-cylindrical one. For the CuNi-sheathed Ta-barrier wire, the AC loss property can be explained by the usual model of multifilament conductors. Further reductions in AC loss can be expected by making the filaments thinner. For the Cu-sheathed Nb-barrier wire, theoretical considerations suggest the multifilament structure behaves as a hollow-cylindrical superconductor in the AC loss property. Thus, we need to pay particular attention to designing the barrier material for reduction in the AC loss.

  1. Distributed Control for Autonomous Operation of a Three-Port AC/DC/DS Hybrid Microgrid

    DEFF Research Database (Denmark)

    Wang, Peng; Jin, Chi; Zhu, Dexuan

    2015-01-01

    This paper presents a distributed control scheme for reliable autonomous operation of a hybrid three-port ac/dc/distributed storage (ds) microgrid by means of power sharing in individual network, power exchange between ac and dc networks, and power management among three networks. The proposed...... distributed control scheme includes: 1) a fully decentralized control, which is achieved by local power sharing (LPS) in individual ac or dc network, global power sharing (GPS) throughout ac/dc networks, and storage power sharing (SPS) among distributed storages. Upon fully decentralized control, each power...... ac/dc networks and operations of DS units with the benefit of reducing power exchange losses and prolonging storage lifetime. The proposed distributed control strategy has been verified by the simulation and experimental results....

  2. Characterization of light absorption by chromophoric dissolved organic matter (CDOM) in the upper layer of the Red Sea

    Science.gov (United States)

    Kheireddine, Malika; Ouhssain, Mustapha; Calleja, Maria Ll.; Morán, Xosé Anxelu G.; Sarma, Y. V. B.; Tiwari, Surya P.; Jones, Burton H.

    2018-03-01

    The absorption coefficient of chromophoric dissolved organic matter (CDOM) is a major variable used in developing robust bio-optical models and understanding biogeochemical processes. Over the last decade, the optical properties of CDOM in the open sea have been intensely studied. However, their variations in clear water are poorly documented, particularly in the Red Sea, owing to the absence of in situ measurements. We performed several cruises in the Red Sea to investigate the spatial distribution of the absorption coefficient of CDOM. The spectral absorption coefficients were determined from 400 nm to 740 nm using a WETLabs ac-s hyper-spectral spectrophotometer. In general, we found a latitudinal gradient in the CDOM absorption coefficient at 443 nm (aCDOM(443)) from south to north that is likely influenced by the exchange of water through the strait of Bab-el-Mandeb and the thermohaline circulation of the Red Sea. However, high aCDOM(443) values were observed in the northern Red Sea due to the existence of a sub-mesoscale feature that may induce an increase in phytoplankton production and lead to CDOM production. The aCDOM(443) covaried with the chlorophyll a concentration ([Chl a],) despite a high scatter. Furthermore, the aCDOM(443) for a given [Chl a] concentration was higher than those predicted by global ocean bio-optical models. This study advances our understanding of CDOM concentration in the Red Sea and may help improve the accuracy of the algorithms used to obtain CDOM absorption from ocean color.

  3. Characterization of light absorption by chromophoric dissolved organic matter (CDOM) in the upper layer of the Red Sea

    KAUST Repository

    Kheireddine, Malika

    2018-02-07

    The absorption coefficient of chromophoric dissolved organic matter (CDOM) is a major variable used in developing robust bio‐optical models and understanding biogeochemical processes. Over the last decade, the optical properties of CDOM in the open sea have been intensely studied. However, their variations in clear water are poorly documented, particularly in the Red Sea, owing to the absence of in situ measurements. We performed several cruises in the Red Sea to investigate the spatial distribution of the absorption coefficient of CDOM. The spectral absorption coefficients were determined from 400nm to 740nm using a WETLabs ac-s hyper-spectral spectrophotometer. In general, we found a latitudinal gradient in the CDOM absorption coefficient at 443nm (aCDOM(443)) from south to north that is likely influenced by the exchange of water through the strait of Bab-el-Mandeb and the thermohaline circulation of the Red Sea. However, high aCDOM(443) values were observed in the northern Red Sea due to the existence of a sub-mesoscale feature that may induce an increase in phytoplankton production and lead to CDOM production. The aCDOM(443) covaried with the chlorophyll a concentration ([Chl a],) despite a high scatter. Furthermore, the aCDOM(443) for a given [Chl a] concentration was higher than those predicted by global ocean bio-optical models. This study advances our understanding of CDOM concentration in the Red Sea and may help improve the accuracy of the algorithms used to obtain CDOM absorption from ocean color.

  4. HOMOGENEOUS UGRIZ PHOTOMETRY FOR ACS VIRGO CLUSTER SURVEY GALAXIES: A NON-PARAMETRIC ANALYSIS FROM SDSS IMAGING

    International Nuclear Information System (INIS)

    Chen, Chin-Wei; Cote, Patrick; Ferrarese, Laura; West, Andrew A.; Peng, Eric W.

    2010-01-01

    We present photometric and structural parameters for 100 ACS Virgo Cluster Survey (ACSVCS) galaxies based on homogeneous, multi-wavelength (ugriz), wide-field SDSS (DR5) imaging. These early-type galaxies, which trace out the red sequence in the Virgo Cluster, span a factor of nearly ∼10 3 in g-band luminosity. We describe an automated pipeline that generates background-subtracted mosaic images, masks field sources and measures mean shapes, total magnitudes, effective radii, and effective surface brightnesses using a model-independent approach. A parametric analysis of the surface brightness profiles is also carried out to obtain Sersic-based structural parameters and mean galaxy colors. We compare the galaxy parameters to those in the literature, including those from the ACSVCS, finding good agreement in most cases, although the sizes of the brightest, and most extended, galaxies are found to be most uncertain and model dependent. Our photometry provides an external measurement of the random errors on total magnitudes from the widely used Virgo Cluster Catalog, which we estimate to be σ(B T )∼ 0.13 mag for the brightest galaxies, rising to ∼ 0.3 mag for galaxies at the faint end of our sample (B T ∼ 16). The distribution of axial ratios of low-mass ( d warf ) galaxies bears a strong resemblance to the one observed for the higher-mass ( g iant ) galaxies. The global structural parameters for the full galaxy sample-profile shape, effective radius, and mean surface brightness-are found to vary smoothly and systematically as a function of luminosity, with unmistakable evidence for changes in structural homology along the red sequence. As noted in previous studies, the ugriz galaxy colors show a nonlinear but smooth variation over a ∼7 mag range in absolute magnitude, with an enhanced scatter for the faintest systems that is likely the signature of their more diverse star formation histories.

  5. The effect of a red leaf pigment on the relationship between red edge and chlorophyll concentration

    Science.gov (United States)

    Curran, Paul J.; Dungan, Jennifer L.; Macler, Bruce A.; Plummer, Stephen E.

    1991-01-01

    The effect of a leaf pigment - red amaranthin - on red edge and chlorophyll concentration is investigated in amaranth leaves by means of treatments with nitrate and salts. A near-linear relationship between red edge and chlorophyll concentration is observed for leaves with low amaranthin concentration, and no relationship is noted at high concentrations. The study demonstrates the limitation inherent in estimating chlorophyll concentration by using remotely sensed red edge.

  6. Activation of extended red emission photoluminescence in carbon solids by exposure to atomic hydrogen and UV radiation

    Science.gov (United States)

    Furton, Douglas G.; Witt, Adolf N.

    1993-01-01

    We report on new laboratory results which relate directly to the observation of strongly enhanced extended red emission (ERE) by interstellar dust in H2 photodissociation zones. The ERE has been attributed to photoluminescence by hydrogenated amorphous carbon (HAC). We are demonstrating that exposure to thermally dissociated atomic hydrogen will restore the photoluminescence efficiency of previously annealed HAC. Also, pure amorphous carbon (AC), not previously photoluminescent, can be induced to photoluminesce by exposure to atomic hydrogen. This conversion of AC into HAC is greatly enhanced by the presence of UV irradiation. The presence of dense, warm atomic hydrogen and a strong UV radiation field are characteristic environmental properties of H2 dissociation zones. Our results lend strong support to the HAC photoluminescence explanation for ERE.

  7. The acute stress response of red porgy, Pagrus pagrus, kept on a red or white background

    NARCIS (Netherlands)

    Salm, A.L. van der; Pavlidis, M; Flik, G.; Wendelaar Bonga, S.E.

    2005-01-01

    The skin colour of red porgy, Pagrus pagrus, can be modified by exposure to different background colours. Red and white background colours brighten the dark skin colour that develops under common culture conditions in red porgy. To assess whether skin colour is also modified by aquaculture related

  8. A red metallic oxide photocatalyst

    Science.gov (United States)

    Xu, Xiaoxiang; Randorn, Chamnan; Efstathiou, Paraskevi; Irvine, John T. S.

    2012-07-01

    Light absorption across the bandgap in semiconductors is exploited in many important applications such as photovoltaics, light emitting diodes and photocatalytic conversion. Metals differ from semiconductors in that there is no energy gap separating occupied and unoccupied levels; however, it is still possible to excite electrons between bands. This is evidenced by materials with metallic properties that are also strongly coloured. An important question is whether such coloured metals could be used in light harvesting or similar applications. The high conductivity of a metal would preclude sufficient electric field being available to separate photocarriers; however, the high carrier mobility in a metal might also facilitate kinetic charge separation. Here we clearly demonstrate for the first time the use of a red metallic oxide, Sr1-xNbO3 as an effective photocatalyst. The material has been used under visible light to photocatalyse the oxidation of methylene blue and both the oxidation and reduction of water assisted by appropriate sacrificial elements.

  9. Control of poultry red mites

    DEFF Research Database (Denmark)

    Kilpinen, Ole; Steenberg, Tove

    2008-01-01

    The poultry red mite (PRM), Dermanyssus gallinae, is the most important ectoparasite in European egg production. The mites hide in cracks and crevices in the near vicinity of the resting places of the birds, coming out to feed mainly during the night. Under favourable conditions the population can...... grow rapidly, leading to serious problems. Large mite populations may cause anaemia or even death to the poultry, but also in lower numbers mites may be a nuisance to the birds causing decreased egg production and egg quality. Furthermore, they may have the potential of acting as reservoir......-pathogenic fungi and desiccant dust. The dust is diatomaceous earth (of natural origin), synthetic silica products or combinations of the two. The progress of the work with desiccant dusts will be reported. So far, 7 different products have been tested in the laboratory with regard to their efficacy, speed...

  10. Red supergiants as supernova progenitors.

    Science.gov (United States)

    Davies, Ben

    2017-10-28

    It is now well-established from pre-explosion imaging that red supergiants (RSGs) are the direct progenitors of Type-IIP supernovae. These images have been used to infer the physical properties of the exploding stars, yielding some surprising results. In particular, the differences between the observed and predicted mass spectrum has provided a challenge to our view of stellar evolutionary theory. However, turning what is typically a small number of pre-explosion photometric points into the physical quantities of stellar luminosity and mass requires a number of assumptions about the spectral appearance of RSGs, as well as their evolution in the last few years of life. Here I will review what we know about RSGs, with a few recent updates on how they look and how their appearance changes as they approach supernova.This article is part of the themed issue 'Bridging the gap: from massive stars to supernovae'. © 2017 The Author(s).

  11. White dwarf-red dwarf binaries in the Galaxy

    NARCIS (Netherlands)

    Besselaar, E.J.M. van den

    2007-01-01

    This PhD thesis shows several studies on white dwarf - red dwarf binaries. White dwarfs are the end products of most stars and red dwarfs are normal hydrogen burning low-mass stars. White dwarf - red dwarf binaries are both blue (white dwarf) and red (red dwarf). Together with the fact that they are

  12. 21 CFR 640.10 - Red Blood Cells.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 7 2010-04-01 2010-04-01 false Red Blood Cells. 640.10 Section 640.10 Food and... ADDITIONAL STANDARDS FOR HUMAN BLOOD AND BLOOD PRODUCTS Red Blood Cells § 640.10 Red Blood Cells. The proper name of this product shall be Red Blood Cells. The product is defined as red blood cells remaining...

  13. Red blood cell alloimmunization after blood transfusion

    NARCIS (Netherlands)

    Schonewille, Henk

    2008-01-01

    Current pretransfusion policy requires the patients’ serum to be tested for the presence of irregular red blood cell antibodies. In case of an antibody, red blood cells lacking the corresponding antigen are transfused after an antiglobulin crossmatch. The aim of the studies in this thesis is

  14. Quirks of dye nomenclature. 2. Congo red.

    Science.gov (United States)

    Cooksey, C J

    2014-07-01

    The history, origin, identity, chemistry and uses of Congo red are described. Originally patented in 1884, Congo red soon found applications in dyeing cotton, as a pH indicator for chemists and as a biological stain. Unlike the majority of the 19th century synthetic dyes, it still is available commercially.

  15. Normal yield tables for red alder.

    Science.gov (United States)

    Norman P. Worthington; Floyd A. Johnson; George R. Staebler; William J. Lloyd

    1960-01-01

    Increasing interest in the management of red alder (Alnus rubra) has created a need for reliable yield information. Existing yield tables for red alder have been very useful as interim sources of information, but they are generally inadequate for current and prospective management needs. The advisory committee for the Station's Olympia...

  16. Grape (Vitis spp.)- Grapevine red blotch disease

    Science.gov (United States)

    This disease is caused by Grapevine red blotch-associated virus (GRBaV), which was first reported in 2012 from New York and subsequently in California, Washington, Oregon, Idaho, and elsewhere in the United States The discovery occurred when grapevines with red leaf symptoms that tested negative for...

  17. Red autofluorescence of dental plaque bacteria

    NARCIS (Netherlands)

    van der Veen, M. H.; Thomas, R. Z.; Huysmans, M. C. D. N. J. M.; de Soet, J. J.

    2006-01-01

    Red autofluorescence of plaque and its relation to fluorescence of a single species in the biofilm was studied. Fluorescence images of non-disclosed and disclosed plaque of 28 first-year students were captured. The plaque samples were assessed by culture methods and studied for red autofluorescence.

  18. Infra Red 3D Computer Mouse

    DEFF Research Database (Denmark)

    Harbo, Anders La-Cour; Stoustrup, Jakob

    2000-01-01

    The infra red 3D mouse is a three dimensional input device to a computer. It works by determining the position of an arbitrary object (like a hand) by emitting infra red signals from a number of locations and measuring the reflected intensities. To maximize stability, robustness, and use...

  19. Nitrogen depletion in field red giants

    DEFF Research Database (Denmark)

    Masseron, T.; Lagarde, N.; Miglio, A.

    2017-01-01

    , the behaviour of nitrogen data along the evolution confirms the existence of non-canonical extramixing on the red giant branch (RGB) for all low-mass stars in the field. But more surprisingly, the data indicate that nitrogen has been depleted between the RGB tip and the red clump. This may suggest that some...

  20. 76 FR 23485 - Safety Zone; Red River

    Science.gov (United States)

    2011-04-27

    ... SECURITY Coast Guard 33 CFR Part 165 RIN 1625-AA00 Safety Zone; Red River AGENCY: Coast Guard, DHS. ACTION... Red River in the State of North Dakota, including those portions of the river bordered by Richland... across latitude 46 20'00'' N, extending the entire width of the river. This safety zone is needed to...

  1. 33 CFR 117.135 - Red River.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Red River. 117.135 Section 117.135 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY BRIDGES DRAWBRIDGE OPERATION REGULATIONS Specific Requirements Arkansas § 117.135 Red River. The draws of the bridges above...

  2. 33 CFR 117.491 - Red River.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Red River. 117.491 Section 117.491 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY BRIDGES DRAWBRIDGE OPERATION REGULATIONS Specific Requirements Louisiana § 117.491 Red River. (a) The draw of the Union Pacific...

  3. Chemical characteristics of red hartebeest (Alcelaphus buselaphus ...

    African Journals Online (AJOL)

    p2492989

    Abstract. The aim of this study was to determine the effect of region (Qua-Qua, Maria Moroka, Sandveld and. Tussen die Riviere) and gender on carcass characteristics and chemical composition of meat from the red hartebeest. The parameters measured on 29 red hartebeest included body weight, carcass weight, dressing.

  4. Chemical characteristics of red hartebeest ( Alcelaphus buselaphus ...

    African Journals Online (AJOL)

    The aim of this study was to determine the effect of region (Qua-Qua, Maria Moroka, Sandveld and Tussen die Riviere) and gender on carcass characteristics and chemical composition of meat from the red hartebeest. The parameters measured on 29 red hartebeest included body weight, carcass weight, dressing ...

  5. The Austrian x red pine hybrid

    Science.gov (United States)

    W. B. Critchfield

    1963-01-01

    The genetic improvement of red pine (Pinus resinosa Ait.) presents tree breeders with one of their most difficult problems. Not only is this valuable species remarkably uniform, but until 1955 it resisted all attempts to cross it with other pines. In that year red pine and Austrian pine (P. nigra var. austriaca [...

  6. Seeing red to being red: conserved genetic mechanism for red cone oil droplets and co-option for red coloration in birds and turtles

    Science.gov (United States)

    Twyman, Hanlu; Valenzuela, Nicole; Literman, Robert; Andersson, Staffan

    2016-01-01

    Avian ketocarotenoid pigments occur in both the red retinal oil droplets that contribute to colour vision and bright red coloration used in signalling. Turtles are the only other tetrapods with red retinal oil droplets, and some also display red carotenoid-based coloration. Recently, the CYP2J19 gene was strongly implicated in ketocarotenoid synthesis in birds. Here, we investigate CYP2J19 evolution in relation to colour vision and red coloration in reptiles using genomic and expression data. We show that turtles, but not crocodiles or lepidosaurs, possess a CYP2J19 orthologue, which arose via gene duplication before turtles and archosaurs split, and which is strongly and specifically expressed in the ketocarotenoid-containing retina and red integument. We infer that CYP2J19 initially functioned in colour vision in archelosaurs and conclude that red ketocarotenoid-based coloration evolved independently in birds and turtles via gene regulatory changes of CYP2J19. Our results suggest that red oil droplets contributed to colour vision in dinosaurs and pterosaurs. PMID:27488652

  7. Human Red Cells With Paroxysmal Nocturnal Haemoglobinuria ...

    African Journals Online (AJOL)

    The purified cells were used as hosts for the culture of P.falciparum in vitro. Results show that GPI-linked molecules on the red cell surface are not required for the efficient entry of the parasites, and that the PNH red cells are competent to sustain the growth of P.falciparum. Nigerian Quarterly Journal of Hospital Medicine Vol ...

  8. Unripe red fruits may be aposematic

    Science.gov (United States)

    Ne'eman, Gidi; Izhaki, Ido

    2009-01-01

    The unripe fruits of certain species are red. Some of these species disperse their seeds by wind (Nerium oleander, Anabasis articulata), others by adhering to animals with their spines (Emex spinosa) or prickles (Hedysarum spinosissimum). Certainly neither type uses red coloration as advertisement to attract the seed dispersing agents. Fleshy-fruited species (Rhamnus alaternus, Rubus sanguineus and Pistacia sp.), which disperse their seeds via frugivores, change fruit color from green to red while still unripe and then to black or dark blue upon ripening. The red color does not seem to function primarily in dispersal (unless red fruits form advertisement flags when there are already black ripe fruits on the plant) because the red unripe fruits of these species are poisonous, spiny, or unpalatable. The unripe red fruits of Nerium oleander are very poisonous, those of Rhamnus alaternus and Anabasis articulata are moderately poisonous, those of Rubus sanguineus are very sour, those of Pistacia sp. contain unpalatable resin and those of Emex spinosa and Hedysarum spinosissimum are prickly. We propose that these unripe red fruits are aposematic, protecting them from herbivory before seed maturation. PMID:19847110

  9. Experimental reintroduction of red-cockaded woodpeckers

    Science.gov (United States)

    D. Craig Rudolph; Richard N. Conner; Dawn K. Carrie; Richard R. Schaefer

    1992-01-01

    The Red-cockaded Woodpecker (Picoides borealis) is an endangered species endemic to the pine forests of the southeastern United States (Jackson 1971). Deforestation and habitat alteration have severely affected Red-cockaded Woodpecker populations; current populations are isolated and most are declining (Jackson 1971, Lennartz et al. 1983, Conner and Rudolph 1989, Costa...

  10. Red variables of spectral class M

    International Nuclear Information System (INIS)

    Feast, M.W.

    1981-01-01

    The following topics are covered. (1) The temperature and evolutionary sequence amongst the low mass red variables. (2) Period as a population indicator for Mira variables. (3) The absolute magnitudes, temperatures and pulsational characteristics of Mira variables. (4) A period-luminosity relation for supergiant red variables in the Magellanic Clouds. (Auth.)

  11. Seeing red to being red: conserved genetic mechanism for red cone oil droplets and co-option for red coloration in birds and turtles.

    Science.gov (United States)

    Twyman, Hanlu; Valenzuela, Nicole; Literman, Robert; Andersson, Staffan; Mundy, Nicholas I

    2016-08-17

    Avian ketocarotenoid pigments occur in both the red retinal oil droplets that contribute to colour vision and bright red coloration used in signalling. Turtles are the only other tetrapods with red retinal oil droplets, and some also display red carotenoid-based coloration. Recently, the CYP2J19 gene was strongly implicated in ketocarotenoid synthesis in birds. Here, we investigate CYP2J19 evolution in relation to colour vision and red coloration in reptiles using genomic and expression data. We show that turtles, but not crocodiles or lepidosaurs, possess a CYP2J19 orthologue, which arose via gene duplication before turtles and archosaurs split, and which is strongly and specifically expressed in the ketocarotenoid-containing retina and red integument. We infer that CYP2J19 initially functioned in colour vision in archelosaurs and conclude that red ketocarotenoid-based coloration evolved independently in birds and turtles via gene regulatory changes of CYP2J19 Our results suggest that red oil droplets contributed to colour vision in dinosaurs and pterosaurs. © 2016 The Author(s).

  12. La red sobre trabajo infantil peligroso (Red Tip The hazardous child labor network (Red Tip

    Directory of Open Access Journals (Sweden)

    Walter Varillas

    2003-01-01

    Full Text Available En el mundo, aproximadamente 351.7 millones de niños entre 5 y 17 años realizaban algún tipo de actividad económica, de ellos 170.5 millones (48.5% realizaban algún tipo de trabajo considerado peligroso. Un alto porcentaje se encuentra en la agricultura, otros en minas, manufacturas, ladrilleras, predominantemente en la economía informal. El Convenio 138 (cobre la edad mínima de admisión en el empleo de la OIT y el Convenio 182 (sobre las peores formas de trabajo infantil, definen como trabajo infantil peligroso el que puede afectar la salud, seguridad y moralidad de los menores. Estudios específicos sobre los menores muestran su susceptibilidad particular frente a los riesgos laborales, aumentando la peligrosidad para su normal desarrollo y crecimiento: "los niños no son adultos pequeños". Los profesionales de la seguridad y salud en el trabajo pueden colaborar con los profesionales y las organizaciones especializadas en el trabajo infantil, en la definición y caracterización de lo que significa el trabajo infantil peligroso. Para ello se ha conformado la Red sobre Trabajo Infantil Peligroso (Red TIP, con la finalidad de articular estos dos espacios, orientados a eliminar el trabajo infantil peligroso y rescatar al menor y devolverle la oportunidad de sonreír ahora y en el futuro.In the world, approximately 351.7 millions children between 5 and 17 years old work. Of them, 170,5 millions (48.5% work at the hazardous child labor forms. A high percentage is in agriculture, others in mines, manufactures, brick makers, predominantly in informal economy. The 138 Convention of ILO and the 182 Convention, define as hazardous child labor activities that can affect the health, safety and morality of the children. Studies on the children at work point out their particular susceptibility to some occupational risks, increasing the danger for their normal development and growth. "They are not little adults". The occupational health

  13. THE ACS NEARBY GALAXY SURVEY TREASURY. IX. CONSTRAINING ASYMPTOTIC GIANT BRANCH EVOLUTION WITH OLD METAL-POOR GALAXIES

    International Nuclear Information System (INIS)

    Girardi, Leo; Williams, Benjamin F.; Gilbert, Karoline M.; Rosenfield, Philip; Dalcanton, Julianne J.; Marigo, Paola; Boyer, Martha L.; Dolphin, Andrew; Weisz, Daniel R.; Skillman, Evan; Melbourne, Jason; Olsen, Knut A. G.; Seth, Anil C.

    2010-01-01

    In an attempt to constrain evolutionary models of the asymptotic giant branch (AGB) phase at the limit of low masses and low metallicities, we have examined the luminosity functions and number ratios between AGB and red giant branch (RGB) stars from a sample of resolved galaxies from the ACS Nearby Galaxy Survey Treasury. This database provides Hubble Space Telescope optical photometry together with maps of completeness, photometric errors, and star formation histories for dozens of galaxies within 4 Mpc. We select 12 galaxies characterized by predominantly metal-poor populations as indicated by a very steep and blue RGB, and which do not present any indication of recent star formation in their color-magnitude diagrams. Thousands of AGB stars brighter than the tip of the RGB (TRGB) are present in the sample (between 60 and 400 per galaxy), hence, the Poisson noise has little impact in our measurements of the AGB/RGB ratio. We model the photometric data with a few sets of thermally pulsing AGB (TP-AGB) evolutionary models with different prescriptions for the mass loss. This technique allows us to set stringent constraints on the TP-AGB models of low-mass, metal-poor stars (with M sun , [Fe/H]∼ sun . This is also in good agreement with recent observations of white dwarf masses in the M4 old globular cluster. These constraints can be added to those already derived from Magellanic Cloud star clusters as important mileposts in the arduous process of calibrating AGB evolutionary models.

  14. THE ACS VIRGO CLUSTER SURVEY. XVII. THE SPATIAL ALIGNMENT OF GLOBULAR CLUSTER SYSTEMS WITH EARLY-TYPE HOST GALAXIES

    Energy Technology Data Exchange (ETDEWEB)

    Wang Qiushi; Peng, Eric W. [Department of Astronomy, Peking University, Beijing 100871 (China); Blakeslee, John P.; Cote, Patrick; Ferrarese, Laura [Herzberg Institute of Astrophysics, National Research Council of Canada, 5071 West Saanich Road, Victoria, BC V9E 2E7 (Canada); Jordan, Andres [Departamento de Astronomia y Astrofisica, Pontificia Universidad Catolica de Chile, Casilla 306, Santiago 22 (Chile); Mei, Simona [University of Paris 7 Denis Diderot, F-75205 Paris Cedex 13 (France); West, Michael J., E-mail: peng@pku.edu.cn [Maria Mitchell Observatory, 4 Vestal Street, Nantucket, MA 02554 (United States)

    2013-06-01

    We study the azimuthal distribution of globular clusters (GCs) in early-type galaxies and compare them to their host galaxies using data from the ACS Virgo Cluster Survey. We find that in host galaxies with visible elongation ({epsilon} > 0.2) and intermediate to high luminosities (M{sub z} < -19), the GCs are preferentially aligned along the major axis of the stellar light. The red (metal-rich) GC subpopulations show strong alignment with the major axis of the host galaxy, which supports the notion that these GCs are associated with metal-rich field stars. The metal-rich GCs in lenticular galaxies show signs of being more strongly associated with disks rather than bulges. Surprisingly, we also find that the blue (metal-poor) GCs can also show the same correlation. If the metal-poor GCs are part of the early formation of the halo and built up through mergers, then our results support a picture where halo formation and merging occur anisotropically, and that the present-day major axis is an indicator of the preferred merging axis.

  15. The ACS Nearby Galaxy Survey Treasury. IX. Constraining Asymptotic Giant Branch Evolution with Old Metal-poor Galaxies

    Science.gov (United States)

    Girardi, Léo; Williams, Benjamin F.; Gilbert, Karoline M.; Rosenfield, Philip; Dalcanton, Julianne J.; Marigo, Paola; Boyer, Martha L.; Dolphin, Andrew; Weisz, Daniel R.; Melbourne, Jason; Olsen, Knut A. G.; Seth, Anil C.; Skillman, Evan

    2010-12-01

    In an attempt to constrain evolutionary models of the asymptotic giant branch (AGB) phase at the limit of low masses and low metallicities, we have examined the luminosity functions and number ratios between AGB and red giant branch (RGB) stars from a sample of resolved galaxies from the ACS Nearby Galaxy Survey Treasury. This database provides Hubble Space Telescope optical photometry together with maps of completeness, photometric errors, and star formation histories for dozens of galaxies within 4 Mpc. We select 12 galaxies characterized by predominantly metal-poor populations as indicated by a very steep and blue RGB, and which do not present any indication of recent star formation in their color-magnitude diagrams. Thousands of AGB stars brighter than the tip of the RGB (TRGB) are present in the sample (between 60 and 400 per galaxy), hence, the Poisson noise has little impact in our measurements of the AGB/RGB ratio. We model the photometric data with a few sets of thermally pulsing AGB (TP-AGB) evolutionary models with different prescriptions for the mass loss. This technique allows us to set stringent constraints on the TP-AGB models of low-mass, metal-poor stars (with M white dwarf masses in the M4 old globular cluster. These constraints can be added to those already derived from Magellanic Cloud star clusters as important mileposts in the arduous process of calibrating AGB evolutionary models.

  16. From red giants to planetary nebulae

    International Nuclear Information System (INIS)

    Kwok, S.

    1982-01-01

    The transition from red giants to planetary nebulae is studied by comparing the spectral characteristics of red giant envelopes and planetary nebulae. Observational and theoretical evidence both suggest that remnants of red giant envelopes may still be present in planetary nebula systems and should have significant effects on their formation. The dynamical effects of the interaction of stellar winds from central stars of planetary nebulae with the remnant red giant envelopes are evaluated and the mechanism found to be capable of producing the observed masses and momenta of planetary nebulae. The observed mass-radii relation of planetary nebulae may also be best explained by the interacting winds model. The possibility that red giant mass loss, and therefore the production of planetary nebulae, is different between Population I and II systems is also discussed

  17. Reduction of 4-ethylphenol and 4-ethylguaiacol in red wine by activated carbons with different physicochemical characteristics: Impact on wine quality.

    Science.gov (United States)

    Filipe-Ribeiro, Luís; Milheiro, Juliana; Matos, Carlos C; Cosme, Fernanda; Nunes, Fernando M

    2017-08-15

    Activated carbon (AC) could be a solution to remove 4-ethylphenol (4-EP) and 4-ethylguaiacol (4-EG) off-flavours from Dekkera/Brettanomyces contaminated red wines. The relation between AC physicochemical characteristics and removal efficiency of these compounds is unknown. The impact of ACs characteristics on 4-EP and 4-EG removal, phenolic and headspace aroma composition was studied. All ACs reduced significantly 4-EP and 4-EG levels (maximum 73%). Their efficiency was related to their surface area and micropores volume. A higher surface area of mesopores and total pore volume were detrimental for anthocyanins and colour intensity, while a higher surface area and micropores volume were important for removing phenolic acids. Volatile phenols reduction was more important for the positive fruity attribute perception than the abundance of headspace aroma compounds. With an optimal selection of the AC physicochemical characteristics it was possible to remove efficiently the volatile phenols without impacting negatively on the wine sensory quality. Copyright © 2017 Elsevier Ltd. All rights reserved.

  18. Coordination Control Strategy for AC/DC Hybrid Microgrids in Stand-Alone Mode

    Directory of Open Access Journals (Sweden)

    Dwi Riana Aryani

    2016-06-01

    Full Text Available Interest in DC microgrids is rapidly increasing along with the improvement of DC power technology because of its advantages. To support the integration process of DC microgrids with the existing AC utility grids, the form of hybrid AC/DC microgrids is considered for higher power conversion efficiency, lower component cost and better power quality. In the system, AC and DC portions are connected through interlink bidirectional AC/DC converters (IC with a proper control system and power management. In the stand-alone operation mode of AC/DC hybrid microgrids, the control of power injection through the IC is crucial in order to maintain the system security. This paper mainly deals with a coordination control strategy of IC and a battery energy storage system (BESS converter under stand-alone operation. A coordinated control strategy for the IC, which considers the state of charge (SOC level of BESS and the load shedding scheme as the last resort, is proposed to obtain better power sharing between AC and DC subgrids. The scheme will be tested with a hybrid AC/DC microgrid, using the tool of the PSCAD/EMTDC software.

  19. AC Loss Reduction in Filamentized YBCO Coated Conductors with Virtual Transverse Cross-cuts

    Energy Technology Data Exchange (ETDEWEB)

    Zhang, Yifei [ORNL; Duckworth, Robert C [ORNL; Ha, Tam T [ORNL; List III, Frederick Alyious [ORNL; Gouge, Michael J [ORNL; Chen, Y [SuperPower Incorporated, Schenectady, New York; X, Xiong, [SuperPower Incorporated, Schenectady, New York; Selvamanickam, V. [SuperPower Incorporated, Schenectady, New York

    2011-01-01

    While the performance of YBa{sub 2}Cu{sub 3}O{sub 7-x} (YBCO)-based coated conductors under dc currents has improved significantly in recent years, filamentization is being investigated as a technique to reduce ac loss so that the 2nd generation (2G) high temperature superconducting (HTS) wires can also be utilized in various ac power applications such as cables, transformers and fault current limiters. Experimental studies have shown that simply filamentizing the superconducting layer is not effective enough to reduce ac loss because of incomplete flux penetration in between the filaments as the length of the tape increases. To introduce flux penetration in between the filaments more uniformly and further reduce the ac loss, virtual transverse cross-cuts were made in superconducting filaments of the coated conductors fabricated using the metal organic chemical vapor deposition (MOCVD) method. The virtual transverse cross-cuts were formed by making cross-cuts (17 - 120 {micro}m wide) on the IBAD (ion beam assisted deposition)-MgO templates using laser scribing followed by depositing the superconducting layer ({approx} 0.6 {micro}m thick). AC losses were measured and compared for filamentized conductors with and without the cross-cuts under applied peak ac fields up to 100 mT. The results were analyzed to evaluate the efficacy of filament decoupling and the feasibility of using this method to achieve ac loss reduction.

  20. Probable alpha and 14C cluster emission from hyper Ac nuclei

    International Nuclear Information System (INIS)

    Santhosh, K.P.

    2013-01-01

    A systematic study on the probability for the emission of 4 He and 14 C cluster from hyper Λ 207-234 Ac and non-strange normal 207-234 Ac nuclei are performed for the first time using our fission model, the Coulomb and proximity potential model (CPPM). The predicted half lives show that hyper Λ 207-234 Ac nuclei are unstable against 4 He emission and 14 C emission from hyper Λ 217-228 Ac are favorable for measurement. Our study also show that hyper Λ 207-234 Ac are stable against hyper Λ 4 He and Λ 14 C emission. The role of neutron shell closure (N = 126) in hyper Λ 214 Fr daughter and role of proton/neutron shell closure (Z ∼ 82, N = 126) in hyper Λ 210 Bi daughter are also revealed. As hyper-nuclei decays to normal nuclei by mesonic/non-mesonic decay and since most of the predicted half lives for 4 He and 14 C emission from normal Ac nuclei are favourable for measurement, we presume that alpha and 14 C cluster emission from hyper Ac nuclei can be detected in laboratory in a cascade (two-step) process. (orig.)