Effects of Fe and Cr on corrosion behavior of ZrFeCr alloys in 500 oC steam
International Nuclear Information System (INIS)
Wang Jun; Fan Hongyuan; Xiong Ji; Liu Hong; Miao Zhi; Ying Shihao; Yang Gang
2011-01-01
Research highlights: Amount and size of SPP will effect the corrosion resistance of Zr alloy at 500 o C/10.3 MPa. - Abstract: A study of the corrosion behaviors of ZrFeCr alloy and the influence of microstructure on corrosion resistance are described by X-ray diffraction and scanning electron microscope in this paper. The results show that several ZrFeCr alloys exhibit protective behavior throughout the test and oxide growth is stable and protective. The best alloy has the composition Zr1.0Fe0.6Cr. Fitting of the weight gain curves for the protective oxide alloys in the region of protective behavior, it showed nearly cubic behavior for the most protective alloys. The Zr1.0Fe0.6Cr has the more laves Zr(Fe,Cr) 2 precipitate in matrix and it has the better corrosion resistance. The Zr0.2Fe0.1Cr has little precipitate, the biggest hydrogen absorption and the worst corrosion resistance. The number of precipitates and the amount of hydrogen absorption in Zr alloy plays an important role on corrosion resistance behaviors in 500 o C/10.3 MPa steam.
Zr/ZrC modified layer formed on AISI 440B stainless steel by plasma Zr-alloying
Shen, H. H.; Liu, L.; Liu, X. Z.; Guo, Q.; Meng, T. X.; Wang, Z. X.; Yang, H. J.; Liu, X. P.
2016-12-01
The surface Zr/ZrC gradient alloying layer was prepared by double glow plasma surface alloying technique to increase the surface hardness and wear resistance of AISI 440B stainless steel. The microstructure of the Zr/ZrC alloying layer formed at different alloying temperatures and times as well as its formation mechanism were discussed by using scanning electron microscopy, glow discharge optical emission spectrum, X-ray diffraction and X-ray photoelectron spectroscopy. The adhesive strength, hardness and tribological property of the Zr/ZrC alloying layer were also evaluated in the paper. The alloying surface consists of the Zr-top layer and ZrC-subsurface layer which adheres strongly to the AISI 440B steel substrate. The thickness of the Zr/ZrC alloying layer increases gradually from 16 μm to 23 μm with alloying temperature elevated from 900 °C to 1000 °C. With alloying time from 0.5 h to 4 h, the alloyed depth increases from 3 μm to 30 μm, and the ZrC-rich alloyed thickness vs time is basically parabola at temperature of 1000 °C. Both the hardness and wear resistance of the Zr/ZrC alloying layer obviously increase compared with untreated AISI 440B steel.
Zr/ZrC modified layer formed on AISI 440B stainless steel by plasma Zr-alloying
Energy Technology Data Exchange (ETDEWEB)
Shen, H.H.; Liu, L.; Liu, X.Z.; Guo, Q.; Meng, T.X.; Wang, Z.X.; Yang, H.J.; Liu, X.P., E-mail: liuxiaoping@tyut.edu.cn
2016-12-01
Highlights: • A Zr/ZrC modified layer was formed on AISI 440B stainless steel using plasma surface Zr-alloying. • The thickness of the modified layer increases with alloying temperature and time. • Formation mechanism of the modified layer is dependent on the mutual diffusion of Zr and substrate elements. • The modified surface shows an improved wear resistance. - Abstract: The surface Zr/ZrC gradient alloying layer was prepared by double glow plasma surface alloying technique to increase the surface hardness and wear resistance of AISI 440B stainless steel. The microstructure of the Zr/ZrC alloying layer formed at different alloying temperatures and times as well as its formation mechanism were discussed by using scanning electron microscopy, glow discharge optical emission spectrum, X-ray diffraction and X-ray photoelectron spectroscopy. The adhesive strength, hardness and tribological property of the Zr/ZrC alloying layer were also evaluated in the paper. The alloying surface consists of the Zr-top layer and ZrC-subsurface layer which adheres strongly to the AISI 440B steel substrate. The thickness of the Zr/ZrC alloying layer increases gradually from 16 μm to 23 μm with alloying temperature elevated from 900 °C to 1000 °C. With alloying time from 0.5 h to 4 h, the alloyed depth increases from 3 μm to 30 μm, and the ZrC-rich alloyed thickness vs time is basically parabola at temperature of 1000 °C. Both the hardness and wear resistance of the Zr/ZrC alloying layer obviously increase compared with untreated AISI 440B steel.
Laser and electron beam welding study on niobium based Nb-1Zr-0.1C alloy
International Nuclear Information System (INIS)
Badgujar, B.P.; Kushwaha, R.P.; Tewari, R.; Dey, G.K.
2016-01-01
The refractory metal based alloys are most suitable for the structural applications in high temperature reactors envisaged to operate at temperature higher than 1000°C. The Nb-1Zr-0.1C (wt. %) is being considered for structural applications in the proposed Compact High Temperature Reactors (CHTR). The welding of this alloy is a difficult task due to its reactive nature and higher thermal conductivity. Laser and Electron Beam (EB) welds were produced on sheet of Nb-1Zr-0.1C alloy at various processing parameters and their effects on weld quality was studied by characterizing their optical and SEM micrographs and microhardness profile. The joining efficiency of both welding processes were also studied. The laser welds done in air with argon shielding showed higher hardness values compared to EB welds indicating need for adequate shielding. This study will help to find the optimized welding parameters to produce defect free welds of Nb-1Zr-0.1C alloy. (author)
High-temperature deformation of dispersion-strengthened Cu-Zr-Ti-C alloys
International Nuclear Information System (INIS)
Palma, Rodrigo H.; Sepulveda, Aquiles; Espinoza, Rodrigo; Dianez, M. Jesus; Criado, Jose M.; Sayagues, M. Jesus
2005-01-01
The hot mechanical behaviour and microstructure of Cu-5 vol.% TiC, Cu-5 vol.% ZrO 2 and Cu-2.5 vol.% TiC-2.5 vol.% ZrO 2 alloys prepared by reaction milling were studied. After a test of 1 h annealing at 1173 K, the Cu-5 vol.% ZrO 2 alloy presented the lower softening resistance to annealing, while the other two ones kept their initial room-temperature hardness (about 2 GPa). Hot-compression tests at 773 and 1123 K, at initial true strain rates of 0.85 x 10 -3 and 0.85 x 10 -4 s -1 were performed. The Cu-2.5 vol.% TiC-2.5 vol.% ZrO 2 and the Cu-5 vol.% ZrO 2 alloys were the strongest and softest materials, respectively. Moreover, by electron microscopy, nanometric TiC and micrometric particles were detected in the Cu-5 vol.% TiC and Cu-5 vol.% ZrO 2 alloys, respectively. A possible explanation for the observed behaviour of these materials is proposed. In the compression tests, it was also found that strain rate has a low effect on flow stress, as it has been previously observed by various authors in dispersion-strengthened alloys deformed at high temperatures
International Nuclear Information System (INIS)
Chakravartty, J.K.; Kapoor, R.; Suri, A.K.
2011-08-01
Nb-1Zr-0.1C is a potential material for use in high temperature nuclear reactors. Use of this alloy in components requires appropriate thermomechanical processing to break the cast microstructure and to obtain uniformly distributed fine stable precipitates so as to produce the desired mechanical properties at the high operating temperatures. This report reviews the thermomechanical processing of Nb-1Zr-0.1C alloy carried out over the years by other researchers and the high temperature creep behavior of the alloy. The hot deformation of Nb-1Zr-0.1C alloy carried out at Mechanical Metallurgy Division is also presented here. From this review it is evident that most primary hot working studies were carried out between 1500 to 1700 degC. The subsequent annealing treatments, which require holding at lower temperatures of about 1100 to 1300 degC for very long times help further transform the precipitates from coarse orthorhombic to very fine cubic. Our studies on Nb-1Zr-0.1C alloy also confirm that optimum hot working lies at temperatures beyond 1500 degC where dynamic recrystallization initiates, and optimally around 1700 degC where dynamic recrystallization transforms the microstructure. Working at temperatures lower than 1000 degC may lead to the undesirable effect of both micro as well as macro strain localization, and should be avoided. (author)
Oxidation kinetics of amorphous AlxZr1−x alloys
International Nuclear Information System (INIS)
Weller, K.; Wang, Z.M.; Jeurgens, L.P.H.; Mittemeijer, E.J.
2016-01-01
The oxidation kinetics of amorphous Al x Zr 1−x alloys (solid solution) has been studied as function of the alloy composition (0.26 ≤ x ≤ 0.68) and the oxidation temperature (350 °C ≤ T ≤ 400 °C; at constant pO 2 = 1 × 10 5 Pa) by a combinatorial approach using spectroscopic ellipsometry (SE), Auger electron spectroscopy (AES) depth profiling, transmission electron microscopy (TEM) and X-ray diffraction (XRD) analysis. Thermal oxidation of the am-Al x Zr 1−x alloys results in the formation of an amorphous oxide overgrowth with a thermodynamically preferred singular composition, corresponding to a constant Al ox /Zr ox ratio of 0.5. Both the solubility and the diffusivity of oxygen in the am-Al x Zr 1−x alloy substrate increase considerably with increasing Zr content, in particular for Zr contents above 49 at.% Zr. Strikingly, the oxidation kinetics exhibit a transition from parabolic oxide growth kinetics for Al-rich am-Al x Zr 1−x alloys (x ≥ 0.51) to linear oxide growth kinetics for Zr-rich am-Al x Zr 1−x alloys (x < 0.35). The underlying oxidation mechanism is discussed. It is concluded that the oxidation kinetics of the amorphous Al x Zr 1−x alloys for 0.26 ≤ x ≤ 0.68 and 350 °C ≤ T ≤ 400 °C are governed by: (i) the atomic mobilities of O and Al in the alloy substrate at the reacting oxide/alloy interface, (ii) the solubility of O in the substrate and (iii) the compositional constraint due to the thermodynamically preferred formation of an amorphous oxide phase of singular composition.
Arc melting and homogenization of ZrC and ZrC + B alloys
Darolia, R.; Archbold, T. F.
1973-01-01
A description is given of the methods used to arc-melt and to homogenize near-stoichiometric ZrC and ZrC-boron alloys, giving attention to the oxygen contamination problem. The starting material for the carbide preparation was ZrC powder with an average particle size of 4.6 micron. Pellets weighing approximately 3 g each were prepared at room temperature from the powder by the use of an isostatic press operated at 50,000 psi. These pellets were individually melted in an arc furnace containing a static atmosphere of purified argon. A graphite resistance furnace was used for the homogenization process.
Nano ZrO{sub 2} particles in nanocrystalline Fe–14Cr–1.5Zr alloy powders
Energy Technology Data Exchange (ETDEWEB)
Xu, W.Z.; Li, L.L.; Saber, M.; Koch, C.C.; Zhu, Y.T., E-mail: ytzhu@ncsu.edu; Scattergood, R.O.
2014-09-15
Here we report on the formation of nano ZrO{sub 2} particles in Fe–14Cr–1.5Zr alloy powders synthesized by mechanical alloying. The nano ZrO{sub 2} particles were found uniformly dispersed in the ferritic matrix powders with an average size of about 3.7 nm, which rendered the alloy powders so stable that it retained nanocrystalline structure after annealing at 900 °C for 1 h. The ZrO{sub 2} nanoparticles have a tetragonal crystal structure and the following orientation relationship with the matrix: (0 0 2){sub ZrO2}//(0 0 2){sub Matrix} and [0 1 0]{sub ZrO2}//[1 2 0]{sub Matrix}. The size and dispersion of the ZrO{sub 2} particles are comparable to those of Y–Ti–O enriched oxides reported in irradiation-resistant ODS alloys. This suggests a potential application of the new alloy powders for nuclear energy applications.
Energy Technology Data Exchange (ETDEWEB)
Chauhan, Mamta, E-mail: mamta-physics@yahoo.co.in; Gupta, Dinesh C., E-mail: sosfizix@gmail.com [Condensed Matter Theory Group, School of Studies in Physics, Jiwaji University, Gwalior – 474 011(India)
2016-05-06
The formation energy, equilibrium lattice parameter, bulk modulus, Debye temperature and heat capacity at constant volume have been calculated for TiC, ZrC, and their intermediate alloys (Ti{sub 1-x}Zr{sub x}C, x = 0,0.25.0.5,0.75,1) using first principles approach. The calculated values of lattice parameter and bulk modulus agree well with the available experimental and earlier theoretical reports. The variation of lattice parameter and bulk modulus with the change in concentration of Zr atom in Ti{sub 1-x}Zr{sub x}C has also been reported. The heat capacities of TiC, ZrC, and their intermediate alloys have been calculated by considering both vibrational and electronic contributions.
Zr-Sn-Nb alloys. Preliminary studies
International Nuclear Information System (INIS)
Danon, C.A.; Arias, D.E.
1993-01-01
Studies of the Zr-Sn-Nb diagram have been started, focussing on the Zr-rich corner, near the composition of Zirlo commercial alloy, Zr-1Sn-1Nb, and with Fe and O contents usual in nuclear grade materials. Three alloys were melted, namely Zr-4Sn-2.4Nb (A), Zr-1Sn-3Nb (B) and Zr-2.1Sn-1Nb (C). α/β transformation temperatures were measured through the variation of electrical resistivity(p) vs temperature (T). Values of 560 deg C, 670 deg C and 750 deg C were measured for the α→α+β reaction and 980 deg C, 910 deg C and 1000 deg C for the α+β→β reaction, for the A, B and C alloys, respectively in that order. Some samples were submitted to heat treatments (62 and 216 hours at 825 deg C, 120 hours at 875 deg C). Optical and scanning electronic microscopy of those samples confirmed our resistivity results. (Author)
Atom probe tomographic studies of precipitation in Al-0.1Zr-0.1Ti (at.%) alloys.
Knipling, Keith E; Dunand, David C; Seidman, David N
2007-12-01
Atom probe tomography was utilized to measure directly the chemical compositions of Al(3)(Zr(1)-(x)Ti(x)) precipitates with a metastable L1(2) structure formed in Al-0.1Zr-0.1Ti (at.%) alloys upon aging at 375 degrees C or 425 degrees C. The alloys exhibit an inhomogeneous distribution of Al(3)(Zr(1)-(x)Ti(x)) precipitates, as a result of a nonuniform dendritic distribution of solute atoms after casting. At these aging temperatures, the Zr:Ti atomic ratio in the precipitates is about 10 and 5, respectively, indicating that Ti remains mainly in solid solution rather than partitioning to the Al(3)(Zr(1)-(x)Ti(x)) precipitates. This is interpreted as being due to the very small diffusivity of Ti in alpha-Al, consistent with prior studies on Al-Sc-Ti and Al-Sc-Zr alloys, where the slower diffusing Zr and Ti atoms make up a small fraction of the Al(3)(Zr(1)-(x)Ti(x)) precipitates. Unlike those alloys, however, the present Al-Zr-Ti alloys exhibit no interfacial segregation of Ti at the matrix/precipitate heterophase interface, a result that may be affected by a significant disparity in the evaporation fields of the alpha-Al matrix and Al(3)(Zr(1)-(x)Ti(x)) precipitates and/or a lack of local thermodynamic equilibrium at the interface.
Energy Technology Data Exchange (ETDEWEB)
Park, Hye Ryoung [Faculty of Applied Chemistry, Chonnam National University, Kwangju (Korea); Kwon, Ik Hyun [Automobile High-Technology Research Institute, Division of Advanced Materials Engineering, Chonbuk National University, Chonju (Korea)
2001-04-01
In order to improve the performance of AB{sub 2}-type hydrogen-storage alloys for Ni-MH secondary battery, AB{sub 2}-type alloys, ZrMn{sub 2}Ni{sub x}(x=0.0, 0.3, 0.6, 0.9 and 1.2) and ZrMnNi{sub 1+x}(x=0.0, 0.1, 0.2, 0.3 and 0.4) were prepared as the Zr-Mn-Ni three component alloys. The hydrogen-storage and the electrochemical properties were investigated. The C14 Laves phase formed in all alloys of ZrMn{sub 2}Ni{sub x}(x=0.0 {approx} 1.2). The equilibrium plateau pressure of the alloy, ZrMn{sub 2}Ni{sub 0.6}-H{sub 2} system, was about 0.5 atm at 30 degree C. Among these alloys, ZrMn{sub 2}Ni{sub 0.6} was the easiest to activate, and it had the largest discharge capacity as well as the best cycling performance. The C14 Laves phase also formed in all alloys of ZrMnNi{sub 1+x}(x=0.0 {approx} 0.4). The equilibrium plateau pressure of the alloy, ZrMnNi{sub 1.0}-H{sub 2} system, was about 0.45 atm at 30 degree C. Among these alloys, ZrMnNi{sub 1.0} was the easiest to activate, taking only 3 charge-discharge cycles, and it had the largest discharge capacity of 42 mAh/g. Among these alloys, ZrMn{sub 2}Ni{sub x}(x=0.0 {approx} 1.2) and ZrMnNi{sub 1+x}(x=0.0 {approx} 0.4), ZrMnNi{sub 1.0} had the largest discharge capacity (maximum value of 42 mAh/g), and it showed the fastest activation and good cycling performance. 23 refs., 4 figs., 2 tabs.
Effect of alloying Mo on mechanical strength and corrosion resistance of Zr-1% Sn-1% Nb-1% Fe alloy
International Nuclear Information System (INIS)
Sugondo
2011-01-01
It had been done research on Zr-1%Sn-1%Nb-1%Fe-(x)%Mo alloy. The ingot was prepared by means of electrical electrode technique. The chemical analysis was identified by XRF, the metallography examination was perform by an optical microscope, the hardness test was done by Vickers microhardness, and the corrosion test was done in autoclave. The objective of this research were making Zr-1%Sn-1%Nb-1%Fe-(x)%Mo alloy with Mo concentration; comparing effect of Mo concentration to metal characteristics of Zr-1%Sn-1%Nb-1%Fe which covered microstructure; composition homogeneity, mechanical strength; and corrosion resistance in steam, and determining the optimal Mo concentration in Zr-1%Sn-1%Nb-1%Fe-(x)% Mo alloy for nuclear fuel cladding which had corrosion resistance and high hardness. The results were as follow: The alloying Mo refined grains at concentration in between 0,1%-0,3% and the concentration more than that could coarsened grains. The hardness of the Zr-1%Sn-1%Nb-1%Fe-(x)%Mo alloy was controlled either by the flaw or the dislocation, the intersection of the harder alloying element, the solid solution of the alloying element and the second phase formation of ZrMo 2 . The corrosion rate of the Zr-1%Sn-1%Nb-1%Fe-(x)%Mo alloy was controlled by the second phase of ZrMo 2 . The 0.3% Mo concentration in Zr-1%Sn-1%Nb-1%Fe-(x)%Mo alloy was the best for second phase formation. The Mo concentration in between 0,3-0,5% in Zr-1%Sn-1%Nb-1%Fe-(x)%Mo alloy was good for the second phase formation and the solid solution. (author)
Fabrication of lithium/C-103 alloy heat pipes for sharp leading edge cooling
Ai, Bangcheng; Chen, Siyuan; Yu, Jijun; Lu, Qin; Han, Hantao; Hu, Longfei
2018-05-01
In this study, lithium/C-103 alloys heat pipes are proposed for sharp leading edge cooling. Three models of lithium/C-103 alloy heat pipes were fabricated. And their startup properties were tested by radiant heat tests and aerothermal tests. It is found that the startup temperature of lithium heat pipe was about 860 °C. At 1000 °C radiant heat tests, the operating temperature of lithium/C-103 alloy heat pipe is lower than 860 °C. Thus, startup failure occurs. At 1100 °C radiant heat tests and aerothermal tests, the operating temperature of lithium/C-103 alloy heat pipe is higher than 860 °C, and the heat pipe starts up successfully. The startup of lithium/C-103 alloy heat pipe decreases the leading edge temperature effectively, which endows itself good ablation resistance. After radiant heat tests and aerothermal tests, all the heat pipe models are severely oxidized because of the C-103 poor oxidation resistance. Therefore, protective coatings are required for further applications of lithium/C-103 alloy heat pipes.
Structure, mechanical properties, and grindability of dental Ti-Zr alloys.
Ho, Wen-Fu; Chen, Wei-Kai; Wu, Shih-Ching; Hsu, Hsueh-Chuan
2008-10-01
Structure, mechanical properties and grindability of a series of binary Ti-Zr alloys with zirconium contents ranging from 10 to 40 wt% have been investigated. Commercially pure titanium (c.p. Ti) was used as a control. Experimental results indicated that the diffraction peaks of all the Ti-Zr alloys matched those for alpha Ti. No beta-phase peaks were found. The hardness of the Ti-Zr alloys increased as the Zr contents increased, and ranged from 266 HV (Ti-10Zr) to 350 HV (Ti-40Zr). As the concentration of zirconium in the alloys increased, the strength, elastic recovery angles and hardness increased. Moreover, the elastically recoverable angle of Ti-40Zr was higher than of c.p. Ti by as much as 550%. The grindability of each metal was found to be largely dependent on the grinding conditions. The Ti-40Zr alloy had a higher grinding rate and grinding ratio than c.p. Ti at low speed. The grinding rate of the Ti-40Zr alloy at 500 m/min was about 1.8 times larger than that of c.p. Ti, and the grinding ratio was about 1.6 times larger than that of c.p. Ti. Our research suggested that the Ti-40Zr alloy has better mechanical properties, excellent elastic recovery capability and improved grindability at low grinding speed. The Ti-40Zr alloy has a great potential for use as a dental machining alloy.
Processing and microstructure of Nb-1 percent Zr-0.1 percent C alloy sheet
Uz, Mehmet; Titran, Robert H.
1992-01-01
A systematic study was carried out to evaluate the effects of processing on the microstructure of Nb-1 wt. pct. Zr-0.1 wt. pct. C alloy sheet. The samples were fabricated by cold rolling different sheet bars that were single-, double- or triple-extruded at 1900 K. Heat treatment consisted on one- or two-step annealing of different samples at temperatures ranging from 1350 to 1850 K. The assessment of the effects of processing on microstructure involved characterization of the precipitates including the type, crystal structure, chemistry and distribution within the material as well as an examination of the grain structure. A combination of various analytical and metallographic techniques were used on both the sheet samples and the residue extracted from them. The results show that the relatively coarse orthorhombic Nb2C carbides in the as-rolled samples transformed to rather fine cubic monocarbides of Nb and Zr with varying Zr/Nb ratios upon subsequent heat treatment. The relative amount of the cubic carbides and the Zr/Nb ratio increased with increasing number of extrusions prior to cold rolling. Furthermore, the size and the aspect ratio of the grains appear to be strong functions of the processing history of the material. These and other results obtained will be presented with the emphasis on a possible relationship between processing and microstructure.
International Nuclear Information System (INIS)
Petel'guzov, I.A.
2002-01-01
In the report brought results of corrosion process studies in water medium of pipe samples for fuel element shells from Zr1Nb alloy (earlier KTZ-110),made from the calcium-thermal zirconium alloys developed in the Ukraine of technology and,for the comparison,samples of pipes from the staff alloy E110, applicable in fuel elements acting reactors of type WWER. Tests were conducted under the working temperature of fuel shells in the reactor (350 degree C) in during of 14000 hours and under increased temperatures (400 degree C) within a time acordinly 4000 hours. Samples from the alloy Zr1Nb had more high contents of oxygen (before 0,12%...0,16%), than staff alloy Eh110 (0,08%O). Studies have shown sufficiently high corrosion stability of experimental alloy Zr1Nb, close to stability of alloy E110.Discovered signs of corrosion 'breakway' or 'transition' on kinetic corrosion curves of Zr1Nb alloys and E110 alloy, characterisating zircaloy type of alloy. Considered mechanism of influence of oxygen on the corrosion process of zirconium alloys with the additive a niobium
Influence of microstructure on the accelerated corrosion in Zr-Nb alloys
International Nuclear Information System (INIS)
Muller, S; Lanzani, L
2012-01-01
The influence of microstructure on the accelerated corrosion of Zr-1%Nb and Zr-2.5%Nb (CANDU's pressure tube material) has been studied. The behavior of Zircaloy-4 was also studied in order to compare the Zr-Nb alloys with an alloy that does not have niobium as an alloying element. The corrosion tests were carried out in LiOH 0.1M at 340 o C, in LiOH 1M at the same temperature and in steam at 400 o C. The results showed that the behavior of Zr-Nb alloys in steam at 400 o C is similar to that of Zircaloy-4 in this medium. However, Zr-Nb alloys are more sensitive than Zircaloy-4 to the presence of LiOH. The results suggest that the niobium concentration in the matrix is the parameter that defines the oxidation rate in Zr-Nb alloys, while the presence of second phases in these alloys (β--Zr/β-Nb/Zr-Nb-Fe) could be related with the growth of non-protective oxides in LiOH solutions. In LiOH 1M, the corrosion resistance of Zr-Nb alloys is similar to that of Zircaloy-4, except for the Zr-1Nb martensitic material which showed a sharp increase in the oxidation rate in this medium (author)
Mode of carbide TiC-ZrC alloy fracture at various temperatures
Energy Technology Data Exchange (ETDEWEB)
Paderno, V.N.; Lesnaya, M.I.; Martynenko, A.N.; Chugunova, S.I. (AN Ukrainskoj SSR, Kiev. Inst. Problem Materialovedeniya; Khersonskij Gosudarstvennyj Pedagogicheskij Inst. (Ukrainian SSR))
1983-05-01
Bending strength is studied for mutual TiC-ZrC alloys within a temperature range of 20-600 deg C. Structure of the material failure surface is studied from replicas by scanning and transmission electron microscopy. The data obtained are compared with concentration dependences of some physical properties of these alloys. Bending strength is shown to be minimum for the alloy with 40 mol % of zirconium carbide. It is stated that within the temperature range under study the carbide alloys undergo macroscopic brittle failure. The materials are characterized by a mixed type of failure with transcrystalline failure somewhat prevailing.
Mode of carbide TiC-ZrC alloy fracture at various temperatures
International Nuclear Information System (INIS)
Paderno, V.N.; Lesnaya, M.I.; Martynenko, A.N.; Chugunova, S.I.
1983-01-01
Bending strength is studied for mutual TiC-ZrC alloys within a temperature range of 20-600 deg C. Structure of the material failure surface is studied from replicas by scanning and transmission electron microscopy. The data obtained are compared with concentration dependences of some physical properties of these alloys. Bending strength is shown to be minimum for the alloy with 40 mol % of zirconium carbide. It is stated that within the temperature range under study the carbide alloys undergo macroscopic brittle failure. The materials are characterized by a mixed type of failure with transcrystalline failure somewhat prevailing
Energy Technology Data Exchange (ETDEWEB)
Behera, A.N. [Mechanical Metallurgy Division, Bhabha Atomic Research Centre, Mumbai 400085 (India); Homi Bhabha National Institute, Anushakti Nagar, Mumbai 400094 (India); Kapoor, R., E-mail: rkapoor@barc.gov.in [Mechanical Metallurgy Division, Bhabha Atomic Research Centre, Mumbai 400085 (India); Homi Bhabha National Institute, Anushakti Nagar, Mumbai 400094 (India); Paul, B. [Materials Processing & Corrosion Engineering Division, Bhabha Atomic Research Centre, Mumbai 400085 (India); Chakravartty, J.K. [Mechanical Metallurgy Division, Bhabha Atomic Research Centre, Mumbai 400085 (India)
2017-04-15
Uniaxial compression tests were carried out on Nb-1 wt%Zr-0.1 wt%C alloy at temperature of 1500 and 1600 °C and strain rate of 0.1 s{sup −1} to study the evolution of dynamic recrystallization with strain. Electron back scatter diffraction was used to quantify the microstructural evolution. Nb-1Zr-0.1C alloy showed a necklace structure at a strain of 0.9 when deformed at 1500 °C and at strain of 0.6 when deformed at 1600 °C, both at strain rate of 0.1 s{sup −1}. This suggested the occurrence of dynamic recrystallization. At 1500 °C and strain of 0.9 the local average misorientation and the grain orientation spread was low confirming the presence of dynamic recrystallization at this deformation condition. At both 1500 and 1600 °C and all measured strains the recrystallized grains had a strong fiber component of <001>. - Highlights: • Necklace formation of dynamically recrystallized grains occurred at strain of 0.6 and 0.9 for 1500 and 1600 °C, respectively. • Equiaxed microstructures were seen with increase in strain for both 1500 and 1600 °C. • At large strains the predominant recrystallized texture evolved to <001> pole.
Phase transformations on Zr-Nb alloys
International Nuclear Information System (INIS)
Doi, Sergio Norifumi
1980-01-01
This research intended the laboratory scale experimental development of Zr-Nb alloys with adequate characteristics for use as fuel element cladding or for the making of irradiation capsules. Zr-Nb alloys with different Nb contents were melted and the resulting material was characterised. The following metallurgical aspects were considered: preparation of Zr-Nb alloys with various Nb contents; heat and thermomechanical treatments; microstructural characterization; mechanical properties; oxidation properties. The influence of the heat treatment and thermomechanical treatment, on the out-of-pile mechanical and oxidation properties of the Zr-Nb alloys were studied. It was found that the alloy microhardness increases with the Nb content and/or with the thermomechanical treatment. Mechanical properties such as yield and ultimate tensile strength as well as elongation were determined by means of compression tests. The results showed that the alloy yield stress increases with the Nb content and with the thermomechanical treatment, while its elongation decreases. Thermogravimetric analysis determined the alloy oxidation kinetics, in the 400 - 800 deg C interval, at 1 atm. oxygen pressure. The results showed that the alloy oxidation rate increases with the temperature and Nb content. It was also observed that the oxidation rate increases considerably for temperatures higher than 600 deg C.(author)
Heat treatment effect on the properties of welded joint of niobium alloys of the Nb-1Zr-C system
International Nuclear Information System (INIS)
Aref'ev, Yu.V; Chernyshova, T.A.; Pokosov, V.S.
1976-01-01
Thermal treatment of weld joints of the alloys Nb-1 Zr-(0.01-0.12)C at 800-900 deg C leads to decomposition of the solid solution of the weld metal which is accompanied with a decrease in plasticity and impact strength. The decomposition of the solid solution takes place even in a relatively pure alloy containing only 0.025% of intrusion impurities. Thermal treatment is reasonable only when carbon content in the alloys is no less than 0.1%. The decomposition of the solid solution in the weld metal of the alloy containing 0.12% of C takes place during thermal treatment at the expense of liberating niobium carbides Nb 3 C 2 and Nb 2 C. When rearrangement takes place, i it is Nb 2 C that liberates mainly
The corrosion behaviour of Zr3Al-based alloys
International Nuclear Information System (INIS)
Murphy, E.V.; Wieler, R.
1977-07-01
The corrosion resistance of several zirconium-aluminum alloys with aluminum contents ranging from 7.6 to 9.6 wt% was examined in 300 deg C and 325 deg C water, 350 deg C and 400 deg C steam and in air and wet CO 2 at 325 deg C and 400 deg C. In the transformed alloys there are three phases present, αZr, Zr 2 Al and Zr 3 Al of which the αZr phase is the least corrosion resistant. The most important factor controlling the corrosion behaviour of these alloys was found to be the size, distribution and amount of the αZr phase in the transformed alloys, which in turn was dependent upon the microstructural scale of the untransformed alloys
Features of ultrafine-grained structure forming in Zr-1Nb alloy
Energy Technology Data Exchange (ETDEWEB)
Stepanova, Ekaterina N.; Prosolov, Konstantin A. [National Research Tomsk Polytechnic University, Tomsk (Russian Federation); Grabovetskaya, Galina P.; Mishin, Ivan P. [Institute of Strength Physics and Materials Science of Siberian Branch of Russian Academy of Sciences, Tomsk (Russian Federation)
2013-07-01
Ultrafine-grained structure forming by the method combined reversible hydrogenation and hot pressing in Zr-1Nb alloy was investigated. Preliminary hydrogenation to concentrations of (0.14–0.4) % at 873 K is found to lead to yield strength decreasing in Zr-1Nb alloy during hot pressing by 1,5–2 times. During uniaxial compression at (70–72) % under isothermal conditions at a temperature of 873 K in Zr-1Nb alloy, hydrogenated to concentration of 0.22 %, homogeneous ultrafine grained structure with an average grain size of 0,4 P m was formed. Key words: zirconium alloy, ultrafine-grained structure, hydrogen.
Microstructural evolution and structure property correlation in Zr-1Nb and Zr-1Nb-1Sn-0.1Fe alloys
International Nuclear Information System (INIS)
Neogy, S.; Srivastava, D.; Chakravartty, J.K.; Dey, G.K.
2005-01-01
This study summarizes the evolution of microstructure and precipitation behavior in binary Zr-1Nb and quaternary Zr-1Nb-1Sn-0.1Fe alloys after different thermo mechanical processing. The processed microstructure and morphology of constituent phases and precipitates have been studied in detail using transmission electron microscopy (TEM). Microstructural studies have revealed the shape, size, size distribution and the nature of precipitate phases. Martensite formation and its tempering behavior have been studied in detail in both the alloys. Recrystallization studies on these alloys have been carried out with a view to understand the recrystallization mechanism. In case of the binary alloy the second phase recipitates were of the β type having composition varying from β I (20 wt% Nb) to β II (85 wt% Nb) depending on the heat treatment temperature and time. The second phase precipitates in the quaternary alloy were intermetallic Zr-Nb-Fe type and also β type rich in Zr. The orientation relationship existing between the precipitating phases and the a matrix were established in case of both the alloys. High resolution electron microscopy (HREM) of the martensitic microstructure and the recrystallized microstructure has revealed the internal structure and the interface structure of the martensite and the precipitating phases respectively. Structure-property correlation studies have been carried out on the heat-treated samples to evaluate the effect of the thermo mechanical processing on the microstructures and hence mechanical properties. (author)
Serbenta, V. A.; Skripnyak, N. V.; Skripnyak, V. A.; Skripnyak, E. G.
2017-12-01
This paper presents the results on the development of theoretical methods of evaluation and prediction of mechanical properties of Zr-Nb alloys over a range of strain rates from 10-3 to 103 s-1. The mechanical behavior of coarse- and ultrafine-grained Zr-1Nb (E110) was investigated numerically. The ranges of strain rates and temperatures in which the mechanical behavior of Zr-1Nb alloy can be described using modified models of Johnson-Cook and Zerilli-Armstrong were defined. The results can be used in engineering analysis of designed technical systems for nuclear reactors.
Microstructural and mechanical characterization of biomedical Ti-Nb-Zr(-Ta) alloys
International Nuclear Information System (INIS)
Elias, L.M.; Schneider, S.G.; Schneider, S.; Silva, H.M.; Malvisi, F.
2006-01-01
In recent years there has been a significant development of novel implant alloys based on β-Ti such as Ti-Nb-Zr and Ti-Nb-Zr-Ta alloys systems. The purpose of this work is to provide characterization of Ti-35.3Nb-5.1Ta-7.1Zr and Ti-41.1Nb-7.1Zr alloys, in which Nb will substitute the atomic amount of Ta, with emphasis in the property-microstructure-composition relationships. These alloys are produced from commercially pure materials (Ti, Nb, Zr and Ta) by an arc melting method. All ingots were submitted to sequences of heat treatment (1000 deg. C/2 h - WQ), cold working by swaging procedures and other heat treatment (1000 deg. C/2 h - WQ). Specimens, in as cast and heat-treated condition, were examined by light and scanning electron microscopy (SEM). These results suggested the presence of β- and ω-phases. Mechanical properties were based on tensile and hardness tests. These alloys exhibit a lower modulus than that of conventional Ti alloys and the other mechanical properties are suitable for biomedical applications
Corrosion behavior of Zr-x(Nb, Sn and Cu) binary alloys
International Nuclear Information System (INIS)
Kim, M. H.; Lee, M. H.; Park, S. Y.; Jung, Y. H.; We, M. Y.
1999-01-01
For the development of advanced zirconium alloys for nuclear fuel cladding, the corrosion behaviors of zirconium binary alloys were studied on the Zr-xNb, Zr-xSn, and Zr-xCu alloys. The corrosion test were performed in water at 360 deg C, steam at 400 deg C and LiOH at 360 deg C for 45 days. The corrosion behaviors of Zr-xNb was similar to that of Zr-xCu alloys. However, the corrosion behavior of Zr-xSn was different from Zr-xNb and Zr-xCu. The weight gain of Zr-xNb and Zr-xCu was increased with addition of alloying elements. When Sn is added to Zr matrix in range below the solubility limit, the corrosion resistance decrease with increasing Sn-content, while in the range over solubility limit, Sn has an adverse effect on the corrosion resistance. Especially, Zr-xSn alloys showed higher corrosion resistance than Zr-xNb and Zr-xCu alloys in LiOH solution
Thermal stability of the microstructure of an aged Nb-Zr-C alloy
Uz, Mehmet; Titran, Robert H.
1991-01-01
The effects of thermal aging with and without an applied stress on the microstructure of a Nb-Zr-C alloy containing 0.9 wt percent Zr and 0.06 percent C were studied. Chemical analysis, metallographic examination, energy dispersive X-ray spectra of the bulk material, and chemical and X-ray analyses of the phase-extracted residue were used to characterize the microstructure. The samples examined were from a creep strength study involving hot and cold working, and various combinations of exposure to temperatures ranging from 1350 to 1755 K with and without applied load times as long as 34,000 plus hours. The results showed that the initial microstructure consisted primarily of orthorombic precipitates of Nb sub C which were partially or completely transformed to face-centered cubic carbides of Nb and Zr, (Zr, Nb)C, upon prolonged exposure to elevated temperatures. Furthermore, it was found that the microstructure of the alloy is extremely stable owing to the very finely distributed precipitates throughout its matrix and along the grain boundaries. The lattice parameters of the cubic carbides were determined to vary from 0.458 to 0.465 nm as the Zr/Nb ratio varied from 38/62 to 75/25.
Thermal stability of the microstructure of an aged Nb-Zr-C alloy
International Nuclear Information System (INIS)
Uz, M.; Titran, R.H.
1991-01-01
The effects of thermally aging with and without an applied stress on the microstructure of a Nb-Zr-C alloy containing 0.9 wt % Zr and 0.06 wt % C were studied. Chemical analysis, metallographic examination, energy dispersive x-ray spectra of the bulk material, and chemical and x-ray analyses of the phase-extracted residue were used to characterize the microstructure. The samples examined were from a creep strength study involving hot and cold working, and various combinations of exposure to temperatures ranging from 1350 to 1755 K with and without applied load for times as long as 34,000 plus hours. The results showed that the initial microstructure consisted primarily of orthorhombic precipitates of Nb 2 C which were partially or completely transformed to face-centered cubic carbides of Nb and Zr, (Zr,Nb)C, upon prolonged exposure to elevated temperatures. Furthermore, it was found that the microstructure of the alloy is extremely stable owing to the very finely distributed precipitates throughout its matrix and along the grain boundaries. The lattice parameters of the cubic carbides were determined to vary from 0.458 to 0.465 nm as the Zr/Nb ratio varied from 38/62 to 75/25. 25 refs., 5 figs., 4 tabs
Observations of a Cast Cu-Cr-Zr Alloy
Ellis, David L.
2006-01-01
Prior work has demonstrated that Cu-Cr-Nb alloys have considerable advantages over the copper alloys currently used in regeneratively cooled rocket engine liners. Observations indicated that Zr and Nb have similar chemical properties and form very similar compounds. Glazov and Zakharov et al. reported the presence of Cr2Zr in Cu-Cr-Zr alloys with up to 3.5 wt% Cr and Zr though Zeng et al. calculated that Cr2Zr could not exist in a ternary Cu-Cr-Zr alloy. A cast Cu-6.15 wt% Cr-5.25 wt% Zr alloy was examined to determine if the microstructure developed would be similar to GRCop-84 (Cu-6.65 wt% Cr-5.85 wt% Nb). It was observed that the Cu-Cr-Zr system did not form any Cr2Zr even after a thermal exposure at 875 C for 176.5 h. Instead the alloy consisted of three phases: Cu, Cu5Zr, and Cr.
Microstructure and mechanical properties of Ti-Zr-Cr biomedical alloys.
Wang, Pan; Feng, Yan; Liu, Fengchao; Wu, Lihong; Guan, Shaokang
2015-06-01
The Ti-15Zr-xCr (0≤x≤10, wt.%) alloys were investigated to develop new biomedical materials. It was found that the phase constitutions and mechanical properties strongly depended on the Cr content. The Ti-15Zr alloy was comprised of α' phase and a small fraction of β phase was detected with adding 1wt.% Cr. With addition of 5wt.% or more, the β phase was completely retained. In addition, the ω phase was detected in the Ti-15Zr-5Cr alloy and Ti-15Zr-7Cr alloy which exhibited the highest compressive Young's modulus and the lowest ductility. On the other hand, all the Ti-15Zr-xCr alloys without ω phase exhibited high microhardness, high yield strength and superior ductility. Furthermore, the elastic energy of Ti-15Zr-10Cr alloy (5.89MJ/m(3)) with only β phase and that of Ti-15Zr-3Cr alloy (4.04MJ/m(3)) with α' phase and small fraction of β phase was higher than the elastic energy of c.p. Ti (1.25MJ/m(3)). This study demonstrated that Ti-15Zr-3Cr alloy and Ti-15Zr-10Cr alloy with superior mechanical properties are potential materials for biomedical applications. Copyright © 2015. Published by Elsevier B.V.
High-temperature strength of Nb-1%Zr alloy for irradiation-capsules inner-shell
International Nuclear Information System (INIS)
Nomura, Yasushi; Nakata, Hirokatsu; Tanaka, Mitsuo; Fukaya, Kiyoshi.
1978-04-01
Coated fuel particles in capsules will be irradiated at about 1600 0 C in JMTR. Nb-1%Zr alloy was chosen for inner shell material of the capsules because of its sufficient strength at 1000 0 C and low induced radioactivity. Nb-1%Zr ingot produced by electron beam melting was formed into seamless tubes by hollowing and swaging, followed by annealing. Creep test in helium flow and tensile test in vacuum were made to examine mechanical strength of the Nb-1%Zr tubes at 1000 0 C. Following are the results; 1) 0.2% yield stress at 1000 0 C is about 6 kg/mm 2 . 2) 3000 hr creep rupture stress at 1000 0 C is about 6 kg/mm 2 . (auth.)
Aqueous corrosion study on U-Zr alloy
International Nuclear Information System (INIS)
Pal, Titas; Venkatesan, V.; Kumar, Pradeep; Khan, K.B.; Kumar, Arun
2009-01-01
In low power or research reactor, U-Zr alloy is a potential candidate for dispersion fuel. Moreover, Zirconium has a low thermal-neutron cross section and uranium alloyed with Zr has excellent corrosion resistance and dimensional stability during thermal cycling. In the present study aqueous corrosion behavior of U-Zr alloy samples was studied in autoclave at 200 deg C temperature. Corrosion rate was determined from weight loss with time. (author)
International Nuclear Information System (INIS)
Doychak, J.; Barrett, C.A.; Smialek, J.L.
1989-01-01
This paper reports the isothermal and cyclic oxidation behavior of Zr-doped β-NiAl and β/γ' intermetallic alloys studied over the temperature range 1000 degrees C-1600 degrees C. Isothermal scale growth was governed by γ-Al 2 O 3 growth kinetics. The scale growth rates showed no monotonic trends with alloy aluminum content, although the stoichiometric β-NiAl alloy had the slowest kinetics. Cyclic oxidation at 1200 degrees C for 1000, 1-hr cycles of alloys having less than approximately 40 at %Al was poor due to the formation of martensite and less protective Ni-containing oxides. The cyclic oxidation behavior of Zr-doped stoichiometric β-NiAl was poor beyond 100, 1-hr cycles at 1425 degrees C. Computer modeling of the cyclic oxidation results was performed to arrive at limiting criteria for alloy service life. The limiting criteria were based on alloy aluminum depletion by oxidation that is necessary for less protective Ni-containing oxide formation. The modelling and lifetime criteria were applied to the cyclic oxidation of a Ni-50.2Al-0.04Zr (at%) alloy
Phase analysis and magnetocaloric properties of Zr substituted Gd-Si-Ge alloys
International Nuclear Information System (INIS)
Prabahar, K.; Raj Kumar, D.M.; Manivel Raja, M.; Chandrasekaran, V.
2011-01-01
The structure, microstructure, magneto-structural transition and magnetocaloric effect have been investigated in series of (Gd 5-x Zr x )Si 2 Ge 2 alloys with 0≤x≥0.20. X-ray powder diffraction analysis revealed the presence of orthorhombic structure for Zr containing alloys at room temperature in contrast to the monoclinic structure observed in the parent Gd 5 Si 2 Ge 2 alloy. The microstructural studies reveal that, low Zr addition (x≤0.1) resulted in low volume fraction of detrimental Gd 5 Si 3 -type secondary phase compared to that present in the parent alloy. All the Zr containing alloys have shown the presence of only second order magnetic transition unlike the parent alloy showing both first order structural and second order magnetic transition. A moderate (ΔS) M value of -5.5 J/kg K was obtained for the x=0.05 alloy at an enhanced operating temperature of 292 K compared to -7.8 J/kg K at 274 K of the parent alloy for an applied field of 2 T. The interesting feature of Zr (x=0.05) containing alloy is the wide operating temperature range of ∼25 K than that of ∼10-12 K for the parent, which resulted in enhanced net refrigerant capacity of 103 J/kg compared to that of 53 J/kg for the parent alloy. - Research highlights: → Zr addition in Gd 5 Si 2 Ge 2 alloy has been investigated for the first time to reduce the 5:3-type (Gd 5 Si 3 ) secondary phase formed when using commercial grade elements in Gd 5 Si 2 Ge 2 alloy. → It is interesting to observe that Zr addition decrease the volume fraction 5:3. → The refrigerator capacity and transition temperature of Zr added alloy is greater than the pure Gd 5 Si 2 Ge 2 which makes this alloy promising for room temperature application.
DENSITY-FUNCTIONAL STUDY OF U-Mo AND U-Zr ALLOYS
Energy Technology Data Exchange (ETDEWEB)
Landa, A; Soderlind, P; Turchi, P A
2010-11-01
Density-functional theory previously used to describe phase equilibria in U-Zr alloys [A. Landa, P. Soederlind, P.E.A. Turchi, J. Alloys Comp. 478 (2009) 103-110] is extended to investigate the ground-state properties of U-Mo solid solutions. We discuss how the heat of formation in both alloys correlates with the charge transfer between the alloy components, and how the specific behavior of the density of states in the vicinity of the Fermi level promotes the stabilization of the U{sub 2}Mo compound. Our calculations prove that, due to the existence of a single {gamma}-phase over the typical fuel operation temperatures, {gamma}-U-Mo alloys should indeed have much lower constituent redistribution than {gamma}-U-Zr alloys for which binodal decomposition causes a high degree of constituent redistribution.
Hydrogen storage behavior of ZrCo1-xNix alloys
International Nuclear Information System (INIS)
Jat, Ram Avtar; Parida, S.C.; Agarwal, Renu; Kulkarni, S.G.
2012-01-01
Intermetallic compound ZrCo is proposed as a candidate material for storage, supply and recovery of hydrogen isotopes in International Thermonuclear Experimental Reactor (ITER) Storage and Delivery System (SDS). However, it has been reported that upon repeated hydriding-dehydriding cycles, ZrCo undergoes disproportionation as per the reaction; 2ZrCo + H 2 ↔ ZrH 2 + ZrCO 2 . This results in reduction in hydrogen storage capacity of ZrCo, which is not a desirable property for SDS. Konishi et al. reported that the disproportionation reaction can be suppressed by decreasing the desorption temperature. It is anticipated that suitable ternary alloying of ZrCo can elevated the hydrogen equilibrium pressure and hence decrease the desorption temperature for supply of 100 kPa of hydrogen. In this study, we have investigated the effect of Ni content on the hydrogenation behavior of ZrCo 1-x Ni x alloys
Microstructural characterization of Zr1Nb alloy after hot rolling
Energy Technology Data Exchange (ETDEWEB)
Souza, A.C. [Universidade Estadual do Mato Grosso do Sul (UEMS), MS (Brazil); Rossi, J.L.; Martinez, L.G.; Mucsi, C.S. [Instituto de Pesquisas Energéticas e Nucleares (IPEN/CNEN-SP), São Paulo, SP (Brazil); Tsakiropoulos, P. [University of Sheffield (United Kingdom); Ceoni, F.C.; Grandini, C.R. [Universidade Estadual Paulista Julio de Mesquita Filho (UNESP), SP (Brazil)
2016-07-01
Full text: The different research lines within the scope in engineering and materials science have developed new materials that can be used in different industrial sectors, such as, energy, health and transportation. For the nuclear industry, for example, the Zr alloys, are of great interest due to its good mechanical properties, excellent corrosion resistance and above all, the high permeability to thermal neutrons. In the health sector, the zirconium poses one of the lowest Young's modulus when compared to other metallic biomaterials, e.g., pure Zr is 68 GPa, bone mineral hydroxyapatite is 80 GPa, for Ti alloys is 90 GPa and above, for Nb is 105 GPa and stainless steels above 189 GPa. This is particularly important for implants in bones, whose elasticity modulus can reach 30 GPa and it is desirable an as close match as possible. However, the zirconium alloys, have great chemical affinity with oxygen and nitrogen. Moreover, oxides and nitrides may form during the melting process, heat treatment and hot rolling, changing the physic-chemical properties of the alloy. This experimental work shows the results of the evolution of the microstructure after hot rolling of the Zr1Nb alloy. It was possible to confirm the absence of formation of oxides and nitrides, thus confirming the of the experimental method of melting and hot rolling of the Zr1Nb alloy. (author)
Mondol, S.; Makineni, S. K.; Kumar, S.; Chattopadhyay, K.
2018-05-01
This paper presents a detailed investigation on the effect of small amount of Nb and Zr additions to 2219 Al alloy coupled with a novel three-stage heat treatment process. The main aim of the work is to increase the high temperature strength of 2219 alloy by introducing thermally stable L12 type ordered precipitates in the matrix as well as by reducing the coarsening of metastable strengthening θ″ and θ' precipitates. To achieve this, small amounts of Nb and Zr are added to 2219 alloy melt and retained in solid solution by suction casting in a water-cooled copper mould having a cooling rate of 102 to 103 K/s. The suction cast alloy is directly aged at 673 K (400 °C) to form L12 type ordered coherent Al3Zr precipitates. Subsequently, the alloy is solution treated at 808 K (535 °C) for 30 minutes to get supersaturation of Cu in the matrix without significantly affecting the Al3Zr precipitates. Finally, the alloy is aged at 473 K (200 °C), which results in the precipitation of θ″ and θ'. Microstructural characterization reveals that θ″ and θ' are heterogeneously precipitated on pre-existing uniformly distributed Al3Zr precipitates, which leads to a higher number density of these precipitates. This results in a significant increase in strength at room temperature as well as at 473 K (200 °C) as compared to the 2219 alloy. Furthermore, the alloy remains thermally stable after prolonged exposure at 473 K (200 °C), which is attributed to the elastic strain energy minimization by the conjoint Al3Zr/θ' or Al3Zr/θ″ precipitates, and the high Zr and Nb solute-vacancy binding energy, retarding the growth and coarsening of θ″ and θ' precipitates.
Effect of Si and Zr on the Microstructure and Properties of Al-Fe-Si-Zr Alloys
Directory of Open Access Journals (Sweden)
Anna Morozova
2017-11-01
Full Text Available The effects of Si and Zr on the microstructure, microhardness and electrical conductivity of Al-Fe-Si-Zr alloys were studied. An increase in the Zr content over 0.3 wt. % leads to the formation of primary Al3Zr inclusions and also decreases mechanical properties. Therefore, the Zr content should not be more than 0.3 wt. %, although the smaller content is insufficient for the strengthening by the secondary Al3Zr precipitates. The present results indicate that high content of Si significantly affects the hardness and electrical conductivity of the investigated alloys. However, the absence of Si led to the formation of harmful needle-shaped Al3Fe particles in the microstructure of the investigated alloys after annealing. Therefore, the optimum amount of Si was 0.25–0.50 wt. % due to the formation of the Al8Fe2Si phase with the preferable platelet morphology. The maximum microhardness and strengthening effects in Al-1% Fe-0.25% Si-0.3% Zr were observed after annealing at 400–450 °C due to the formation of nanosized coherent Al3Zr (L12 dispersoids. The effect of the increasing of the electrical conductivity can be explained by the decomposition of the solid solution. Thus, Al-1% Fe-0.25% Si-0.3% Zr alloy annealed at 450 °C has been studied in detail as the most attractive with respect to the special focus on transmission line applications.
International Nuclear Information System (INIS)
Zakharova, M.I.; Khundzhua, A.K.; Kertesz, L.; Szasz, A.
1981-01-01
Changes in the crystal structure of the titanium alloy, containing 6.7 at% Mo, 3 at% Zr, and 1.8 at% Sn, during thermal decomposition are followed by means of X-ray and electron diffraction methods. Parallel to these tests the alteration in the electron structure and chemical bonds of the alloy are investigated with the help of the soft-x-ray emission (SXES) method. Attention is focussed on the at room temperature not equilibrated b.c.c. β-solid solution, on the metastable transition phase ω, and on the equilibrium phase α. (author)
Isothermal oxidation behavior of ternary Zr-Nb-Y alloys at high temperature
Energy Technology Data Exchange (ETDEWEB)
Prajitno, Djoko Hadi, E-mail: djokohp@batan.go.id [Research Center for Nuclear Materials and Radiometry, Jl. Tamansari 71, Bandung 40132 (Indonesia); Soepriyanto, Syoni; Basuki, Eddy Agus [Metallurgy Engineering, Institute Technology Bandung, Jl. Ganesha 10, Bandung 40132 (Indonesia); Wiryolukito, Slameto [Materials Engineering, Institute Technology Bandung, Jl. Ganesha 10, Bandung 40132 (Indonesia)
2014-03-24
The effect of yttrium content on isothermal oxidation behavior of Zr-2,5%Nb-0,5%Y, Zr-2,5%Nb-1%Y Zr-2,5%Nb-1,5%Y alloy at high temperature has been studied. High temperature oxidation carried out at tube furnace in air at 600,700 and 800°C for 1 hour. Optical microscope is used for microstructure characterization of the alloy. Oxidized and un oxidized specimen was characterized by x-ray diffraction. In this study, kinetic oxidation of Zr-2,5%Nb with different Y content at high temperature has also been studied. Characterization by optical microscope showed that microstructure of Zr-Nb-Y alloys relatively unchanged and showed equiaxed microstructure. X-ray diffraction of the alloys depicted that the oxide scale formed during oxidation of zirconium alloys is monoclinic ZrO2 while unoxidised alloy showed two phase α and β phase. SEM-EDS examination shows that depletion of Zr composition took place under the oxide layer. Kinetic rate of oxidation of zirconium alloy showed that increasing oxidation temperature will increase oxidation rate but increasing yttrium content in the alloys will decrease oxidation rate.
International Nuclear Information System (INIS)
Pinatti, D.G.; Baldan, C.A.; Dainesi, C.R.; Sandim, H.R.Z.
1988-01-01
The melting technology of niobium alloys with high ductilidade and high steam pressure, having the Ti, Zr and Ta as alloying elements is described. The electron beam technique for production of Nb 46,5%Ti, Nb 1%Zr and Nb 20%Ta alloys is analysed, aiming a product with high grade and low cost. (C.G.C.) [pt
Effect of metallurgical factors on the oxidation of Zr - 1% Nb Alloy
International Nuclear Information System (INIS)
Soliman, H.M.
1979-01-01
The importance of study of the oxidation behaviour of zirconium and its niobium alloys arises from their suitability as cladding and structural materials in nuclear reactors and their use in oxidizing conditions. This work includes the oxidation behaviour of Zr - 1%Nb in both air and steam, and to less extent, zirconium was investigated in air. The effect of 1%Nb, oxidizing medium, fluoride ions contamination and thermal cycling on the oxidation behaviour has been investigated using weight gain, plastic deformation generated during oxidation, electron microscopy , metallography and X- ray techniques. The kinetics of oxidation of Zr-1%Nb alloy have been studied in the temperature range 500 - 1200 degree C and 500 - 900 degree C in both air and steam, respectively. The oxidation rate increases with temperature, Initially, the reaction proceeds with a decreasing rate ( mainly parabolic) followed by transition to a linear or acceleration, indicating breakaway. As the oxidation temperature increases, the time to breakaway transition decreases
Creep properties of Nb-1Zr and Nb-1Zr-0.1C
International Nuclear Information System (INIS)
Horak, J.A.; Egner, L.K.
1994-12-01
In the early 1980s a compact, lithium cooled, fast-energy spectrum nuclear reactor was selected for space applications requiring prolonged uninterrupted electrical power. This reactor was to be capable of generating up to 100 kilowatts of electricity for times up to seven years in space and thus was given the acronym SP-100. The material selected for the fuel cladding, reactor heat transport systems and structural components was Nb-1 wt % Zr (Nb-1Zr). In addition to commercial Nb-1Zr, modified alloys containing 100--200 wt ppM each of carbon and nitrogen and 900 ± 150 wt ppM carbon were also included, Type B Nb-1Zr and PWC-11, respectively. The SP-100 reactor was designed to operate at temperatures of 1290--1425 K. At these temperatures the principal mode of deformation for Nb-1Zr is creep, and creep strain of the fuel cladding limits the useful reactor lifetime. To develop a creep data base for design, safety and reliability analyses, uniaxial creep testing of Nb-1Zr, Type B Nb-1Zr and PWC-11 was conducted from 1250--1450 K at stresses from 5.0 MPa to 41.4 MPa. Methodology and test results are presented
Nanotube morphology changes for Ti-Zr alloys as Zr content increases
International Nuclear Information System (INIS)
Kim, Won-Gi; Choe, Han-Cheol; Ko, Yeong-Mu; Brantley, William A.
2009-01-01
Nanotube morphology changes in Ti-Zr alloys as Zr content increases have been investigated. Ti-Zr (10, 20, 30 and 40 wt.%) alloys were prepared by arc melting and heat treated for 24 h at 1000 o C in an argon atmosphere. TiO 2 nanotubes were formed on the Ti-Zr alloys by anodization in H 3 PO 4 containing 0.5 wt.% NaF. Electrochemical experiments were performed using a conventional three-electrode configuration with a platinum counter electrode and a saturated calomel reference electrode. Samples were embedded in epoxy resin, leaving an area of 10 mm 2 exposed to the electrolyte. Anodization was carried out using a scanning potentiostat, and all experiments were conducted at room temperature. Microstructures of the alloys were examined by optical microscopy (OM), field emission scanning electron microscopy (FE-SEM) and x-ray diffraction (XRD). The Ti-Zr alloy microstructures observed by OM and FE-SEM changed from a lamellar structure to a needle-like structure with increasing Zr content. The microstructures also changed from β phase to increasing amounts of α phase as the Zr content increased. The number of large nanotubes formed by anodization decreased, and the number of small nanotubes increased, as the Zr content increased. The mean inner diameter ranged from approximately 150 to 200 nm with a tube-wall thickness of about 20 nm. The interspace between the nanotubes was approximately 60, 70, 100 and 130 nm for Zr contents of 10, 20, 30 and 40 wt.%, respectively.
Understanding hydride formation in Zr-1Nb alloy through microstructural characterization
International Nuclear Information System (INIS)
Neogy, S.; Srivastava, D.; Tewari, R.; Singh, R.N.; Dey, G.K.; De, P.K.; Banerjee, S.
2003-07-01
In this study the experimental results of hydride formation and their microstructure evolution in Zr-1Nb alloy is presented. This Zr-1Nb binary alloy and other Zr-1 Nb based ternary and quaternary alloys are being used as fuel tube materials and have the potential for meeting the requirement of high burn up fuel. Hydriding of Zr-1Nb alloy having a microstructure comprising equiaxed α grains and a uniform distribution of spherical particles of the β phase has been carried out in this study. The specimens have been hydrided by gaseous charging method to different hydrogen levels. The microstructures of hydrided samples were examined as a function of hydrogen content. The formation of δ hydride in slow cooled specimens and formation of γ hydride in rapidly cooled specimens has been studied with their morphology, habit plane and orientation relationship with the α matrix in view. The habit planes of either type of hydride phase has been determined and compared with those observed in other Zr-Nb alloys. The orientation relationship between the α matrix and the δ hydride was found to be the following: (0001) α // (111) δ and [1120] α // [110] δ . The orientation relationship between the α matrix and the γ hydride was of the following type: (0001) α // (111) γ and [1120] α // [110] γ . The internal structure of both types of hydride has been examined. The effect of the presence of the spherical β phase particles in the a matrix on the growth of the hydride plates has been investigated. (author)
Fabrication by powder metallurgy of the niobium based alloy Nb-1-Zr
International Nuclear Information System (INIS)
Marty, M.; Delaunay, C.; Walder, A.
1989-01-01
The Nb-1Zr alloy has been produced by the powder metallurgy technique. Production of powders was performed by centrifugal atomization with the rotating electrode process (REP) under an inert atmosphere of argon-helium. Alloy powders were characterized by granulometric spectra, oxygen content and the various types of structures which were found. After consolidation by extrusion, materials were evaluated by tensile test under vacuum at ambient temperature, 750 and 900 0 C and compared with the same alloy elaborated by ingot metallurgy. 8 refs., 9 figs. (Author)
TEM study on a new Zr-(Fe, Cu) phase in furnace-cooled Zr-1.0Sn-0.3Nb-0.3Fe-0.1Cu alloy
Liu, Yushun; Qiu, Risheng; Luan, Baifeng; Hao, Longlong; Tan, Xinu; Tao, Boran; Zhao, Yifan; Li, Feitao; Liu, Qing
2018-06-01
A new Zr-(Fe, Cu) phase was found in furnace-cooled Zr-1.0Sn-0.3Nb-0.3Fe- 0.1Cu alloy and alloys aged at 580 °C for 10min, 2 h and 10 h. Electron diffraction experiment shows the crystal structure of this phase to be body-centered tetragonal with unit cell dimensions determined to be a = b = 6.49 Å, c = 5.37 Å. Its possible space groups have been discussed and the reason accounting for its formation is believed to be the addition of Cu according to the atom-level images. In addition, no crystal structural or chemical composition changes were observed throughout the aging process.
Effect of heat treatment on the microstructures and damping properties of biomedical Mg-Zr alloy
Energy Technology Data Exchange (ETDEWEB)
Tsai, Ming-Hung [Department of Mechanical Engineering and Graduate Institute of Mechanical and Precision Engineering, National Kaoshiung University of Applied Sciences, Kaoshiung 807, Taiwan (China); Department of Dentistry, Chang Yin dental clinic, No.46-1, Yangming St., Banqiao City, Taipei County 220, Taiwan (China); Research Center for Biomedical Devices, Taipei Medical University, Taipei 110, Taiwan (China); Chen, May-Show [Research Center for Biomedical Devices, Taipei Medical University, Taipei 110, Taiwan (China); School of Oral Hygiene, College of Oral Medicine, Taipei Medical University, Taipei 110, Taiwan (China); Department of Dentistry, Taipei Medical University Hospital, Taipei 110, Taiwan (China); Lin, Ling-Hung [Department of Dentistry, Taipei Medical University Hospital, Taipei 110, Taiwan (China); School of Dentistry, College of Oral Medicine, Taipei Medical University, Taipei 110, Taiwan (China); Lin, Ming-Hong [Department of Mechanical Engineering and Graduate Institute of Mechanical and Precision Engineering, National Kaoshiung University of Applied Sciences, Kaoshiung 807, Taiwan (China); Wu, Ching-Zong, E-mail: chinaowu@tmu.edu.tw [Department of Dentistry, Taipei Medical University Hospital, Taipei 110, Taiwan (China); School of Dentistry, College of Oral Medicine, Taipei Medical University, Taipei 110, Taiwan (China); Ou, Keng-Liang, E-mail: klou@tmu.edu.tw [Research Center for Biomedical Devices, Taipei Medical University, Taipei 110, Taiwan (China); Graduated Institute of Biomedical Materials and Engineering, Taipei Medical University, Taipei 110, Taiwan (China); Research Center for Biomedical Implants and Microsurgery Devices, Taipei Medical University, Taipei 110, Taiwan (China); Yu, Chih-Hua [Research Center for Biomedical Devices, Taipei Medical University, Taipei 110, Taiwan (China); Research Center for Biomedical Implants and Microsurgery Devices, Taipei Medical University, Taipei 110, Taiwan (China)
2011-01-21
Research highlights: > When the as-quenched Mg-1Zr alloy was aged at temperatures ranging from 200 deg. C to 500 deg. C, a microstructural transformation sequence was found to be {alpha}-Mg {yields} ({alpha}-Mg + twin{sub dense}) {yields} ({alpha}-Mg + twin{sub loose}) {yields} ({alpha}-Mg + {alpha}-Zr). > As the as-quenched Mg-1Zr alloy was subjected to aging treatment at 300 deg. C for 16 h, it exhibited the maximum damping properties. > The twin structure plays a crucial role in increasing the damping capacity of the Mg-1Zr alloy. - Abstract: In this study, we elucidated the effect of heat treatment on the microstructures and damping properties of the biomedical Mg-1 wt% Zr (K1) alloy by optical microscopy, transmission electron microscopy, energy-dispersive X-ray spectrometry, and experimental model analysis. The following microstructural transformation occurred when the as-quenched (AQ, i.e., solution heat treated and quenched) K1 alloy was subjected to aging treatment in the temperature range 200-500 deg. C: {alpha}-Mg {yields} ({alpha}-Mg + twin{sub dense}) {yields} ({alpha}-Mg + twin{sub loose}) {yields} ({alpha}-Mg + {alpha}-Zr). This microstructural transformation was accompanied by variations in the damping capacity. The damping properties of the AQ K1 alloy subjected to aging treatment at 300 deg. C for 16 h were the best among those of the alloys investigated in the present study. The presence of twin structures in the alloy matrix was thought to play a crucial role in increasing the damping capacity of the K1 alloy. Hence, we state that a combination of solution treatment and aging is an effective means of improving the damping capacity of biomedical K1 alloys.
Effect of heat treatment on the microstructures and damping properties of biomedical Mg-Zr alloy
International Nuclear Information System (INIS)
Tsai, Ming-Hung; Chen, May-Show; Lin, Ling-Hung; Lin, Ming-Hong; Wu, Ching-Zong; Ou, Keng-Liang; Yu, Chih-Hua
2011-01-01
Research highlights: → When the as-quenched Mg-1Zr alloy was aged at temperatures ranging from 200 deg. C to 500 deg. C, a microstructural transformation sequence was found to be α-Mg → (α-Mg + twin dense ) → (α-Mg + twin loose ) → (α-Mg + α-Zr). → As the as-quenched Mg-1Zr alloy was subjected to aging treatment at 300 deg. C for 16 h, it exhibited the maximum damping properties. → The twin structure plays a crucial role in increasing the damping capacity of the Mg-1Zr alloy. - Abstract: In this study, we elucidated the effect of heat treatment on the microstructures and damping properties of the biomedical Mg-1 wt% Zr (K1) alloy by optical microscopy, transmission electron microscopy, energy-dispersive X-ray spectrometry, and experimental model analysis. The following microstructural transformation occurred when the as-quenched (AQ, i.e., solution heat treated and quenched) K1 alloy was subjected to aging treatment in the temperature range 200-500 deg. C: α-Mg → (α-Mg + twin dense ) → (α-Mg + twin loose ) → (α-Mg + α-Zr). This microstructural transformation was accompanied by variations in the damping capacity. The damping properties of the AQ K1 alloy subjected to aging treatment at 300 deg. C for 16 h were the best among those of the alloys investigated in the present study. The presence of twin structures in the alloy matrix was thought to play a crucial role in increasing the damping capacity of the K1 alloy. Hence, we state that a combination of solution treatment and aging is an effective means of improving the damping capacity of biomedical K1 alloys.
Thermomechanical processing of aluminum micro-alloyed with Sc, Zr, Ti, B, and C
McNamara, Cameron T.
Critical exploration of the minimalistic high strength low alloy aluminum (HSLA-Al) paradigm is necessary for the continued development of advanced aluminum alloys. In this study, scandium (Sc) and zirconium (Zr) are examined as the main precipitation strengthening additions, while magnesium (Mg) is added to probe the synergistic effects of solution and precipitation hardening, as well as the grain refinement during solidification afforded by a moderate growth restriction factor. Further, pathways of recrystallization are explored in several potential HSLA-Al syste =ms sans Sc. Aluminum-titanium-boron (Al-Ti-B) and aluminum-titanium-carbon (Al-Ti-C) grain refining master alloys are added to a series of Al-Zr alloys to examine both the reported Zr poisoning effect on grain size reduction and the impact on recrystallization resistance through the use of electron backscattered diffraction (EBSD) imaging. Results include an analysis of active strengthening mechanisms and advisement for both constitution and thermomechanical processing of HSLA-Al alloys for wrought or near-net shape cast components. The mechanisms of recrystallization are discussed for alloys which contain a bimodal distribution of particles, some of which act as nucleation sites for grain formation during annealing and others which restrict the growth of the newly formed grains.
Structure, mechanical properties and grindability of dental Ti-10Zr-X alloys
International Nuclear Information System (INIS)
Ho, W.-F.; Cheng, C.-H.; Pan, C.-H.; Wu, S.-C.; Hsu, H.-C.
2009-01-01
This study aimed to investigate the structure, mechanical properties and grindability of a binary Ti-Zr alloy added to a series of alloying elements (Nb, Mo, Cr and Fe). The phase and structure of Ti-10Zr-X alloys were evaluated using an X-ray diffraction (XRD) for phase analysis and optical microscope for microstructure of the etched alloys. Three-point bending tests were performed using a desk-top mechanical tester. Grindability was evaluated by measuring the amount of metal volume removed after grinding for 1 min at each of the four rotational speeds of the wheel (500, 750, 1000 or 1200 m/min). Results were compared with c.p. Ti, which was chosen as a control. Results indicated that the phase/crystal structure, microstructure, mechanical properties and grindability of the Ti-10Zr alloy can be significantly changed by adding small amounts of alloying elements. The alloying elements Nb, Mo, Cr and Fe contributed significantly to increasing the grinding ratio under all grinding conditions, although the grinding rate of all the metals was found to be largely dependent on grinding speed. The Ti-10Zr-1Mo alloy showed increases in microhardness (63%), bending strength (40%), bending modulus (30%) and elastic recovery angle (180%) over those of c.p. Ti, and was also found to have better grindability. The Ti-10Zr-1Mo alloy could therefore be used for prosthetic dental applications if other conditions necessary for dental casting are met
Alloying effects on structural and thermal behavior of Ti1-xZrxC: A first principles study
International Nuclear Information System (INIS)
Chauhan, Mamta; Gupta, Dinesh C.
2016-01-01
The formation energy, equilibrium lattice parameter, bulk modulus, Debye temperature and heat capacity at constant volume have been calculated for TiC, ZrC, and their intermediate alloys (Ti 1-x Zr x C, x = 0,0.25.0.5,0.75,1) using first principles approach. The calculated values of lattice parameter and bulk modulus agree well with the available experimental and earlier theoretical reports. The variation of lattice parameter and bulk modulus with the change in concentration of Zr atom in Ti 1-x Zr x C has also been reported. The heat capacities of TiC, ZrC, and their intermediate alloys have been calculated by considering both vibrational and electronic contributions.
Unusual morphology of the omega phase in a Zr-1.75 At. pct Ni alloy
International Nuclear Information System (INIS)
Srivastava, D.; Mukhopadhyay, P.; Ramadasan, E.; Banerjee, S.
1993-01-01
The observations reported in the present communication were made in the course of a microstructural investigation on dilute Zr-Ni alloys. The alloys were prepared from nuclear-grade sponge zirconium and high-purity nickel by nonconsumable arc melting. Repeated melting was carried out to enhance homogeneity. A master alloy was used in the preparation of very dilute alloys. The observations reported here clearly indicate that the formation of the ω phase on β quenching, can occur in the binary Zr-Ni system at very low solute concentrations, suggesting that nickel is a strong ω stabilizer. Such a situation is known to obtain in the binary Zr-Mo system also. However, the unusual ω morphology observed in the present work has not been reported in the context of dilute Zr-Mo alloys. The appearance of sharp ω reflections and the absence of streaking and diffuse distributions in the selected area electron diffraction (SAD) patterns suggest that the Zr-1.75 at. pct Ni composition lies toward the solute lean end of the composition range associated with the formation of the athermal ω phase in the binary Zr-Ni system. In a more dilute Zr-Ni alloy (Zr-1.30 at. pct Ni), no athermal ω could be observed in β quenched specimens. The absence of streaking is also consistent with the fact that the ω phase in the β quenched Zr-1.75 at. pct Ni alloy did not occur in the form of very fine precipitates. The unusual ω morphology encountered in this work merits further investigation
Microstructure and tensile properties of Fe-40 at. pct Al alloys with C, Zr, Hf, and B additions
Gaydosh, D. J.; Draper, S. L.; Nathal, M. V.
1989-01-01
The influence of small additions of C, Zr, and Hf, alone or in combination with B, on the microstructure and tensile behavior of substoichiometric FeAl was investigated. Tensile properties were determined from 300 to 1100 K on powder which was consolidated by hot extrusion. All materials possessed some ductility at room temperature, although ternary additions generally reduced ductility compared to the binary alloy. Adding B to the C- and Zr-containing alloys changed the fracture mode from intergranular to transgranular and restored the ductility to approximately 5 percent elongation. Additions of Zr and Hf increased strength up to about 900 K. Fe6Al6Zr and Fe6Al6Hf precipitates, both with identical body-centered tetragonal structures, were identified as the principal second phase in these alloys. Strength decreased steadily as temperature increased above 700 K, as diffusion-assisted mechanisms became operative. Although all alloys had similar strengths at 1100 K, Hf additions significantly improved high-temperature ductility by suppressing cavitation.
LCF behavior of Zr-4 alloy at elevated temperature
International Nuclear Information System (INIS)
Ye Yuming; Cai Lixun
2006-01-01
A series of strain fatigue tests were carried out on small bugle-like slice-specimens of Zr-4 alloy at room temperature and 400 degree C. According to Elastic and Plastic Finite Element Analysis and assumption of local damage equivalence, a strain conversion equation was given to transform the transverse strain of the specimen to the axial strain. Based on the test results of the alloy and the strain conversion equation, fatigue life estimation equations of Zr-4alloy, or M-C (Manson-Coffin) models, were obtained. The results showed that, Zr-4 alloy had obvious cyclic hardening character during high amplitude strain at different temperatures, but showed reverse character during low amplitude strain. Elevated temperature lowered seriously the fatigue life of Zr-4 alloys, ann as the increasing of amplitude strain, temperature effect impaired gradually. Analysis showed that the prediction life by using M-C model based on the traditional strain conversion equation was quite conservative when axial strain amplitude was less than 5000 micro-strain. (authors)
Influence of Temperature to Thermal Properties of U-Zr Alloy With The Zr Content Variation
International Nuclear Information System (INIS)
Aslina-Br-Ginting; Masrukan; M-Husna-Al-Hasa
2007-01-01
Have been done thermal of characteristic covering heat stability, heat capacities, enthalpy and also phase changes from uranium, zirkonium and U-Zr alloy with the Zr content variation of Zr 2 %, 6 %, 10% and 14% weight. Change of the temperature and composition anticipated will cause the characteristic of thermal to uranium metal, zirkonium and also U-Zr alloy. Therefore at this research was conducted using analysis influence of temperature to thermal of characteristic of uranium, zirkonium and U-Zr alloy with the Zr content variation by using DTA and DSC. Result of analysis indicate that the uranium metal at temperature 662 o C stable in phase α. Above at temperature, uranium metal experience of the phase change indicated by formed the thermochemical reaction as much 3 endothermic peak. At temperature 667.16 o C, happened by the phase change of α become the phase β with the enthalpy 2,3034 cal/g, at temperature 773.05 o C happened by the phase change β becoming phase γ 2,8725 cal/g and also at temperature 1125.26 the o C uranium metal experience the phenomenon become to melt with the enthalpy 2,1316 cal/g. (author)
Hydrogen traps in the oxide/alloy interface region of Zr-Nb alloys
International Nuclear Information System (INIS)
Khatamian, D.
1995-03-01
In this study the 1 H( 15 N,αγ) 12 C nuclear reaction has been used to measure hydrogen profiles of anodically oxidized Zr-Nb specimens containing various amounts of niobium. The profiles have been correlated with oxygen profiles, obtained using a Scanning Auger Microprobe (SAM), and with X-ray diffraction patterns. In addition, unoxidized Zr-2.5Nb (Zr-2.5 wt% Nb) samples were implanted with oxygen and hydrogen to study the interaction between these two species when dissolved in the alloy. All the anodically oxidized specimens, except the pure Zr and the single-phase β-Zr (Zr-20Nb) samples, displayed hydrogen peaks beneath the oxide layer. These results, in conjunction with the results from the implanted specimens, indicate that the hydrogen moves under the influence of a stress gradient to the sub-oxide region, where the metal lattice has been expanded due to superficial oxide growth. The results show that dissolved oxygen sites in Zr-2.5Nb alloy do not trap hydrogen. (author). 16 refs., 6 figs
Zr - based alloys as hydride electrodes in Ni-MH batteries
International Nuclear Information System (INIS)
Biris, A.R.; Biris, A.S.; Misan, I.; Lupu, D.
1999-01-01
Hydrogen storage alloys, MH, are already used in Ni-MH alkaline batteries conquering an important share of the rechargeable nickel-cadmium battery market. This remarkable success is due not only to the replacement of the toxic material, cadmium, by metal hydrides but also to an increased specific energy, which makes them attractive for electric vehicles. Many research groups are concerned in the improvement of the hydride electrode characteristics: hydrogen storage capacity, high-rate discharge ability, increased cycle life. These properties can be modified by substitution of the base components of a given alloy. A comparison of two types of alloys suitable for MH electrodes LaNi 5 able to store 1.36 w/o hydrogen with Zr(Ti)-Ni alloys of the AB 2 Laves phase type structure showed that the latter could absorb higher amounts of hydrogen. We report part of studies on Zr-V-Cr-Ni of the 15 C type Laves phase structure using our original procedure for pasted electrodes. The substitution of Cr for V atoms in ZrV 0.5 Ni 1 . 5 did not increase the discharge capacity. However, it proved to have a remarkable effect on the discharge capacity C at low temperatures. C at - 12 deg. C as compared to 20 deg.C increases up to ∼ 65 % for Cr containing alloys. (authors)
Influence of alkali metal hydroxides on corrosion of Zr-base alloys
International Nuclear Information System (INIS)
Jeong, Yong Hwan
1996-01-01
The influence of group-1 alkali hydroxides on different Zr-based alloys have been carried out in static autoclaves at 350 deg C in pressurized water, conditioned in low(0.32 mmol), medium(4.3 mmol) and high(31.5 mmol) equimolar concentration of Li-, Na-, K-, Rb- and Cs-hydroxide. Two types of alloys have been investigated: Zr-Sn-(TRM, Transition metal) and Zr-Sn-Nb-(TRM, Transition metal). From the experiments the cation could be identified as the responsible species for corrosion of Zr alloy in alkalized water. The radius of the cation governs the accelerated corrosion in the pre-transition region of Zr alloy. Incorporation of alkali cation into the zirconium oxide lattice is probably the mechanism which allows the corrosion enhancement for Li and Na and the significant lower effect for the other bases. Nb containing alloys showed lower corrosion resistance than Zr-Sn-TRM alloys in all alkali solutions. Both types of alloys were corroded significantly more in LiOH and NaOH than in the other alkali environments. Lowest corrosive aggressiveness has been found for CsOH followed by KOH. Concluding from the corrosion behavior in the different alkali environments and taking into account the tendency to accelerate the corrosion of Zr alloys, CsOH and KOH are possible alternate alkali for PWR (Pressurized Water Reactor) application. (author)
Corrosion Behaviour of New Zr Alloys
DEFF Research Database (Denmark)
Tolksdorf, E.
1974-01-01
Corrosion studies have indicated that the most promising replacements for Zicaloy-2 are ZrCrFe, ZrVFe and probably ZrNbTa, provided they are in their optimized condition. These alloys are conventionally manufactured alloys. An internally oxidized ZrMgO alloy is even superior, from the corrosion...
Thermal Expansion Property of U-Zr Alloys and U-Zr-Ce Alloys as a Surrogate Metallic Fuel for SFR
International Nuclear Information System (INIS)
Kim, Sun Ki; Lee, Jong Tak; Oh, Seok Jin; Ko, Young Mo; Kim, Ki Hwan; Woo, Youn Myung; Lee, Chan Bock
2010-01-01
Metal fuels was selected for fueling many of the first reactors in the US, including the Experimental Breeder Reactor-I (EBR-I) and the Experimental Breeder Reactor-II (EBR-II) in Idaho, the FERMI-I reactor, and the Dounreay Fast Reactor (DFR) in the UK. Metallic U.Pu.Zr alloys were the reference fuel for the US Integral Fast Reactor (IFR) program. An extensive database on the performance of advanced metal fuels was generated as a result of the operation of these reactors and the IFR program. In this study, the U-Zr binary alloys and U-Zr-Ce ternary alloys as surrogate metallic fuel were fabricated in lower pressure Ar environment by gravity casting. The melt temperature was approximately 1,500 .deg. C. Thermal expansion of the fuel during normal operation is related with fuel performance in a reactor. Therefore, it is necessary to investigate the thermal expansion of the fuel in order to warrant a good prediction the fuel performance
A Novel Zr-1Nb Alloy and a New Look at Hydriding
Energy Technology Data Exchange (ETDEWEB)
Robert D. Mariani; James I. Cole; Assel Aitkaliyeva
2013-09-01
A novel Zr-1Nb has begun development based on a working model that takes into account the hydrogen permeabilities for zirconium and niobium metals. The beta-Nb secondary phase particles (SPPs) in Zr-1Nb are believed to promote more rapid hydrogen dynamics in the alloy in comparison to other zirconium alloys. Furthermore, some hydrogen release is expected at the lower temperatures corresponding to outages when the partial pressure of H2 in the coolant is less. These characteristics lessen the negative synergism between corrosion and hydriding that is otherwise observed in cladding alloys without niobium. In accord with the working model, development of nanoscale precursors was initiated to enhance the performance of existing Zr-1Nb alloys. Their characteristics and properties can be compared to oxide-dispersion strengthened alloys, and material additions have been proposed to zirconium-based LWR cladding to guard further against hydriding and to fix the size of the SPPs for microstructure stability enhancements. A preparative route is being investigated that does not require mechanical alloying, and 10 nanometer molybdenum particles have been prepared which are part of the nanoscale precursors. If successful, the approach has implications for long term dry storage of used fuel and for new routes to nanoferritic and ODS alloys.
Corrosion properties of cladding materials from Zr1Nb alloy
International Nuclear Information System (INIS)
Kloc, K.; Kosler, S.
1975-01-01
The corrosion behaviour was observed of the Zr1Nb alloy in hot water and superheated steam and the effects of impurity content, of the purity of the corrosion environment and of the heat treatment of the alloy were studied on the alloy corrosion resistance. Also studied were the absorption of hydrogen by the alloy and its behaviour in reactor situations. It was ascertained that the alloy has a good corrosion resistance up to a temperature of 350 degC. The corrosion resistance is reduced by the presence of nitrogen above 50 to 70 ppm and of carbon above 50 to 90 ppm. A graphic representation is given of the dependence of corrosion resistance on the temperature of annealing, the nitrogen content of the alloy and the time of the action of hot water or steam, as well as the dependence of the hydrogen content in the alloy on the peripheral tension of the cladding in hot water both in non-active environment and at irradiation with a neutron flux of approximately 10 20 n/cm 2 . (J.B.)
Precipitation in cold-rolled Al-Sc-Zr and Al-Mn-Sc-Zr alloys prepared by powder metallurgy
Vlach, Martin
2013-12-01
The effects of cold-rolling on thermal, mechanical and electrical properties, microstructure and recrystallization behaviour of the AlScZr and AlMnScZr alloys prepared by powder metallurgy were studied. The powder was produced by atomising in argon with 1% oxygen and then consolidated by hot extrusion at 350 C. The electrical resistometry and microhardness together with differential scanning calorimetry measurements were compared with microstructure development observed by transmission and scanning electron microscopy, X-ray diffraction and electron backscatter diffraction. Fine (sub)grain structure developed and fine coherent Al3Sc and/or Al3(Sc,Zr) particles precipitated during extrusion at 350 C in the alloys studied. Additional precipitation of the Al3Sc and/or Al3(Sc,Zr) particles and/or their coarsening was slightly facilitated by the previous cold rolling. The presence of Sc,Zr-containing particles has a significant antirecrystallization effect that prevents recrystallization at temperatures minimally up to 420 C. The precipitation of the Al6Mn- and/or Al 6(Mn,Fe) particles of a size ~ 1.0 μm at subgrain boundaries has also an essential antirecrystallization effect and totally suppresses recrystallization during 32 h long annealing at 550 C. The texture development of the alloys seems to be affected by high solid solution strengthening by Mn. The precipitation of the Mn-containing alloy is highly enhanced by a cold rolling. The apparent activation energy of the Al3Sc particles formation and/or coarsening and that of the Al6Mn and/or Al 6(Mn,Fe) particle precipitation in the powder and in the compacted alloys were determined. The cold deformation has no effect on the apparent activation energy values of the Al3Sc-phase and the Al 6Mn-phase precipitation. © 2013 Elsevier Inc.
Precipitation in cold-rolled Al-Sc-Zr and Al-Mn-Sc-Zr alloys prepared by powder metallurgy
Vlach, Martin; Stulí ková , Ivana; Smola, Bohumil; Kekule, Tomá š; Kudrnová , Hana; Daniš, Stanislav; Gemma, Ryota; Očená šek, Vladivoj; Má lek, Jaroslav; Tanprayoon, Dhritti; Neubert, Volkmar
2013-01-01
The effects of cold-rolling on thermal, mechanical and electrical properties, microstructure and recrystallization behaviour of the AlScZr and AlMnScZr alloys prepared by powder metallurgy were studied. The powder was produced by atomising in argon with 1% oxygen and then consolidated by hot extrusion at 350 C. The electrical resistometry and microhardness together with differential scanning calorimetry measurements were compared with microstructure development observed by transmission and scanning electron microscopy, X-ray diffraction and electron backscatter diffraction. Fine (sub)grain structure developed and fine coherent Al3Sc and/or Al3(Sc,Zr) particles precipitated during extrusion at 350 C in the alloys studied. Additional precipitation of the Al3Sc and/or Al3(Sc,Zr) particles and/or their coarsening was slightly facilitated by the previous cold rolling. The presence of Sc,Zr-containing particles has a significant antirecrystallization effect that prevents recrystallization at temperatures minimally up to 420 C. The precipitation of the Al6Mn- and/or Al 6(Mn,Fe) particles of a size ~ 1.0 μm at subgrain boundaries has also an essential antirecrystallization effect and totally suppresses recrystallization during 32 h long annealing at 550 C. The texture development of the alloys seems to be affected by high solid solution strengthening by Mn. The precipitation of the Mn-containing alloy is highly enhanced by a cold rolling. The apparent activation energy of the Al3Sc particles formation and/or coarsening and that of the Al6Mn and/or Al 6(Mn,Fe) particle precipitation in the powder and in the compacted alloys were determined. The cold deformation has no effect on the apparent activation energy values of the Al3Sc-phase and the Al 6Mn-phase precipitation. © 2013 Elsevier Inc.
Precipitation in cold-rolled Al–Sc–Zr and Al–Mn–Sc–Zr alloys prepared by powder metallurgy
International Nuclear Information System (INIS)
Vlach, M.; Stulikova, I.; Smola, B.; Kekule, T.; Kudrnova, H.; Danis, S.; Gemma, R.; Ocenasek, V.; Malek, J.; Tanprayoon, D.; Neubert, V.
2013-01-01
The effects of cold-rolling on thermal, mechanical and electrical properties, microstructure and recrystallization behaviour of the AlScZr and AlMnScZr alloys prepared by powder metallurgy were studied. The powder was produced by atomising in argon with 1% oxygen and then consolidated by hot extrusion at 350 °C. The electrical resistometry and microhardness together with differential scanning calorimetry measurements were compared with microstructure development observed by transmission and scanning electron microscopy, X-ray diffraction and electron backscatter diffraction. Fine (sub)grain structure developed and fine coherent Al 3 Sc and/or Al 3 (Sc,Zr) particles precipitated during extrusion at 350 °C in the alloys studied. Additional precipitation of the Al 3 Sc and/or Al 3 (Sc,Zr) particles and/or their coarsening was slightly facilitated by the previous cold rolling. The presence of Sc,Zr-containing particles has a significant antirecrystallization effect that prevents recrystallization at temperatures minimally up to 420 °C. The precipitation of the Al 6 Mn- and/or Al 6 (Mn,Fe) particles of a size ∼ 1.0 μm at subgrain boundaries has also an essential antirecrystallization effect and totally suppresses recrystallization during 32 h long annealing at 550 °C. The texture development of the alloys seems to be affected by high solid solution strengthening by Mn. The precipitation of the Mn-containing alloy is highly enhanced by a cold rolling. The apparent activation energy of the Al 3 Sc particles formation and/or coarsening and that of the Al 6 Mn and/or Al 6 (Mn,Fe) particle precipitation in the powder and in the compacted alloys were determined. The cold deformation has no effect on the apparent activation energy values of the Al 3 Sc-phase and the Al 6 Mn-phase precipitation. - Highlights: • The Mn, Sc and Zr additions to Al totally suppresses recrystallization at 550 °C. • The Sc,Zr-containing particle precipitation is slightly facilitated by
Creep deformation behaviour and microstructural changes in Zr-2.5% Nb alloy
International Nuclear Information System (INIS)
Chaudhuri, S.; Singh, R.; Ghosh, R.N.; Sinha, T.K.; Banerjee, S.
2002-01-01
Cold worked and stress relieved Zr-2.5% Nb alloy is a well-known material used as pressure tubes in Pressurised Heavy Water Reactors. The pressure tubes, made of a typical Zr-alloy, consisting of 2.54% Nb, 0.1175% oxygen and less than 100 ppm impurities, are expected to withstand 9.5 MPa to 12.5 MPa pressure at 250 degC to 310 degC under fast neutron fluxes of 3.5 x 10 17 nm -2 s -1 . These tubes are made by hot extrusion at 780 degC with an extrusion ratio 8.3:1 and 40% cold pilgering followed by annealing at 550 degC for 3 hours and subsequently by 20-30% cold pilgering and stress relieving at 400 degC for 24 hours. The microstructure of such cold worked and stress relieved alloy consists of Β-Zr precipitates in the matrix of elongated Α-Zr grains. Although various factors such as irradiation creep, thermal creep, irradiation growth etc are responsible for limiting the life of pressure tubes; the thermal creep contributes significantly in overall creep deformation. Keeping this in view as well as due to non-availability of adequate published information including creep database on this alloy, an extensive investigation on the thermal creep behaviour of indigenously produced Zr-2.5% Nb alloy was undertaken. The creep tests in air using Mayes' creep testing machines were carried out in the temperature range of 300 degC to 450 degC under stresses in the range of 50 to 550 MPa. Analysis of data revealed that the mechanism of creep deformation remains the same in this range
Directory of Open Access Journals (Sweden)
Aritza Brizuela-Velasco
2017-01-01
Full Text Available The objective of the study is to characterise the mechanical properties of Ti-15Zr binary alloy dental implants and to describe their biomechanical behaviour as well as their osseointegration capacity compared with the conventional Ti-6Al-4V (TAV alloy implants. The mechanical properties of Ti-15Zr binary alloy were characterised using Roxolid© implants (Straumann, Basel, Switzerland via ultrasound. Their biomechanical behaviour was described via finite element analysis. Their osseointegration capacity was compared via an in vivo study performed on 12 adult rabbits. Young’s modulus of the Roxolid© implant was around 103 GPa, and the Poisson coefficient was around 0.33. There were no significant differences in terms of Von Mises stress values at the implant and bone level between both alloys. Regarding deformation, the highest value was observed for Ti-15Zr implant, and the lowest value was observed for the cortical bone surrounding TAV implant, with no deformation differences at the bone level between both alloys. Histological analysis of the implants inserted in rabbits demonstrated higher BIC percentage for Ti-15Zr implants at 3 and 6 weeks. Ti-15Zr alloy showed elastic properties and biomechanical behaviours similar to TAV alloy, although Ti-15Zr implant had a greater BIC percentage after 3 and 6 weeks of osseointegration.
Precipitation behaviors of cubic and tetragonal Zr–rich phase in Al–(Si–)Zr alloys
Energy Technology Data Exchange (ETDEWEB)
Gao, Tong [Australian Centre for Microscopy & Microanalysis, The University of Sydney, NSW 2006 (Australia); Key Laboratory of Liquid–Solid Structural Evolution and Processing of Materials, Ministry of Education, Shandong University, Jinan 250061 (China); Ceguerra, Anna; Breen, Andrew [Australian Centre for Microscopy & Microanalysis, The University of Sydney, NSW 2006 (Australia); Liu, Xiangfa; Wu, Yuying [Key Laboratory of Liquid–Solid Structural Evolution and Processing of Materials, Ministry of Education, Shandong University, Jinan 250061 (China); Ringer, Simon, E-mail: simon.ringer@sydney.edu.au [Australian Centre for Microscopy & Microanalysis, The University of Sydney, NSW 2006 (Australia)
2016-07-25
The precipitation behaviors of Zr–rich phase in binary Al–0.5Zr and ternary Al–3Si–0.5Zr alloys were investigated by high resolution transmission electron microscopy and atom probe. After the alloys were aged at 525 °C for 24 h, the precipitates in Al–0.5Zr alloy are identified as L1{sub 2}–ZrAl{sub 3}, performing a coherent relationship with the Al matrix. While in Al–3Si–0.5Zr alloy, the precipitates are Si–containing D0{sub 23}–Zr(Al,Si){sub 3}, which has an approximate 90° reversed cube–on–cube orientation relationship with Al. It is regarded that Si accelerates the precipitation of D0{sub 23}–Zr(Al,Si){sub 3}. - Highlights: • L1{sub 2}–ZrAl{sub 3} and D0{sub 23}–Zr(Al, Si){sub 3} particles precipitate in Al–Zr and Al–Si–Zr alloys. • D0{sub 23}–Zr(Al, Si){sub 3} performs an approximate 90° reversed cube–on–cube orientation relationship with Al. • Si accelerates the precipitation process of D0{sub 23}–Zr(Al,Si){sub 3}.
Superconductivity and NMR investigations of amorphous Be-Nb-Zr and Be-Mo-Zr alloys
International Nuclear Information System (INIS)
Goebbels, J.; Lueders, K.; Freyhardt, H.C.; Reichelt, J.
1981-01-01
9 Be NMR investigations and measurements of the superconducting properties and the resistivity are reported for amorphous Besub(32.5)Nbsub(x)Zrsub(67.5-x) and Besub(32.5)Mosub(x)Zrsub(67.5-x) alloys (x = 2.5; 5; 7). Line width analysis suggests an enlarged Nb concentration around the Be sites for the Be-Nb-Zr alloys. Comparing the two types of alloys the Knight shifts are of the same order of magnitude whereas the Tsub(c) and Bsub(c) 2 (0) values are slightly smaller than for the Nb alloys. For Be-Nb-Zr Tsub(c) and K increases with the Nb content. The results are discussed in connection with the density of states N(Esub(F)). (orig.)
Oxide impedance characteristics of the Zr-xNb alloys
International Nuclear Information System (INIS)
Park, S. Y.; Choi, B. K.; Jung, Y. H.; Jung, Y. H.
2002-01-01
To elucidate the correlation between the oxide impedance and corrosion characteristics of the Zr-xNb alloys, the long term corrosion test in high temperature / high pressure aqueous solution and the impedance test in the room temperature sulfate solution were performed. β-quenched plate specimens were heat-treated at 570 .deg. C for 500 hours to get the α+β Nb phase and the at 640 .deg. C for 10 hours to get the α+β Zr phase. The impedance test was conducted in sulfate solution for the initial corrosion test specimen (WG = 30 mg/dm 2 ). To evaluate the impedance date, 4 types of equivalent circuits were constructed by 5 parallel and serial RC elements. By using the equivalent circuits, the thickness of the inner and outer layers were calculated and the electric resistance of each layers were estimated. The corrosion behaviour of Zr-xNb alloys were quite different depending of the annealing condition and Nb-content. The corrosion resistance of the β Nb phase contained high Nb alloys were excellent rather than β Zr phase contained high Nb alloys. The electric resistance of the outer layer of β Zr phase contained high Nb alloy was twice larger than that of β Zr phase contained high Nb alloy, and in the case of outer layer 30% larger. So, the long term corrosion behaviors in high temperature could be estimated well by using the impedance test results
Constitutive Model for Hot Deformation of the Cu-Zr-Ce Alloy
Zhang, Yi; Sun, Huili; Volinsky, Alex A.; Wang, Bingjie; Tian, Baohong; Liu, Yong; Song, Kexing
2018-02-01
Hot compressive deformation behavior of the Cu-Zr-Ce alloy has been investigated according to the hot deformation tests in the 550-900 °C temperature range and 0.001-10 s-1 strain rate range. Based on the true stress-true strain curves, the flow stress behavior of the Cu-Zr-Ce alloy was investigated. Microstructure evolution was observed by optical microscopy. Based on the experimental results, a constitutive equation, which reflects the relationships between the stress, strain, strain rate and temperature, has been established. Material constants n, α, Q and ln A were calculated as functions of strain. The equation predicting the flow stress combined with these materials constants has been proposed. The predicted stress is consistent with experimental stress, indicating that developed constitutive equation can adequately predict the flow stress of the Cu-Zr-Ce alloy. Dynamic recrystallization critical strain was determined using the work hardening rate method. According to the dynamic material model, the processing maps for the Cu-Zr and Cu-Zr-Ce alloy were obtained at 0.4 and 0.5 strain. Based on the processing maps and microstructure observations, the optimal processing parameters for the two alloys were determined, and it was found that the addition of Ce can promote the hot workability of the Cu-Zr alloy.
Determination of Nb and Zr in U-Nb-Zr alloys by ICP-AES
International Nuclear Information System (INIS)
Wang Cuiping; Dong Shizhe; Li Lin; He Meiying
2003-01-01
The U-Nb-Zr alloy sample is dissolved by HNO 3 , H 2 O 2 and HF, and the contents of Nb and Zr in the sample are determined on the JY-70 II type ICP-AES by using the internal standard synchronous dilution method. The range of determination is 1%-10% and 0.33%-3.33%, respectively for Nb and Zr. The relative standard deviation is better than 3.2% for Nb, and 2.5% for Zr. The method is rapid and convenient for determining Nb and Zr in U-Nb-Zr alloy sample
Structure and properties of Al-Mg-Li-Zr system alloys
International Nuclear Information System (INIS)
Fridlyander, I.N.; Dolzhanskij, Yu.M.; Sandler, V.S.; Tyurin, .V.; Nikol'skaya, T.I.
1977-01-01
Studied were the structure and mechanical properties of the Al-Mg-Li-Zr alloy system (including 01420 alloy) containing 1.6-5.3%Li and 1.0-8.8%Mg). Electron microscopic studies of 01420 alloy conducted after heating at 450 deg C for 4 hours revealed non-uniformly distributed precipitations of a metastable phase ZrAl 3 , having spherical and needle-like configurations. These precipitations, together with zirconium contained in the solid solution, retard recrystallization. The introduction of 0.1-0.2% Zr decreases the limiting solubility of magnesium and lithium in the aluminium solid solution and leads to the formation of disperse equilibrium (S and, possibly, γ) phases with the size of 0.1-0.5 mcm. These phases were observed in the alloys containing (>=) 4% Mg and 1.9-3.5% Li. The method of planned experiment was used to study the principles governing the variation of the mechanical properties of the alloys subjected to water hardening and after aging at 170 deg C for 16 hours. It was established that the strength properties of the hardened alloys become higher, and the relative elongation decreases with the content of lithium and especially magnesium. It would be more proper to assess strengthening in the course of aging according to variation in the yield point and hardness. The effect of aging determined by the yield point depends on the content of lithium and is practically independent of the concentration of magnesium
Hydrogen isotope storage behavior of Zr1-xTixCo alloys
International Nuclear Information System (INIS)
Jat, Ram Avtar; Pati, Subhasis; Parida, S.C.; Agarwal, Renu; Mukerjee, S.K.
2016-01-01
Tritium storage properties similar to uranium make ZrCo as a suitable candidate material for storage, supply and recovery of hydrogen isotopes in various tritium facilities. Beside non-radioactive, nonpyrophoric at room temperature and higher storage capacity (H/f.u. up to 3, f.u. = ZrCo), it has been reported that upon repeated hydriding-dehydriding cycles, ZrCo undergoes dis-proportionation as per the reaction; ZrCo + H 2 ↔ ZrH 2 + ZrCo 2 . The present study is aimed to investigate the effect of Ti content on the hydrogen storage behavior of Zr 1-x Ti x Co alloys and the hydrogen isotope effect
Institute of Scientific and Technical Information of China (English)
钱昭; 范景莲; 成会朝; 田家敏
2012-01-01
采用粉末冶金方法制备Mo-Ti-Zr-TiC合金,研究微量TiC的添加对Mo-Ti-Zr-TiC合金的拉伸性能和显微组织的影响.结果表明,在Mo-Ti-Zr合金中添加微量TiC(0.1%~0.5%,质量分数)后,合金的相对密度和室温抗拉强度得到了提高,当TiC添加量为0.4%时,合金强度最高,较Mo-Ti-Zr合金提高了28.1%.微量TiC的添加,阻碍了合金烧结过程中的晶粒长大,合金晶粒尺寸随TiC添加量的增加而降低.添加的细小TiC粒子在高温烧结过程中或与坯体中的微量氧发生反应形成了由Mo、Ti、C及O 4种元素组成的(Mo,Ti)xOyCz细小复合第二相粒子,或发生团聚结成大颗粒,对合金起到净化晶界氧和弥散强化的作用,因而合金的性能相比Mo-Ti-Zr合金有了较明显的提高.%Mo-Ti-Zr-TiC alloy was prepared via powder metallurgy method. The effects of trace TiC additive on the mechanical properties and microstructure of TiC reinforced Mo-Ti-Zr-TiC alloy were studied. The results indicate that the relative density and the tensile strength at room temperature of Mo-Ti-Zr-TiC alloy is effectively enhanced by adding trace TiC (0.1wt%~0.5wt%). The tensile strength achieves the highest value when the content of TiC is 0.4wt%, which is 28.1% higher than that of Mo-Ti-Zr alloy. The adding of trace TiC can inhibit the grain growth during alloy sintering process, which leads to the decrease of grain sizes with the rise of TiC content. A part of the fine TiC particles react with trace oxygen in molybdenum matrix to form (Mo,Ti)xOyC2 compound second phase particles during high temperature sintering, while the other part are agglomerated into large particles, which play a role in grain boundaries purification and dispersion-strengthening.
Phase transition temperature in the Zr-rich corner of Zr-Nb-Sn-Fe alloys
Canay, M.; Danón, C. A.; Arias, D.
2000-08-01
The influence of small composition changes on the phase transformation temperature of Zr-1Nb-1Sn-0.2(0.7)Fe alloys was studied in the present work, by electrical resistivity measurements and metallographic techniques. For the alloy with 0.2 at.% Fe we have determined Tα↔α+β=741°C and Tα+β↔β=973°C, and for the 0.7 at.% Fe the transformation temperatures were T α↔α+β=712°C and T α+β↔β=961°C. We have verified that the addition of Sn stabilized the β phase.
Precipitation structures and mechanical properties of Al-Li-Zr alloy containing V
International Nuclear Information System (INIS)
Ying, J.K.; Ohashi, T.
1999-01-01
It is known that Al-Li alloys possess high elastic modulus and low density, and the metastable δ' (Al 3 Li) precipitate in these alloys affords considerable strengthening effect. However, with the strengthening resulting from the precipitation of δ' which is coherent with the matrix, these alloys suffer from low ductility and fracture toughness. It seems that the loss of ductility is the slip localization which occurs as a result of slip planes during deformation in connection with the specific hardening mechanism. As a result it indicates typical intergranular fracture. On the one hand, zirconium is used in many aluminum alloys to inhibit recrystallization during alloy processing. When zirconium is present in the alloy grain refinement occurs, which consequently, is considered as a factor that reduces the slip distance, and lowers the stress concentration across grain boundaries and at grain boundary triple points. Nevertheless, if only zirconium is added in Al-Li alloy it still shows intergranular fracture. By Zedaris et al., equilibrium phase Al 3 (Zr,V) in Al-Zr alloy containing V reduces the lattice mismatch along the c-axis with Al and, the L1 2 -structure metastable precipitates Al 3 (Zr,V) in Al-Zr-V alloys are stable at elevated temperature. Therefore, it is interesting to elucidate the effect of V in Al-Li-Zr alloy at the precipitation structures and mechanical properties of these alloys
Influence of oxygen on the interaction of Nb-Zr-C alloy with lithium
International Nuclear Information System (INIS)
Lyutyi, E.M.; Ignativ, M.I.
1980-01-01
This work is devoted to an investigation of the interaction of Nb-1% Zr-0.1% C alloy of different oxygen contents with molten technical-grade lithium. To obtain different oxygen contents in the steel, one lot of samples was annealed at 1400/degree/C for 2 h with a residual gas pressure of 0.1 mPa and the other under the same conditions in a vacuum of 10 mPa, which provided oxygen contents in the samples of 0.015 and 0.019 wt.%, respectively. The small difference between the oxygen contents in the samples of the two lots caused substantial differences in the interaction of the alloy with lithium. The sample with 0.015 wt.% oxygen had practically no corrosion even in holding in lithium for 1000 h. Impregnation of the samples with oxygen during the preliminary anneal leads to intensification of the corrosive action of lithium
Superconducting properties of amorphous Zr-Ge binary alloys
International Nuclear Information System (INIS)
Inoue, A.; Takahashi, Y.; Toyota, N.; Fukase, T.; Masumoto, T.
1982-01-01
A new type of refractory metal-metalloid amorphous alloys exhibiting superconductivity has been found in a binary Zr-Ge system by a modified melt-spinning technique. Specimens are in the form of continuous ribbons 1 to 2 mm wide and 0.02 to 0.03 mm thick. The germanium content in the amorphous alloys is limited to the range of 13 to 21 at%. These amorphous alloys are so ductile that no cracks are observed even after closely contacted bending test. Data are reported for various alloy compositions for the Vickers hardness and crystallization temperature, the tensile fracture strength, superconducting transition temperature Tsub(c), upper critical magnetic field, critical current density in the absence of an applied field, upper critical field gradient at Tsub(c) and the electrical resistivity at 4.2 K. The Ginzburg-Landau (GL) parameter and the GL coherence length were estimated to be 72 to 111 and about 7.9 nm, respectively, from these experimental values by using the Ginzburg-Landau-Abrikosov-Gorkov theory and hence it is concluded that the Zr-Ge amorphous alloys are extremely 'soft' type-II superconductor with high degree of dirtiness which possesses the Tsub(c) values higher than zirconium metal, in addition to high strength combined with good ductility. (author)
Arcella, F. G.
1974-01-01
Arc cast W, CVD W, CVD Re, and powder metallurgy Re materials were hot isostatically pressure welded to ten different refractory metals and alloys (Cb, Cb-1Zr, Ta, Ta-10W, T-111, ASTAR-811C, W-25Re, Mo-50Re, W-30Re-20Mo, ect.) and thermally aged at 10 to the minus 8th power torr at 1200, 1500, 1630, 1800, and 2000 C for 100 to 2000 hours. Electron beam microprobe analysis was used to characterize the interdiffusion zone width of each couple system as a function of age time and temperature. Extrapolations of interdiffusion zone thickness to 10,000 hours were made. Classic interdiffusion analysis was performed for several of the systems by Boltzmann-Matano analysis. A method of inhibiting Kirkendall voids from forming during thermal ageing of dissimilar metal junctions was devised and experimentally demonstrated. An electron beam weld study of Cb-1Zr to Re and W-25Re demonstrated the limited acceptability of these welds.
Energy Technology Data Exchange (ETDEWEB)
Erika, Teliz [Universidad de la República, Facultad de Ciencias, Laboratorio de Electroquímica Fundamental, Núcleo Interdisciplinario Ingeniería Electroquímica, Igua 4225, CP 11400 Montevideo (Uruguay); Ricardo, Faccio [Universidad de la República, Crystallography, Solid State and Materials Laboratory (Cryssmat-Lab), DETEMA, Centro NanoMat, Polo Tecnológico de Pando, Espacio Interdisciplinario, Facultad de Química, Montevideo (Uruguay); Fabricio, Ruiz [Consejo Nacional de Investigaciones Científicas y Técnicas , CONICET, Av. Rivadavia 1917, C1033AAJ Ciudad de Buenos Aires (Argentina); Centro Atómico Bariloche , Comisión Nacional de Energía Atómica (CAB-CNEA), Av. Bustillo 9500, CP 8400 S.C. de Bariloche, RN (Argentina); Fernando, Zinola [Universidad de la República, Facultad de Ciencias, Laboratorio de Electroquímica Fundamental, Núcleo Interdisciplinario Ingeniería Electroquímica, Igua 4225, CP 11400 Montevideo (Uruguay); and others
2015-11-15
The effects of partial replacement of chromium by molybdenum was studied on the structure and electrochemical kinetic properties of ZrCr{sub 1-x}NiMo{sub x}(x = 0.0, 0.3 and 0.6) metal hydride alloys. The arc-melting prepared alloys were metallurgically characterized by X-ray diffraction and energy dispersive spectroscopy microanalysis, which showed AB{sub 2} (with hexagonal C14 structure) and Zr{sub x}Ni{sub y} (Zr{sub 7}Ni{sub 10}, Zr{sub 9}Ni{sub 11}) phases. After a partial substitution of chromium by molybdenum, secondary phases monotonically increase with the C14 unit cell volume indicating that most of molybdenum atoms locate in the B-site. The alloys were electrochemically characterized using charge/discharge cycling, electrochemical impedance spectroscopy and rate capability experiments that allowed the determination of hydriding reaction kinetic parameters. The presence of molybdenum produces a positive effect for hydrogen diffusion in the alloy lattice, and ZrCr{sub 0.7}NiMo{sub 0.3} alloy depicts the better kinetics associated with a fast activation, lower charge transfer resistance and the best high rate discharge behavior. This fact would be related to a lower diffusion time constant and a bigger value of the product between exchange density current and surface active area. There is a trade-off in the amounts of secondary phase and Laves phases in order to improve the kinetic performance. - Highlights: • Metallurgical characterization evidences the presence of Zr{sub x}Ni{sub y} and C14 phases. • The partial replacement of Cr by Mo promotes the segregation of Zr{sub x}Ni{sub y} phase. • The incorporation of molybdenum improves the kinetics for the hydriding process. • Mo produces a decrease in the diffusion time constant.
Beta decomposition of (Hf/sub x/Zr/sub 1-x/)80Nb20 ternary alloys
International Nuclear Information System (INIS)
Jones, W.B.; Taggart, R.; Polonis, D.H.
1978-01-01
The processes of beta decomposition have been examined in ternary alloys of the form (Hf/sub x/Zr/sub 1-x/) 80 Nb 20 to determine the influence of Hf additions to a basic Zr 80 Nb 20 composition. In the chill cast condition, Hf additions have been found to decrease the temperature coefficient of electrical resistivity from a value of -0.0015%/K for the binary Zr 80 Nb 20 alloy to a value of -0.011%/K for a (Hf 50 Zr 50 ) 80 Nb 20 ternary alloy. This change is explained in terms of the bcc lattice instability typical of Ti, Zr, and Hf alloys. The Hf additions enhance the kinetics of omega-phase precipitation during aging at 648 K. The aging of a (Hf 05 Zr 95 ) 80 Nb 20 alloy for 12 h results in the precipitation of a high volume fraction of cuboidal shaped omega-phase particles. A phase separation which results in the formation of solute lean discs (β/sub l/) occurs together with the precipitation of the omega-phase. These discs formed both randomly within the matrix and heterogeneously along dislocations and at grain boundaries
51Cr diffusion in Zr-Sn alloys
International Nuclear Information System (INIS)
Nicolai, L.I.; Migoni, R.L.; Hojvat de Tendler, Ruth
1982-01-01
The 51 Cr volume diffusion in Zr-Sn alloys is measured in polycrystals with big grains by the thin-film method. The Sn content in the alloys ranges from 0.39% at to 6.66 % at. In the beta-phase the analysed temperature range is 982 deg C-1240 deg C. The Sn dehances the 51 Cr diffusion in beta-Zr, the effect being small but well defined. Assuming the formation of Sn-Cr dimers, the linear dehancement coefficient b and the parameters for the variation of b with temperature were calculated. The parameters Q and D o were calculated for the more diluted alloys and, upon application of the Zener theory for D o , a negative contribution to the activation entropy is found. Three experiments at different temperatures were performed in the alpha-phase. 51 Cr diffuses very fast in alpha-Zr-Sn. No definite correlation is found between the 51 Cr diffusivity and the increasing Sn concentration, probably due to the anisotropy of the alfa-phase. (M.E.L.) [es
Effect of nitrogen addition on superelasticity of Ti-Zr-Nb alloys
International Nuclear Information System (INIS)
Tahara, Masaki; Kim, Hee Young; Miyazaki, Shuichi; Inamura, Tomonari; Hosoda, Hideki
2008-01-01
Recently, the Ti-Zr-Nb alloys have been developed as Ni-free shape memory and superelastic alloys. In this study, the effect of Nb and nitrogen (N) contents on martensitic transformation behavior, shape memory effect and superelasticity in Ti-18Zr-(12-16)Nb-(0-1.0)N (at%) alloys were investigated using tensile tests, optical microscopy and X-ray diffraction. Shape memory effect was observed in Ti-18Zr-(12-13)Nb and Ti-18Zr-12Nb-0.5N alloys at room temperature. The superelastic behavior appeared by the increase of Nb or N content. The Ti-18Zr-(14-15)Nb, Ti-18Zr-(13-14)Nb-0.5N and Ti-18Zr-(12-14)Nb-1.0N alloys exhibited the superelasticity at room temperature. The martensitic transformation start temperature (M s ) decreased by 75 K with 1 at% increase of N content for Ti-18Zr-13Nb alloy. The critical stress for slip deformation and the stress for inducing the martensitic transformation increased with increasing N content. The superelastic recovery strain was also increased by adding N. The maximum recovery strain of 5.0% was obtained in the Ti-18Zr-14Nb-0.5N alloy. (author)
Corrosion resistance of amorphous NiCrZr and NiCrMoZr alloys
International Nuclear Information System (INIS)
Naka, M.; Miyake, M.; Okamoto, I.
1987-01-01
One of the authors has reported that the corrosion resistance of chromium containing amorphous alloys is extremely improved by alloying phosphorus among metalloids. Two factors operate for the improvement of corrosion resistance of the amorphous alloys. First, phosphorus serves for the rapid formation of protective passive film. Second, the compositional and structural homogeneity in amorphous state also account for the formation of protective film. The latter factor has been clearly seen in the high corrosion resistance of CoCrMoZr and CoCrWZr alloys without metalloids. In order to clarify the separately two factors in the corrosion resistance of amorphous alloys, the corrosion resistance of amorphous alloys without metalloids has to be further investigated. This paper also deals with the corrosion resistance and electrochemical behavior of NiCrZr and NiCrMoZr alloys in 1N HCl, and compare them with the corrosion behavior of the crystalline alloys containing the same composition as that of the amorphous alloys
Kar, Sujoy Kumar; Dheeradhada, Voramon S.; Lipkin, Don M.
2013-08-01
Alloys in the Mo-rich corner of the Mo-Ti-Zr-C system have found broad applications in non-oxidizing environments requiring structural integrity well beyond 1273 K (1000 °C). Alloys such as TZM (Mo-0.5Ti-0.08Zr-0.03C by weight %) and TZC (Mo-1.2Ti-0.3Zr-0.1C by weight) owe much of their high temperature strength and microstructural stability to MC and M2C carbide phases. In turn, the stability of the respective carbides and the subsequent mechanical behavior of the alloys are strongly dependent on the alloying additions and thermal history. A CALPHAD-based thermodynamic modeling approach is employed to develop a quaternary thermodynamic database for the Mo-Ti-Zr-C system. The thermodynamic database thus developed is validated with diffusion multiple experiments and the validated database is exercised to elucidate the effects of alloying and thermal history on the phase equilibrium in Mo-rich alloys.
Energy Technology Data Exchange (ETDEWEB)
Ohishi, Yuji, E-mail: ohishi@see.eng.osaka-u.ac.jp [Graduate School of Engineering, Osaka University (Japan); Kondo, Toshiki [Graduate School of Engineering, Osaka University (Japan); Ishikawa, Takehiko [Japan Aerospace Exploration Agency (Japan); SOKEN-DAI (Graduate University for Advanced Studies) (Japan); Okada, Junpei T. [Institute for Materials Research, Tohoku University (Japan); Watanabe, Yuki [Advanced Engineering Services Co. Ltd. (Japan); Muta, Hiroaki; Kurosaki, Ken [Graduate School of Engineering, Osaka University (Japan); Yamanaka, Shinsuke [Graduate School of Engineering, Osaka University (Japan); Research Institute of Nuclear Engineering, University of Fukui (Japan)
2017-03-15
It is important to understand the behaviors of molten core materials to investigate the progression of a core meltdown accident. In the early stages of bundle degradation, low-melting-temperature liquid phases are expected to form via the eutectic reaction between Zircaloy and stainless steel. The main component of Zircaloy is Zr and those of stainless steel are Fe, Ni, and Cr. Our group has previously reported physical property data such as viscosity, density, and surface tension for Zr-Fe liquid alloys using an electrostatic levitation technique. In this study, we report the viscosity, density, and surface tension of Zr-Ni and Zr-Cr liquid alloys (Zr{sub 1-x}Ni{sub x} (x = 0.12 and 0.24) and Zr{sub 0.77}Cr{sub 0.23}) using the electrostatic levitation technique. - Highlights: • The physical properties of Zr-Ni and Zr-Cr liquid alloys have been measured Zr{sub 1-x}Ni{sub x} (x = 0.12 and 0.24) and Zr{sub 77}Cr{sub 23}. • The measurement was conducted using the electrostatic levitation technique. • The density, viscosity, and surface tension of each liquid alloy were measured.
International Nuclear Information System (INIS)
Ohishi, Yuji; Kondo, Toshiki; Ishikawa, Takehiko; Okada, Junpei T.; Watanabe, Yuki; Muta, Hiroaki; Kurosaki, Ken; Yamanaka, Shinsuke
2017-01-01
It is important to understand the behaviors of molten core materials to investigate the progression of a core meltdown accident. In the early stages of bundle degradation, low-melting-temperature liquid phases are expected to form via the eutectic reaction between Zircaloy and stainless steel. The main component of Zircaloy is Zr and those of stainless steel are Fe, Ni, and Cr. Our group has previously reported physical property data such as viscosity, density, and surface tension for Zr-Fe liquid alloys using an electrostatic levitation technique. In this study, we report the viscosity, density, and surface tension of Zr-Ni and Zr-Cr liquid alloys (Zr 1-x Ni x (x = 0.12 and 0.24) and Zr 0.77 Cr 0.23 ) using the electrostatic levitation technique. - Highlights: • The physical properties of Zr-Ni and Zr-Cr liquid alloys have been measured Zr 1-x Ni x (x = 0.12 and 0.24) and Zr 77 Cr 23 . • The measurement was conducted using the electrostatic levitation technique. • The density, viscosity, and surface tension of each liquid alloy were measured.
Damping characteristics of a Ti40.5Ni49.5Zr10 shape memory alloy
International Nuclear Information System (INIS)
Hsieh, S.F.; Wu, S.K.
2005-01-01
Ti 40.5 Ni 49.5 Zr 10 alloy undergoes B2-bar B19' martensitic transformation. Damping capacities of B19' and B2 phases of this alloy are lower than those of Ti 51 Ni 49 alloy due to Zr atoms solid-soluted hardening. Transformation temperatures of this alloy decrease, but transformation peak heights Q max -1 increase with increasing aging time at 300 o C due to the formation of finer (001) M twins for specimens aged longer. The Q max -1 peaks of the slightly cold-rolled Ti 40.5 Ni 49.5 Zr 10 alloy are higher than those of the as-annealed alloy, which may be because the thinner twins are induced by small deformation
Interdiffusion among U-Mo-Zr and alloys of Al to 550oC
International Nuclear Information System (INIS)
Komar Varela, C.L; Arico, S.F; Gribaudo, L.M
2006-01-01
The international community, by means of the project 'Reduced Enrichment for Research and Test Reactors' is interested in the development of a new nuclear fuel of very high density of uranium and low enrichment (≤ 20% de U 235 ) for reactors of investigation and production of radioisotopes, that permit to reach greater neutron flows, with good capacity to be reprocessed One of these assemblies are the alloys of U with Mo contents between 7 and 10% in weight. In the fuels 'dispersed type plate' the particles of U-Mo are mixed with dust of aluminum and are co - laminated between two plates of an alloy of the same material. The existing contact among the particles permits the interdiffusion of the materials with the consequent apparition of new phases. Studies pursuit-irradiation have shown a badly behavior of these new phases. It is for this that is necessary to control the presence of these products of interaction. The aggregate of a third element to the alloys U - Mo has begun to be practiced with this purpose. In this work the modification of the start of the disorder of the phase γU in the alloy U-7%Mo-1%Zr was studied and the interdiffusion between pure aluminum and the same alloy to 550 o C. The results obtained are compared with other obtained for peers U-Mo/Al. The techniques of characterization utilized were: optical microscopy, analysis by diffraction of X-rays and microanalysis quantitative by microprobe electronic. It was observed that the aggregate of Zr refines the grain for a processing of homogenized in composition of Mo to 1000 o C and accelerates the start of the disorder of the phase γU to 550 o C. As for the zone of interaction, was found that the composed identifying do not they differ to them reported in the in peers U-Mo/Al. These are: (U,Mo)Al 4 y UAl 3 (AG)
International Nuclear Information System (INIS)
Krasnorutsky, V.S.; Petel'guzov, I.A.; Gritsina, V.M.; Rodak, A.G.; Belash, N.N.; Yakovlev, V.K.
2006-01-01
In the article happen to results of testing the fuel rod models, their welded joints, changing the mechanical characteristics of shells of models from experimental parties of pipes from Zr1Nb alloy (Zr+1 mass%Nb) at heating of models, pervaded helium before pressures, using in earned one's living fuel rods (2,2 MPa), before the temperature 770 degree C and above occurs an overblown fuels, but at temperature 820...830 degree C shells can be broken at the expense of pressure of warming gas. Swept away reduction plasticity and embrittlement shells after the heating under temperature of 900...1200 degree C and cooling before room temperature pipes-shells from Zr1Nb alloy and from the staff alloy E110
Alternative Zr alloys with irradiation resistant precipitates for high burnup BWR application
International Nuclear Information System (INIS)
Garzarolli, F.; Ruhmann, H.; Van Swan, L.
2002-01-01
In the core of BWRs, the second-phase particles (SPP) of Zircaloy-2 and Zircaloy-4, the Zr(FeCr) 2 and the Zr 2 (FeNi) phase, release Fe and dissolve. The degree of dissolution depends on initial size and fluence. These SPP, however, are important for the corrosion behavior of Zircaloy. Zircaloy shows an increase of corrosion at a certain burnup, depending on the initial SPP size and fast neutron fluence. Only Zr alloys with irradiation resistant SPP avoid this type of increased corrosion completely. Two types of irradiation resistant materials were considered. One is a Zr-Sn-Fe alloy containing the Zr 3 Fe phase, which is irradiation resistant under BWR conditions. The other material is a Zr-Sn-Nb alloy containing the irradiation resistant β-Nb phase. In-BWR tests have shown that a Sn content of >0.8% is mandatory to minimize the nodular corrosion. Two prototypes of irradiation resistant alloys, Zr1.3Sn0.25-0.3 Fe and Zr1Sn2-3Nb, were irradiated in a BWR for 1372 days to a fast fluence of 9 x 10 21 n/cm 2 (E > 1 MeV). These irradiation tests showed that Zr1.3Sn0.25-0.3 Fe has a little lower resistance against nodular corrosion than optimized LTP (Low Temperature Process) Zircaloy-2/4 and revealed that Zr1Sn2-3Nb is superior to LTP Zircaloy-2/4 with respect to nodular and shadow corrosion resistance. The BWR corrosion resistance of Zr1Sn2-3Nb depends on heat treatment. The lowest corrosion was observed with material fabricated completely in the α-range, but also material manufactured in the lower (α+β)-range exhibits low corrosion. Material fabricated in the upper (α+β)-range showed a somewhat higher corrosion, a corrosion behavior similar to LTP Zircaloy-2/4. As far as final annealing is concerned, a long time annealing at 540 deg C is superior to a standard recrystallization treatment (e.g., at 580 deg C), which still leads to a corrosion behavior that is better than stress relieved Zr1Sn2-3Nb. Zr1Sn2-3Nb is resistant to shadow corrosion, when fabricated
International Nuclear Information System (INIS)
Lee Peeyew; Koch, C.C.
1994-01-01
The microstructural change of Ni 40 Zr 60 alloy during mechanical alloying of mixtures of the intermetallic compounds NiZr 2 and Ni 11 Zr 9 has been studied by transmission electron microscopy. A specific ''cauliflower'' phase was formed during early stage of mechanical alloying process. It is suggested that the solid state reaction between intermetallic compounds NiZr 2 and Ni 11 Zr 9 is not the only origin for the formation of the ''cauliflower'' phase. ((orig.))
International Nuclear Information System (INIS)
Hellio, C.; Novion, C.H. de; Boulanger, L.
1987-01-01
Pure zirconium and four (annealed) α - zirconium based alloys (Zr-1760 ppm weight 0, Zr - 1% Nb - 430 ppm 0, Zr-1% Nb-1800 ppm 0, zircaloy 4) have been studied by transmission electron microscopy after 500 keV Zr + ion or 1 MeV electron irradiation performed at high temperature. Type of burgers vectors of the dislocation loops are given; in the case of electron irradiated Zr-1760 ppm 0, the larger loops were found of interstitial type. Alloying elements increase the loop density. The kinetic of loop growth was observed in-situ during 1 MeV electron irradiation between 400 and 700 0 C: oxygen was found to reduce considerably the growth speed of loops. In-situ annealing at 450 or 500 0 C after ion irradiation led to a large coalescence of loops in the case of pure zirconium, but modified only slightly the defect structure of the alloys
International Nuclear Information System (INIS)
Liu, X.B.; Chen, R.S.; Han, E.H.
2008-01-01
Mg-10Gd-3Y-0.5Zr alloys with and without 1% Zn additions have been investigated using optical microscopy, scanning electron microscope and X-ray diffraction. The microstructures, ageing hardening behaviors and mechanical properties of the two alloys are compared. The extruded-T5 specimens exhibit remarkable age hardening responses during ageing from 200 to 250 deg. C. The highest peak hardness and strength of the two alloys are obtained when they are aged at 200 deg. C. Addition of 1% Zn to Mg-10Gd-3Y-0.5Zr alloy results in the greater magnitude ageing effect and better mechanical properties as well as better heat resistance. Furthermore, secondary ageing is carried out at 200 deg. C following preliminary ageing at 250 deg. C for both Mg-10Gd-3Y-0.5Zr and Mg-10Gd-3Y-1Zn-0.5Zr alloys. The ultimate tensile strength values after secondary ageing are slightly lower compared with the highest strength of the two alloys, but secondary ageing offers a better combination of high strength and ductility
Development of Zr alloys - Fabrication of Zr-Nb alloy used in PHWRs
Energy Technology Data Exchange (ETDEWEB)
Lee, Kang In; Kim, Won Baek; Choi, Guk Sun; Lee, Chul Kyung; Jang, Dae Kyu; Seo, Chang Yeol; Sim, Kun Joo; Lee, Jae Cheon [Korea Institute of Geology Mining and Materials, Taejon (Korea, Republic of)
1996-07-01
The manufacture of Zr-Nb alloy ingot by EB melting process is carried out to meet the chemical composition and mechanical and property specifications and to ensure that the ingots are free of unacceptable defects through this study. It was established that Zr-Nb alloy was made by EB melting technique including the control of adding elements, melting power and melting and cast device. 28 refs., 13 tabs., 26 figs., 23 ills. (author)
International Nuclear Information System (INIS)
Klimenko, S.P.; Gritsina, V.M.; Petel'guzov, I.A.; Chernyaeva, T.P.
2007-01-01
The paper determines the applicability areas of different methods for the study of structural phase transformations in a Zr+1Nb alloy, which is extensively used in reactor construction; production and fabrication of products from Zr+1Nb is currently developed in Ukraine. Electromotive force and electric resistance were measured to study structural phase transformations of Zr+1Nb fuel rod tubes based on calciumthermal zirconium (Zr1Nb). It was established that changes in electric resistance clearly show the beginning of a massive α → β transition at ∼ 750 degree C and the end of α → β transition at ∼ 950 degree C, whereas measurement of thermo-e.m.f. in the samples subjected to successive 3-hour step annealing in the temperature range from 300 to 700 degree C allows the temperature of monotectoid transformation to be found. For sample Zr1Nb batches the temperature of monotectoid transformation is (620±7) degree C. The measurement results are consistent with the similar studies carried out on Zr+1Nb fuel rod tubes based on electrolytic zirconium (E110), for which the temperature of monotectoid transformation is equal to ∼ 610 degree C
Moessbauer and transport studies of amorphous and icosahedral Zr-Ni-Cu-Ag-Al alloys
International Nuclear Information System (INIS)
Stadnik, Z.M.; Rapp, O.; Srinivas, V.; Saida, J.; Inoue, A.
2002-01-01
The alloy Zr 65 Al 7.5 Ni 10 Cu 7.3 Fe 0.2 Ag 10 in the amorphous and icosahedral states, and the bulk amorphous alloy Zr 65 Al 7.5 Ni 10 Cu 7.5 Ag 10 , have been studied with 57 Fe Moessbauer spectroscopy, electrical resistance and magnetoresistance techniques. The average quadrupole splitting in both alloys decreases with temperature as T 3/2 . The average quadrupole splitting in the icosahedral alloy is the largest ever reported for a metallic system. The lattice vibrations of the Fe atoms in the amorphous and icosahedral alloys are well described by a simple Debye model, with the characteristic Moessbauer temperatures of 379(29) and 439(28) K, respectively. Amorphous alloys Zr 65 Al 7. )5Ni 10 Cu 7.5 Ag 10 and Zr 65 Al 7.5 Ni 10 Cu 7.3 Fe 0.2 Ag 10 have been found to be superconducting with the transition temperature, T c , of about 1.7 K. The magnitude of Tc and the critical field slope at Tc are in agreement with previous work on Zr-based amorphous superconductors, while the low-temperature normal state resistivity is larger than typical results for binary and ternary Zr-based alloys. The resistivity of icosahedral Zr 65 Al 7.5 Ni 10 Cu 7.3 Fe 0.2 Ag 10 is larger than that for the amorphous ribbon of the same composition, as inferred both from direct measurements on the ribbons and from the observed magnetoresistance. However the icosahedral sample is non-superconducting in the measurement range down to 1.5 K. The results for the resistivity and the superconducting T c both suggest a stronger electronic disorder in the icosahedral phase than in the amorphous phase. (author)
Zhang, Dongdong; Bai, Fang; Wang, Yong; Wang, Jinguo; Wang, Wenquan
2017-08-08
The TiC p /Cu master alloy was prepared via thermal explosion reaction. Afterwards, the nano-sized TiC p /Cu master alloy was dispersed by electromagnetic stirring casting into the melting Cu-Cr-Zr alloys to fabricate the nano-sized TiC p -reinforced Cu-Cr-Zr composites. Results show that nano-sized TiC p can effectively refine the grain size of Cu-Cr-Zr alloys. The morphologies of grain in Cu-Cr-Zr composites changed from dendritic grain to equiaxed crystal because of the addition and dispersion of nano-sized TiC p . The grain size decreased from 82 to 28 μm with the nano-sized TiC p content. Compared with Cu-Cr-Zr alloys, the ultimate compressive strength (σ UCS ) and yield strength (σ 0.2 ) of 4 wt% TiC p -reinforced Cu-Cr-Zr composites increased by 6.7% and 9.4%, respectively. The wear resistance of the nano-sized TiCp-reinforced Cu-Cr-Zr composites increased with the increasing nano-sized TiCp content. The wear loss of the nano-sized TiC p -reinforced Cu-Cr-Zr composites decreased with the increasing TiC p content under abrasive particles. The eletrical conductivity of Cu-Cr-Zr alloys, 2% and 4% nano-sized TiCp-reinforced Cu-Cr-Zr composites are 64.71% IACS, 56.77% IACS and 52.93% IACS, respectively.
Hydrogen calibration of GD-spectrometer using Zr-1Nb alloy
Mikhaylov, Andrey A.; Priamushko, Tatiana S.; Babikhina, Maria N.; Kudiiarov, Victor N.; Heller, Rene; Laptev, Roman S.; Lider, Andrey M.
2018-02-01
To study the hydrogen distribution in Zr-1Nb alloy (Э110 alloy) GD-OES was applied in this work. Qualitative analysis needs the standard samples with hydrogen. However, the standard samples with high concentrations of hydrogen in the zirconium alloy which would meet the requirements of the shape, size are absent. In this work method of Zr + H calibration samples production was performed at the first time. Automated Complex Gas Reaction Controller was used for samples hydrogenation. To calculate the parameters of post-hydrogenation incubation of the samples in an inert gas atmosphere the diffusion equations were used. Absolute hydrogen concentrations in the samples were determined by melting in the inert gas atmosphere using RHEN602 analyzer (LECO Company). Hydrogen distribution was studied using nuclear reaction analysis (HZDR, Dresden, Germany). RF GD-OES was used for calibration. The depth of the craters was measured with the help of a Hommel-Etamic profilometer by Jenoptik, Germany.
Zhou, F Y; Wang, B L; Qiu, K J; Li, L; Lin, J P; Li, H F; Zheng, Y F
2013-02-01
In this study, the microstructure, mechanical properties, corrosion behaviors, and in vitro biocompatibility of Zr-Mo alloys as a function of Mo content after solution treatment were systemically investigated to assess their potential use in biomedical application. The experimental results indicated that Zr-1Mo alloy mainly consisted of an acicular structure of α' phase, while ω phase formed in Zr-3Mo alloy. In Zr-5Mo alloy, retained β phase and a small amount of precipitated α phase were observed. Only the retained β phase was obtained in Zr-10Mo alloy. Zr-1Mo alloy exhibited the greatest hardness, bending strength, and modulus among all experimental Zr-Mo alloys, while β phase Zr-10Mo alloy had a low modulus. The results of electrochemical corrosion indicated that adding Mo into Zr improved its corrosion resistance which resulted in increasing the thermodynamic stability and passivity of zirconium. The cytotoxicity test suggested that the extracts of the studied Zr-Mo alloys produced no significant deleterious effect to fibroblast cells (L-929) and osteoblast cells (MG 63), indicating an excellent in vitro biocompatibility. Based on these facts, certain Zr-Mo alloys potentially suitable for different biomedical applications were proposed. Copyright © 2012 Wiley Periodicals, Inc.
International Nuclear Information System (INIS)
Park, S. Y.; Lee, M. H.; Choi, B. K.; Jung, Y. H.; Jung, Y. H.
2000-01-01
As a part of the advanced Zr fuel cladding development program, the autoclave corrosion test was performed on the series of Zr-0.2Nb-1.1Sn-Fe-Cu and Zr-0.4Nb-0.8Sn-Fe-Cu alloys in 70 ppm LiOH solution at 360 .deg. C. The oxide characteristics were investigated by using the Electrochemical Impedance Spectroscope(EIS) method. The corrosion resistance of the alloys was evaluated from the corrosion rate determined as a function of the concentration of main alloying elements such as Nb, Sn, Fe and Cu. The equivalent circuit was composed as a result of the spectrum from EIS measurements on the oxide layer that formed at pro- and post-transition regions. By using the capacitance characteristics of equivalent circuit, the thickness of impervious layer, it's electrical resistance and characteristics of space charge layer were evaluated. The corrosion characteristics of the Zr-Nb-Sn-Fe-Cu alloys were successfully explained by applying the EIS test results
Hot rolling effect on the characters of Zr-0.6Nb-0.5Fe-0.5Cr alloy
International Nuclear Information System (INIS)
Sungkono; Siti Aidah
2015-01-01
Characters of Zr-0.6Nb-0.5Fe-0.5Cr alloy after hot rolling have been studied. The objective of this research was to obtain of hot rolling effect on the characteristics of microstructures, hardness and phases formed in Zr-0.6Nb-0.5Fe-0.5Cr alloy. The hot rolling process of alloy carried out at temperature of 800 °C with retention time of 1.5 and 2 hours and a thickness reduction between 5 to 25 %. The results of this experiment showed that the Zr-0.6Nb-0.5Fe-0.5Cr alloy has Widmanstaetten structure with microstructure evolving into deformed columnar grains and deformed elongated grains with increasing thickness reduction. Besides, the longer the retention time at temperature of 800 °C is the larger are the grain structures and formation of α-Zr and Zr_3Fe phase. The hardness of Zr-0.6Nb-0.5Fe-0.5Cr alloy has same trends i.e the larger thickness reduction gives higher hardness. The Zr-0.6Nb-0.5Fe-0.5Cr alloy can under go hot rolling deformation at a thickness reduction of 25 % and the formation of α-Zr and Zr_3Fe can increased of hardness and strength of Zr-0.6 Nb-0.5 Fe-0.5 Cr alloy. (author)
Investigation of phase transformations of U2.5Zr7.5Nb and U3Zr9Nb alloys aging at 600 deg C
International Nuclear Information System (INIS)
Cantagalli, Natalia Mattar; Tanure, Leandro Paulo de Almeida Reis; Braga, Daniel Martins; Santos, Ana Maria Matildes dos; Ferraz, Wilmar Barbosa
2009-01-01
Investigation has been made of the effects of high-temperature aging (600 deg C) on the phase transformations in the U2.5Zr7.5Nb and U3Zr9Nb alloys. These alloys have been produced with vacuum induction melting (VIM) furnace in cast ingots. The ingots were homogenized at 1000 deg C for 24 hours in vacuum of -4 torr, and cooled to room temperature at a rate of 3 deg C/min. Specimens from these homogeneous materials, cut in 3 mm high and 10 mm diameter, were reheated to γ phase at 850 deg C, for 1 hour, and aging at 600 deg C at different times from 0.5 to 24 hours. The phases decomposition were characterized by X-ray diffraction (XRD), metallographic, micro-probe analyze by energy dispersive spectrometry (EDS) and microhardness methods. It was verified that the decomposition of the δ phase proceeds in two steps. The first is a discontinuous precipitation of a lamellar two-phase aggregate composed of alpha solid solution and a metastable gamma phase. The metastable gamma phase has a constant composition at given temperature. After longer annealing, it decomposes eutectoidally into the equilibrium (α + δ 2 ) phases mixture. During this process a modification of the original lamellar microstructure takes place. The obtained metastable phases of these alloys of different compositions were analyzed in relation to their constitution, heat treatability and micrographic features and the results confronted with available distinct uranium alloys data from literature. (author)
International Nuclear Information System (INIS)
Liang, S.X.; Yin, L.X.; Ma, M.Z.; Jing, R.; Yu, P.F.; Zhang, Y.F.; Wang, B.A.; Liu, R.P.
2013-01-01
Zirconium (Zr)-based bulk metallic glass possesses the highest potential as a structural material among metallic glasses. Although Zr-based bulk metallic glass exhibits extremely high strength, its potential application has been restricted by a number of issues, such as fragility, small size, difficult fabrication into different shapes and poisonous beryllium content, among others. In this paper, a Zr-based crystal alloy with comparable strength and higher plasticity than Zr-based bulk metallic glass is presented. The proposed Zr-based alloy has a tensile strength greater than 1600 MPa. That value is comparable to the 1500 MPa to 2000 MPa strength of Zr-based bulk metallic glasses (BMGs). The ductility in terms of elongation reached 6.2%; at the same time, the 1400 MPa tensile strength was retained. This phenomenon is not possible for Zr-based BMGs. XRD results show that the proposed ultrahigh-strength Zr-based crystal alloy has two-phase structures: an hcp-structured α phase and a bcc-structured β phase. The forged specimen exhibits a typical basket-weave microstructure, which is characterised by the interlaced plate α phase separated from the β phase matrix. Fine, short bar-shaped α phases precipitated along the original β grain boundary together with ultrafine dot-shaped α phases that presented inside the original β grain when the ageing temperature was between 500 °C and 525 °C. As the ageing temperature increased, the dot-shaped α phase grew into plate shapes, decreasing the material's strength and increasing its plasticity. The ultrafine dot-shaped and short bar-shaped α phases in the original β phase matrix are the main strengthening mechanisms of the ultrahigh-strength Zr-based crystal alloy.
Enthalpy of mixing of liquid Ni-Zr and Cu-Ni-Zr alloys
International Nuclear Information System (INIS)
Witusiewicz, V.T.; Sommer, F.
2000-01-01
Since the Al-Cu-Ni-Zr system is a basis for the production of bulk amorphous materials by rapid solidification techniques from the liquid state, it is of great scientific interest to determine the partial and the integral thermodynamic functions of liquid and undercooled liquid alloys. Such data, as was pointed out previously, are important in order to understand their extremely good glass-forming ability in multicomponent metallic systems as well as for processing improvements. In order to measure the thermodynamic properties of the Al-Cu-Ni-Zr quaternary, it is necessary to have reliable thermochemical data for its constituent canaries and ternaries first. In a series of articles, the authors have reported in detail the thermodynamic properties of liquid Al-Cu, Al-Ni, Cu-Ni, Cu-Zr, Al-Zr, Al-Cu-Ni, and Al-Cu-Zr alloys. This article deals with the direct calorimetric measurements of the partial and the integral enthalpies of mixing of liquid Ni-Zr and Cu-Ni-Zr alloys and the heat capacity of liquid Ni 26 Zr 74 . In a subsequent article, the authors will present similar data for the liquid ternary Al-Ni-Zr and for the liquid quaternary Al-Cu-Ni-Zr alloys
The effect of Zr on the microstructure and properties of Ti-35Nb-XZr alloy
Energy Technology Data Exchange (ETDEWEB)
Málek, Jaroslav, E-mail: malek@ujp.cz [UJP PRAHA a.s., Nad Kamínkou 1345, 156 00 Prague-Zbraslav (Czech Republic); Czech Technical University in Prague, Faculty of Mechanical Engineering, Karlovo náměstí 13, 121 35 Praha 2 (Czech Republic); Hnilica, František, E-mail: hnilica@ujp.cz [UJP PRAHA a.s., Nad Kamínkou 1345, 156 00 Prague-Zbraslav (Czech Republic); Veselý, Jaroslav, E-mail: vesely@ujp.cz [UJP PRAHA a.s., Nad Kamínkou 1345, 156 00 Prague-Zbraslav (Czech Republic); Smola, Bohumil, E-mail: smola@met.mff.cuni.cz [Charles University in Prague, Faculty of Mathematics and Physics, KeKarlovu 5, 121 16 Prague 2 (Czech Republic); Kolařík, Kamil, E-mail: kamil.kolarik@email.cz [Czech Technical University in Prague, Faculty of Nuclear Sciences and Physical Engineering, Trojanova 339/13, 120 00 Praha 2 (Czech Republic); Fojt, Jaroslav, E-mail: jaroslav.fojt@vscht.cz [Institute of Chemical Technology, Technická 5, 166 28 Prague (Czech Republic); Vlach, Martin, E-mail: martin.vlach@mff.cuni.cz [Charles University in Prague, Faculty of Mathematics and Physics, KeKarlovu 5, 121 16 Prague 2 (Czech Republic); Kodetová, Veronika [Charles University in Prague, Faculty of Mathematics and Physics, KeKarlovu 5, 121 16 Prague 2 (Czech Republic)
2016-10-15
The demand for biomaterials with high strength, low modulus, excellent biocompatibility and good corrosion resistance has led to the development of new alloys. Zirconium is known as a biocompatible element that can be used for alloying in titanium alloys. The effect of Zr on the mechanical and structural properties of a titanium alloy is studied in this paper. Binary Ti-35Nb alloy has been alloyed with various amounts of Zr (2, 4, 6 or 8 wt%). The specimens were thermo-mechanically processed (hot forged, solution treated 850 °C/0.5 h/water quenched, cold swaged and finally aged (at 400 °C or 450 °C for various periods). Cold-swaged alloys possess tensile strength of about 800 MPa, along with a low Young's modulus (~50 GPa). The elongation of all the alloys is more than 12%. The hardness increased during 400 °C annealing up to 370 HV10. The addition of Zr stabilized the β-phase and supports recrystallization and recovery processes. Corrosion resistance was also increased by the addition of Zr.
Energy Technology Data Exchange (ETDEWEB)
Deaf, G.H.; Beshai, M.H.N.; Abd El Khalek, A.M.; Graiss, G. [Ain Shams Univ., Cairo (Egypt). Dept. of Physics; Kenawy, M.A. [Ain Shams Univ., Cairo (Egypt). Womens Coll.
1997-12-31
Al-1 wt% Si and Al-1 wt% Si-0.1 wt% Zr-0.1 wt% Ti alloys were used to trace the effect of Zr and Ti additions on the behaviour of the steady state creep. After solid solution treatment specimens of both alloys were aged at 623, 673, 723 and 773 K and creep tests were performed at room temperature by applying stresses of 60.0, 62.4, 64.7 and 67.1 MPa. The results showed a sound stabilization effect of Zr and Ti on the ageing characteristics of binary Al-1 wt% Si alloy. Values of the applied stress sensitivity parameter, m, obtained were in the range of (20-34) for Al-Si alloy and (14-19) for Al-Si-Zr-Ti alloy. Time to rupture was found to be strongly increased by Zr and Ti additions. The activation energies of the precipitation process involved were found to be 81.9 kJ/mole and 33.7 kJ/mole of the Al-Si and Al-Si-Zr-Ti alloys respectively. (orig.) 17 refs.
Microstructural investigation of as-cast uranium rich U–Zr alloys
Energy Technology Data Exchange (ETDEWEB)
Zhang, Yuting, E-mail: zhangyuting@caep.cn [Science and Technology on Surface Physics and Chemistry Laboratory, Jiangyou 621908, Sichuan (China); School of Nuclear Science and Technology, National Synchrotron Radiation Laboratory, University of Science and Technology of China, Hefei 230029, Anhui (China); Wang, Xin [Science and Technology on Surface Physics and Chemistry Laboratory, Jiangyou 621908, Sichuan (China); Zeng, Gang [Institute of Materials, China Academy of Engineering Physics, Jiangyou 621908, Sichuan (China); Wang, Hui [Science and Technology on Surface Physics and Chemistry Laboratory, Jiangyou 621908, Sichuan (China); Jia, Jianping [Institute of Materials, China Academy of Engineering Physics, Jiangyou 621908, Sichuan (China); Sheng, Liusi [School of Nuclear Science and Technology, National Synchrotron Radiation Laboratory, University of Science and Technology of China, Hefei 230029, Anhui (China); Zhang, Pengcheng, E-mail: zpc113@sohu.com [Science and Technology on Surface Physics and Chemistry Laboratory, Jiangyou 621908, Sichuan (China)
2016-04-01
The present study evaluates the microstructure in as-cast uranium rich U–Zr alloys, an important subsystem of U–Pu–Zr ternary metallic nuclear reactor fuel, as a function of the Zr content, from 2wt.% to 15wt.%Zr. It has been previously suggested that the unique intermetallic compound δ phase in U–Zr alloys is only present in as-cast U–Zr alloys with a Zr content exceeding 10wt.%Zr. However, our analysis of transmission electron microscopy (TEM) data shows that the δ phase is common to all as-cast alloys studied in this work. Furthermore, specific coherent orientation relationship is found between the α and δ phases, consistent with previous findings, and a third variant is discovered in this paper. - Highlights: • Initially, lattice parameter of as-cast U–Zr alloys decrease with the increasing Zr content, and then increase. • XRD data show the presence of δ-UZr{sub 2} phase in as-cast U–Zr alloys with a Zr content of more than 8wt.% Zr. • Finding δ-UZr{sub 2} phase exists in all as-cast uranium rich U–Zr alloys, even for alloys with a lean Zr content. • Three kinds of preferential orientations of the δ phase grow.
Experimental phases diagram Zr-Fe and Zr-Sn-Fe of the Fe rich zone at a temperature of 1100oC
International Nuclear Information System (INIS)
Nieva, N.; Jimenez, J.; Gomez, A; Granovsky, M.S
2010-01-01
Zr-based alloys are frequently used in the nuclear energy industry; among these are the Zr-based Zircaloys whose main alloys are Sn and Fe. In order to experimentally evaluate part of the diagram of the binary Zr-Fe phases and the ternary Zr-Sn-Fe in the Fe-rich zone, different binary alloys in the area closest to the composition of the ZrFe 2 and Zr 6 Fe 23 compounds were designed as well as a ternary alloy of Zr-Sn-Fe in the Fe-rich region of the ternary system. All the alloys underwent a two month heat treatment at a temperature of 1100 o C. Later the phases that were present were identified using different complementary techniques (mainly X-ray diffraction and microanalysis). The clear presence of the Zr 6 Fe 23 phase was not observed in any of the alloys. A new ternary phase consisting approximately of Zr 2 0Sn 14 Fe 66 was verified in the ternary alloy
Zr inclusions in actinide—Zr alloys: New data and ideas about how they form
International Nuclear Information System (INIS)
Janney, Dawn E.; O'Holleran, Thomas P.
2015-01-01
High-Zr inclusions are common in actinide—Zr alloys despite phase diagrams indicating that these alloys should not contain a high-Zr phase. The inclusions may contain enough Zr to cause significant differences between bulk compositions and those of inclusion-free areas, leading to possible errors in interpreting data if the inclusions are not considered. This paper presents data from high-Zr inclusions in a complex U—Np—Pu—Am—Zr—RE alloy. It is suggested that the high-Zr inclusions nucleated as high-Zr solid solutions at interfaces with high-actinide RE liquids, then unmixed to form nanometer-scale high-actinide sub-inclusions.
Energy Technology Data Exchange (ETDEWEB)
Qin, W.; Szpunar, J.A., E-mail: weq565@mail.usask.ca, E-mail: jerzy.szpunar@usask.ca [Univ. of Saskatchewan, Dept. of Mechanical Engineering, Saskatoon, SK (Canada); Kozinski, J., E-mail: janusz.kozinski@lassonde.yorku.ca [York Univ., Faculty of Science and Engineering, Toronto, ON (Canada)
2014-07-01
Oxidation and hydrogen embrittlement are related to formation of cracks and failure of Zr alloys used in nuclear reactor applications. An in-depth understanding of the formation of ZrO{sub 2} film and the hydride precipitation and orientation is important for improving the corrosion resistance of zirconium alloys. In this work a theoretical model is developed to analyze the microstructure of ZrO{sub 2} film formed on Zr alloys and the effect of stress that results from ZrO{sub 2} formation on hydride reorientation in the region near oxide/metal interface. Our work shows that the macroscopic stress produced due to Pilling-Bedworth ratio for ZrO{sub 2}/Zr could lead to the hydride re-orientation in the region near ZrO{sub 2}/Zr interface. Whether or not this effect can occur is dependent on the texture of the zirconium alloys. Control of texture of zirconium alloys can affect the microstructure of ZrO{sub 2} film and can be responsible for change of hydride orientation. (author)
Refining U-Zr-Nb alloys by remelting
International Nuclear Information System (INIS)
Aguiar, B.M.; Kniess, C.T.; Riella, H.G.; Ferraz, W.B.
2011-01-01
The high density U-Zr-Nb and U-Nb uranium-based alloys can be employed as nuclear fuel in a PWR reactor due to their high density and nuclear properties. These alloys can stabilize the gamma phase, however, according to TTT diagrams, at the working temperature of a PWR reactor, all gamma phase transforms to α'' phase in a few hours. To avoid this kind of transformation during the nuclear reactor operation, the U-Zr-Nb alloy and U-Nn are used in α'' phase. The stability of α'' phase depends on the alloy composition and cooling rate. The alloy homogenization has to be very effective to eliminate precipitates rich in Zr and Nb to avoid changes in the alloying elements contents in the matrix. The homogenization was obtained by remelting the alloy and keeping it in the liquid state for enough time to promote floating of the precipitates (usually carbides, less dense) and leaving the matrix free of precipitates. However, this floating by density difference may result in segregation between the alloying elements (Nb and Zr, at the top) and uranium (at the bottom). The homogenized alloys were characterized in terms of metallographic techniques, optical microscopy, scanning electronic microscopy, EDS and X-ray diffraction. In this paper, it is shown that the contents of Zr and Nb at the bottom and at the top of the matrix are constant. (author)
Energy Technology Data Exchange (ETDEWEB)
Chauhan, Mamta; Gupta, Dinesh C., E-mail: sosfizix@gmail.com, E-mail: mamta-physics@yahoo.co.in [Condensed Matter Theory Group, School of Studies in Physics, Jiwaji University, Gwalior – 474 011 (India)
2016-05-23
First-principles pseudo-potential calculations have been performed to analyze the stability of Ti{sub 1-x}Zr{sub x}N alloy under high pressures. The first order phase transition from B1 to B2 phase has been observed in this alloy at high pressure. The variation of lattice parameter with the change in concentration of Zr atom in Ti{sub 1-x}Zr{sub x}N is also reported in both the phases. The calculations for density of states have been performed to understand the alloying effects on chemical bonding of Ti-Zr-N alloy.
X-ray study of rapidly cooled ribbons of Al-Cr-Zr and Al-Ni-Y-Cr-Zr alloys
International Nuclear Information System (INIS)
Betsofen, S.Ya.; Osintsev, O.E.; Lutsenko, A.N.; Konkevich, V.Yu.
2002-01-01
One investigated into phase composition, lattice spacing and structure of rapidly cooled 25-200 μm gauge strips made of Al-4,1Cr-3,2Zr and Al-1,5Cr-1,5Zr-4Ni-3Y alloys, wt. %, produced by melt spinning to a water-cooled copper disk. In Al-4,1Cr-3,2Zr alloy one detected intermetallic phases: Al 3 Zr and two Al 86 Cr 14 composition icosahedral phases apart from aluminium solid solution with 4.040-4.043 A lattice spacing. In Al-1,5Cr-1,5Zr-4Ni-3Y alloy one identified two Al 86 Cr 14 icosahedral phases and two AlNiY and Al 3 Y yttrium-containing ones, lattice spacing of aluminium solid solution was equal to 4.052-4.053 A [ru
Microstructural characterization of laser and electron beam (EB) welds of Nb-1Zr-0.1C alloy
International Nuclear Information System (INIS)
Badgujar, B.P.; Tewari, R.; Dey, G.K.; Samajdar, I.
2015-01-01
Nb-1wt%Zr-0.1wt%C alloy is being considered for the structural applications in proposed Compact High Temperature Reactor (CHTR) on account of its excellent combination of high temperature properties. The applications of this alloy calls for welding, which is a difficult task due to its reactive nature, higher thermal conductivity and melting point. The high energy density techniques like laser and electron beam were employed to produce the welds on sheets of Nb-alloy at various processing parameters in bead-on-plate and square butt joint configurations. The weld joints produced were characterized by studying their optical, Scanning Electron Microscopy (SEM) and Electron Back Scattering Diffraction (EBSD) micro-graphs. The SEM micrograph of EB fusion zone along with the heat affected zone (HAZ) and the base region were studied and abrupt changes in the grain morphology were found in each zone. The fusion zone shows larger grains indicating the rapid grain growth after solidification, whereas the HAZ shows relatively smaller size of the grains but still much larger than the base zone. The SEM micrograph of central part of the same butt weld shows clear grain boundaries with a large variation in the grain size (45-82 micrometer) in the weld region. The heat affected zone (HAZ) and base metal showed fine carbide precipitates along the grain boundaries, whereas carbides were found dissolved in the weld zone. The EBSD micrograph of electron beam fusion zone describing the grain orientation in the weld region are described. The micro-hardness profile across the width of welds was also studied. The detailed results of all these studies are described in this paper. (author)
Xu, Wei; Li, Ming; Wen, Cuie; Lv, Shaomin; Liu, Chengcheng; Lu, Xin; Qu, Xuanhui
2018-03-30
A biocompatible Ti-28Nb-35.4Zr alloy used as bone implant was fabricated through the powder metallurgy process. The effects of mechanical milling and sintering temperatures on the microstructure and mechanical properties were investigated systematically, before in vitro biocompatibility of full dense Ti-28Nb-35.4Zr alloy was evaluated by cytotoxicity tests. The results show that the mechanical milling and sintering temperatures have significantly effects on the density and mechanical properties of the alloys. The relative density of the alloy fabricated by the atomized powders at 1500 °C is only 83 ± 1.8%, while the relative density of the alloy fabricated by the ball-milled powders can rapidly reach at 96.4 ± 1.3% at 1500 °C. When the temperature was increased to 1550 °C, the alloy fabricated by ball-milled powders achieve full density (relative density is 98.1 ± 1.2%). The PM-fabricated Ti-28Nb-35.4Zr alloy by ball-milled powders at 1550 °C can achieve a wide range of mechanical properties, with a compressive yield strength of 1058 ± 35.1 MPa, elastic modulus of 50.8 ± 3.9 GPa, and hardness of 65.8 ± 1.5 HRA. The in vitro cytotoxicity test suggests that the PM-fabricated Ti-28Nb-35.4Zr alloy by ball-milled powders at 1550 °C has no adverse effects on MC3T3-E1 cells with cytotoxicity ranking of 0 grade, which is nearly close to ELI Ti-6Al-4V or CP Ti. These properties and the net-shape manufacturability makes PM-fabricated Ti-28Nb-35.4Zr alloy a low-cost, highly-biocompatible, Ti-based biomedical alloy.
Xu, Wei; Li, Ming; Wen, Cuie; Lv, Shaomin; Liu, Chengcheng; Lu, Xin
2018-01-01
A biocompatible Ti-28Nb-35.4Zr alloy used as bone implant was fabricated through the powder metallurgy process. The effects of mechanical milling and sintering temperatures on the microstructure and mechanical properties were investigated systematically, before in vitro biocompatibility of full dense Ti-28Nb-35.4Zr alloy was evaluated by cytotoxicity tests. The results show that the mechanical milling and sintering temperatures have significantly effects on the density and mechanical properties of the alloys. The relative density of the alloy fabricated by the atomized powders at 1500 °C is only 83 ± 1.8%, while the relative density of the alloy fabricated by the ball-milled powders can rapidly reach at 96.4 ± 1.3% at 1500 °C. When the temperature was increased to 1550 °C, the alloy fabricated by ball-milled powders achieve full density (relative density is 98.1 ± 1.2%). The PM-fabricated Ti-28Nb-35.4Zr alloy by ball-milled powders at 1550 °C can achieve a wide range of mechanical properties, with a compressive yield strength of 1058 ± 35.1 MPa, elastic modulus of 50.8 ± 3.9 GPa, and hardness of 65.8 ± 1.5 HRA. The in vitro cytotoxicity test suggests that the PM-fabricated Ti-28Nb-35.4Zr alloy by ball-milled powders at 1550 °C has no adverse effects on MC3T3-E1 cells with cytotoxicity ranking of 0 grade, which is nearly close to ELI Ti-6Al-4V or CP Ti. These properties and the net-shape manufacturability makes PM-fabricated Ti-28Nb-35.4Zr alloy a low-cost, highly-biocompatible, Ti-based biomedical alloy. PMID:29601517
High-temperature air oxidation of E110 and Zr-1%Nb alloys claddings with coatings
International Nuclear Information System (INIS)
Kuprin, A.S.; Belous, V.A.; Voyevodin, V.N.; Bryk, V.V.; Vasilenko, R.L.; Ovcharenko, V.D.; Tolmachova, G.N.; V'yugov, P.N.
2014-01-01
Results of experimental study of the influence of protective vacuum-arc claddings on the base of compounds zirconium-chromium and of its nitrides on air oxidation resistance at temperatures 660, 770, 900, 1020, 1100 deg C during 3600 s. of tubes produced of zirconium alloys E110 and Zr-1%Nb (calcium-thermal alloy of Ukrainian production) are presented. Change of hardness, the width of oxide layer and depth of oxygen penetration into alloys from the side of coating and without coating are investigated by the methods of nanoindentation and by scanning electron microscopy. It is shown that the thickness of oxide layer in zirconium alloys at temperatures 1020 and 1100 deg C from the side of the coating doesn't exceed 5 μm, and from the unprotected side reaches the value of ≥ 120 μm with porous and rough structure. Tubes with coatings save their shape completely independently of the type of alloy; tubes without coatings deform with the production of through cracks
Energy Technology Data Exchange (ETDEWEB)
Krausová, Aneta [University of Chemistry and Technology, Technická 3, 166 28 Prague 6 (Czech Republic); Macák, Jan, E-mail: macakj@vscht.cz [University of Chemistry and Technology, Technická 3, 166 28 Prague 6 (Czech Republic); Sajdl, Petr [University of Chemistry and Technology, Technická 3, 166 28 Prague 6 (Czech Republic); Novotný, Radek [JRC-IET, Westerduinveg 3, 1755 LE Petten (Netherlands); Renčiuková, Veronika [University of Chemistry and Technology, Technická 3, 166 28 Prague 6 (Czech Republic); Vrtílková, Věra [ÚJP a.s., Nad Kamínkou 1345, 156 10 Prague 5 (Czech Republic)
2015-12-15
Long-term in-situ corrosion tests were performed in order to evaluate the influence of lithium ions on the corrosion of zirconium alloy. Experiments were carried out in a high-pressure high-temperature loop (280 °C, 8 MPa) in a high concentration water solution of LiOH (70 and 200 ppm Li{sup +}) and in a simulated WWER primary coolant environment. The kinetic parameters characterising the oxidation process have been explored using in-situ electrochemical impedance spectroscopy and slow potentiodynamic polarization. Also, a suitable equivalent circuit was suggested, which would approximate the impedance characteristics of the corrosion of Zr–1Nb alloy. The Mott–Schottky approach was used to determine the semiconducting character of the passive film. - Highlights: • Zr1Nb alloy was tested in WWER coolant and in LiOH solutions at 280 °C. • Corrosion rates were estimated in-situ from electrochemical data. • Electrochemical data agreed well with weight gains and metallography data. • Increase of corrosion rate in LiOH appeared after short exposure (300–500 h). • Very high donor densities (1.1–1.2 × 10{sup 20} cm{sup −3}) of Zr oxide grown in LiOH were found.
Alpha and beta stabilizer character of Al in Zr-Nb-Al alloys
International Nuclear Information System (INIS)
Peruzzi Bardella, A.; Bolcich, J.C.
1987-01-01
The T β/α+β of Zr5Nb and Zr5Nb2Al (weight %) were determined in order to observe the alpha-stabilizer character of Al in ternary Zr-Nb-Al alloys. Techniques employed were change of resistivity with temperature in dynamic experiences, and metallography of samples quenched to room temperature after isothermal annealings. The T β/α+β of the ternary resulted 17 ± 8 deg C higher than that of the binary alloy. In addition, taking into account the results of previous investigations of the transformation of beta on quenching Zr-Nb-Al alloys from the beta field to room temperature, it is concluded that the beta-stabilizer character of Nb is stronger than the alpha-stabilizer character of Al in these Zr alloys, and that the Al can have important influence on the mechanical properties by the appearance of TRIP effect. (Author) [es
Energy Technology Data Exchange (ETDEWEB)
Duan, Y.L. [School of Materials Science and Engineering, Central South University, Changsha 410083 (China); Xu, G.F., E-mail: csuxgf660302@csu.edu.cn [School of Materials Science and Engineering, Central South University, Changsha 410083 (China); Key Laboratory of Nonferrous Materials Science and Engineering of Ministry of Education, Central South University, Changsha 410083, China. (China); Xiao, D.; Zhou, L.Q. [School of Materials Science and Engineering, Central South University, Changsha 410083 (China); Deng, Y.; Yin, Z.M. [School of Materials Science and Engineering, Central South University, Changsha 410083 (China); Key Laboratory of Nonferrous Materials Science and Engineering of Ministry of Education, Central South University, Changsha 410083, China. (China)
2015-01-29
A refined microstructure of Al–Mg–Sc–Zr alloy with an average grain size of ∼3.7 μm and a portion of high angle boundaries of 69.2% was produced by free forging. Excellent superplastic ductility of ≥500% was achieved at a wide temperature range of 450∼500 °C and relatively high strain rate range of 1×10{sup −3}∼5×10{sup −2} s{sup −1} in the Al–Mg–Sc–Zr alloy. A maximum elongation of 1593% was obtained at 475 °C and 1×10{sup −3} s{sup −1}. Moreover, the electron back scattered diffraction (EBSD) and the transmission electron microscopy (TEM) analyses showed that the excellent superplasticity can be attributed to the high fraction of high angle grain boundaries and the presence of Al{sub 3}(Sc,Zr) dispersoids in the Al–Mg–Sc–Zr alloy microstructure. The analyses on the superplastic data revealed the presence of threshold stress, the coefficient of strain rate sensitivity of 0.5, and an activation energy of 83.9 kJ/mol{sup –1}. It indicated that the dominant deformation mechanism was grain boundary sliding. Based on this notion, a constitutive equation for Al–Mg–Sc–Zr alloy has been developed.
Refining U-Zr-Nb alloys by remelting
Energy Technology Data Exchange (ETDEWEB)
Aguiar, B.M.; Kniess, C.T.; Riella, H.G., E-mail: bmaguiar@ipen.b [Instituto de Pesquisas Energeticas e Nucleares (IPEN/CNEN-SP), Sao Paulo, SP (Brazil); Ferraz, W.B. [Centro de Desenvolvimento da Tecnologia Nuclear (CDTN/CNEN-MG), Belo Horizonte, MG (Brazil)
2011-07-01
The high density U-Zr-Nb and U-Nb uranium-based alloys can be employed as nuclear fuel in a PWR reactor due to their high density and nuclear properties. These alloys can stabilize the gamma phase, however, according to TTT diagrams, at the working temperature of a PWR reactor, all gamma phase transforms to {alpha}'' phase in a few hours. To avoid this kind of transformation during the nuclear reactor operation, the U-Zr-Nb alloy and U-Nn are used in {alpha}'' phase. The stability of {alpha}'' phase depends on the alloy composition and cooling rate. The alloy homogenization has to be very effective to eliminate precipitates rich in Zr and Nb to avoid changes in the alloying elements contents in the matrix. The homogenization was obtained by remelting the alloy and keeping it in the liquid state for enough time to promote floating of the precipitates (usually carbides, less dense) and leaving the matrix free of precipitates. However, this floating by density difference may result in segregation between the alloying elements (Nb and Zr, at the top) and uranium (at the bottom). The homogenized alloys were characterized in terms of metallographic techniques, optical microscopy, scanning electronic microscopy, EDS and X-ray diffraction. In this paper, it is shown that the contents of Zr and Nb at the bottom and at the top of the matrix are constant. (author)
Metastable phases in Zr-Excel alloy and their stability under heavy ion (Kr{sup 2+}) irradiation
Energy Technology Data Exchange (ETDEWEB)
Yu, Hongbing, E-mail: 12hy1@queensu.ca [Department of Mechanical and Materials Engineering, Queen' s University, Kingston, ON, K7L 3N6 (Canada); Zhang, Ken; Yao, Zhongwen [Department of Mechanical and Materials Engineering, Queen' s University, Kingston, ON, K7L 3N6 (Canada); Kirk, Mark A. [Material Science Division Argonne National Laboratory, Argonne, IL, 60439 (United States); Long, Fei; Daymond, Mark R. [Department of Mechanical and Materials Engineering, Queen' s University, Kingston, ON, K7L 3N6 (Canada)
2016-02-15
Zr-Excel alloy (Zr-3.5Sn-0.8Nb-0.8Mo, wt.%) has been proposed as a candidate material of pressure tubes in the CANDU-SCWR design. It is a dual-phase alloy containing primary hcp α-Zr and metastable bcc β-Zr. Metastable hexagonal ω-Zr phase could form in β-Zr as a result of aging during the processing of the tube. A synchrotron X-ray study was employed to study the lattice properties of the metastable phases in as-received Zr-Excel pressure tube material. In situ heavy ion (1 MeV Kr{sup 2+}) irradiations were carried out at 200 °C and 450 °C to emulate the stability of the metastable phase under a reactor environment. Quantitative Chemi-STEM EDS analysis was conducted on both un-irradiated and irradiated samples to investigate alloying element redistribution induced by heavy ion irradiation. It was found that no decomposition of β-Zr was observed under irradiation at both 200 °C and 450 °C. However, ω-Zr particles experienced shape changes and shrinkage associated with enrichment of Fe at the β/ω interface during 200 °C irradiation but not at 450 °C. There is a noticeable increase in the level of Fe in the α matrix after irradiation at both 200 °C and 450 °C. The concentrations of Nb, Mo and Fe are increased in the ω phase but decreased in the β phase at 200 °C. The stability of metastable phases under heavy ion irradiation associated with elemental redistribution is discussed.
Safety of some fuel cladding materials, alternative to Zr-alloys
International Nuclear Information System (INIS)
Hache, Georges; Clement, Bernard; Barrachin, Marc
2013-01-01
published by Westinghouse and Fauske with MAAP code, assuming zero kinetics and no physicochemical interactions. SiC is probably tolerant to DBAs and short duration severe accidents (TMI-2 like) but more intolerant than Zr-alloys to long-duration severe accidents (Fukushima Daiichi unit 1 like). Stainless steels (SS) - During SS oxidation by steam, nearly the same number of H 2 moles are produced per cladding length unit at thermochemical equilibrium than for Zr-alloys. - SS oxidation kinetics below 1600 deg. C: According to early tests performed by GE, 304L oxidises faster than Zr-alloys above 1150 deg. C. Recent ORNL tests show that Fe-25 Cr or PM2000 (19% Cr, 5% Al) are similar to SiC at 1200 deg. C. - SS oxidation kinetics above 1600 deg. C (melting point of FeOx): In molten FeOx, oxygen diffusion is very fast; this is known in the literature as 'catastrophic oxidation by molten oxides'. There will be a cliff-edge effect. For un-inerted containments, H 2 recombiners will be saturated, leading to a risk of H 2 explosion in these containments: - The main advantage of SS is the lower heat of reaction produced per cladding length unit at thermochemical equilibrium compared to Zr-alloys. - Molten FeOx will interact with UO 2 to form molten mixtures at temperatures well below UO 2 melting temperature. - Calculations with system codes (ASTEC, MELCOR, MAAP) are necessary and were published by Westinghouse and Fauske with MAAP code, assuming no catastrophic oxidation above 1600 deg. C and no physicochemical interactions. 304L is intolerant to long-duration severe accidents (extended station blackout)
International Nuclear Information System (INIS)
Pan Fusheng; Yang Mingbo; Shen Jia; Wu Lu
2011-01-01
Research highlights: → Minor Zr and/or Sr additions can effectively refine the grains of the Mg-3Ce-1.2Mn-0.9Sc alloy. → Minor Zr and/or Sr additions can improve the tensile properties of the Mg-3Ce-1.2Mn-0.9Sc alloy. → Minor Zr and/or Sr additions can improve the creep properties of the Mg-3Ce-1.2Mn-0.9Sc alloy. - Abstract: The effects of minor Zr and Sr on the as-cast microstructure and mechanical properties of the Mg-3Ce-1.2Mn-0.9Sc (wt.%) alloy were investigated by using optical and electron microscopies, differential scanning calorimetry (DSC) analysis, and tensile and creep tests. The results indicate that adding minor Zr and/or Sr to the Mg-3Ce-1.2Mn-0.9Sc alloy does not cause an obvious change in the morphology and distribution of the Mg 12 Ce phase. However, the grains of the Zr and/or Sr-containing alloys are effectively refined. Among the Zr and/or Sr-containing alloys, the grains of the alloy with the addition of 0.5 wt.%Zr + 0.1 wt.%Sr are the finest, followed by the alloys with the additions of 0.5 wt.%Zr and 0.1 wt.%Sr, respectively. In addition, small additions of Zr and/or Sr can improve the tensile and creep properties of the Mg-3Ce-1.2Mn-0.9Sc alloy. Among the Zr and/or Sr-containing alloys, the alloy with the addition of 0.5 wt.%Zr + 0.1 wt.%Sr obtains the optimum tensile and creep properties.
The structure and mechanical properties of as-cast Zr-Ti alloys
International Nuclear Information System (INIS)
Hsu, H.-C.; Wu, S.-C.; Sung, Y.-C.; Ho, W.-F.
2009-01-01
This study has investigated the structure and mechanical properties of pure Zr and a series of binary Zr-Ti alloys in order to determine their potential application as dental implant materials. The titanium contents of these alloys range from 10 to 40 wt.% and were prepared by arc melting in inert gas. This study evaluated the phase and structure of these Zr-Ti alloys using an X-ray diffraction (XRD) for phase analysis, and an optical microscope for microstructure analysis of the etched alloys. Three-point bending tests were performed to evaluate the mechanical properties of all specimens. The experimental results indicated that the pure Zr and Zr-10Ti comprised entirely of an acicular hexagonal structure of α' phase. When the Ti content increased to 20 wt.%, a significant amount of β phase was retained. However, when the Ti content increased to 40 wt.%, only the equi-axed, retained β phase was observed in the cast alloy. Moreover, the hardness values and bending strengths of the Zr-Ti alloys decreased with an increasing Ti content. Among pure Zr and Zr-Ti alloys, the α'-phase Zr-10Ti alloy has the greatest hardness and bending strength. The pure Zr and Zr-Ti alloys exhibit a similar elastic modulus ranging from 68 GPa (Zr-30Ti) to 78 GPa (Zr-40Ti). Based on the results of elastic moduli, pure Zr and Zr-Ti alloys are found to be suitable for implant materials due to lower modulus. Like bending strength, the elastically recoverable angle of Zr-Ti alloys decreased as the concentration of Ti increased. In the current search for a better implant material, the Zr-10Ti alloy exhibited the highest bending strength/modulus ratios as large as 25.3, which are higher than that of pure Zr (14.9) by 70%, and commercially pure Ti (8.7) by 191%. Thus, Zr-Ti alloy's low modulus, ductile property, excellent elastic recovery capability and impressive strength confirm that it is a promising candidate for dental implant materials.
Formation and stability of Fe-rich precipitates in dilute Zr(Fe) single-crystal alloys
International Nuclear Information System (INIS)
Zou, H.; Hood, G.M.; Roy, J.A.; Schultz, R.J.
1993-02-01
The formation and stability of Fe-rich precipitates in two α-Zr(Fe) single-crystal alloys with nominal compositions (I, 50 ppma Fe, and II, 650 ppma Fe) have been investigated (the maximum solid solubility of Fe in α-Zr is 180 ppma - 800 C). Optical microscopy, scanning electron microscopy (SEM) and transmission electron microscopy (TEM) have been used to examine the characteristics of Fe-rich precipitates. SEM and TEM micrographs show that in as-grown alloy II, Zr 2 Fe precipitates are located at 'stringers'. Precipitates were not observed in as-grown alloy I. During annealing, below the solvus, Fe diffuses to the surfaces to form Zr 3 Fe precipitates in both alloys. The precipitates on the surfaces of alloy I tend to be star-like (0001) or pyramidal (1010), and their distribution is heterogeneous. Dissolution of Zr 3 Fe surface precipitates of alloy I (annealing above the solvus) leaves precipitate-like features on the surfaces. Zr 2 Fe precipitates in as-grown alloy II can be dissolved only by β-phase annealing. (Author) 8 figs., 18 refs
International Nuclear Information System (INIS)
Yu, H.; Yao, Z.; Kirk, M.A.; Daymond, M.R.
2015-01-01
In situ heavy ion irradiation with 1 MeV Kr"2"+ was carried out to study irradiation induced phase change and atomic lattice defects in theβ phase of Zr Excel alloy. No decomposition of β-Zr was observed under irradiation at either 200 "oC or 450 "oC. However, ω-Zr particles experienced shape change and shrinkage associated enrichment of Fe in the β/ω interface at 200 "oC irradiation but not at 450 "oC. The defect evolution in the β-phase was examined with single phase Zr-20Nb alloy. It was found that dislocation loops with Burgers vector 1/2 and both present in β-Zr under room temperature irradiation. (author)
Advanced Corrosion-Resistant Zr Alloys for High Burnup and Generation IV Application
International Nuclear Information System (INIS)
Jeong, Y. H.; Park, S. Y.; Lee, M. H.; Choi, B. K.; Baek, J. H.; Park, J. Y.; Kim, J. H.; Kim, H. G.; Jung, Y. H.; Bang, B. G.
2006-08-01
The systematic study was performed to develop the advanced corrosion-resistant Zr alloys for high burnup and Gen IV application. The corrosion behavior was significantly changed with the alloy composition and the corrosion environment. In general, the model alloys with a higher alloying elements showed a higher corrosion resistance. Among the model alloys tested in this study, Zr-10Cr-0.2Fe showed the best corrosion resistance regardless of the corrosion condition. The oxide on the higher corrosion-resistant alloy such as Zr-1.0Cr-0.2Fe consisted of mainly columnar grains, and it have a higher tetragonal phase stability. In comparison with other alloys being considered for the SCWR, the Zr alloys showed a lower corrosion rate than ferritic-martensitic steels. The results of this study imply that, at least from a corrosion standpoint, Zr alloys deserve consideration as potential cladding or structural materials in supercritical water cooled reactors
Research on aging precipitation in a Cu-Cr-Zr-Mg alloy
International Nuclear Information System (INIS)
Su Juanhua; Dong Qiming; Liu Ping; Li Hejun; Kang Buxi
2005-01-01
The effects of aging processes on the properties and microstructure of Cu-0.3Cr-0.15Zr-0.05Mg lead frame alloy were investigated. Aging precipitation phase was dealt with by transmission electronic microscope (TEM). After solid solution was treated at 920 deg. C and aged at 470 deg. C for 4 h, the fine precipitation of an ordered compound CrCu 2 (Zr, Mg) is found in copper matrix as well as fine Cr and Cu 4 Zr. Along the grain boundary, there are larger chromium. The hardness and electrical conductivity can reach 109 HV and 80% IACS, respectively. Sixty percent cold-rolled deformation prior to aging at 470 deg. C enhances the hardness of the alloy. The coherent precipitates Cr in copper matrix and the dislocations pinned by the fine precipitates are responsible for maximum strengthening of the alloy. So the hardness 165 HV and electrical conductivity 79.2% IACS are available
Study and simulations of quick diffusion in Zr-based alloys
Energy Technology Data Exchange (ETDEWEB)
Corvalán, C., E-mail: corvalan@cnea.gov.ar [UNTREF (Universidad Nacional de Tres de Febrero), General Enrique Mosconi 2736, B1674AHF, Buenos Aires (Argentina); Gerencia de Materiales, CAC, Comisión de Energía Atómica, Av. del Libertador 8250, C1429BNP Buenos Aires (Argentina); Consejo Nacional de Investigaciones Científicas y Técnicas (Argentina); Lucía, A. [UNTREF (Universidad Nacional de Tres de Febrero), General Enrique Mosconi 2736, B1674AHF, Buenos Aires (Argentina); Instituto Sabato, Comisión Nacional de Energía Atómica, Universidad Nacional de San Martín, Buenos Aires (Argentina); Iribarren, M. [Gerencia de Materiales, CAC, Comisión de Energía Atómica, Av. del Libertador 8250, C1429BNP Buenos Aires (Argentina); Instituto Sabato, Comisión Nacional de Energía Atómica, Universidad Nacional de San Martín, Buenos Aires (Argentina); Servant, C. [Laboratoire de Physicochimie de l' Etat Solide, UMR 8182, ICMMO, Université de Paris-Sud XI, 91405 Orsay Cedex (France); Costa e Silva, A. [Universidade Federal Fluminense, Volta Redonda, RJ (Brazil)
2015-11-15
Zirconium and its alloys are widely used in the nuclear industry. Under normal conditions, Zr-alloys are polycrystalline and contain a high density of grain and interphase boundaries. These boundaries function as paths for accelerated matter movement. The movement of fast diffusing elements (Co, Fe, Cr, Ni) in Zr alloys along boundaries produces technologically important changes in the materials in nuclear reactors at normal temperatures (∼550 K) e.g.: segregation, phase precipitation, hydrogen absorption, etc. In this work, diffusion parameters for fast diffusion in Zr at low temperature were assessed for Co and Cr. An improved database for DICTRA (DIffusion-Controlled-TRAnsformation) software for fast diffusion was obtained. The diffusion parameters in grain boundaries of α-Zr for Cr and Co were used from a particular kinetic diffusion model [1]. Simulated profiles were compared with previous experimental work [2]. The results of the comparison and the adequacy of the improved database are discussed. Diffusion profiles on grain boundaries in α-Zr for Cr and Co are presented in the temperature range of 380–460 K. - Highlights: • An improved database for fast diffusion paths was obtained. • The diffusion parameters in type C kinetic on fast paths in α-Zr for Cr and Co were used. • Simulated diffusion profiles were compared with previous experimental results. This comparison and the adequacy of the improved database are discussed. • Diffusion parameters for fast diffusion paths in Zr at low temperature were assessed for Co and Cr. • Diffusion profiles on grain boundaries in α-Zr for Cr and Co are presented in the temperature range of 380–460 K.
Study and simulations of quick diffusion in Zr-based alloys
International Nuclear Information System (INIS)
Corvalán, C.; Lucía, A.; Iribarren, M.; Servant, C.; Costa e Silva, A.
2015-01-01
Zirconium and its alloys are widely used in the nuclear industry. Under normal conditions, Zr-alloys are polycrystalline and contain a high density of grain and interphase boundaries. These boundaries function as paths for accelerated matter movement. The movement of fast diffusing elements (Co, Fe, Cr, Ni) in Zr alloys along boundaries produces technologically important changes in the materials in nuclear reactors at normal temperatures (∼550 K) e.g.: segregation, phase precipitation, hydrogen absorption, etc. In this work, diffusion parameters for fast diffusion in Zr at low temperature were assessed for Co and Cr. An improved database for DICTRA (DIffusion-Controlled-TRAnsformation) software for fast diffusion was obtained. The diffusion parameters in grain boundaries of α-Zr for Cr and Co were used from a particular kinetic diffusion model [1]. Simulated profiles were compared with previous experimental work [2]. The results of the comparison and the adequacy of the improved database are discussed. Diffusion profiles on grain boundaries in α-Zr for Cr and Co are presented in the temperature range of 380–460 K. - Highlights: • An improved database for fast diffusion paths was obtained. • The diffusion parameters in type C kinetic on fast paths in α-Zr for Cr and Co were used. • Simulated diffusion profiles were compared with previous experimental results. This comparison and the adequacy of the improved database are discussed. • Diffusion parameters for fast diffusion paths in Zr at low temperature were assessed for Co and Cr. • Diffusion profiles on grain boundaries in α-Zr for Cr and Co are presented in the temperature range of 380–460 K.
Microstructure and mechanical properties of as-cast Zr-Nb alloys.
Kondo, Ryota; Nomura, Naoyuki; Suyalatu; Tsutsumi, Yusuke; Doi, Hisashi; Hanawa, Takao
2011-12-01
On the basis of the microstructures and mechanical properties of as-cast Zr-(0-24)Nb alloys the effects of phase constitution on the mechanical properties and magnetic susceptibility are discussed in order to develop Zr alloys for use in magnetic resonance imaging (MRI). The microstructures were evaluated using an X-ray diffractometer, an optical microscope, and a transmission electron microscope; the mechanical properties were evaluated by a tensile test. The α' phase was dominantly formed with less than 6 mass% Nb content. The ω phase was formed in Zr-(6-20)Nb alloys, but disappeared from Zr-22Nb. The β phase dominantly existed in Zr-(9-24)Nb alloys. The mechanical properties as well as the magnetic susceptibility of the Zr-Nb alloys varied depending on the phase constitution. The Zr-Nb alloys consisting of mainly α' phase showed high strength, moderate ductility, and a high Young's modulus, retaining low magnetic susceptibility. Zr-Nb alloys containing a larger volume of ω phase were found to be brittle and, thus, should be avoided, despite their low magnetic susceptibility. When the Zr-Nb alloys consisted primarily of β phase the effect of ω phase weakened the mechanical properties, thereby leading to an increase in ductility, even with an increase in magnetic susceptibility. The minimum value of Young's modulus was obtained for Zr-20Nb, because this composition was the phase boundary between the β and ω phases. However, the magnetic susceptibility of the alloy was half that of Ti-6Al-4V alloys. Zr-Nb alloys consisting of α' or β phase have excellent mechanical properties with low magnetic susceptibility and, thus, these alloys could be useful for medical devices used in MRI. Copyright © 2011 Acta Materialia Inc. Published by Elsevier Ltd. All rights reserved.
Shape memory characteristics of Ti-22Nb-(2-8)Zr(at.%) biomedical alloys
International Nuclear Information System (INIS)
Kim, J.I.; Kim, H.Y.; Inamura, T.; Hosoda, H.; Miyazaki, S.
2005-01-01
Shape memory characteristics of Ti-22Nb-(2-8)Zr(at.%) biomedical alloys were investigated by using tensile tests and X-ray diffraction (XRD) measurement. The alloy ingots were fabricated by an arc melting method. The ingots were cold-rolled by a reduction up to 95% in thickness at room temperature. All the alloys were solution-treated at 1173 K for 1.8 ks. The alloys subjected to the solution treatment exhibited large elongations ranging between 28 and 40%. The martensitic transformation temperature decreased by 38 K with 1 at.% increase of Zr content. The maximum recovered strain of 4.3% was obtained in the Ti-22Nb-4Zr(at.%) alloy. Ti-22Nb-(2-4)Zr(at.%) and Ti-22Nb-6Zr(at.%) alloys exhibited stable shape memory effect and superelastic behavior at room temperature, respectively
Morais, Nathanael Wagner Sales; Lopes, Denise Adorno; Schön, Cláudio Geraldo
2018-04-01
The present work is the second and final part of an extended investigation on Usbnd Nb - Zr alloys. It investigates the effect of mechanical processing routes on microstructure of alloys U - 3 wt % Nb - 9 wt % Zr and U - 9 wt% Nb - 3 wt% Zr, through X-ray diffraction and scanning electron microscopy, completing the investigation, which started with alloy U - 6 wt% Nb - 6 wt% Zr in part 1. Mechanical properties are determined using microhardness and bending tests and correlated with the developed microstructures. The results show that processing sequence, in particular the inclusion of a 1000 °C heat treatment step, affects significantly the microstructure and mechanical properties of these alloys alloy in different ways. Microstructural characterization shows that both alloys present significant volume fraction of precipitates of a body-centered cubic (BCC) γ-Nb-Zr rich phase in addition the uranium-rich matrix. Bending tests show that sample ductility does not correlate necessarily with hardness and that the key factor appears to be the amount of the γ-Nb-Zr precipitates, which controls the matrix microstructure. Samples with a monoclinic α″ cellular microstructure and/or with the tetragonally-distorted BCC phase (γ0), although not strictly ductile, showed the largest allowed strains-before-break and complete elastic recovery of the broken pieces, pointing out to the macroscopic observation of superelasticity.
Energy Technology Data Exchange (ETDEWEB)
Yu, H.; Yao, Z., E-mail: 12hy1@queensu.ca [Queen' s University, Department of Mechanical and Materials Engineering, Kingston, ON (Canada); Kirk, M.A. [Argonne National Laboratory, Materials Science Division, Argonne, IL (United States); Daymond, M.R. [Queen' s University, Department of Mechanical and Materials Engineering, Kingston, ON (Canada)
2015-07-01
In situ heavy ion irradiation with 1 MeV Kr{sup 2+} was carried out to study irradiation induced phase change and atomic lattice defects in theβ phase of Zr Excel alloy. No decomposition of β-Zr was observed under irradiation at either 200 {sup o}C or 450 {sup o}C. However, ω-Zr particles experienced shape change and shrinkage associated enrichment of Fe in the β/ω interface at 200 {sup o}C irradiation but not at 450 {sup o}C. The defect evolution in the β-phase was examined with single phase Zr-20Nb alloy. It was found that dislocation loops with Burgers vector 1/2<111> and <001> both present in β-Zr under room temperature irradiation. (author)
Ribeiro, Ana Lúcia Roselino; Hammer, Peter; Vaz, Luís Geraldo; Rocha, Luís Augusto
2013-12-01
The main aim of this work was to assess the electrochemical behavior of new Ti35Nb5Zr and Ti35Nb10Zr alloys in artificial saliva at 37 °C to verify if they are indicated to be used as biomaterials in dentistry as alternatives to Ti6Al4V alloys in terms of corrosion protection efficiency of the material. Electrochemical impedance spectroscopy (EIS) experiments were carried out for different periods of time (0.5-216 h) in a three-electrode cell, where the working electrode (Ti alloys) was exposed to artificial saliva at 37 °C. The near-surface region of the alloys was investigated using x-ray photoelectron spectroscopy (XPS). All alloys exhibited an increase in corrosion potential with the immersion time, indicating the growth and stabilization of the passive film. Ti35Nb5Zr and Ti6Al4V alloys had their EIS results interpreted by a double-layer circuit, while the Ti35Nb10Zr alloy was modeled by a one-layer circuit. In general, the new TiNbZr alloys showed similar behavior to that observed for the Ti6Al4V. XPS results suggest, in the case of the TiNbZr alloys, the presence of a thicker passive layer containing a lower fraction of TiO2 phase than that of Ti6Al4V. After long-term immersion, all alloys develop a calcium phosphate phase on the surface. The new TiNbZr alloys appear as potential candidates to be used as a substitute to Ti6Al4V in the manufacturing of dental implant-abutment sets.
Local atomic structure of Zr-Cu and Zr-Cu-Al amorphous alloys investigated by EXAFS method
International Nuclear Information System (INIS)
Antonowicz, J.; Pietnoczka, A.; Zalewski, W.; Bacewicz, R.; Stoica, M.; Georgarakis, K.; Yavari, A.R.
2011-01-01
Research highlights: → Coordination number, interatomic distances and mean square atomic displacement in Zr-Cu and Zr-Cu-Al glasses. → Icosahedral symmetry in local atomic structure. → Deviation from random mixing behavior resulting from Al addition. - Abstract: We report on extended X-ray absorption fine structure (EXAFS) study of rapidly quenched Zr-Cu and Zr-Cu-Al glassy alloys. The local atomic order around Zr and Cu atoms was investigated. From the EXAFS data fitting the values of coordination number, interatomic distances and mean square atomic displacement were obtained for wide range of compositions. It was found that icosahedral symmetry rather than that of corresponding crystalline analogs dominates in the local atomic structure of Zr-Cu and Zr-Cu-Al amorphous alloys. Judging from bonding preferences we conclude that addition of Al as an alloying element results in considerable deviation from random mixing behavior observed in binary Zr-Cu alloys.
Characters of alloy Zr-0.4%Mo-0.5%Fe-0.5%Cr post heat treatment and cold rolling
International Nuclear Information System (INIS)
Sungkono; Siti Aidah
2014-01-01
Research and development of Zr-Mo-Fe-Cr alloys aimed to obtain PWR fuel element structure material with high burn up. In this study of the Zr-0.4%Mo-0.5%Fe-0.5%Cr alloys was prepared from zirconium sponge, molybdenum, iron and chromium powder. The alloy were heat treated at varying temperatures of 650 and 750 °C and retention time of 1, 1.5 and 2 hours. The objectives of this research was to obtain effect of thickness reduction on the character of Zr-0.4%Mo-0.5%Fe-0.5%Cr alloy. The results of this experiment showed that the microstructures of Zr-0.4%Mo-0.5%Fe-0.5%Cr alloy after heat treatment and cold rolling exhibits that the higher of the thickness reduction has applied on the alloy caused the microstructure to evolve from deformed equiaxial grains into flat bar grains and then into deformed flat bar grains. However, the higher of the temperature and the retention time then the larger grain structures so that the cold rolling causes the shape of the grains structure into a flat bar with a relatively larger size which affects the lower hardness. The Zr-0.4%Mo-0.5%Fe-0.5%Cr alloy after heat treatment (650-750°C; 1.5-2 hours) can undergo cold deformation without cracking at a thickness reduction between 5 to 15%. (author)
International Nuclear Information System (INIS)
Bordoni, Roberto A.; Olmedo, Ana M.; Villegas, Marina; Maroto, Alberto J. G.; Lin, J.; Szpunar, J. A.
1999-01-01
The corrosion kinetics of Zr-2.5 Nb and Zircaloy-4 was studied at 350 C degrees in lithiated heavy water. The oxides grown on both alloys during the exposures were found to be strongly textured. The pole figures showed that the major orientation components of the oxide formed on Zr-2.5 Nb were (10-3) [0-10] and (10-3)[301] while (10-3) fiber was formed on Zircaloy-4. No significant change in texture was found in either alloy when increasing the thickness of the oxide film. The phases present in the film were determined and their evolution with the exposure time was followed. The results indicated that the tetragonal volume fraction decreased with increasing the thickness of the oxide layers of both materials. The tetragonal volume fraction of Zircaloy-4 was higher than that of Zr-2.5 Nb for the same oxide thickness. (author)
Energy Technology Data Exchange (ETDEWEB)
Lee, Yun Ju; Kim, Tae Ho; Kim, Ji Hyun [UNIST, Ulsan (Korea, Republic of)
2016-05-15
The water-metal interface is regarded as rate-controlling site governing the rapid oxidation transition in high burn-up fuel. And the zirconium oxide is made in water-metal interface and its structure and phase do an important role in terms of oxide properties. During oxidation process, the protective tetragonal oxide layer develops at the interface due to accumulated high stress during oxide growth, and it turns into non-protective monoclinic oxide with increasing oxide thickness, thus decreasing the stress. It has been reported that Nb addition was proven to be very beneficial for increasing the corrosion resistance of the zirconium alloys. From a more recent study, Cu addition in Nb containing Zirconium alloy was reported to be effective for increasing corrosion resistance in water containing B and Li. According to the previous research conducted, Zr-Nb-Cu shows better corrosion resistance than Zircaloy-4. The dissolved hydrogen (DH) concentration is the key issue of primary water chemistry, and the effect of DH concentration on the corrosion rate of nickel based alloy has been researched. However, the effect of DH on the zirconium alloy corrosion mechanism was not fully investigated. In this study, the weight gain measurement, FIB-SEM analysis, and Raman spectroscopic measurement were conducted to investigate the effects of dissolved hydrogen concentration and the chemical composition on the corrosion resistance and oxide phase of Zr-Nb-Cu alloy and Zr-Nb-Sn alloy after oxidizing in a primary water environment for 20 d. The corrosion rate of Zr-Nb-Cu alloy is slow, when it is compared to Zr-Nb-Sn alloy. In SEM images, the oxide thickness of Zr-Nb-Cu alloy is measured to be around 1.06 μm it of Zr-Nb-Sn alloy is measured to be 1.15 μm. It is because of the Segregation made by Sn solute element when Sn solute element oxidized. And according to ex situ Raman spectra, Zr-Nb-Cu alloy oxide has more tetragonal zirconium oxide fraction than Zr-Nb-Sn alloy oxide.
Precipitation hardening in dilute Al–Zr alloys
Directory of Open Access Journals (Sweden)
Pedro Henrique Lamarão Souza
2018-01-01
Full Text Available The aim of this study was to investigate the effect of solute content (hipoperitectic Al–0.22 wt.%Zr and hiperperitectic Al–0.32 wt.%Zr on the precipitation hardening and microstructural evolution of dilute Al–Zr alloys isothermally aged. The materials were conventionally cast in a muffle furnace, solidified in a water-cooled Cu mold and subsequently heat-treated at the temperature of 650 K (377 °C for 4, 12, 24, 100 and 400 h. Mechanical characterization was performed at room temperature, using a microhardness tester and microstructural characterization was carried out on a Transmission Electron Microscope – TEM. The observed microhardness values increased during isothermal aging, due to the precipitation of nanometer-scale Al3Zr L12 particles. Peak strength was achieved within 100 h of aging. After aging for 400 h, microhardness values presented a slight decrease for both alloys, thus indicating overaging due to the coalescence of precipitates. Microhardness values increased with solute content, due to the precipitation of a higher number density of finer precipitates. After 400 h of heat-treating, coalescence was higher for the alloy with lower solute content and, also, the presence of antiphase boundaries – APBs, planar faults associated with the L12 to D023 structural transition, were observed. Comparing theoretical calculations of the increment in strength due to precipitation strengthening with experimental results, it was observed that their values are in reasonable agreement. The Orowan dislocation looping mechanism takes place during precipitation hardening for both alloys in the peak hardness condition.
Atomic bonding and mechanical properties of Al-Mg-Zr-Sc alloy
Institute of Scientific and Technical Information of China (English)
高英俊; 班冬梅; 韩永剑; 钟夏平; 刘慧
2004-01-01
The valence electron structures of Al-Mg alloy with minor Sc and Zr were calculated according to the empirical electron theory(EET) in solid. The results show that because of the strong interaction of Al atom with Zr and Sc atom in melting during solidification, the Al3 Sc and Al3 (Sc1-xZrx) particles which act as heterogeneous nuclear are firstly crystallized in alloy to make grains refine. In progress of solidification, the Al-Sc, Al-Zr-Sc segregation regions are formed in solid solution matrix of Al-Mg alloy owing to the strong interaction of Al atom with Zr, Scatoms in bulk of alloy, so in the following homogenization treatment, the finer dispersed Al3 Sc and Al3 (Sc1-x Zrx) second-particles which are coherence with the matrix are precipitated in the segregation region. These finer second particles with the strong Al-Zr, Al-Sc covalent bonds can strengthen the covalent bonds in matrix of the alloy, and also enhance the hardness and strength of Al-Mg alloy. Those finer second-particles precipitated in interface of sub-grains can also strengthen the covalence bonds there, and effectively hinder the interface of sub-grains from migrating and restrain the sub-grains from growing, and cause better thermal stability of Al-Mg alloy.
Shaha, S. K.; Czerwinski, F.; Kasprzak, W.; Friedman, J.; Chen, D. L.
2015-07-01
High-temperature tensile and low-cycle fatigue tests were performed to assess the influence of micro-additions of Ti, V, and Zr on the improvement of the Al-7Si-1Cu-0.5Mg (wt pct) alloy in the as-cast condition. Addition of transition metals led to modification of microstructure where in addition to conventional phases present in the Al-7Si-1Cu-0.5Mg base, new thermally stable micro-sized Zr-Ti-V-rich phases Al21.4Si4.1Ti3.5VZr3.9, Al6.7Si1.2TiZr1.8, Al2.8Si3.8V1.6Zr, and Al5.1Si35.4Ti1.6Zr5.7Fe were formed. The tensile tests showed that with increasing test temperature from 298 K to 673 K (25 °C to 400 °C), the yield stress and tensile strength of the present studied alloy decreased from 161 to 84 MPa and from 261 to 102 MPa, respectively. Also, the studied alloy exhibited 18, 12, and 5 pct higher tensile strength than the alloy A356, 354 and existing Al-Si-Cu-Mg alloy modified with additions of Zr, Ti, and Ni, respectively. The fatigue life of the studied alloy was substantially longer than those of the reference alloys A356 and the same Al-7Si-1Cu-0.5Mg base with minor additions of V, Zr, and Ti in the T6 condition. Fractographic analysis after tensile tests revealed that at the lower temperature up to 473 K (200 °C), the cleavage-type brittle fracture for the precipitates and ductile fracture for the matrix were dominant while at higher temperature fully ductile-type fracture with debonding and pull-out of cracked particles was identified. It is believed that the intermetallic precipitates containing Zr, Ti, and V improve the alloy performance at increased temperatures.
Corrosion rate transients observed by linear polarization techniques at Zr-1%Nb alloy
International Nuclear Information System (INIS)
Beran, J.; Cerny, K.
1997-01-01
Momentary corrosion rate of Zr-1%Nb alloy during nonisothermal autoclave experiments at temperature up to 328 deg. C in various solutions was determined by T/R p values (T - absolute temperature, R p - polarization resistance), multiplied by temperature independent conversion factor. This factor was found by comparison of conventional corrosion loss evaluation with electrochemical measurements. Corrosion rate transients in boric acid solutions and in lithium hydroxide differed significantly. Great differences were also found in stabilized corrosion rates at the end of experiments. Temperature irregularities caused considerable changes in corrosion rate. (author). 5 refs, 5 figs, 1 tab
Corrosion rate transients observed by linear polarization techniques at Zr-1%Nb alloy
Energy Technology Data Exchange (ETDEWEB)
Beran, J; Cerny, K [ZJS SKODA plc., Pelzen (Czech Republic)
1997-02-01
Momentary corrosion rate of Zr-1%Nb alloy during nonisothermal autoclave experiments at temperature up to 328 deg. C in various solutions was determined by T/R{sub p} values (T - absolute temperature, R{sub p}- polarization resistance), multiplied by temperature independent conversion factor. This factor was found by comparison of conventional corrosion loss evaluation with electrochemical measurements. Corrosion rate transients in boric acid solutions and in lithium hydroxide differed significantly. Great differences were also found in stabilized corrosion rates at the end of experiments. Temperature irregularities caused considerable changes in corrosion rate. (author). 5 refs, 5 figs, 1 tab.
Electric resistivity and thermoelectricity of Ni-Nb-Zr and Ni-Nb-Zr-H glassy alloys
Fukuhara, Mikio; Inoue, Akihisa
2010-09-01
Electric resistivity ρ and thermoelectric power S of Ni 36Nb 24Zr 40 and (Ni 0.36Nb 0.24Zr 0.4) 90H 10 glassy alloys were investigated in temperature region between 1.5 and 300 K. After resistivity curves of both alloys increase gradually with decreasing temperature down to around 6 K, they dropped suddenly and then reached zero resistivity at 2.1 K, leading to superconductivity. Linear curve with negative TCR of ρ vs T2 and slight increase of S/ T in temperature region down to around 6 K clearly reveal Fermi-liquid phenomenon in electronic state for both alloys independent of hydrogen content.
Electric resistivity and thermoelectricity of Ni-Nb-Zr and Ni-Nb-Zr-H glassy alloys
International Nuclear Information System (INIS)
Fukuhara, Mikio; Inoue, Akihisa
2010-01-01
Electric resistivity ρ and thermoelectric power S of Ni 36 Nb 24 Zr 40 and (Ni 0.36 Nb 0.24 Zr 0.4 ) 90 H 10 glassy alloys were investigated in temperature region between 1.5 and 300 K. After resistivity curves of both alloys increase gradually with decreasing temperature down to around 6 K, they dropped suddenly and then reached zero resistivity at 2.1 K, leading to superconductivity. Linear curve with negative TCR of ρ vs T 2 and slight increase of S/T in temperature region down to around 6 K clearly reveal Fermi-liquid phenomenon in electronic state for both alloys independent of hydrogen content.
International Nuclear Information System (INIS)
Ribeiro, Ana Lúcia Roselino; Hammer, Peter; Vaz, Luís Geraldo; Rocha, Luís Augusto
2013-01-01
The main aim of this work was to assess the electrochemical behavior of new Ti35Nb5Zr and Ti35Nb10Zr alloys in artificial saliva at 37 °C to verify if they are indicated to be used as biomaterials in dentistry as alternatives to Ti6Al4V alloys in terms of corrosion protection efficiency of the material. Electrochemical impedance spectroscopy (EIS) experiments were carried out for different periods of time (0.5–216 h) in a three-electrode cell, where the working electrode (Ti alloys) was exposed to artificial saliva at 37 °C. The near-surface region of the alloys was investigated using x-ray photoelectron spectroscopy (XPS). All alloys exhibited an increase in corrosion potential with the immersion time, indicating the growth and stabilization of the passive film. Ti35Nb5Zr and Ti6Al4V alloys had their EIS results interpreted by a double-layer circuit, while the Ti35Nb10Zr alloy was modeled by a one-layer circuit. In general, the new TiNbZr alloys showed similar behavior to that observed for the Ti6Al4V. XPS results suggest, in the case of the TiNbZr alloys, the presence of a thicker passive layer containing a lower fraction of TiO 2 phase than that of Ti6Al4V. After long-term immersion, all alloys develop a calcium phosphate phase on the surface. The new TiNbZr alloys appear as potential candidates to be used as a substitute to Ti6Al4V in the manufacturing of dental implant-abutment sets. (paper)
The effect of tungsten on mechanical properties of the Ti-9% Al-3% Zr alloy
International Nuclear Information System (INIS)
Nartova, T.T.; Grigor'ev, I.P.; Stepanov, Yu.N.; Tarasova, O.B.
1979-01-01
The effect of tungsten (from 0 to 10 %) on mechanical properties of the ternary Ti-9 %, Al-3 % Zr alloy, has been studied. The microstructure, tensile properties at 20 and 600 deg C and Vickers hardness in as-forged and as-annealed states have been studied. The experiments have shown that the ultimate strength increases with tungsten content. Titanium alloys with 9 % Al and 3 % Zr in the case of varying tungsten content at 20 deg C fracture by brittle mechanism. The dUctility of the annealed alloy does not rise at 20 deg C, but at the test temperature of 600 deg C the alloy becomes ductile
Devitrification behavior and glass-forming ability of Cu-Zr-Ag alloys
International Nuclear Information System (INIS)
Louzguine-Luzgin, Dmitri V.; Xie, Guoqiang; Zhang, Wei; Inoue, Akihisa
2007-01-01
This paper presents an influence of Ag addition on the glass-forming ability and devitrification behavior of Cu-Zr glassy alloys on heating. The crystallization kinetics and structure changes in Cu 45 Zr 45 Ag 10 and Cu 35 Zr 45 Ag 20 glassy alloys on heating were studied by X-ray diffraction, transmission electron microscopy, differential scanning and isothermal calorimetry methods. Based on the results obtained one can assume that the improvement of the glass-forming ability of the Cu-Zr alloys by the addition of Ag is connected with a particular crystallization mechanism and a higher reduced glass-transition temperature of the Cu 45 Zr 45 Ag 10 ternary alloy compared to the binary Cu 55 Zr 45 counterpart. As observed in the present work crystallization of the Cu-Zr-Ag alloys is found to cause embitterment of the samples and should be avoided as these alloys are considered to be used as structural materials. The Cu 35 Zr 45 Ag 20 alloy shows possible submicron-scale phase separation upon annealing
Study of oxidation behaviour of Zr-based bulk amorphous alloy Zr 65 ...
Indian Academy of Sciences (India)
The oxidation behaviour of Zr-based bulk amorphous alloy Zr65Cu17.5Ni10Al7.5 has been studied in air environment at various temperatures in the temperature range 591–684 K using a thermogravimetric analyser (TGA). The oxidation kinetics of the alloy in the amorphous phase obeys the parabolic rate law for oxidation ...
A DFT study of thermodynamic properties of C36 and C14 Fe2Zr Laves phases
Ali, Kawsar; Ghosh, P. S.; Arya, A. K.
2018-04-01
Fe-Zr alloys are promising materials for metallic waste immobilization in nuclear industry. C36 and C14 Fe2Zr Laves phases are frequently observed in Fe-Zr alloys that can host radionuclides. The phonon dispersions of C36 and C14 Fe2Zr Laves phases shows that both intermetallics are dynamically stable. The Helmholtz free energy, vibrational entropy, internal energy and specific heat at constant volume has been calculated. The zero point energies of C36 and C14 phases are 9.23 and 9.91 kJ/mole, respectively. The vibrational free energy becomes negative at 250 K and 270 K. The high temperature specific heat at constant volume of both intermetallics is 74 J/K/mole.
Hua, Nengbin; Chen, Wenzhe; Zhang, Lei; Li, Guanghui; Liao, Zhenlong; Lin, Yan
2017-07-01
The present study prepares novel Zr 70+x Al 5 Fe 15-x Nb 10 (x=0, 5) alloys by arc-melting for potential biomedical application. The mechanical properties and bio-tribological behaviors of the Zr-based alloys are evaluated and compared with biomedical pure Zr. The as-prepared alloys exhibit a microstructure containing a micrometer-sized dendritic beta-Zr phase dispersed in a Zr 2 Fe-typed matrix. It is found that increasing the content of Zr is favorable for the mechanical compatibility with a combination of low Young's modulus, large plasticity, and high compressive strength. The wear resistance of the Zr-Al-Fe-Nb alloys in air and phosphate buffer saline (PBS) solution is superior to that of pure Zr. The wear mechanism of Zr-based alloys sliding in air is controlled by oxidation and abrasive wear whereas that sliding in PBS is controlled by synergistic effects of the abrasive and corrosive wear. Electrochemical measurements demonstrate that the Zr-based alloys are corrosion resistant in PBS. Their bio-corrosion resistance is improved with the increase in Zr content, which is attributed to the enrichment in Zr and decrease in Al concentration in the surface passive film of alloys. The Zr 75 Al 5 Fe 10 Nb 10 exhibits the best corrosion resistance in PBS, which contributes to its superior wear resistance in a simulated body environment. The combination of good mechanical properties, corrosion resistance, and biotribological behaviors of the Zr-Al-Fe-Nb alloys offers them potential advantages in biomedical applications. Copyright © 2017 Elsevier B.V. All rights reserved.
International Nuclear Information System (INIS)
Sastry, S.M.L.; Oneal, J.E.
1984-01-01
The deformation behavior at 25-300 C of rapidly solidified Al-3Li-0.6Co and Al-3Li-0.3Zr alloys was studied by tensile property measurements and transmission electron microscopic examination of dislocation substructures. In binary Al-3Li and Al-3Li-Co alloys, the modulus normalized yield stress increases with an increase in temperature up to 150 C and then decreases. The yield stress at 25 C of Al-3Li-0.3Zr alloys is 180-200 MPa higher than that of Al-3Li alloys. However, the yield stress of the Zr-containing alloy decreases drastically with increasing temperatures above 75 C. The short-term yield stresses at 100-200 C of the Al-3Li-based alloys are higher than that of the conventional high-temperature Al alloys. The temperature dependences of the flow stresses of the alloys were analyzed in terms of the magnitudes and temperature dependences of the various strengthening contributions in the two alloys. The dislocation substructures at 25-300 C were correlated with mechanical properties. 19 references
Effect of HIP temperature on microstructure and low cycle fatigue strength of CuCrZr alloy
Nishi, Hiroshi; Enoeda, Mikio
2011-10-01
In order to investigate the effect of the HIP cycle temperatures on the metallurgic degradation and the mechanical properties of CuCrZr alloy, assessments of the microstructure, tensile test, Charpy impact test and low cycle fatigue test are performed for various heat treated CuCrZr alloys, which were solution-annealed followed by water-quenched and aged state of CuCrZr with simulated HIP cycle at temperatures of 980 and 1045 °C. Grain growth occurred on 1045 °C HIP CuCrZr, though slightly on 980 °C HIP CuCrZr. Metallurgic degradation such as voids was not found by optical and SEM observations. There were coarse precipitates in all the CuCrZr and the precipitates did not easily dissolve at 980 °C. The low cycle fatigue strength of 1045 °C HIP CuCrZr was lower than that of other CuCrZr because of the metallurgic degradation caused by the heat cycle, while that of other CuCrZr was corresponding to the best fit curve of ITER MPH.
Effect of HIP temperature on microstructure and low cycle fatigue strength of CuCrZr alloy
Energy Technology Data Exchange (ETDEWEB)
Nishi, Hiroshi, E-mail: nishi.hiroshi88@jaea.go.jp [Japan Atomic Energy Agency, Naka-shi, Ibaraki-ken 311-0193 (Japan); Enoeda, Mikio [Japan Atomic Energy Agency, Naka-shi, Ibaraki-ken 311-0193 (Japan)
2011-10-01
In order to investigate the effect of the HIP cycle temperatures on the metallurgic degradation and the mechanical properties of CuCrZr alloy, assessments of the microstructure, tensile test, Charpy impact test and low cycle fatigue test are performed for various heat treated CuCrZr alloys, which were solution-annealed followed by water-quenched and aged state of CuCrZr with simulated HIP cycle at temperatures of 980 and 1045 deg. C. Grain growth occurred on 1045 deg. C HIP CuCrZr, though slightly on 980 deg. C HIP CuCrZr. Metallurgic degradation such as voids was not found by optical and SEM observations. There were coarse precipitates in all the CuCrZr and the precipitates did not easily dissolve at 980 deg. C. The low cycle fatigue strength of 1045 deg. C HIP CuCrZr was lower than that of other CuCrZr because of the metallurgic degradation caused by the heat cycle, while that of other CuCrZr was corresponding to the best fit curve of ITER MPH.
Effect of HIP temperature on microstructure and low cycle fatigue strength of CuCrZr alloy
International Nuclear Information System (INIS)
Nishi, Hiroshi; Enoeda, Mikio
2011-01-01
In order to investigate the effect of the HIP cycle temperatures on the metallurgic degradation and the mechanical properties of CuCrZr alloy, assessments of the microstructure, tensile test, Charpy impact test and low cycle fatigue test are performed for various heat treated CuCrZr alloys, which were solution-annealed followed by water-quenched and aged state of CuCrZr with simulated HIP cycle at temperatures of 980 and 1045 deg. C. Grain growth occurred on 1045 deg. C HIP CuCrZr, though slightly on 980 deg. C HIP CuCrZr. Metallurgic degradation such as voids was not found by optical and SEM observations. There were coarse precipitates in all the CuCrZr and the precipitates did not easily dissolve at 980 deg. C. The low cycle fatigue strength of 1045 deg. C HIP CuCrZr was lower than that of other CuCrZr because of the metallurgic degradation caused by the heat cycle, while that of other CuCrZr was corresponding to the best fit curve of ITER MPH.
Ding, Yunfei; Lin, Jixing; Wen, Cuie; Zhang, Dongmei; Li, Yuncang
2017-11-28
This study investigates the microstructure, mechanical properties, corrosion behavior, and biocompatibility of magnesium (Mg)-based Mg1Zr2SrxDy (x = 0, 1, 1.63, 2.08 wt %) alloys for biodegradable implant applications. The corrosion behavior of the Mg-based alloys has been evaluated in simulated body fluid using an electrochemical technique and hydrogen evolution. The biocompatibility of the Mg-based alloys has been assessed using SaSO2 cells. Results indicate that the addition of Dy to Mg-Zr-Sr alloy showed a positive impact on the corrosion behavior and significantly decreased the degradation rates of the alloys. The degradation rate of Mg1Zr2Sr1.0Dy decreased from 17.61 to 12.50 mm year -1 of Mg1Zr2Sr2.08Dy based on the hydrogen evolution. The ultimate compressive strength decreased from 270.90 MPa for Mg1Zr2Sr1Dy to 236.71 MPa for Mg1Zr2Sr2.08Dy. An increase in the addition of Dy to the Mg-based alloys resulted in an increase in the volume fraction of the Mg 2 Dy phase, which mitigated the galvanic effect between the Mg 17 Sr 2 phase and the Mg matrix, and led to an increase in the corrosion resistance of the base alloy. The biocompatibility of the Mg-based alloys was enhanced with decreasing corrosion rates. Mg1Zr2Sr2.08Dy exhibited the lowest corrosion rate and the highest biocompatibility compared with the other Mg-based alloys. © 2017 Wiley Periodicals, Inc. J Biomed Mater Res Part B: Appl Biomater, 2017. © 2017 Wiley Periodicals, Inc.
Influence of alkali metal hydroxides on corrosion of Zr-based alloys
International Nuclear Information System (INIS)
Jeong, Y.H.; Ruhmann, H.; Garzarolli, F.
1997-01-01
In this study the influence of group-1 alkali hydroxides on different zirconium based alloys has been evaluated. The experiments have been carried out in small stainless steel autoclaves at 350 deg. C in pressurized 17 MPa water, with in low (0.32 mmol), medium (4.3 mmol) and high (31.5 mmol) equimolar concentrations of Li-, Na-, K-, Rb- and Cs-Hydroxides. Two types of alloys have been investigated: Zr-Sn-(Transition metal) and Zr-Sn-Nb-(Transition metal). The corrosion behaviour was evaluated from weight gain measurements. From the experiments the cation could be identified as the responsible species for zirconium alloy corrosion in alkalized water. The radius of the cation governs the corrosion behaviour in the pre accelerated region of zircaloy corrosion. Incorporating of alkali cations into the zirconium oxide lattice is probably the mechanism which allows the corrosion enhancement for Li and Na and the significantly lower effect for the other bases. Nb containing alloys show lower corrosion resistance than alloys from the Zr-Sn-TRM system in all alkali solutions. Both types of alloys corrode significantly more in LiOH and NaOH than in the other alkali environments. Lowest corrosive aggressiveness has been found for CsOH followed by KOH. Concluding from the corrosion behaviour in the different alkali environments and taking into account the tendency to promote accelerate corrosion, CsOH and KOH are possible alternate alkalis for PWR application. (author). 17 refs, 15 figs, 5 tabs
Influence of alkali metal hydroxides on corrosion of Zr-based alloys
Energy Technology Data Exchange (ETDEWEB)
Jeong, Y H [Korea Atomic Energy Research Inst., Dae Jun (Korea, Republic of); Ruhmann, H; Garzarolli, F [Siemens-KWU, Power Generation Group, Erlangen (Germany)
1997-02-01
In this study the influence of group-1 alkali hydroxides on different zirconium based alloys has been evaluated. The experiments have been carried out in small stainless steel autoclaves at 350 deg. C in pressurized 17 MPa water, with in low (0.32 mmol), medium (4.3 mmol) and high (31.5 mmol) equimolar concentrations of Li-, Na-, K-, Rb- and Cs-Hydroxides. Two types of alloys have been investigated: Zr-Sn-(Transition metal) and Zr-Sn-Nb-(Transition metal). The corrosion behaviour was evaluated from weight gain measurements. From the experiments the cation could be identified as the responsible species for zirconium alloy corrosion in alkalized water. The radius of the cation governs the corrosion behaviour in the pre accelerated region of zircaloy corrosion. Incorporating of alkali cations into the zirconium oxide lattice is probably the mechanism which allows the corrosion enhancement for Li and Na and the significantly lower effect for the other bases. Nb containing alloys show lower corrosion resistance than alloys from the Zr-Sn-TRM system in all alkali solutions. Both types of alloys corrode significantly more in LiOH and NaOH than in the other alkali environments. Lowest corrosive aggressiveness has been found for CsOH followed by KOH. Concluding from the corrosion behaviour in the different alkali environments and taking into account the tendency to promote accelerate corrosion, CsOH and KOH are possible alternate alkalis for PWR application. (author). 17 refs, 15 figs, 5 tabs.
Method of treating Ti--Nb--Zr--Ta superconducting alloys
International Nuclear Information System (INIS)
Horiuchi, T.; Monju, Y.; Tatara, I.; Nagai, N.; Hisata, M.; Matsumoto, K.
1975-01-01
A superconducting alloy is formulated from 10 to 50 at. percent Ti, 20 to 50 at. percent Nb, 10 to 40 at. percent Zr, and 5 to 12 at. percent Ta. A Ti--Nb--Zr--Ta superconducting alloy with a fine, non-homogeneous structure is obtained by forming a β solid solution of Ti--Nb--Zr--Ta alloy by heating to a temperature within the β solid solution range, cooling, and then cold working the heated alloy. The cold worked alloy is heated to a temperature within the (β' + β'') alloy to maintain the peritectoid structure, cold worked, then heated to a temperature within the eutectoid range to form a multiphase alloy structure and then cooled and finally cold worked. (U.S.)
Hot temperature corrosion of a zircon-1%niobium alloy
International Nuclear Information System (INIS)
Muller, Sebastian; Lanzani, Liliana
2010-01-01
The reaction of the Zr-1%Niobium alloy to corrosion is studied in this work, which is used as fuel elements sheath material in Russian VVER reactors. For comparative purposes, the conventional alloys Zircaloy-4 y Zr-2.5%Nb have been tested as well. Autoclave tests were carried out in water and in solutions of LiOH with concentrations of 0-1 to 1M at 343 o C and in water vapor at 400 o C (following ASTM G2/G2M-06). The gain in weight/unit of area of the autoclaved samples was determined in order to evaluate the corrosion, and metallographics were performed to characterize the oxides and hydrides that formed. The results show that for tests of 16 hours, a minimum concentration of 0.65M LiOH is needed to accelerate corrosion in Zr-1%Nb and Zr-2.5%Nb, while acceleration occurs in Zircaloy-4 at a concentration of 0.45M. In solutions of LiOH 1M the hydrogen 'uptake' in Zr-1Nb and Zr-2,5Nb is considerably lower in Zircaloy-4. The lesser amount of β-Zr phase present in the Zr-1Nb alloy produces thinner and more compact oxides, with better visual characteristics than for those formed in Zr-2.5Nb
The effect of aging on the critical current density in superconducting Nb-Ti-Zr alloys
International Nuclear Information System (INIS)
Ishida, Fumihiko; Doi, Toshio
1979-01-01
The effect of aging temperature, cold-reduction prior to aging, O 2 content and composition on the variation in the critical current density, J sub(c), by isothermal aging was investigated in heavily cold-worked Nb-Ti-Zr alloys on the Nb-Ti side. The results are summarized as follows: (1) When these alloys are aged isothermally at temperatures from 350 to 500 0 C, J sub(c) increases initially, reaches a maximum value and then decreases. Increase in J sub(c) of three orders of magnitude is possible as a result of aging. (2) The maximum value of J sub(c) on the isothermal aging curve becomes higher at a lower aging temperature, at a less cold-reduction prior to aging or with a higher O 2 content. (3) The J sub(c) of aged alloy becomes a maximum in composition containing 35 at%Nb, 60 to 65 at%Ti and less than 5 at%Zr. (4) The maximum value of J sub(c) was obtained for Nb-60.0 at%Ti-5.0 at%Zr alloy containing 1200 wt ppm O 2 , aged at 350 0 C for 330 h after 98.44% cold-reduction. The values of J sub(c) at 4.2 K were 2.4 x 10 9 A/m 2 at 5.0 T, 1.1 x 10 9 A/m 2 at 7.0 T and 3.0 x 10 8 A/m 2 at 9.0 T, respectively. The upper critical field of this specimen was 11.3 T at 4.2 K and its critical temperature was 8.6 K. (author)
Energy Technology Data Exchange (ETDEWEB)
Luan, B.F., E-mail: bfluan@cqu.edu.cn [College of Materials Science and Engineering, Chongqing University, Chongqing 400044 (China); Wang, J.M.; Qiu, R.S.; Tao, B.R.; He, W.J. [College of Materials Science and Engineering, Chongqing University, Chongqing 400044 (China); Zhang, X.Y.; Liu, R.P. [State Key Laboratory of Metastable Materials Science and Technology, Yanshan University, Qinhuangdao 066004 (China); Liu, Q., E-mail: qingliu@cqu.edu.cn [College of Materials Science and Engineering, Chongqing University, Chongqing 400044 (China)
2016-09-05
Energy dispersive X-ray spectroscopy in scanning transmission electron microscope (STEM-EDS) technique and first-principles calculation are jointly utilized to investigate the distribution trends and site preferences of alloying elements in the precipitates within Zr-1.0Cr-0.4Fe-0.4Mo-0.4Bi alloy. Based on selected area electron diffraction (SAED) and energy dispersive X-ray spectroscopy (EDS) results, the precipitates within the studied alloy are confirmed to be ZrCr{sub 2}-based Laves phase with FCC (C15) type structure. The STEM-EDS elemental mapping is acquired to clarify the distribution trends of alloying elements in precipitates, i.e. Fe>Mo>Bi. To better verify this distribution behavior, substitutional formation energies and equilibrium concentrations of ternary alloying elements in ZrCr{sub 2} Laves phase are calculated by first-principles. The calculated results show a good consistence with the STEM-EDS results. In addition, the site preferences of ternary alloying elements in ZrCr{sub 2} Laves phase are predicted by the calculation of transfer energies. Finally, the reasons accounting for different distribution trends and site preferences of alloying elements in ZrCr{sub 2} Laves phase are discussed in terms of density of states, which attributed to the pseudogap effect and hybridizations between atoms. - Highlights: • Clarified the distribution trends of Fe>Mo>Bi in precipitates by STEM-EDS. • Verified the experimental results by first-principles calculation. • Predicted the site preferences of alloying elements by first-principles calculation. • Hybridization and pseudogap lead to the strong distribution and site preferences.
Diffusion of hydrogen interstitials in Zr based AB2 and mischmetal based AB5 alloys
International Nuclear Information System (INIS)
Mani, N; Ravi, N; Ramaprabhu, S
2005-01-01
The Zr based AB 2 alloys ZrMnFe 0.5 Ni 0.5 , ZrMnFe 0.5 Co 0.5 and mischmetal (Mm) based AB 5 alloy MmNi 3.5 Al 0.5 Fe 0.5 Co 0.5 have been prepared and characterized by means of powder x-ray diffractograms. The hydrogen absorption kinetics of these alloys have been studied in the temperature and pressure ranges 450-650 0 C and 10-100 mbar respectively with a maximum H to host alloy formula unit ratio of 0.01, using a pressure reduction technique. The diffusion coefficient of the hydrogen interstitials has been determined from hydrogen absorption kinetics experiments. The dependence of the diffusion coefficient on the alloy content has been discussed. For Mm based MmNi 3.5 Al 0.5 Fe 0.5 Co 0.5 alloy, the diffusion coefficient is about an order of magnitude higher than that of the Zr based alloys
The Method of Measured Electrical Resistivity in Studying Phase Transformations in Zr1Nb Alloy
International Nuclear Information System (INIS)
Gritsina, V.M.; Klimenko, S.P.; Chernyaeva, T.P.
2006-01-01
The paper systematically arranges and analyzes the data on the methods of research into α ↔ β transformation process in zirconium alloys, as well as capabilities and information provided by each method. A special emphasis is put on the method of measured electrical resistivity. The authors also present the results of their own research into α ↔ β transformation process in Zr1Nb alloy (in the material of Zr+1% Nb tubing produced in Ukraine from calciothermal zirconium). The ρ →T curve was used to define the maximum and minimum values for transformation temperatures. Combined processing of the phase data on Zr+1% Nb found in literature and obtained from measured resistivity suggests that transformation process happens in several stages. The maximum value on the ρ → T curve corresponds to the beginning of stage 3, whereas the minimum - to its completion; as suggested by the pooled data, accounts for over 95% of the total volume of the material
Energy Technology Data Exchange (ETDEWEB)
Ho, Wen-Fu, E-mail: fujiiwfho@yahoo.com.tw [Department of Materials Science and Engineering, Da-Yeh University, Changhua, Taiwan (China); Wu, Shih-Ching; Hsu, Shih-Kuang [Department of Dental Technology and Materials Science, Central Taiwan University of Science and Technology, Taiwan (China); Institute of Biomedical Engineering and Materials Science, Central Taiwan University of Science and Technology, Taiwan (China); Li, Yu-Chi [Department of Materials Science and Engineering, Da-Yeh University, Changhua, Taiwan (China); Hsu, Hsueh-Chuan, E-mail: hchsu@ctust.edu.tw [Department of Dental Technology and Materials Science, Central Taiwan University of Science and Technology, Taiwan (China); Institute of Biomedical Engineering and Materials Science, Central Taiwan University of Science and Technology, Taiwan (China)
2012-04-01
The effects of molybdenum on the structure and mechanical properties of a Ti-10Zr-based system were studied with an emphasis on improving the strength/modulus ratio. Commercially pure titanium (c.p. Ti) was used as a control. As-cast Ti-10Zr and a series of Ti-10Zr-xMo (x = 1, 3, 5, 7.5, 10, 12.5, 15, 17.5 and 20 wt.%) alloys prepared using a commercial arc-melting vacuum pressure casting system were investigated. X-ray diffraction (XRD) for phase analysis was conducted with a diffractometer. Three-point bending tests were performed to evaluate the mechanical properties of all specimens. The experimental results indicated that these alloys had different structures and mechanical properties when various amounts of Mo were added. The as-cast Ti-10Zr has a hexagonal {alpha} Prime phase, and when 1 wt.% Mo was introduced into the Ti-10Zr alloy, the structure remained essentially unchanged. However, with 3 or 5 wt.%, the martensitic {alpha} Double-Prime structure was found. When increased to 7.5 wt.% or greater, retention of the metastable {beta} phase began. The {omega} phase was observed only in the Ti-10Zr-7.5Mo alloy. Among all Ti-10Zr-xMo alloys, the {alpha} Double-Prime -phase Ti-10Zr-5Mo alloy had the lowest elastic modulus. It is noteworthy that all the Ti-10Zr and Ti-10Zr-xMo alloys had good ductility. In addition, the Ti-10Zr-5Mo and Ti-10Zr-12.5Mo alloys exhibited higher bending strength/modulus ratios at 20.1 and 20.4, respectively. Furthermore, the elastically recoverable angles of these two alloys (26.4 Degree-Sign and 24.6 Degree-Sign , respectively) were much greater than those of c.p. Ti (2.7 Degree-Sign ). Given the importance of these properties for implant materials, the low modulus, excellent elastic recovery capability and high strength/modulus ratio of {alpha} Double-Prime phase Ti-10Zr-5Mo and {beta} phase Ti-10Zr-12.5Mo alloys appear to make them promising candidates. - Highlights: Black-Right-Pointing-Pointer The effects of Mo on the structure
International Nuclear Information System (INIS)
Ning Congqin; Zhai Wanyin; Chen Lei; Ding Dongyan; Dai Kerong
2010-01-01
β-type low elastic modulus alloys of the Ti-Nb-Zr system have recently attracted much attention for both orthopedic and dental applications. In the present study, meta-stable β alloys of Ti-35Nb-xZr with different Zr contents were developed. The effect of Zr content on the microstructure, mechanical properties and cell attachment was investigated. It was found that the addition of Zr improved the tensile strength and elongation of Ti-35Nb-xZr alloys, and simultaneously reduced the elastic modulus. Moreover, the Zr element helped to stabilize the β phase. Cell culture work indicated that the addition of Zr enhanced the attachment and spreading of bone marrow stem cells. Cell attachment and spreading on the surface of titanium alloys were dominated not only by the wettability but also by the inherent biocompatibility of alloying elements. The peak-aged alloy with 5 wt% Zr had a highest tensile strength of 874 MPa, while its elastic modulus was only 65 GPa, presenting a much higher strength/modulus ratio than Ti-6Al-4V. The Ti-35Nb-5Zr alloy exhibited a great potential for orthopedic and dental applications.
International Nuclear Information System (INIS)
Ye Yuxing; Gao Yuan
1997-09-01
The effect of dissolution time, temperature, total surface area of U-10Zr alloy pellets and stirring on the dissolution and dissolution rate of uranium in liquid cadmium were studied. Cadmium containing U and Zr dissolved from U-10Zr alloy at 475 degree C and 500 degree C respectively was analyzed with electron microanalyzer. The experimental results show that at 400 degree and 500 degree C with the stirring rate of some 150 r/min, the solubilities of uranium in liquid cadmium are 0.4% and 2.2%, respectively. At the first 30 min, the dissolution rates of U-10Zr alloy pellets are 0.05 g/(cm 2 ·h) and 0.32 g/(cm 2 ·h), respectively. The suitable dissolution conditions for U-10Zr alloy pellets in liquid cadmium (the ratio of the mass of liquid cadmium to that of the pellets ≅7) are: temperature, about 480 degree C; stirring rate, about 150 r/min; dissolution time, 4 h. The distribution of uranium and zirconium in cadmium is homogeneous
Evidence of icosahedral short-range order in Zr70Cu30 and Zr70Cu29Pd1 metallic glasses
DEFF Research Database (Denmark)
Saksl, K.; Franz, H.; Jovari, P.
2003-01-01
Change in local atomic environment during crystallization of Zr-based glassy alloys was studied by extended x-ray absorption fine structure (EXAFS) spectroscopy. The formation of icosahedral quasicrystalline phase followed by crystallization of tetragonal CuZr2 has been observed in the Zr70Cu29Pd1...... glassy alloy during annealing up to 850 K. On the other hand, the binary Zr70Cu30 alloy shows a single glassy to crystalline CuZr2 phase transformation. The local atomic environment of as-quenched Zr70Cu30 alloy is matched to an icosahedral local atomic configuration, which is similar to that of the as......-quenched Zr70Cu29Pd1 alloy and the alloy annealed at 593 K containing icosahedral phase. Considering that the supercooled liquid region appears prior to crystallization in the Zr70Cu30 glassy alloy, the observed results support the theory claiming a strong correlation between the existence of local...
Directory of Open Access Journals (Sweden)
Vončina M.
2017-01-01
Full Text Available The microstructure features and hardness of AlSi9Cu3(Fe die casting alloy was investigated in the presence of Zr addition. The cast alloys were undergone the solutionizing treatment 2 h at 500°C followed by artificial aging at 180°C for 5 h. Optical microscopy and electron micro-analyzer were used to study the formation of different intermetallic phases. The hardness was tested for all samples at 25°C. The results revealed that the intermetallic phase, based on (Al,Si(Zr,Ti, forms when Zr is added in the investigated alloy, while the T6 heat treatment does not influence on the formation of Zr-bearing phase. Results also indicate that the hardness slightly increases in the AlSi9Cu3 alloy in as-cast state when Zr is added, while after T6 heat treatment increases by 50% in the alloy without Zr and by 61% in the alloy with Zr addition.
Microstructural and thermophysical properties of U–6 wt.%Zr alloy for fast reactor application
International Nuclear Information System (INIS)
Kaity, Santu; Banerjee, Joydipta; Nair, M.R.; Ravi, K.; Dash, Smruti; Kutty, T.R.G.; Kumar, Arun; Singh, R.P.
2012-01-01
Highlights: ► Characterization of U–6%Zr alloy prepared by injection casting route. ► Martensitic to non-martensitic transformation of U–6%Zr alloy occurs at 843 K. ► Specific heat versus temperature curve shows a phase transition at 845 K. ► Average coefficient of thermal expansion is 18.28 × 10 −6 K −1 (298–823 K). ► Hardness versus temperature plot shows a transition at 748 K. - Abstract: The microstructural and high temperature behavior of U–6 wt.%Zr alloy has been investigated in this study. U–6 wt.%Zr alloy sample for this study was prepared by following injection casting route. The thermophysical properties like coefficient of thermal expansion, specific heat, thermal conductivity of the above alloy were determined. The hot-hardness data of the U–6 wt.%Zr alloy was also generated from room temperature to 973 K. Apart from that, the fuel-clad chemical compatibility with T91 grade steel was also studied by diffusion couple experiment. No studies have been reported on U–6 wt.%Zr alloy. This paper aims at filling up the gap on characterization and thermophysical property evaluation of U–6 wt.%Zr alloy.
Grain size stability and hardness in nanocrystalline Cu–Al–Zr and Cu–Al–Y alloys
Energy Technology Data Exchange (ETDEWEB)
Roy, D., E-mail: droy2k6@gmail.com [Material Science and Engineering Department, North Carolina State University, Raleigh, NC 27606 (United States); Materials and Metallurgical Engineering Department, NIFFT, Ranchi 834003 (India); Mahesh, B.V. [Department of Mechanical and Aerospace Engineering, Monash University (Australia); Atwater, M.A. [U.S. Army Research Laboratory, Weapons and Materials Research Directorate, RDRL-WMM-F, Aberdeen Proving Ground, MD 21005-5069 (United States); Chan, T.E.; Scattergood, R.O.; Koch, C.C. [Material Science and Engineering Department, North Carolina State University, Raleigh, NC 27606 (United States)
2014-03-01
Cryogenic high energy ball milling has been used to synthesize nanocrystalline Cu–14Al, Cu–12Al–2Zr and Cu–12Al–2Y alloys by mechanical alloying. The alloys were studied with the aim of comparing the effect of substituting Y and Zr in place of Al, in Cu–Al alloys, on the grain size stability at elevated temperatures. The as-milled alloys were subjected to annealing at various temperatures between 200 and 900 °C and the resulting grain morphology has been studied using X-ray diffraction and transmission electron microscopy. The addition of Y results in significantly reduced susceptibility to grain growth whereas in case of CuAl and CuAlZr alloys, the susceptibility to grain growth was much higher. The hardness is substantially increased due to Zr and Y addition in the as-milled CuAl powders. However, the hardness of Cu–12Al–2Zr gradually decreases and approaches that of Cu–14Al alloy after the annealing treatment whereas in case of Cu–12Al–2Y alloy, the relative drop in the hardness is much lower after annealing. Accordingly, the efficacy of grain size stabilization by Y addition at high homologous temperatures has been explained on the basis of a recent thermodynamic stabilization models.
Grain size stability and hardness in nanocrystalline Cu–Al–Zr and Cu–Al–Y alloys
International Nuclear Information System (INIS)
Roy, D.; Mahesh, B.V.; Atwater, M.A.; Chan, T.E.; Scattergood, R.O.; Koch, C.C.
2014-01-01
Cryogenic high energy ball milling has been used to synthesize nanocrystalline Cu–14Al, Cu–12Al–2Zr and Cu–12Al–2Y alloys by mechanical alloying. The alloys were studied with the aim of comparing the effect of substituting Y and Zr in place of Al, in Cu–Al alloys, on the grain size stability at elevated temperatures. The as-milled alloys were subjected to annealing at various temperatures between 200 and 900 °C and the resulting grain morphology has been studied using X-ray diffraction and transmission electron microscopy. The addition of Y results in significantly reduced susceptibility to grain growth whereas in case of CuAl and CuAlZr alloys, the susceptibility to grain growth was much higher. The hardness is substantially increased due to Zr and Y addition in the as-milled CuAl powders. However, the hardness of Cu–12Al–2Zr gradually decreases and approaches that of Cu–14Al alloy after the annealing treatment whereas in case of Cu–12Al–2Y alloy, the relative drop in the hardness is much lower after annealing. Accordingly, the efficacy of grain size stabilization by Y addition at high homologous temperatures has been explained on the basis of a recent thermodynamic stabilization models
Directory of Open Access Journals (Sweden)
Tao Li
2014-06-01
Full Text Available The microstructure, mechanical property, and in vitro biocorrosion behavior of as-cast single-phase biodegradable Mg–1.5Zn–0.6Zr alloy were investigated and compared with a commercial as-cast AZ91D alloy. The results show that the Mg–1.5Zn–0.6Zr alloy had a single-phase solid solution structure, with an average grain size of 34.7 ± 13.1 μm. The alloy exhibited ultimate tensile strength of 168 ± 2.0 MPa, yield strength of 83 ± 0.6 MPa, and elongation of 9.1 ± 0.6%. Immersion tests and electrochemical measurements reveal that the alloy displayed lower biocorrosion rate and more uniform corrosion mode than AZ91D in Hank's solution. The elimination of intensive galvanic corrosion reactions and the formation of a much more compact and uniform corrosion film mainly account for the better biocorrosion properties of the Mg–1.5Zn–0.6Zr alloy than AZ91D.
Mechanism of abnormally slow crystal growth of CuZr alloy
International Nuclear Information System (INIS)
Yan, X. Q.; Lü, Y. J.
2015-01-01
Crystal growth of the glass-forming CuZr alloy is shown to be abnormally slow, which suggests a new method to identify the good glass-forming alloys. The crystal growth of elemental Cu, Pd and binary NiAl, CuZr alloys is systematically studied with the aid of molecular dynamics simulations. The temperature dependence of the growth velocity indicates the different growth mechanisms between the elemental and the alloy systems. The high-speed growth featuring the elemental metals is dominated by the non-activated collision between liquid-like atoms and interface, and the low-speed growth for NiAl and CuZr is determined by the diffusion across the interface. We find that, in contrast to Cu, Pd, and NiAl, a strong stress layering arisen from the density and the local order layering forms in front of the liquid-crystal interface of CuZr alloy, which causes a slow diffusion zone. The formation of the slow diffusion zone suppresses the interface moving, resulting in much small growth velocity of CuZr alloy. We provide a direct evidence of this explanation by applying the compressive stress normal to the interface. The compression is shown to boost the stress layering in CuZr significantly, correspondingly enhancing the slow diffusion zone, and eventually slowing down the crystal growth of CuZr alloy immediately. In contrast, the growth of Cu, Pd, and NiAl is increased by the compression because the low diffusion zones in them are never well developed
Structural investigation of Fe(Cu)ZrB amorphous alloy
International Nuclear Information System (INIS)
Duhaj, P.; Janickovic, D.
1996-01-01
The crystallization process in Fe 86 (Cu 1 )Zr 7 B 6 and Fe 87 Zr 7 B 6 is investigated using the methods of transmission electron microscopy, electron and X-ray diffraction and resistometry. Two crystallization reactions take place during thermal annealing of amorphous Fe 86 (Cu 1 )Zr 7 B 6 and Fe 87 Zr 7 B 6 alloys. In both alloys the first crystallization begins with the formation of nanocrystalline α-Fe at temperature to approximately 800 K. The second crystallization starts above 1000 K; the nanocrystalline phase dissolves and together with the remaining amorphous matrix form rough grains of α-Fe and dispersed Fe 23 Zr 6 phases. From Moessbauer spectroscopy it seems that there exist two neighbourhoods of Fe atoms in the amorphous structure. One of them is characterized by low Zr content and is responsible for the high-field component of the hyperfine field distribution p(H). The second one is rich in Zr and B and is responsible for the low-field component of p(H). This is in accord with the observation of two crystallization steps separated by a large interval of temperatures due to the existence of two chemically different regions or clusters. (orig.)
Glass-forming ability and stability of ternary Ni-early transition metal (Ti/Zr/Hf) alloys
Energy Technology Data Exchange (ETDEWEB)
Basu, Joysurya [Department of Metallurgy, Indian Institute of Science, Bangalore 560 012 (India); Ranganathan, S. [Department of Metallurgy, Indian Institute of Science, Bangalore 560 012 (India)]. E-mail: rangu@met.iisc.ernet.in
2006-08-15
Four Ni-bearing Ti, Zr and Hf ternary alloys of nominal composition Zr{sub 41.5}Ti{sub 41.5}Ni{sub 17}, Zr{sub 25}Ti{sub 25}Ni{sub 50}, Zr{sub 41.5}Hf{sub 41.5}Ni{sub 17} and Ti{sub 41.5}Hf{sub 41.5}Ni{sub 17} were rapidly solidified in order to produce ribbons. The Zr-Ti-Ni and Ti-Hf-Ni alloys become amorphous, whereas the Zr-Hf-Ni alloy shows precipitation of a cubic phase. The devitrification of all three alloys was followed and the relative tendency to form nanoquasicrystals and cF96 phases analysed. The relative glass-forming ability of the alloys can be explained by taking into account their atomic size difference. Addition of Ni often leads to quasicrystallisation or quasicrystal-related phases. This can be explained by the atomic radius and heat of mixing of the constituent elements. The phases precipitated at the initial stages of crystallisation indicate the possible presence of Frank-Kasper polyhedral structure in the amorphous alloys. Structural analysis reveals that the Laves and the anti-Laves phases have the same polyhedral structural unit, which is similar to the structural characteristics of glass.
Interdiffusion between U(Mo,Pt) or U(Mo,Zr) and Al or Al A356 alloy
International Nuclear Information System (INIS)
Komar Varela, C.; Mirandou, M.; Arico, S.; Balart, S.; Gribaudo, L.
2009-01-01
Solid state reactions in chemical diffusion couples U-7 wt.%Mo-0.9 wt.%Pt/Al at 580 deg. C and U-7 wt.%Mo-0.9 wt.%Pt/Al A356 alloy, U-7 wt.%Mo-1 wt.%Zr/Al and U-7 wt.%Mo-1 wt.%Zr/Al A356 alloy at 550 deg. C were characterized. Results were obtained from optical and scanning electron microscopy, electron probe microanalysis and X-ray diffraction. The UAl 3, UAl 4 and Al 20 Mo 2 U phases were identified in the interaction layers of γU(Mo,Pt)/Al and γU(Mo,Zr)/Al diffusion couples. Al 43 Mo 4 U 6 ternary compound was also identified in γU(Mo,Zr)/Al due to the decomposition of γU(Mo,Zr) phase. The U(Al,Si) 3 and U 3 Si 5 phases were identified in the interaction layers of γU(Mo,Pt)/Al A356 and γU(Mo,Zr)/Al A356 diffusion couples. These phases are formed due to the migration of Si to the interaction layer. In the diffusion couple U(Mo,Zr)/Al A356, Zr 5 Al 3 phase was also identified in the interaction layer. The use of synchrotron radiation at Brazilian Synchrotron Light Laboratory (LNLS, CNPq, Campinas, Brazil) was necessary to achieve a complete crystallographic characterization.
Formation of ω-phase in Zr-4 at.% Cr alloy
International Nuclear Information System (INIS)
Dobromyslov, A.V.; Kazantseva, N.V.
1996-01-01
The ω-phase has been discovered in zirconium-base alloys with the transition metals of Period 4 of the Periodic Table only in Zr-V, Zr-Cr, and Zr-Cu alloys. The first mention about the ω-phase formation in Zr-Cr alloys was given for Zr-4.5 at.%. However, there were no experimental data that confirmed this fact. W.M. Rumball and F.G. Elder presented the X-ray results on the ω-phase formation in Zr-3.9 at.%Cr, but at the present time there are no electron microscope studies of the structure of the ω-phase in this system. Investigations of the features of the ω-phase formation, morphology of the ω-phase and the mechanism of its formation in the different zirconium-base alloys are necessary to establish the common features of the formation of structures with the metastable phases. The task of the present work is to study the conditions and features of the ω-phase formation in the Zr-Cr alloys and the effect of the eutectoid decomposition on the formation of ω-phase. This article is part of the detailed investigations of the feature and condition of the ω-phase formation in zirconium-base alloys with the transition metals of the groups I and V to VIII of the Periodic Table
International Nuclear Information System (INIS)
Hernandez-Sandoval, J.; Garza-Elizondo, G.H.; Samuel, A.M.; Valtiierra, S.; Samuel, F.H.
2014-01-01
Highlights: • Characterization on the precipitation of Ni- and Zr-based intermetallics. • High temperature tensile properties of 354 alloy containing Zr and Ni below 0.5%. • Quality index charts as a function of heat treatment. • Yield strength and ductility color contours as a function of aging temperature and aging time. - Abstract: The principal aim of the present work was to investigate the effects of minor additions of nickel and zirconium on the strength of cast aluminum alloy 354 at ambient and high temperatures. Tensile properties of the as-cast and heat-treated alloys were determined at room temperature and at high temperatures (190 °C, 250 °C, 350 °C). The results show that Zr reacts only with Ti, Si and Al. From the quality index charts constructed for these alloys, the quality index attains minimum and maximum values of 259 MPa and 459 MPa, in the as-cast and solution-treated conditions; also, maximum and minimum values of yield strength are observed at 345 MPa and 80 MPa, respectively, within the series of aging treatments applied. A decrease in tensile properties of ∼10% with the addition of 0.4 wt.% nickel is attributed to a nickel–copper reaction. The reduction in mechanical properties due to addition of different elements is attributed principally to the increase in the percentage of intermetallic phase particles formed during solidification; such particles act as stress concentrators, decreasing the alloy ductility. Tensile test results at ambient temperatures show a slight increase (∼10%) in alloys with Zr and Zr/Ni additions, particularly at aging temperatures above 240 °C. Additions of Zr and Zr + Ni increase the high temperature tensile properties, in particular for the alloy containing 0.2 wt.% Zr + 0.2 wt.% Ni, which exhibits an increase of more than 30% in the tensile properties at 300 °C compared with the base 354 alloy
The Structure–Function Relationships of Classical Cannabinoids: CB1/CB2 Modulation
Bow, Eric W.; Rimoldi, John M.
2016-01-01
The cannabinoids are members of a deceptively simple class of terpenophenolic secondary metabolites isolated from Cannabis sativa highlighted by (−)-Δ9-tetrahydrocannabinol (THC), eliciting distinct pharmacological effects mediated largely by cannabinoid receptor (CB1 or CB2) signaling. Since the initial discovery of THC and related cannabinoids, synthetic and semisynthetic classical cannabinoid analogs have been evaluated to help define receptor binding modes and structure–CB1/CB2 functional activity relationships. This perspective will examine the classical cannabinoids, with particular emphasis on the structure–activity relationship of five regions: C3 side chain, phenolic hydroxyl, aromatic A-ring, pyran B-ring, and cyclohexenyl C-ring. Cumulative structure–activity relationship studies to date have helped define the critical structural elements required for potency and selectivity toward CB1 and CB2 and, more importantly, ushered the discovery and development of contemporary nonclassical cannabinoid modulators with enhanced physicochemical and pharmacological profiles. PMID:27398024
Extraordinary high strength Ti-Zr-Ta alloys through nanoscaled, dual-cubic spinodal reinforcement.
Biesiekierski, Arne; Ping, Dehai; Li, Yuncang; Lin, Jixing; Munir, Khurram S; Yamabe-Mitarai, Yoko; Wen, Cuie
2017-04-15
While titanium alloys represent the current state-of-the-art for orthopedic biomaterials, concerns still remain over their modulus. Circumventing this via increased porosity requires high elastic admissible strains, yet also limits traditional thermomechanical strengthening techniques. To this end, a novel β-type Ti-Zr-Ta alloy system, comprised of Ti-45Zr-10Ta, Ti-40Zr-14Ta, Ti-35Zr-18Ta and Ti-30Zr-22Ta, was designed and characterized mechanically and microstructurally. As-cast, this system displayed extremely high yield strengths and elastic admissible strains, up to 1.4GPa and potentially 1.48%, respectively. This strength was attributed to a nanoscaled, cuboidal structure of semi-coherent, dual body-centered cubic (BCC) phases, arising from the thermodynamics of interaction between Ta and Zr; this morphology occurring with dual BCC-phases is heretofore unreported in Ti-based alloys. Further, cell proliferation investigated by MTS assay suggests this was achieved without sacrificing biocompatibility, with no significant difference to either empty-well or commercially-pure Ti controls noted. The current research details microstructural, mechanical, and biological investigations into four novel biomedical alloys in a hitherto uninvestigated region of the Ti-Zr-Ta alloy system; Ti-45Zr-10Ta, Ti-40Zr-14Ta, Ti-35Zr-18Ta and Ti-30Zr-22Ta. We find that the investigated alloys display 0.2% yield strengths of up to 1.40GPa and elastic admissible strains of up to 1.48%, along with biological properties comparable to that seen in the conventional metallic biomaterial ASTM Grade-2 CP-Ti, achieved in the complete absence of traditional thermomechanical processing techniques. This is attributed to the presence of a dual-BCC cuboidal nanostructure, achieved via spinodal decomposition; while similar structures have been reported in e.g. Ni-based superalloys, we believe this is the first such structure investigated in a Ti-based material. As such, this work is felt to be of
An XRD technique for quantitative phase analysis of Al-U-Zr alloy
International Nuclear Information System (INIS)
Khan, K.B.; Kulkarni, N.K.; Jain, G.C.
2003-01-01
In several nuclear research reactors all over the world, Al-U alloy is used as fuel. To stabilise less brittle phase UAl 3 in Al-U alloy, a small amount of Zr (1 to 3 wt% ) is added. A rapid, non destructive and simple x-ray diffraction technique has been developed for quantitative phase analysis Al-U-Zr alloy system containing UAl 4 , UAl 3 and Al. (author)
Chayeuski, V.; Zhylinski, V.; Cernashejus, O.; Visniakov, N.; Mikalauskas, G.
2018-04-01
In this work, combined gradient ZrC/Ni-nanodiamond ultradispersed diamonds (UDD) coatings were synthesized on the surface of knife blades made of hard alloy WC-2 wt.% Co by electroplating and cathode arc evaporation PVD techniques to increase the durability period of a wood-cutting milling tool. The microstructure, phase and elemental composition, microhardness, and adhesion strength of the coatings were investigated. Ni-UDD layer is not mixed with the ZrC coating and hard alloy substrate. Cobalt is present in Ni-UDD layer after deposition of ZrC. The ZrC/Ni-nanodiamond coating consists of separate phases of zirconium carbide (ZrC), α-Ni, and Ni-UDD. The maximum value of microhardness of the Ni-nanodiamond coating is 5.9 GPa. The microhardness value of the ZrC/Ni-nanodiamond coatings is 25 ± 6 GPa, which corresponds to the microhardness of the hard alloy substrate and ZrC coating. The obtained high values of the critical loads on the scratch track of the ZrC/Ni-nanodiamond coating in 24 N prove a sufficiently high value of the adhesion strength of the bottom Ni-UDD layer with WC-Co substrate. Pilot testing of ZrC/Ni-nanodiamond-coated cutting tools proved their increasing durability period to be 1.5-1.6 times higher than that of bare tools, when milling laminated chipboard.
Effect of V or Zr addition on the mechanical properties of the mechanically alloyed Al-8wt%Ti alloys
International Nuclear Information System (INIS)
Moon, I.H.; Lee, J.H.; Lee, K.M.; Kim, Y.D.
1995-01-01
Mechanical alloying (MA) of Al-Ti alloy, being a solid state process, offers the unique advantage of producing homogeneous and fine dispersions of thermally stable Al 3 Ti phase, where the formation of the fine Al 3 Ti phase by the other method is restricted from the thermodynamic viewpoint. The MA Al-Ti alloys show substantially higher strength than the conventional Al alloys at the elevated temperature due to the presence of Al 3 Ti as well as Al 4 C 3 and Al 2 O 3 , of which the last two phases were introduced during MA process. The addition of V or Zr to Al-Ti alloy was known to decrease the lattice mismatch between the intermetallic compound and the aluminum matrix, and such decrease in lattice mismatching can influence positively the high temperature mechanical strength of the MA Al-Ti by increasing the resistance to dispersoid coarsening at the elevated temperature. In the present study, therefore, the mechanical behavior of the MA Al-Ti-V and Al-Ti-Zr alloys were investigated in order to evaluate the effect of V or Zr addition on the mechanical properties of the MA Al-8Ti alloy at high temperature
Crystallization behavior and the thermal properties of Zr63Al7.5Cu17.5Ni10B2 bulk amorphous alloy
International Nuclear Information System (INIS)
Jang, J.S.C.; Chang, L.J.; Jiang, Y.T.; Wong, P.W.
2003-01-01
The ribbons of amorphous Zr 63 Al 7.5 Cu 17.5 Ni 10 B 2 alloys with 0.1 mm thickness were prepared by melt spinning method. The thermal properties and micro structural development during the annealing of amorphous alloy have been investigated by a combination of differential thermal analysis, differential scanning calorimetry, high-temperature optical microscope, X-ray diffractometry and TEM. The glass transition temperature for the Zr 63 Al 7.5 Cu 17.5 Ni 10 B 2 alloys are measured about 645 K (372 C). This alloy also obtains a large temperature interval ΔT x about 63 K. Meanwhile, the calculated T rg for Zr 63 Al 7.5 Cu 17.5 Ni 10 B 2 alloy presents the value of 0.57. The activation energy of crystallization for the alloy Zr 63 Al 7.5 Cu 17.5 Ni 10 B 2 was about 370± 10 kJ/mole as determined by the Kissinger and Avrami plot, respectively. These values are about 20% higher than the activation energy of crystallization for the Zr 65 Al 7.5 Cu 17.5 Ni 10 alloy (314 kJ/mol.). This implies that the boron additions exhibit the effect of improving the thermal stability for the Zr-based alloy. The average value of the Avrami exponent n were calculated to be 1.75±0.15 for Zr 63 Al 7.5 Cu 17.5 Ni 10 B 2 alloy. This indicates that this alloy presents a crystallization process with decreasing nucleation rate. (orig.)
Corrosion and deuterium uptake of Zr-based alloys in supercritical water
International Nuclear Information System (INIS)
Khatamian, D.
2010-01-01
To increase the thermodynamic efficiency above 40% in nuclear power plants, the use of supercritical water as the heat transport fluid has been suggested. Zircaloy-2, -4, Zr-Cr-Fe, Zr-1Nb and Zr-2.5Nb were tested as prospective fuel cladding materials in 30 MPa D 2 O at 500 o C. Zircaloy-2 showed the highest rates of corrosion and hydriding. Although Zr-Cr-Fe initially showed a very low corrosion rate, it displayed breakaway corrosion kinetics after 50 h exposure. The best-behaved material both from a corrosion and hydrogen uptake point of view was Zr-2.5Nb. However, the Zr-2.5Nb oxide growth rate was still excessive and beyond the current CANDU design allowance. Similar coupons, coated with Cr, were also tested. The coated layer effectively prevented oxidation of the coupons except on the edges, where the coating was thinner and had some flaws. In addition, the Cr-coated Zr-2.5Nb coupons had the lowest deuterium pickup of all the alloys tested and showed no signs of accelerated or nonuniform corrosion. (author)
Internal friction and mechanical properties of Zr - 2.5% Nb alloy after programme loading
International Nuclear Information System (INIS)
Gindin, I.A.; Chirkina, L.A.; Okovit, V.S.; Netesov, V.M.
1984-01-01
Temperature dependence of internal friction in the range 20-600 deg C of the alloy Zr-2.5% Nb in the initial state after programmed loading up to 0.1% of residual elongation and static deformation to the same deformation degree has been studied. It is shown, that the programmed loading promotes the decrease in relaxation rate at 20 and 200 deg C and the increase of strength characteristics of the alloy without the decrease in plasticity margin to fracture in the range 20-400 deg C
Structural investigation of Fe(Cu)ZrB amorphous alloy
Energy Technology Data Exchange (ETDEWEB)
Duhaj, P. [Slovenska Akademia Vied, Bratislava (Slovakia). Fyzikalny Ustav; Matko, I. [Slovenska Akademia Vied, Bratislava (Slovakia). Fyzikalny Ustav; Svec, P. [Slovenska Akademia Vied, Bratislava (Slovakia). Fyzikalny Ustav; Sitek, J. [Department of Nuclear Physics and Technology, Slovak Technical University, 81219 Bratislava (Slovakia); Janickovic, D. [Slovenska Akademia Vied, Bratislava (Slovakia). Fyzikalny Ustav
1996-07-01
The crystallization process in Fe{sub 86}(Cu{sub 1})Zr{sub 7}B{sub 6} and Fe{sub 87}Zr{sub 7}B{sub 6} is investigated using the methods of transmission electron microscopy, electron and X-ray diffraction and resistometry. Two crystallization reactions take place during thermal annealing of amorphous Fe{sub 86}(Cu{sub 1})Zr{sub 7}B{sub 6} and Fe{sub 87}Zr{sub 7}B{sub 6} alloys. In both alloys the first crystallization begins with the formation of nanocrystalline {alpha}-Fe at temperature to approximately 800 K. The second crystallization starts above 1000 K; the nanocrystalline phase dissolves and together with the remaining amorphous matrix form rough grains of {alpha}-Fe and dispersed Fe{sub 23}Zr{sub 6} phases. From Moessbauer spectroscopy it seems that there exist two neighbourhoods of Fe atoms in the amorphous structure. One of them is characterized by low Zr content and is responsible for the high-field component of the hyperfine field distribution p(H). The second one is rich in Zr and B and is responsible for the low-field component of p(H). This is in accord with the observation of two crystallization steps separated by a large interval of temperatures due to the existence of two chemically different regions or clusters. (orig.)
Brazing characteristics of a Zr-Ti-Cu-Fe eutectic alloy filler metal for Zircaloy-4
Lee, Jung G.; Lim, C. H.; Kim, K. H.; Park, S. S.; Lee, M. K.; Rhee, C. K.
2013-10-01
A Zr-Ti-Cu-Fe quaternary eutectic alloy was employed as a new Be-free brazing filler metal for Zircaloy-4 to supersede physically vapor-deposited Be coatings used conventionally with several disadvantages. The quaternary eutectic composition of Zr58Ti16Cu10Fe16 (at.%) showing a low melting temperature range from 832 °C to 853 °C was designed by a partial substitution of Zr with Ti based on a Zr-Cu-Fe ternary eutectic system. By applying an alloy ribbon with the determined composition, a highly reliable joint was obtained with a homogeneous formation of predominantly grown α-Zr phases owing to a complete isothermal solidification, exhibiting strength higher than that of Zircaloy-4. The homogenization of the joint was rate-controlled by the diffusion of the filler elements (Ti, Cu, and Fe) into the Zircaloy-4 base metal, and the detrimental segregation of the Zr2Fe phase in the central zone was completely eliminated by an isothermal holding at a brazing temperature of 920 °C for 10 min.
Stability study of the γ phase in U-Nb-Zr alloys
International Nuclear Information System (INIS)
Arico, S.F; Hermida, J.D; Gribaudo, L.M
2006-01-01
The development of new low enrichment nuclear fuels for research and radioisotope production reactors imposes the knowledge of properties and behaviors about a series of alloys which the reducing of U 235 (fissionable) concentration is compensated with a greater density of this element inside the fuel. One of these series is composed by U alloys with different contents of alloying, that allow to retain the body centered cubic structure solid solution recognized as phase α in metastable condition at low temperatures. For the present work 10 U based alloys were manufactured with different concentrations containing up to 43,7 % zirconium weight and up to 7,3 % niobium weight. An arch oven was utilized with argon atmosphere. The identification of the present phases in massive samples from the melting was carried out through X-rays diffraction analysis. The results obtained in this work are compared with others results published since the year 1957. In the samples melted the intermetallic UZr 2 diminishes in quantity with the reduction of the composition of Zr in the alloys. In all of them were identified, besides, Zr 6 Fe 3 O, ZrO 0,35 , α and U 3 O 8 present in quantities reduced. The quantity of the two last phases diminishes at the same time with the content in Zr. The parameter of network of the cubic phase γU in these alloys can be represented for the equation: α=(3,5796 -0,1616.x Nb +0,1155.x Zr )/(1.0306+0,003.x Nb -0,0068.x Zr . The parameter of network of the γ phase was measured. Comparing it measured with the value calculated, for eight alloys, the proposed equation showed a very good adjustment (HC)
The Importance of Rare-Earth Additions in Zr-Based AB2 Metal Hydride Alloys
Directory of Open Access Journals (Sweden)
Kwo-Hsiung Young
2016-07-01
Full Text Available Effects of substitutions of rare earth (RE elements (Y, La, Ce, and Nd to the Zr-based AB2 multi-phase metal hydride (MH alloys on the structure, gaseous phase hydrogen storage (H-storage, and electrochemical properties were studied and compared. Solubilities of the RE atoms in the main Laves phases (C14 and C15 are very low, and therefore the main contributions of the RE additives are through the formation of the RENi phase and change in TiNi phase abundance. Both the RENi and TiNi phases are found to facilitate the bulk diffusion of hydrogen but impede the surface reaction. The former is very effective in improving the activation behaviors. −40 °C performances of the Ce-doped alloys are slightly better than the Nd-doped alloys but not as good as those of the La-doped alloys, which gained the improvement through a different mechanism. While the improvement in ultra-low-temperature performance of the Ce-containing alloys can be associated with a larger amount of metallic Ni-clusters embedded in the surface oxide, the improvement in the La-containing alloys originates from the clean alloy/oxide interface as shown in an earlier transmission electron microscopy study. Overall, the substitution of 1 at% Ce to partially replace Zr gives the best electrochemical performances (capacity, rate, and activation and is recommended for all the AB2 MH alloys for electrochemical applications.
Energy Technology Data Exchange (ETDEWEB)
Sickafus, Kurt E. [Univ. of Tennessee, Knoxville, TN (United States); Wirth, Brian [Univ. of Tennessee, Knoxville, TN (United States); Miller, Larry [Univ. of Tennessee, Knoxville, TN (United States); Weber, Bill [Univ. of Tennessee, Knoxville, TN (United States); Zhang, Yanwen [Univ. of Tennessee, Knoxville, TN (United States); Patel, Maulik [Univ. of Tennessee, Knoxville, TN (United States); Motta, Arthur [Pennsylvania State Univ., University Park, PA (United States); Wolfe, Doug [Pennsylvania State Univ., University Park, PA (United States); Fratoni, Max [Univ. of California, Berkeley, CA (United States); Raj, Rishi [Univ. of Colorado, Boulder, CO (United States); Plunkett, Kenneth [Univ. of Colorado, Boulder, CO (United States); Was, Gary [Univ. of Michigan, Ann Arbor, MI (United States); Hollis, Kendall [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Nelson, Andy [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Stanek, Chris [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Comstock, Robert [Westinghouse Electric Corporation, Pittsburgh, PA (United States); Partezana, Jonna [Westinghouse Electric Corporation, Pittsburgh, PA (United States); Whittle, Karl [Univ. of Sheffield (United Kingdom); Preuss, Michael [Univ. of Manchester (United Kingdom); Withers, Philip [Univ. of Manchester (United Kingdom); Wilkinson, Angus [Univ. of Oxford (United Kingdom); Donnelly, Stephen [Univ. of Huddersfield (United Kingdom); Riley, Daniel [Australian Nuclear Science and Technology Organisation, Syndney (Australia)
2017-02-14
The goal of this NEUP-IRP project is to develop a fuel concept based on an advanced ceramic coating for Zr-alloy cladding. The coated cladding must exhibit demonstrably improved performance compared to conventional Zr-alloy clad in the following respects: During normal service, the ceramic coating should decrease cladding oxidation and hydrogen pickup (the latter leads to hydriding and embrittlement). During a reactor transient (e.g., a loss of coolant accident), the ceramic coating must minimize or at least significantly delay oxidation of the Zr-alloy cladding, thus reducing the amount of hydrogen generated and the oxygen ingress into the cladding. The specific objectives of this project are as follows: To produce durable ceramic coatings on Zr-alloy clad using two possible routes: (i) MAX phase ceramic coatings or similar nitride or carbide coatings; and (ii) graded interface architecture (multilayer) ceramic coatings, using, for instance, an oxide such as yttria-stabilized zirconia (YSZ) as the outer protective layer. To characterize the structural and physical properties of the coated clad samples produced in 1. above, especially the corrosion properties under simulated normal and transient reactor operating conditions. To perform computational analyses to assess the effects of such coatings on fuel performance and reactor neutronics, and to perform fuel cycle analyses to assess the economic viability of modifying conventional Zr-alloy cladding with ceramic coatings. This project meets a number of the goals outlined in the NEUP-IRP call for proposals, including: Improve the fuel/cladding system through innovative designs (e.g. coatings/liners for zirconium-based cladding) Reduce or eliminate hydrogen generation Increase resistance to bulk steam oxidation Achievement of our goals and objectives, as defined above, will lead to safer light-water reactor (LWR) nuclear fuel assemblies, due to improved cladding properties and built-in accident resistance, as well as
Low in reactor creep Zr-base alloy tubes
International Nuclear Information System (INIS)
Cheadle, B.A.; Holt, R.A.
1984-01-01
This invention relates to zirconium alloy tubes especially for use in nuclear power reactors. More particularly it relates to quaternary 3.5 percent Sn, 1 percent Mo, 1 percent Nb, balance Zr alloy tubes which have been extruded, cold worked and heat treated to lower their dislocation density. In one embodiment the alloys are cold worked less than 5 percent and stress relieved to produce a low dislocation density and in another embodiment the alloys are cold worked up to about 50 percent and annealed to produce a very low dislocation density and also small equiaxed β grains
International Nuclear Information System (INIS)
Peng, Yongyi; Li, Shu; Deng, Ying; Zhou, Hua; Xu, Guofu; Yin, Zhimin
2016-01-01
Mechanical properties, exfoliation corrosion behavior and microstructure of Al-5.98Mg-0.47Mn and Al-6.01Mg-0.45Mn-0.25Sc-0.10Zr (wt%) alloy sheets under various homogenizing and annealing processes were investigated comparatively by tensile tests, electrochemical measurements, X-ray diffraction technique and microscopy methods. The as-cast alloys mainly consist of Fe and Mn enriched impurity phases, Mg and Mn enriched non-equilibrium aluminides and Mg 3 Al 2 phases. During homogenization treatment, solvable intermetallics firstly precipitate and then dissolve into matrix. The optimized homogenization processes for removing micro-segregation and obtaining maximum precipitation strengthening of secondary Al 3 (Sc, Zr) particles are 440 °C×8 h and 300 °C×8 h, respectively. Sc and Zr additions can make the yield strength of Al-Mg-Mn alloy increase by 21 MPa (6.9%), 120 MPa (61.2%) and 127 MPa (68.3%), when annealed at 270 °C, 300 °C and 330 °C, respectively, indicating that Orowan precipitation strengthening caused by secondary Al 3 (Sc, Zr) nano-particles is much greater than grain boundary strengthening from primary Al 3 (Sc, Zr) micro-particles. Increasing homogenization and annealing degrees and adding Sc and Zr all can decrease corrosion current density and improve exfoliation corrosion resistance. The exfoliation corrosion behavior is dominant by anodic dissolution occurring at the interface between intermetallics and α(Al) matrix. After homogenizing at 440 °C for 8 h and annealing at 300 °C for 1 h, yield strength, ultimate strength, elongation to failure and exfoliation corrosion rank are 196 MPa, 360 MPa, 20.2% and PA (slight pitting corrosion) in Al-Mg-Mn alloy, and reach to 316 MPa, 440 MPa, 17.0% and PA in Al-Mg-Mn-Sc-Zr alloy, respectively, revealing that high strength, high ductility and admirable corrosion resistance of Al-Mg-Mn alloys can be achieved by the synergetic effects of Sc and Zr microalloying and heat treatment.
Tao Li; Yong He; Hailong Zhang; Xitao Wang
2014-01-01
The microstructure, mechanical property, and in vitro biocorrosion behavior of as-cast single-phase biodegradable Mg–1.5Zn–0.6Zr alloy were investigated and compared with a commercial as-cast AZ91D alloy. The results show that the Mg–1.5Zn–0.6Zr alloy had a single-phase solid solution structure, with an average grain size of 34.7 ± 13.1 μm. The alloy exhibited ultimate tensile strength of 168 ± 2.0 MPa, yield strength of 83 ± 0.6 MPa, and elongation of 9.1 ± 0.6%. Immersion tests and electroc...
International Nuclear Information System (INIS)
Masrukan; Tri Yulianto; Anwar Muchsin
2011-01-01
U-Zr-Nb alloy chemical composition analysis using X Ray Fluorescence (XRF) and Atomic Absorption Spectroscopy (AAS) techniques have been conducted, where U-Zr- Nb alloy was chosen as candidates for new high-density fuel for future research reactors . Composition analysis is necessary because the composition of elements in the fuel will determine the characteristics of fuel during the fabrication process and in the reactor. The use of two kinds of analysis techniques were designed to obtain accurate analysis results. The experiment was conducted to determine the major element composition and impurities in the alloy U-Zr-Nb. First U-Zr-Nb varying alloy composition Nb were respectively 1%, 4%, 7% (U10% Zr1% Nb, U10% Zr4% Nb and U10% 7% Nb) as results of the melting process of measuring the diameter of 120 mm crushed on the surface bottom. Once on the bottom surface is smooth, then analyzed using XRF techniques. To analyze the elements using AAS techniques, alloy U-Zr-Nb cut into 10 mm x 5 mm then dissolved using HF and nitric acid. Solution that occurred were analyzed using AAS technique. From the analysis using the XRF technique is obtained the alloy U-10% Zr-1% Nb, U-10% Zr-4% Nb and Zr-10% U-7% Nb) had a content of each element as follows: U (87.8858%), Zr (2.6097%) and Nb (0.2206%), U (87.8556%), Zr (2.6302%), and Nb (0.6573%); U (84.6334%), Zr (2.5773%), and Nb (1.0940) weight. Results of analysis using AAS techniques on samples obtained third consecutive Zr content of 9.25%, 8.90% and 9.80% while the content of Nb was not detected. Meanwhile, the results of elemental analysis of impurities in all three samples showed that almost all the elements are still qualify as fuel except Zn element. Element Zn at the three samples of each alloys U-10% Zr-1% Nb, U-10% Zr-4% Nb and U-10% Zr-7%Nb is 1.3266%, 3.2756% and 1.0927% weight. It could be concluded that the results of analysis of elemental content and impurities in the alloy U-Nb-Zr using both XRF and AAS visible
Microstructures and phase transformations of Ti-30Zr-xNb (x = 5, 7, 9, 13 at.%) shape memory alloys
Energy Technology Data Exchange (ETDEWEB)
Qu, Wentao; Sun, Xuguang; Yuan, Bifei [School of Mechanical Engineering, Xi' an Shiyou University, Xi' an 710065 (China); Xiong, Chengyang; Zhang, Fei [School of Materials Science and Engineering, Beihang University, Beijing 100191 (China); Li, Yan, E-mail: liyan@buaa.edu.cn [School of Materials Science and Engineering, Beihang University, Beijing 100191 (China); Sun, Baohui [Lanzhou Seemine SMA Co. Ltd., Lanzhou 730010 (China)
2016-12-15
The microstructures, phase transformations and shape memory properties of Ti-30Zr-xNb (x = 5, 7, 9, 13 at.%) alloys were investigated. The X-ray diffraction and transmission electron microscopy observations showed that the Ti-30Zr-5Nb, Ti-30Zr-7/9Nb and Ti-30Zr-13Nb alloys were composed of the hcp α′-martensite, orthorhombic α″-martensite and β phases, respectively. The results indicated the enhanced β-stabilizing effect of Nb in Ti-30Zr-xNb alloys than that in Ti-Nb alloys due to the high content of Zr. The differential scanning calorimetry test indicated that the Ti-30Zr-5Nb alloy displayed a reversible transformation with a high martensitic transformation start temperature of 776 K and a reverse martensitic transformation start temperature (A{sub s}) of 790 K. For the Ti-30Zr-7Nb and Ti-30Zr-9Nb alloys, the martensitic transformation temperatures decreased with the increasing Nb content. Moreover, an ω phase transformation occurred in the both alloys upon heating at a temperature lower than the corresponding A{sub s}, which is prompted by more addition of Nb. Although the critical stress in tension of the three martensitic alloys decreased with increasing Nb content, the Ti-30Zr-9Nb alloy showed a critical stress of as high as 300 MPa. Among all the alloys, the Ti-30Zr-9Nb alloy exhibited the maximum shape memory effect of 1.61%, due to the lowest critical stress for the martensite reorientation. - Highlights: •Ti-30Zr-5Nb alloy is composed of hcp α′-martensite with the M{sub s} of 776 K. •Ti-30Zr-7Nb and Ti-30Zr-9Nb alloys are predominated by orthorhombic α″-martensite. •Ti-30Zr-13Nb alloy consists of a single β phase due to the β-stabilizing effect of Nb. •The martensitic transformation temperatures decrease with increasing Nb content. •Ti-30Zr-9Nb alloy shows the maximum shape memory effect of 1.61%.
Encapsulation of Mg-Zr alloy in metakaolin-based geo-polymer
International Nuclear Information System (INIS)
Rooses, Adrien; Steins, Prune; Dannoux-Papin, Adeline; Lambertin, David; Poulesquen, Arnaud; Frizon, Fabien
2013-01-01
Investigations were carried out to propose a suitable material for the encapsulation of Mg-Zr alloy wastes issued from fuel cladding of the first generation nuclear reactors. Stability over time, good mechanical properties and low gas production are the main requirements that embedding matrices must comply with in order to be suitable for long run storage. One of the main issues encapsulating Mg-Zr alloy in mineral binder is the hydrogen production related to Mg-Zr alloys corrosion and water radiolysis process. In this context, metakaolin geo-polymers offer an interesting outlook: corrosion densities of Mg-Zr alloys are significantly lower than in Portland cement. This work firstly presents the hydrogen production of Mg-Zr alloy embedded in geo-polymers prepared from different the activation solution (NaOH or KOH). The effect of addition of fluorine on the magnesium corrosion in geo-polymer has been investigated too. The results point out that sodium geo-polymer is a suitable binder for Mg-Zr alloy encapsulation with respect to magnesium corrosion resistance. Furthermore the presence of fluorine reduces significantly the hydrogen release. Then, the impact of fluorine on the geo-polymer network formation was studied by rheological, calorimetric and 19 F NMR measurements. No direct effect resulting from the addition of fluorine has been shown on the geo-polymer binder. Secondly, the formulation of the encapsulation matrix has been adjusted to fulfil the expected physical and mechanical properties. Observations, dimensional evolutions and compressive strengths demonstrated that addition of sand to the geo-polymer binder is efficient to meet the storage criteria. Consequently, a matrix formulation compatible with Mg-Zr alloy encapsulation has been proposed. Finally, irradiation tests have been carried out to assess the hydrogen radiolytic yield of the matrix under exposure to γ radiation. (authors)
Change of Composition in Metallic Fuel Slug of U-Zr Alloy from High-Temperature Annealing
Energy Technology Data Exchange (ETDEWEB)
Youn, Young Sang; Lee, Jeong Mook; Kim, Jong Yun; Kim, Jong Hwan; Song, Hoon [KAERI, Daejeon (Korea, Republic of)
2016-09-15
The U–Zr alloy is a candidate for fuel to be used as metallic fuel in sodium-cooled fast reactors (SFRs). Its chemical composition before and after annealing at the operational temperature of SFRs (610 .deg. C) was investigated using X-ray photoelectron spectroscopy, Raman spectroscopy, and X-ray diffraction. The original alloy surface contained uranium oxides with the U(IV) and U(VI) oxidation states, Zr{sub 2}O{sub 3}, and a low amount of uranium metal. After annealing at 610 .deg. C, the alloy was composed of uranium metal, uranium carbide, uranium oxide with the U(V) valence state, zirconium metal, and amorphous carbon. Meanwhile, X-ray diffraction data indicate that the bulk composition of the alloy remained unchanged.
Change of Composition in Metallic Fuel Slug of U-Zr Alloy from High-Temperature Annealing
International Nuclear Information System (INIS)
Youn, Young Sang; Lee, Jeong Mook; Kim, Jong Yun; Kim, Jong Hwan; Song, Hoon
2016-01-01
The U–Zr alloy is a candidate for fuel to be used as metallic fuel in sodium-cooled fast reactors (SFRs). Its chemical composition before and after annealing at the operational temperature of SFRs (610 .deg. C) was investigated using X-ray photoelectron spectroscopy, Raman spectroscopy, and X-ray diffraction. The original alloy surface contained uranium oxides with the U(IV) and U(VI) oxidation states, Zr 2 O 3 , and a low amount of uranium metal. After annealing at 610 .deg. C, the alloy was composed of uranium metal, uranium carbide, uranium oxide with the U(V) valence state, zirconium metal, and amorphous carbon. Meanwhile, X-ray diffraction data indicate that the bulk composition of the alloy remained unchanged
Zhang, Junyi; Kang, Zhixin; Wang, Fen
2016-11-01
A Mg-Gd-Nd-Zn-Zr alloy was processed by equal channel angular pressing (ECAP) at 375°C. The grain size of Mg-Gd-Nd-Zn-Zr alloy was refined to ~2.5μm with the spherical precipitates (β1 phase) distributing in the matrix. The mechanical properties of ECAPed alloy were significantly improved as a result of the grain refinement and precipitation strengthening. The corrosion rate of the ECAPed magnesium alloy in simulated body fluid dramatically decreased from 0.236mm/a to 0.126mm/a due to the strong basal texture and refined microstructure. This wrought magnesium alloy shows potentials in biomedical application. Copyright © 2016 Elsevier B.V. All rights reserved.
Crystallization-induced plasticity of Cu-Zr containing bulk amorphous alloys
International Nuclear Information System (INIS)
Lee, Seok-Woo; Huh, Moo-Young; Fleury, Eric; Lee, Jae-Chul
2006-01-01
This study examined the parameter governing the plasticity observed in various Cu-Zr containing monolithic amorphous alloys. All the alloys were fully amorphous in their as-cast condition but exhibited different plastic strains. Microscopic observations of the quasi-statically compressed alloys showed abundant nanocrystallites in the amorphous matrices in the alloys that exhibited pronounced plasticity. On the other hand, insignificant changes in the microstructure were observed in the alloy that did not show plasticity. The mechanism for the formation of these deformation-induced nanocrystallites was examined from the viewpoints of thermodynamics and kinetics. The role of the deformation-induced nanocrystallites on the plasticity of the amorphous alloy was examined using high-resolution transmission electron microscopy. The results demonstrate that compressive loading facilitates nanocrystallization in monolithic Cu-Zr containing amorphous alloys, resulting in plasticity. The parameter governing the plasticity in these monolithic Cu-Zr containing amorphous alloys lies in the activation energy for the overall crystallization process
International Nuclear Information System (INIS)
Cantagalli, Natalia Mattar; Pais, Rafael Witter Dias; Braga, Daniel Martins; Santos, Ana Maria Matildes dos; Ferraz, Wilmar Barbosa
2011-01-01
Powders of the U-Zr-Nb alloys are raw materials for obtaining plate-type dispersion fuel of high density and medium enrichment for research and test reactors as well as small power reactors. U-2.5Zr-7.5Nb and U-3Zr-9Nb (wt%) alloys, initially homogenized at high temperatures, were transformed at different phases by means aging heat treatments, and then comminuted by hydriding-dehydriding process to powder production. The phases transformations were obtained by the homogenization of the U-2.5Zr-7.5Nb and U-3Zr-9Nb alloys at high temperatures (1000 deg C for 1 and 16 h), followed by aging heat treatment at 600 deg C, in times of 0.5 h, 3.0 h and 24h, and subsequently quenched in water to stabilize the desired phase. The comminution process was performed at 200 deg C for different times ranging from 20 minutes to 4 hours. The powders were then characterized by scanning electron microscopy, X-ray diffraction and determination of particle size distribution by means of laser equipment CILAS. One of the main objectives of this study was to verify the influence of the different phases in the characteristics of the obtained powders. It was found that alloys stabilized in gamma phase produced powders with smaller particles sizes than those with cellular structure of the α and γ phases. Regardless of retained phases, the produced powders consist of agglomerates with irregular morphology. (author)
Energy Technology Data Exchange (ETDEWEB)
Cantagalli, Natalia Mattar; Pais, Rafael Witter Dias; Braga, Daniel Martins; Santos, Ana Maria Matildes dos; Ferraz, Wilmar Barbosa, E-mail: ferrazw@cdtn.b [Centro de Desenvolvimento da Tecnologia Nuclear (CDTN/CNEN-MG) Belo Horizonte, MG (Brazil)
2011-07-01
Powders of the U-Zr-Nb alloys are raw materials for obtaining plate-type dispersion fuel of high density and medium enrichment for research and test reactors as well as small power reactors. U-2.5Zr-7.5Nb and U-3Zr-9Nb (wt%) alloys, initially homogenized at high temperatures, were transformed at different phases by means aging heat treatments, and then comminuted by hydriding-dehydriding process to powder production. The phases transformations were obtained by the homogenization of the U-2.5Zr-7.5Nb and U-3Zr-9Nb alloys at high temperatures (1000 deg C for 1 and 16 h), followed by aging heat treatment at 600 deg C, in times of 0.5 h, 3.0 h and 24h, and subsequently quenched in water to stabilize the desired phase. The comminution process was performed at 200 deg C for different times ranging from 20 minutes to 4 hours. The powders were then characterized by scanning electron microscopy, X-ray diffraction and determination of particle size distribution by means of laser equipment CILAS. One of the main objectives of this study was to verify the influence of the different phases in the characteristics of the obtained powders. It was found that alloys stabilized in gamma phase produced powders with smaller particles sizes than those with cellular structure of the {alpha} and {gamma} phases. Regardless of retained phases, the produced powders consist of agglomerates with irregular morphology. (author)
Energy Technology Data Exchange (ETDEWEB)
Yang, S.J.; Hu, L.; Wang, L.; Wei, B. [Northwestern Polytechnical University, Department of Applied Physics, Xi' an (China)
2017-05-15
The dendritic growth and thermal expansion of isomorphous refractory Nb-5%Zr, Nb-10%Zr, and Nb-15%Zr alloys were studied by electrostatic levitation technique. The obtained maximum undercoolings for the three alloys were 534 (0.2T{sub L}), 498 (0.19T{sub L}), and 483 K (0.18T{sub L}), respectively. Within these undercooling ranges, the dendritic growth velocities of the three alloys all exhibited power laws, and achieved 38.5, 34.0, and 27.1 m s{sup -1} at each maximum undercooling. The microstructures were characterized by coarse dendrites at small undercooling, while they transformed into refined dendrites under large undercooling condition. In addition, the measured thermal expansion coefficients of solid Nb-Zr alloys increased linearly with temperature. The values at liquid state were more than double of those at solid state, which also displayed linear dependence on temperature. (orig.)
International Nuclear Information System (INIS)
Sharma, Poonam; Dhawan, Anil; Jayraj, J.; Kamachi Mudali, U.
2013-01-01
The potentiodynamic polarization studies were carried out on Zr based bulk amorphous alloy Zr 57 Cu 15.4 Ni 12.6 Al 10 Nb 5 and Zr 59 Cu 20 Ni 8 Al 10 Ti 3 in solutions of 1 M, 6 M and 11.5 M HNO 3 aqueous media at room temperature. As received specimens of Zr 57 Cu 15.4 Ni 12.6 Al 10 Nb 5 (5 mm diameter rod) and Zr 59 Cu 20 Ni 8 Al 10 Ti 3 (3 mm diameter rod) were polished with SiC paper before testing them for potentiodynamic polarization studies. The amorphous nature of the specimens was checked by X-ray diffraction. The bulk amorphous alloy Zr 59 Cu 20 Ni 8 Al 10 Ti 3 shows the better corrosion resistance than Zr 57 Cu 15.4 Ni 12.6 Al 10 Nb 5 alloy in the aqueous HNO 3 media as the value of the corrosion current density (I corr ) for Zr 57 Cu 15.4 Ni 12.6 Al 10 Nb 5 alloy were found to be more than Zr 59 Cu 20 Ni 8 Al 10 Ti 3 alloy in aqueous HNO 3 media. The improved corrosion resistance of Zr 59 Cu 20 Ni 8 Al 10 Ti 3 alloy is possibly due to the presence of Ti and formation of TiO 2 during anodic oxidation. Both Zr based bulk amorphous alloys shows wider passive range at lower concentration of nitric acid and the passive region gets narrowed down with the increase in concentration. A comparison of data obtained from both the Zr-based bulk amorphous alloys is made and results are discussed in the paper. (author)
Obtaining of U-2.5Zr7.5Nb and U-3Zr-9Nb alloys by sintering process
International Nuclear Information System (INIS)
Mazzeu, Thiago de Oliveira; Paula, Joao Bosco de; Ferraz, Wilmar Barbosa; Santos, Ana Maria Matildes dos; Brina, Jose Giovanni Mascarenhas
2011-01-01
The development of metallic fuels with low enrichment to be used in research and test reactors, as well in the future pressurized water reactors, focuses on the search for uranium alloys of high density. Alloying elements such as Zr, Nb and Mo are added to uranium to improve fuel performance in reactors. In this context, the Centro de Desenvolvimento da Tecnologia Nuclear (CDTN) in Belo Horizonte is developing the U-2.5Zr-7.5Nb and U- 3Zr-9Nb (weight %) alloys by the innovative process of sintering that utilizes raw materials in the form of powders. The powders were pressed at 400MPa and then sintered under a vacuum of about 5 x 10-6 Torr at temperatures ranging from 1050 deg to 1300 deg C. The densities of the alloys were measured geometrically and by hydrostatic method using water. The microstructures of the pellets were observed by scanning electron microscopy (SEM) and the elements of alloying were identified by energy dispersive X-ray spectroscopy (SEM/EDS) analysis. The obtained results showed a small increasing density with rising sintering temperature. The highest density achieved was approximately 80% of theoretical density. It was also qualitatively observed that the superficial oxidation of the pellets increased with increasing sintering temperature thus avoiding the fusion of the alloys at higher temperatures. (author)
Biological Properties of Ti-Nb-Zr-O Nanostructures Grown on Ti35Nb5Zr Alloy
Directory of Open Access Journals (Sweden)
Zhaohui Li
2012-01-01
Full Text Available Surface modification of low modulus implant alloys with oxide nanostructures is one of the important ways to achieve favorable biological behaviors. In the present work, amorphous Ti-Nb-Zr-O nanostructures were grown on a peak-aged Ti35Nb5Zr alloy through anodization. Biological properties of the Ti-Nb-Zr-O nanostructures were investigated through in vitro bioactivity testings, stem cell interactions, and drug release experiments. The Ti-Nb-Zr-O nanostructures demonstrated a good capability of inducing apatite formation after immersion in simulated body fluids (SBFs. Drug delivery experiment based on gentamicin and the Ti-Nb-Zr-O nanostructures indicated that a high drug loading content could result in a prolonged release process and a higher quantity of drug residues in the oxide nanostructures after drug release. Quick stem cell adhesion and spreading, as well as fast formation of extracellular matrix materials on the surfaces of the Ti-Nb-Zr-O nanostructures, were found. These findings make it possible to further explore the biomedical applications of the Ti-Nb-Zr-O nanostructure modified alloys especially clinical operation of orthopaedics by utilizing the nanostructures-based drug-release system.
Zirconium hydrides and Fe redistribution in Zr-2.5%Nb alloy under ion irradiation
Energy Technology Data Exchange (ETDEWEB)
Idrees, Y.; Yao, Z. [Department of Mechanical and Materials Engineering, Queen' s University, Kingston, ON, Canada, K7L 3N6 (Canada); Cui, J.; Shek, G.K. [Kinetrics, Mississauga, ON (Canada); Daymond, M.R., E-mail: daymond@queensu.ca [Department of Mechanical and Materials Engineering, Queen' s University, Kingston, ON, Canada, K7L 3N6 (Canada)
2016-11-15
Zr-2.5%Nb alloy is used to fabricate the pressure tubes of the CANDU reactor. The pressure tube is the primary pressure boundary for coolant in the CANDU design and is susceptible to delayed hydride cracking, reduction in fracture toughness upon hydride precipitation and potentially hydride blister formation. The morphology and nature of hydrides in Zr-2.5%Nb with 100 wppm hydrogen has been investigated using transmission electron microscopy. The effect of hydrides on heavy ion irradiation induced decomposition of the β phase has been reported. STEM-EDX mapping was employed to investigate the distribution of alloying elements. The results show that hydrides are present in the form of stacks of different sizes, with length scales from nano- to micro-meters. Heavy ion irradiation experiments at 250 °C on as-received and hydrided Zr-2.5%Nb alloy, show interesting effects of hydrogen on the irradiation induced redistribution of Fe. It was found that Fe is widely redistributed from the β phase into the α phase in the as-received material, however, the loss of Fe from the β phase and subsequent precipitation is retarded in the hydrided material. This preliminary work will further the current understanding of microstructural evolution of Zr based alloys in the presence of hydrogen. - Graphical abstract: STEM HAADF micrographs at low magnification showing the hydride structure in Zr-2.5Nb alloy.
Effect of alloying on elastic properties of ZrN based transition metal nitride alloys
Kanoun, Mohammed; Goumri-Said, Souraya
2014-01-01
We report the effect of composition and metal sublattice substitutional element on the structural, elastic and electronic properties of ternary transition metal nitrides Zr1-xMxN with M=Al, Ti, Hf, V, Nb, W and Mo. The analysis of the elastic constants, bulk modulus, shear modulus, Young's modulus, and Poisson's ratio provides insights regarding the mechanical behavior of Zr1-xMxN. We predict that ternary alloys are more ductile compared to their parent binary compounds. The revealed trend in the mechanical behavior might help for experimentalists on the ability of tuning the mechanical properties during the alloying process by varying the concentration of the transition metal. © 2014 Elsevier B.V.
Effect of alloying on elastic properties of ZrN based transition metal nitride alloys
Kanoun, Mohammed
2014-09-01
We report the effect of composition and metal sublattice substitutional element on the structural, elastic and electronic properties of ternary transition metal nitrides Zr1-xMxN with M=Al, Ti, Hf, V, Nb, W and Mo. The analysis of the elastic constants, bulk modulus, shear modulus, Young\\'s modulus, and Poisson\\'s ratio provides insights regarding the mechanical behavior of Zr1-xMxN. We predict that ternary alloys are more ductile compared to their parent binary compounds. The revealed trend in the mechanical behavior might help for experimentalists on the ability of tuning the mechanical properties during the alloying process by varying the concentration of the transition metal. © 2014 Elsevier B.V.
Energy Technology Data Exchange (ETDEWEB)
Qian, D.Y.; Hussain, M.; Zheng, Z.G.; Zhong, X.C. [School of Materials Science and Engineering, South China University of Technology, Guangzhou 510640 (China); Gao, X.X. [State Key Laboratory for Advanced Metals and Materials, University of Science and Technology Beijing, Beijing 100083 (China); Liu, Z.W., E-mail: zwliu@scut.edu.cn [School of Materials Science and Engineering, South China University of Technology, Guangzhou 510640 (China); State Key Laboratory for Advanced Metals and Materials, University of Science and Technology Beijing, Beijing 100083 (China)
2015-06-15
To reduce the rare earth content and maintain good magnetic properties for NdFeB based alloys, the effects of RE and B contents on the micro-structure and magnetic properties of nanocrystalline MRE{sub 11−y}Fe{sub 79.5}B{sub 8+y}Zr{sub 1.5} (MRE=Nd{sub 0.8}(Dy{sub 0.5}Y{sub 0.5}){sub 0.2}, y=0–3) alloys have been investigated. Increasing B concentration leads to the appearance and increase of soft magnetic Fe{sub 3}B phase and reduced grain size. With decreasing MRE and increasing B concentrations, the coercivity decreased from 1159.8 kA/m for y=0 to 619.0 kA/m for y=3. The saturation magnetization and remanence increased with B content until y=2 then decreases. The B content also has effects on the exchange coupling, microstructure and thermal stability. While comparing MRE{sub 10}Fe{sub 82.5}B{sub 6}Zr{sub 1.5} alloy with MRE{sub 11−y}Fe{sub 79.5}B{sub 8+y}Zr{sub 1.5} (y=1 and 2) alloys, the alloy with 9 at% MRE can achieve similar magnetic properties as that with 10 at% MRE. The magnetic properties with coercivity of 792.2 kA/m, (BH){sub max} of 128 kJ/m{sup 3} and good thermal stability have been obtained for MRE{sub 9}Fe{sub 79.5}B{sub 10}Zr{sub 1.5} alloy. - Highlights: • Nanocomposite NdFeB composition is optimized to reduce RE from 10 to 9 at.%. • Increasing B content benefits microstructure, exchange coupling, thermal stability. • Alloy with 9% RE has H{sub c}=792kA/m, (BH){sub max}=128kJ/m{sup 3} and low temperature coefficients.
Institute of Scientific and Technical Information of China (English)
耿浩然; 王艳; 王英姿; 夏琳燕
2012-01-01
We used Zr66.7 Ni33.3 binary alloys as base alloys and selected the intermetallic compound TiC as additional particles. The influence of TiC addition on the microstructural evolution induced by mechanical alloying has been investigated using X-ray diffraction (XRD), scanning electron microscopy (SEM), transmission electron microscopy (TEM), and differential scanning calorimetry (DSC). The experimental results show that the proper addition of TiC (5wt%) not only shortens the starting time of the amarphization reaction, but also improves the glass forming ability (GFA) of Zr-Ni alloy powders and greatly enhances the mechanical stability of the amorphous composites. Based upon the EDX analysis, we have found that the diffusion of TiC among the atoms of Zr and Ni is inhomogeneous, leading to the increase of the disorder degree of atoms in local regions. Therefore, the TiC addition improves the GFA and stability of the Zr-Ni alloys. The DSC results demonstrate that the effect of the addition of 3 wt% TiC is better than that of the addition of 5 wt% TiC on the improvement of thermal stability of the amorphous phase, suggesting that there is no correlation between thermal stability and mechanical stability of MA induced Zr-Ni-based amorphous alloys.%利用机械合金化法,以Zr66.7Ni33.3合金粉末作为基体,选择TiC作为掺杂物,研究其对机械合金化诱导合金粉末显微结构演化行为的影响.研究发现,掺杂适量的TiC粉末可使Ti和C原子在Zr-Ni间发生不均匀扩散,导致局域范围内原子排列的无序度增大,从而提高非晶形成能力和机械稳定性,其中5wt% TiC的掺杂效果最佳.此外,3wt%TiC掺杂导致非晶相的热稳定性优于5wt%TiC的掺杂效果,说明机械合金化合成Zr-Ni基非晶合金粉末的机械稳定性和其热稳定性之间无相关性.
Corrosion of clean Mg-Zr alloys in various basic media for waste encapsulation
International Nuclear Information System (INIS)
Lambertin, D.; Frizon, F.; Blachere, A.; Bart, F.
2012-01-01
The dismantling of UNGG nuclear reactor generates a large volume of fuel decladding. These materials are based on Mg-Zr alloy. The strategy could be to encapsulate these wastes into an ordinary Portland cement (OPC) or geo-polymer (aluminosilicate material) in a form suitable for storage. Studies have been performed on Mg or Mg-Al alloy in basic media but no data are available on Mg-Zr behaviour. The influence of representative pore solution of OPC and geo-polymer with Mg-Zr alloy has been studied on corrosion behaviour. Electrochemical methods have been used to determine the corrosion densities at room temperature. Results show that the corrosion densities of Mg-Zr alloy in OPC solution is one order of magnitude more important than in geo-polymer solution environment and effect of inhibiting agent has been undertaken with Mg-Zr alloy. The evaluation of encapsulation of Mg-Zr alloy in OPC and geo-polymer has been done in term of corrosion hydrogen production. (authors)
Desorption dynamics of deuterium in CuCrZr alloy
Thi Nguyen, Lan Anh; Lee, Sanghwa; Noh, S. J.; Lee, S. K.; Park, M. C.; Shu, Wataru; Pitcher, Spencer; Torcy, David; Guillermain, David; Kim, Jaeyong
2017-12-01
Desorption behavior of deuterium (D2) in CuCrZr alloy was investigated considering sample thickness, loading and baking temperature of deuterium followed by the ITER scopes. Cylindrical specimens of 1, 3, 5 mm thick with 4 mm diameter were exposed to deuterium at a pressure of 25 bar at 120, 240 and 350 °C for 24 h, then baked at 800 °C in a vacuum chamber maintained at a pressure lower than 10-7 Torr. Deuterium desorption characteristics such as desorption rate and amount of deuterium in the sample were estimated by analyzing the desorption peaks monitored with a residual gas analyzer (RGA), and the trapping energy of deuterium was calculated using thermal desorption spectroscopy (TDS). Secondary ion mass spectroscopy (SIMS) results showed that deuterium atoms embedded in the sample at a depth of less than 15 μm and desorbed as low as 400 °C. All absorbed deuterium atoms in the specimen were completely retrieved by dynamic pumping at 800 °C in 15 min. The desorption rate of deuterium per unit area was inversely proportional to the increment of the thickness of the sample, and was proportional to the loading temperature. Based on the assumption that a uniform distribution of interstitial sites for deuterium follows the Femi-Dirac statistics, the result of TDS demonstrated that the CuCrZr alloy has two types of trapping energies, which were estimated to be 62 and 79 kJ/mol.
FRACTIONAL RECRYSTALLIZATION KINETICS IN DIRECTLY COLD ROLLED Al-Mg, Al-Mg-Sc AND Al-Mg-Sc-Zr ALLOY
Directory of Open Access Journals (Sweden)
M. S. Kaiser
2014-12-01
Full Text Available The evaluation of texture as a function of recrystallization has been characterized for directly cold rolled Al-6Mg, Al-6Mg-0.4Sc and Al-6Mg-0.4Sc-0.2Zr alloys. Samples were annealed isothermally at 400 °C for 1 to 240 minutes to allow recrystallization. Recrystallization kinetics of the alloys is analyzed from the micro-hardness variation. Isothermally annealed samples of aluminum alloys were also studied using JMAK type analysis to see if there exists any correlation between the methods. Recrystallization fraction behavior between two methods the scandium added alloys show the higher variation due to precipitation hardening and higher recrystallization behavior. The scandium and zirconium as a combined shows the more variation due to formation of Al3(Sc, Zr precipitate. From the microstructure it is also observed that the base Al-Mg alloy attained almost fully re-crystallized state after annealing at 400 °C for 60 minutes
Energy Technology Data Exchange (ETDEWEB)
Flanagan, Ted B., E-mail: ted.flanagan@uvm.edu; Noh, Hak; Luo, Suifang
2016-08-25
ZrCo and HfCo intermetallic compounds have the same cubic (CsCl-type) structure and their ternary (Zr{sub 1−x}Hf{sub x})Co alloys are also cubic. ZrNi and HfNi intermetallic compounds have the orthorhombic structure (CrB-type) and the ternary (Zr{sub 1−x}Hf{sub x})Ni alloys also have this structure. Thermodynamic data for hydride formation and decomposition in ZrCo, HfCo and HfNi intermetallic compounds have been determined from reaction calorimetry and from pressure-composition isotherms. Thermodynamic data have been determined for the three ternary alloys: (Zr{sub 0.75}Hf{sub 0.25})Co, (Zr{sub 0.50}Hf{sub 0.50})Co, and (Zr{sub 0.25}Hf{sub 0.75})Co and the four ternary alloys: (Zr{sub 0.875}Hf{sub 0.125})Ni, (Zr{sub 0.75}Hf{sub 0.25})Ni, (Zr{sub 0.50}Hf{sub 0.50})Ni, and (Zr{sub 0.25}Hf{sub 0.75})Ni. This offers the opportunity to learn how the thermodynamic properties of the ternary alloy-H systems change with the stoichiometry of alloys with the same structure. - Highlights: • Calorimetric enthalpies determined for H absorption by ZrCo, HfCo, HfNi are determined. • Ternary alloys, e.g., Zr{sub 1−x}Hf{sub x}Ni, prepared and characterized by x-ray diffraction. • Isotherms for the ternary alloys give thermodynamic parameters for H solution.
Correlation between zirconium oxide impedance and corrosion behavior of Zr-Nb-Sn-Fe-Cu alloys
International Nuclear Information System (INIS)
Park, Sang Yoon; Lee, Myung Ho; Choi, Byoung Kwon; Jeong, Yong Hwan; Jung, Youn Ho
2001-01-01
To evaluate the correlation of Zr oxide impedance and corrosion behavior of Zr-Nb-Sn-Fe-Cu alloys, the corrosion behavior of the alloys was tested in the autoclave containing 70 ppm LiOH solution at 360 .deg. C. The characteristics of the oxide on the alloys were investigated by using the electrochemical impedance spectrosocpy (EIS) method. The corrosion resistance of the alloys was evaluated from the corrosion rate determined as a function of the concentration of Nb. The equivalent circuit of the oxide was composed on the base of the spectrum from EIS measurements on the oxide layers that had formed at pre-and post-transition regions on the curve of corrosion rate. By using the capacitance characteristics of the equivalent circuit, the thickness of impervious layer, it's electrical resistance and characteristics of space charge layer were evaluated. The corrosion characteristics of the Zr-Nb-Sn-Fe-Cu alloys were successfully explained by applying the EIS test results
Energy Technology Data Exchange (ETDEWEB)
Das, N., E-mail: nirupamd@barc.gov.in; Sengupta, P.; Abraham, G.; Arya, A.; Kain, V.; Dey, G.K.
2016-08-15
Highlights: • Grain refinement was made in Zr–16 wt.% SS alloy while prepared by suction casting process. • Distribution of Laves phase, e.g., Zr{sub 2}(Fe, Cr) was raised in suction cast (SC) Zr–16 wt.% SS. • Corrosion resistance was improved in SC alloy compared to that of arc-melt-cast alloy. • Grain refinement in SC alloy assisted for an increase in its corrosion resistance. - Abstract: Zirconium (Zr)-stainless steel (SS) hybrid alloys are being considered as baseline alloys for developing metallic-waste-form (MWF) with the motivation of disposing of Zr and SS base nuclear metallic wastes. Zr–16 wt.% SS, a MWF alloy optimized from previous studies, exhibit significant grain refinement and changes in phase assemblages (soft phase: Zr{sub 2}(Fe, Cr)/α-Zr vs. hard phase: Zr{sub 3}(Fe, Ni)) when prepared by suction casting (SC) technique in comparison to arc-cast-melt (AMC) route. Variation in Cr-distribution among different phases are found to be low in suction cast alloy, which along with grain refinement restricted Cr-depletion at the Zr{sub 2}(Fe, Cr)/Zr interfaces, prone to localized attack. Hence, SC alloy, compared to AMC alloy, showed lower current density, higher potential at the breakdown of passivity and higher corrosion potential during polarization experiments (carried out under possible geological repository environments, viz., pH 8, 5 and 1) indicating its superior corrosion resistance.
Effects of phase constitution of Zr-Nb alloys on their magnetic susceptibilities
International Nuclear Information System (INIS)
Nomura, Naoyuki; Tanaka, Yuko; Suyalatu; Kondo, Ryota; Doi, Hisashi; Tsutsumi, Yusuke; Hanawa, Takao
2009-01-01
The magnetic susceptibilities and microstructures of Zr-Nb binary alloys were investigated to develop a new metallic biomaterial with a low magnetic susceptibility for magnetic resonance imaging (MRI). The magnetic susceptibility was measured with a magnetic susceptibility balance, and the microstructure was evaluated with an X-ray diffractometer (XRD), an optical microscope (OM), and a transmission electron microscope (TEM). Zr-Nb alloys as-cast showed a minimum value of magnetic susceptibility between 3 and 9 mass% Nb, and the value abruptly increased up to 20 mass% Nb, followed by a gradual increase with the increase of the Nb content. XRD, OM, and TEM revealed that the minimum value of the susceptibility was closely related to the appearance of the athermal ω phase in the β phase. Since the magnetic susceptibility of Zr-3Nb alloy consisting of an α' phase was as low as that of Zr-9Nb alloy consisting of the β and ω phases, that of the ω phase was lower than that of the α' and β phases. When Zr-16Nb alloy was heat-treated, the isothermal ω phase appeared, and, simultaneously, the magnetic susceptibility decreased. Therefore, the ω phase contributes to the decrease of the magnetic susceptibility, independently of the formation process of the ω phase. The magnetic susceptibility of the Zr-3Nb alloy as-cast was almost one-third that of Ti-6Al-4V alloy, which is commonly used for medical implant devices. Zr-Nb alloys are useful for medical devices used under MRI. (author)
A superplastic Al-Li-Cu-Mg-Zr powder alloy with high hardness and modulus
International Nuclear Information System (INIS)
Phillips, V.A.
1986-01-01
Structure/property studies were made on an experimental Al-3.18% Li-4.29% Cu-1.17% Mg-0.18% Zr powder alloy, which is of the low density/high modulus type. Alloy powder was made by the P and W/GPD rapid solidification rate (RSR) process, canned, and extruded to bar. The density was 2.458 x 10/sup 6/ g/m/sup 3/. The material was solution-treated, and aged at 149 0 C(300 0 F), 171 0 C(340 0 F), and 193 0 C(380 0 F), using hardness tests to determine the aging curves. Testpieces solution-treated at 516 0 C(961 0 F) showed an average yield strength (0.2% offset) of 43.3 ksi (299 MPa) and ultimate tensile strength of 50.0 ksi (345 MPa), with 1% elongation, which increased to 73.0 ksi (503 MPa) and 73.1 ksi (504 MPa), respectively, with only 0.2% elongation, on peak aging at 193 0 C(380 0 F), with a modulus of elasticity of 11.4 x 10/sup 6/ psi (78.3 GPa). Hardness values reached 90-92 R/sub B/ on aging at 149-193 0 C(300-380 0 F). The as-extruded alloy showed superplastic behavior at 400-500 0 C(752-932 0 F) with elongations of 80-185% on 25.6 mm, peaking at 450 0 C(842 0 F). An RSR Al-2.53% Li-2.82% Mn-0.02% Zr extruded allow showed only 18-23% elongation at 400-500 0 C(752-932 0 F)
Energy Technology Data Exchange (ETDEWEB)
Huang, Xing [School of Materials Science and Engineering, Central South University, Changsha 410083 (China); Pan, Qinglin, E-mail: pql1964@126.com [School of Materials Science and Engineering, Central South University, Changsha 410083 (China); Li, Bo [School of Materials Science and Engineering, Central South University, Changsha 410083 (China); Liu, Zhiming; Huang, Zhiqi [Guangdong Fenglu Aluminum Co., Ltd, Foshan 528133 (China); Yin, Zhimin [School of Materials Science and Engineering, Central South University, Changsha 410083 (China)
2015-11-25
Microstructural and property evolution of the Al–Zn–Mg–0.10%Sc–0.10%Zr alloy sheet during its preparation were investigated in detail by means of optical microscopy (OM), scanning electron microscope (SEM), energy dispersive X-ray (EDX), transmission electron microscopy (TEM), Vickers micro-hardness test and room temperature tensile test. Stress corrosion cracking (SCC) behavior of the Al–Zn–Mg–0.10%Sc–0.10%Zr alloy under different heat treatments was studied using slow strain rate test. The results showed that serious dendritic segregation existed in as-cast condition. The suitable homogenization treatment for Al–Zn–Mg–0.10%Sc–0.10%Zr alloy was 470 °C/24 h. After homogenization treatment, dissoluble Zn and Mg enriched non-equilibrium phases dissolved into α-Al matrix completely. The suitable solid solution-aging treatment for Al–Zn–Mg–0.10%Sc–0.10%Zr alloy was solution treated at 470 °C for 60 min, followed by water quenching and then aged at 120 °C for 24 h. Under this aging temper, the grain structures were composed of sub-grains, η′ phases and nanometer-sized, spherical Al{sub 3}(Sc, Zr) particles. Grain boundary precipitates (GBPs) area fraction was found to be an important parameter to evaluate the SCC susceptibility. The improved corrosion resistance from increasing aging temperature or prolonging aging time was due to the discontinuous η precipitates along the grain boundary and the high area fraction of GBPs. The main strengthening mechanisms of Al–Zn–Mg–0.10%Sc–0.10%Zr alloy are precipitation strengthening derived from η′ precipitates, dispersion strengthening, sub-grain strengthening and grain refinement caused by coherent Al{sub 3}(Sc, Zr) particles. - Highlights: • The suitable homogenization treatment of the alloy has been identified. • Evolution of microstructure and mechanical properties is investigated. • Strengthening mechanisms of the alloy has been established. • The basic mechanism has
Structure and mechanical properties of TiZr binary alloy after Al addition
International Nuclear Information System (INIS)
Jiang, X.J.; Jing, R.; Liu, C.Y.; Ma, M.Z.; Liu, R.P.
2013-01-01
Microstructure and mechanical properties of hot-rolled TiZrAl alloys were studied. The results showed that the microstructure of all alloys mainly consisted of lamellar α phase. The thickness of the lamellar α phase gradually increased with increasing aluminum content. Moreover, large numbers of stacking faults was observed in Ti–25Zr–15Al (at%) alloy. The aluminum addition strongly affected the mechanical properties of the TiZrAl alloys. With increased aluminum contents, the strength increased evidently, whereas, the elongation decreased. Ti–25Zr–15Al (at%) with the highest aluminum contents in all alloys, possessed the highest tensile strength (σ b =1319 MPa), i.e. strengthened by 41% compared with Ti–25Zr (at%) alloy, and still retained the elongation of 5.5%. According to the classical size and/or modulus misfits model, the effect of aluminum addition was significant in TiZr alloys because of the considerable misfits between aluminum and zirconium
Carbides precipitated from the melt in a Zr-2.5 Nb alloy
International Nuclear Information System (INIS)
Piotrkowski, R.; Garcia, E.A.; Vigna, G.L.; Bermudez, S.E.
1993-01-01
An experimental method is presented which leads to the formation of carbides similar in size (3 to 8 microns) and composition to those observed in some pressure tubes of CANDU type reactors. The method is based on melting the Zr-2.5 Nb alloy in a graphite crucible, where isothermal C diffusion in the Zr-Nb melt took place. It can be inferred that the carbides observed in pressure tubes could be originated in high temperature stages of the manufacture process. Otherwise, they could have been incorporated in the Zr sponge. As a result of the diffusion couple Liquid Zr-2.5 Nb/Solid Graphite, a carbide layer, up to 100μm thick, grew attached to the crucible wall, together with carbide particles whose size was in the some microns range. The smallest particles were arranged in rows determined by the prior β phase grains. The main carbide phase detected was the cubic MC 1-x ; the hexagonal M 2 C was also detected; M for metal. (Author)
International Nuclear Information System (INIS)
Peruzzi Bardella, A.; Bolcich, J.C.
1990-01-01
Zr alloys with 2.5 to 8.0 at%Nb and 0 to 6.7 at%Al, were subjected to dynamic and static treatments between 730-900 deg C and studied by qualitative and quantitative optical metallography, electrical resistance, X-ray diffractometry and electron microanalysis. The experimental data were analyzed by taking into account the effects of oxygen and nitrogen impurities. The main results for Zr-Nb-Al alloys with 750 at.ppm0 and 250 at.ppmN are the following: a) Equilibrium relationships are established between α (hcp), β (bcc) and Zr 3 Al (Cu 3 Au) phases along isothermal sections at 730, 771 and 800 deg C. b) β/α+β boundaries are determined along iso-aluminium vertical sections at 6.7, 3.3 and 0 at%Al. As for the first two iso-aluminium sections, the β/α+β equilibrium boundary corresponding to the binary Zr-Nb system is found to have a positive curvature, which is contrary to what has been reported in the literature. The increase in the Al content shifts the T β/α+β at a rate of 5.1 to 8.5 deg C/at.%Al, depending on Nb content. c) The addition of Al to Zr-Nb alloys increases the partial solubility of Nb in the α phase, its maximum value at 730 deg C being about 0.7-0.8 at% for 4 at%Al. d) Solubility values for Al in α-phase of Zr-Al were estimated by extrapolation from ternary alloys. These estimates help to solve an existing discrepancy on the Zr-Al system. (Author)
The role of Zr and Nb in oxidation/sulfidation behavior of Fe-Cr-Ni alloys
Energy Technology Data Exchange (ETDEWEB)
Natesan, K. (Argonne National Lab., IL (USA)); Baxter, D.J. (Argonne National Lab., IL (USA) INCO Alloy Ltd., Hereford, England (UK))
1990-11-01
05Structural Fe-Cr-Ni alloys may undergo rapid degradation at elevated temperatures unless protective surface oxide scales are formed and maintained. The ability of alloys to resist rapid degradation strongly depends on their Cr content and the chemistry of the exposure environment. Normally, 20 wt % Cr is required for service at temperatures up to 1000{degree}C; the presence of sulfur, however, inhibits formation of a protective surface oxide scale. The oxidation and sulfidation behavior of Fe-Cr-Ni alloys is examined over a wide temperature range (650 to 1000{degree}C), with particular emphasis on the effects of alloy Cr content and the radiation of reactive elements such as Nb and Zr. Both Nb and Zr are shown to promote protective oxidation behavior on the 12 wt % Cr alloy in oxidizing environments and to suppress sulfidation in mixed oxygen/sulfur environments. Additions of Nb and Zr at 3 wt % level resulted in stabilization of Cr{sub 2}O{sub 3} scale and led to a barrier layer of Nb- or Zr-rich oxide at the scale/metal interface, which acted to minimize the transport of base metal cations across the scale. Oxide scales were preformed in sulfur-free environments and subsequently exposed to oxygen/sulfur mixed-gas atmospheres. Preformed scales were found to delay the onset of breakaway corrosion. Corrosions test results obtained under isothermal and thermal cycling conditions are presented. 58 refs., 55 figs., 8 tabs.
A new Ti-Zr-Hf-Cu-Ni-Si-Sn bulk amorphous alloy with high glass-forming ability
International Nuclear Information System (INIS)
Huang, Y.J.; Shen, J.; Sun, J.F.; Yu, X.B.
2007-01-01
The effect of Sn substitution for Cu on the glass-forming ability was investigated in Ti 41.5 Zr 2.5 Hf 5 Cu 42.5-x Ni 7.5 Si 1 Sn x (x = 0, 1, 3, 5, 7) alloys by using differential scanning calorimetry (DSC) and X-ray diffractometry. The alloy containing 5% Sn shows the highest glass-forming ability (GFA) among the Ti-Zr-Hf-Cu-Ni-Si-Sn system. Fully amorphous rod sample with diameters up to 6 mm could be successfully fabricated by the copper mold casting Ti 41.5 Zr 2.5 Hf 5 Cu 37.5 Ni 7.5 Si 1 Sn 5 alloy. The activation energies for glass transition and crystallization for Ti 41.5 Zr 2.5 Hf 5 Cu 37.5 Ni 7.5 Si 1 Sn 5 amorphous alloy are both larger than those values for the Sn-free alloy. The enhancement in GFA and thermal stability after the partial replacement of Cu by Sn may be contributed to the strong atomic bonding nature between Ti and Sn and the increasing of atomic packing density. The amorphous Ti 41.5 Zr 2.5 Hf 5 Cu 37.5 Ni 7.5 Si 1 Sn 5 alloy also possesses superior mechanical properties
Shim, Joong-Youn; Ahn, Kwang H; Kendall, Debra A
2013-11-08
The cannabinoid (CB1) receptor is a member of the rhodopsin-like G protein-coupled receptor superfamily. The human CB1 receptor, which is among the most expressed receptors in the brain, has been implicated in several disease states, including drug addiction, anxiety, depression, obesity, and chronic pain. Different classes of CB1 agonists evoke signaling pathways through the activation of specific subtypes of G proteins. The molecular basis of CB1 receptor coupling to its cognate G protein is unknown. As a first step toward understanding CB1 receptor-mediated G protein signaling, we have constructed a ternary complex structural model of the CB1 receptor and Gi heterotrimer (CB1-Gi), guided by the x-ray structure of β2-adrenergic receptor (β2AR) in complex with Gs (β2AR-Gs), through 824-ns duration molecular dynamics simulations in a fully hydrated 1-palmitoyl-2-oleoyl-sn-glycero-3-phosphocholine bilayer environment. We identified a group of residues at the juxtamembrane regions of the intracellular loops 2 and 3 (IC2 and IC3) of the CB1 receptor, including Ile-218(3.54), Tyr-224(IC2), Asp-338(6.30), Arg-340(6.32), Leu-341(6.33), and Thr-344(6.36), as potential key contacts with the extreme C-terminal helix α5 of Gαi. Ala mutations of these residues at the receptor-Gi interface resulted in little G protein coupling activity, consistent with the present model of the CB1-Gi complex, which suggests tight interactions between CB1 and the extreme C-terminal helix α5 of Gαi. The model also suggests that unique conformational changes in the extreme C-terminal helix α5 of Gα play a crucial role in the receptor-mediated G protein activation.
Effect of processing variables on microstructure and properties of two Al-Li-Cu-Mg-Zr alloys
International Nuclear Information System (INIS)
Palmer, I.G.; Lewis, R.E.; Crooks, D.D.
1984-01-01
Two Al-Li-Cu-Mg-Zr alloys have been prepared in the form of both powder metallurgy (PM) and ingot metallurgy (IM) alloys. The compositions were selected to meet certain program goals based on the results of an alloy development phase, the details of which have been previously published. The target compositions were Al-3Li-1.5Cu-1Mg-0.2Zr and Al-3Cu-2Li-1Mg-0.2Zr. The PM alloys were prepared from chill cast remelt stock by centrifugal atomization in helium, followed by screening, degassing, and extrusion. The IM alloys were prepared by direct chill (DC) casting, homogenization and extrusion. Full details of the production of the alloys are given. The effects of various processing conditions on microstructure and properties were evaluated, including different heat treatments and stretching conditions. These effects are described in detail with particular emphasis on a comparison of the PM and IM alloys. 10 references
Diffusion and chemical activity of Zr-Sn and Zr-Ti systems
International Nuclear Information System (INIS)
Zee, R.H.; Watters, J.F.; Davidson, R.D.
1986-01-01
A modified evaporation method was used to determine the diffusion coefficients and the emission rates of Sn and Ti in Zr-Sn and Zr-Ti, respectively, at temperatures between 1605 and 1970 K. Results show that both Sn and Ti diffuse in their respective alloys via a vacancy mechanism. Comparison with data in the literature reveals that the activation energy for diffusion of Sn in Zr-Sn, with Sn content between 3 and 5 at.X is relatively constant from 1200 to 1970 K. From the measured emission rates, values of 103 and 98 kcal/mol were obtained for the enthalpies of sublimation for Sn and Ti in their alloys. With a comparison of the solute vapor pressures with those of the pure elements, partial molar free energies, entropies, and enthalpies for the two systems were determined in the temperature range investigated. The Zr-Sn system shows a very large negative heat of formation (-33 kcal/mol) whereas the Zr-Ti system behaves quite ideally, in agreement with phase-diagram predictions
Magnetoimpedance effect in Nanoperm alloys
International Nuclear Information System (INIS)
Hernando, B.; Alvarez, P.; Santos, J.D.; Gorria, P.; Sanchez, M.L.; Olivera, J.; Perez, M.J.; Prida, V.M.
2006-01-01
The influence of isothermal annealing (1 h at 600 deg. C in Ar atmosphere) on the soft magnetic properties and magnetoimpedance (MI) effect has been studied in ribbons of the following Nanoperm alloys: Fe 91 Zr 7 B 2 , Fe 88 Zr 8 B 4 , Fe 87 Zr 6 B 6 Cu 1 and Fe 8 Zr 1 B 1 . A maximum MI ratio of about 27% was measured for the nanocrystalline alloy Fe 87 Zr 6 B 6 Cu 1 at a driving frequency of 0.2 MHz. The thermal annealing led to magnetic softening for this alloy, while a hardening is observed for the Fe 8 Zr 1 B 1 alloy
Directory of Open Access Journals (Sweden)
Kozieł T.
2016-06-01
Full Text Available The effect of oxygen content in zirconium on the structure and mechanical properties of the Cu46Zr42Al7Y5 alloy, in the form of melt-spun ribbons and suction-cast rods, was investigated. Two types of Zr, rod and crystal bar of different nominal purities and oxygen contents, were used to synthesize the alloy by arc melting. Rapidly solidified ribbons were produced by melt spinning and their amorphous structures were confirmed by X-ray diffractometry (XRD and differential scanning calorimetry (DSC. Bulk samples in the form of rods were cast using a special water-cooled suction casting unit attached to the arc melting system. XRD and DSC studies proved the amorphous structure of the bulk alloy synthesized from low-oxygen Zr and partial crystallization of the same alloy for high-oxygen Zr. In both bulk samples, uniformly distributed crystalline particles were identified as yttrium oxides. Higher mean compressive strength of amorphous alloy was observed. The hardness of amorphous phase was close to 500 HV1 in both bulk alloys, while the hardness of crystalline dendritic areas, observed in the alloy synthesized from high oxygen Zr, was lower by about 50 HV1.
Effects of homogenization on microstructures and properties of a new type Al-Mg-Mn-Zr-Ti-Er alloy
International Nuclear Information System (INIS)
He, L.Z.; Li, X.H.; Liu, X.T.; Wang, X.J.; Zhang, H.T.; Cui, J.Z.
2010-01-01
Research highlights: These new type alloys are very potential for increased use in aerospace and automobile industries. However, most of published reports have focused on the effects of Cu, Sc, Zr, Ag, rare metals and Si additions, Portevin-LeChatelier effect, corrosion properties, friction stir welding and superplasticity in 5000-series aluminum alloy, few investigated on Er and stepped homogenization on the precipitation of dispersoids in Al-Mg-Mn alloy. The purpose of this work was to study the effects of Er and homogenization treatment on mechanical properties and microstructural evolution in new type Al-Mg-Mn-Er alloy. - Abstract: Microstructural evolutions and mechanical properties of Al-Mg-Mn-Zr-Ti-Er alloy after homogenization were investigated in detail by optical microscope (OM), scanning electronic microscope (SEM), transmission electronic microscope (TEM), energy dispersive spectrum (EDS) and tensile test. A maximum tensile strength is obtained when the alloy homogenized at 510 deg. C for 16 h. With increasing preheating temperature (200-400 deg. C), the strength of the alloy finial homogenized at 490 deg. C for 16 h increases. When the preheating temperature is ≥300 deg. C, the strengths of the two-step homogenized alloys are higher than those of the single homogenized alloys. The preheating stage plays an important role in the microstructures and properties of the final homogenized alloy. Many fine (Mn,Fe)Al 6 precipitates when the preheating temperature is 400 deg. C. ErAl 3 phase cannot be observed during preheating stage. Plenty of fine (Mn,Fe)Al 6 and ErAl 3 precipitate in finial homogenized alloy when the preheating temperature is ≥300 deg. C. The Al-Mg-Mn-Zr-Ti-Er alloy is effectively strengthened by substructure and dispersoids of (Mn,Fe)Al 6 and ErAl 3 .
Mechanical properties and corrosion behavior of Mg-Gd-Ca-Zr alloys for medical applications.
Shi, Ling-Ling; Huang, Yuanding; Yang, Lei; Feyerabend, Frank; Mendis, Chamini; Willumeit, Regine; Ulrich Kainer, Karl; Hort, Norbert
2015-07-01
Magnesium alloys are promising candidates for biomedical applications. In this work, influences of composition and heat treatment on the microstructure, the mechanical properties and the corrosion behavior of Mg-Gd-Ca-Zr alloys as potential biomedical implant candidates were investigated. Mg5Gd phase was observed at the grain boundaries of Mg-10Gd-xCa-0.5Zr (x=0, 0.3, 1.2wt%) alloys. Increase in the Ca content led to the formation of additional Mg2Ca phase. The Ca additions increased both the compressive and the tensile yield strengths, but reduced the ductility and the corrosion resistance in cell culture medium. After solution heat treatment, the Mg5Gd particles dissolved in the Mg matrix. The compressive strength decreased, while the corrosion resistance improved in the solution treated alloys. After ageing at 200°C, metastable β' phase formed on prismatic planes and a new type of basal precipitates have been observed, which improved the compressive and tensile ultimate strength, but decreased the ductility. Copyright © 2015 Elsevier Ltd. All rights reserved.
Fan, Jun; Qiu, Xin; Niu, Xiaodong; Tian, Zheng; Sun, Wei; Liu, Xiaojuan; Li, Yangde; Li, Weirong; Meng, Jian
2013-05-01
Mg-1.5Y-1.2Zn-0.44Zr alloys were newly developed as degradable metallic biomaterials. A comprehensive investigation of the microstructure, mechanical properties, in vitro degradation assessments and in vitro cytotoxicity evaluations of the as-cast state, as-heat treated state and as-extruded state alloys was done. The microstructure observations show that the Mg-1.5Y-1.2Zn-0.44Zr alloys are mainly composed of the matrix α-Mg phases and the Mg12ZnY secondary phases (LPS structure). The hot extrusion method significantly refined the grains and eliminated the defects of both as-cast and heat treated alloys and thereby contributed to the better mechanical properties and biodegradation resistance. The values of tensile strength and tensile yield strength of the alloy in the as-extruded condition are about 236 and 178 MPa respectively, with an excellent elongation of 28%. Meanwhile, the value of compressive strength is about 471 MPa and the value of bending strength is about 501 MPa. The superior bending strength further demonstrates the excellent ductility of the hot extruded alloys. The results of immersion tests and electrochemical measurements in the SBF indicate that a protective film precipitated on the alloy's surface with the extension of degradation. The protective film contains Mg(OH)2 and hydroxyapatite (HA) which can reinforce osteoblast activity and promote good biocompatibility. No significant cytotoxicity towards L-929 cells was detected and the immersion extracts of alloy samples could enhance the cell proliferation with time in the cytotoxicity evaluations, implying that the Mg-1.5Y-1.2Zn-0.44Zr alloys have the potential to be used for biomedical applications. Copyright © 2013 Elsevier B.V. All rights reserved.
International Nuclear Information System (INIS)
Jiang, S.T.; Zhang, J.; Shun, S.Z.; Chen, M.F.
2016-01-01
Highlights: • Use a two-step chemical treatment method for formation of FHA coating on biodegradable Mg-Zn-Zr alloy;. • We reported the formation mechanism of FHA coating on Mg-Zn-Zr alloy and achieved optimum properties;. • The MgF_2 coating and FHA coating provide effective protection for the Mg alloy substrate and the FHA coating showed better corrosion resistance. - Abstract: To improve the corrosion resistance of the biomedical magnesium alloy, a two-step chemical treatment method has been employed to prepare an FHA coating on the alloy surface. Prior to forming an FHA layer, the samples of Mg-3 wt% Zn-0.5 wt% Zr alloy were soaked in HF with concentration of 20% (v/v) at 37 °C temperature for 2 h, and were then placed into an aqueous solution with 0.1 mol/L Ca(NO_3).4H_2O and 0.06 mol/L NH_4H_2PO_4 at 90 °C to prepare the Ca-P coating. The concentrations of Mg"2"+, F"− ions, and pH variation with immersing time in the solution were investigated to explore the growth mechanism of FHA. The surface morphologies and compositions of the coatings were characterized by X-ray diffraction, scanning electron microscopy, and energy dispersive spectroscopy. The results showed that the alloy surface treated with acid formed a layer of MgF_2 nanoparticles with a thickness of 0.7 μm. The corrosion resistance of coatings in SBF solution was evaluated by electrochemical impedance spectroscopy (EIS) and potentiodynamic polarization. The results showed that the substrate with FHA coating had good corrosion resistance. After immersing into the calcium phosphate solution, some small spherical particles were first formed on the surface; these then cover the surface completely after 20 min. Some clusters consisting of needle-like crystal were observed in the spherical particles covering the surface, and the Ca/P ratio of the needle-like crystal was 1.46, clearly growing along the c axis preferred orientation growth. After immersion for 60 min, the FHA coating with
Electron microscopy investigations of rapidly solidified Fe-Zr-B-Cu alloys
International Nuclear Information System (INIS)
Majumdar, B.; Arvindha Babu, D.; Akhtar, D.
2010-01-01
Rapidly solidified Fe-based nanocrystalline soft magnetic materials possess a unique combination of properties i,e high permeability, saturation and Curie temperature and very low coercivity which are otherwise not attainable in conventional soft magnetic materials. The alloys are processed by producing amorphous phase through melt spinning route followed by a partial devitrification for incorporation of nanocrystalline phase in the amorphous matrix. In this paper, detailed electron microscopic investigations of melt spun Fe-Zr-B-Cu alloys are presented. Melt spun ribbons of Fe 99-x-y Zr x BCu 1 alloys with x+y = 11 and x+y = 13 were prepared under different wheel speed conditions and then vacuum annealed for 1 h at different temperatures. The microstructure changes from completely amorphous to a cellular/dendritic bcc solid solution coexisting with the amorphous phase at intercellular/dendritic regions when Zr/B ratio or the process parameters are varied. Annealing leads to the precipitation of nanocrystalline bcc-Fe phase from both amorphous phase and already existing bcc solid solution. (author)
Ternary ceramic alloys of Zr-Ce-Hf oxides
Becher, P.F.; Funkenbusch, E.F.
1990-11-20
A ternary ceramic alloy is described which produces toughening of zirconia and zirconia composites through the stress transformation from tetragonal phase to monoclinic phase. This alloy, having the general formula Ce[sub x]Hf[sub y]Zr[sub 1[minus]x[minus]y]O[sub 2], is produced through the addition of appropriate amounts of ceria and hafnia to the zirconia. Typically, improved toughness is achieved with about 5 to about 15 mol % ceria and up to about 40 mol % hafnia. The preparation of alloys of these compositions are given together with data as to the densities, tetragonal phase content, hardness and fracture toughness. The alloys are useful in preparing zirconia bodies as well as reinforcing ceramic composites. 1 fig.
Grain refining efficiency of Al-Ti-C alloys
International Nuclear Information System (INIS)
Birol, Yuecel
2006-01-01
The problems associated with boride agglomeration and the poisoning effect of Zr in Zr-bearing alloys have created a big demand for boron-free grain refiners. The potential benefits of TiC as a direct nucleant for aluminium grains have thus generated a great deal of interest in TiC-bearing alloys in recent years. In Al-Ti-C grain refiners commercially available today, Al 3 Ti particles are introduced into the melt along with the TiC particles. Since the latter are claimed to nucleate α-Al directly, it is of great technological interest to see if reducing the Ti:C ratio further, i.e., increasing the C content of the grain refiner, will produce an increase in the grain refining efficiency of these alloys. A series of grain refiner samples with the Ti concentration fixed at 3% and a range of C contents between 0 and 0.75 were obtained by appropriately mixing an experimental Al-3Ti-0.75C alloy with Al-10Ti alloy and commercial purity aluminium. The grain refining efficiency of these grain refiners was assessed to investigate the role of the insoluble TiC and the soluble Al 3 Ti particles. The optimum chemistry for the Al-Ti-C grain refiners was also identified
Grain refining efficiency of Al-Ti-C alloys
Energy Technology Data Exchange (ETDEWEB)
Birol, Yuecel [Materials Institute, Marmara Research Center, TUBITAK, 41470 Gebze, Kocaeli (Turkey)]. E-mail: yucel.birol@mam.gov.tr
2006-09-28
The problems associated with boride agglomeration and the poisoning effect of Zr in Zr-bearing alloys have created a big demand for boron-free grain refiners. The potential benefits of TiC as a direct nucleant for aluminium grains have thus generated a great deal of interest in TiC-bearing alloys in recent years. In Al-Ti-C grain refiners commercially available today, Al{sub 3}Ti particles are introduced into the melt along with the TiC particles. Since the latter are claimed to nucleate {alpha}-Al directly, it is of great technological interest to see if reducing the Ti:C ratio further, i.e., increasing the C content of the grain refiner, will produce an increase in the grain refining efficiency of these alloys. A series of grain refiner samples with the Ti concentration fixed at 3% and a range of C contents between 0 and 0.75 were obtained by appropriately mixing an experimental Al-3Ti-0.75C alloy with Al-10Ti alloy and commercial purity aluminium. The grain refining efficiency of these grain refiners was assessed to investigate the role of the insoluble TiC and the soluble Al{sub 3}Ti particles. The optimum chemistry for the Al-Ti-C grain refiners was also identified.
Effect of hydrogen and oxygen content on the embrittlement of Zr alloys
International Nuclear Information System (INIS)
Griger, A.; Hozer, Z.; Matus, L.; Vasaros, L.; Horvath, M.
2001-01-01
An experimental study is carried out in the KFKI Atomic Energy Research Institute in order to clear up the role of oxidation and hydrogen uptake in the embrittlement process. Russian E110 type Zr1%Nb and Zircaloy-4 claddings are used as test materials. The differences between the properties of two alloys are examined. The sample preparation covered the following cases: oxidation in Ar+O 2 atmosphere; hydrogen uptake of as received and pre-oxidised samples (in Ar+O 2 atmosphere); oxidation in steam. The oxidation in Ar+O 2 and the subsequent hydrogen uptake procedure make possible the production of samples with well-characterized hydrogen and oxygen content. Corrosion treated ring samples of 8 mm height are examined in ring compression tests. The force-deformation curves are recorded and the crushing force and deformation are determined. The relative deformation is used for the characterisation of embrittlement level. The results of experiments provide detailed information about the effect of hydrogen and oxygen content on the embrittlement of zirconium alloys. The conclusions are: 1) hydrogen seems to play a more important role in the embrittlement of zirconium alloys than oxygen; 2) the Zircaloy-4 alloy becomes brittle at lower hydrogen content than the Zr1%Nb; 3) under steam oxidation conditions the Zr1%Nb alloy takes up much more hydrogen and becomes more brittle than the Zircaloy-4
Interdiffusion and reactions between U-Mo and Zr at 650 °C as a function of time
Park, Y.; Keiser, D. D.; Sohn, Y. H.
2015-01-01
Development of monolithic U-Mo alloy fuel (typically U-10 wt.%Mo) for the Reduced Enrichment for Research and Test Reactors (RERTR) program entails a use of Zr diffusion barrier to eliminate the interdiffusion-reactions between the fuel alloy and Al-alloy cladding. The application of Zr barrier to the U-Mo fuel system requires a co-rolling process that utilizes a soaking temperature of 650 °C, which represents the highest temperature the fuel system is exposed to during both fuel manufacturing and reactor application. Therefore, in this study, development of phase constituents, microstructure and diffusion kinetics of U-10 wt.%Mo and Zr was examined using solid-to-solid diffusion couples annealed at 650 °C for 240, 480 and 720 h. Phase constituents and microstructural development were analyzed by scanning electron microscopy (SEM) and transmission electron microscopy (TEM). Concentration profiles were mapped as diffusion paths on the isothermal ternary phase diagram. Within the diffusion zone, single-phase layers of β-Zr and β-U were observed along with a discontinuous layer of Mo2Zr between the β-Zr and β-U layers. In the vicinity of Mo2Zr phase, islands of α-Zr phases were also found. In addition, acicular α-Zr and U6Zr3Mo phases were observed within the γ-U(Mo) terminal alloy. Growth rate of the interdiffusion-reaction zone was determined to be 7.75 (± 5.84) × 10-16 m2/s at 650 °C, however with an assumption of a certain incubation period.
Zhang, Jianfeng; Gan, Xiaxia; Tang, Hongqun; Zhan, Yongzhong
2017-07-01
In order to obtain material with low elastic modulus, good abrasion resistance and high corrosion stability as screw for dental implant, the biomedical Zr-20Nb and Zr-20Nb-3Ti alloy with low elastic modulus were thermal oxidized respectively at 700°C for 1h and 600°C for 1.25h to obtain the compact oxidized layer to improve its wear resistance and corrosion resistance. The results show that smooth compact oxidized layer (composed of monoclinic ZrO 2 , tetragonal ZrO 2 and 6ZrO 2 -Nb 2 O 5 ) with 22.6μm-43.5μm thickness and 1252-1306HV hardness can be in-situ formed on the surface of the Zr-20Nb-xTi (x=0, 3). The adhesion of oxidized layers to the substrates is determined to be 58.35-66.25N. The oxidized Zr-20Nb-xTi alloys reveal great improvement of the pitting corrosion resistance in comparison with the un-oxidized alloys. In addition, the oxidized Zr-20Nb-3Ti exhibits sharply reduction of the corrosion rates and the oxidized Zr-20Nb shows higher corrosion rates than un-oxidized alloys, which is relevant with the content of the t-ZrO 2 . Wear test in artificial saliva demonstrates that the wear losses of the oxidized Zr-20Nb-xTi (x=0, 3) are superior to pure Ti. All of the un-oxidized Zr-20Nb-xTi (x=0, 3) alloys suffer from serious adhesive wear due to its high plasticity. Because of the protection from compact oxide layer with high adhesion and high hardness, the coefficients of friction and wear losses of the oxidized Zr-20Nb-xTi (x=0, 3) alloys decrease 50% and 95%, respectively. The defects on the oxidized Zr-20Nb have a negative effect on the friction and wear properties. In addition, after the thermal oxidation, compression test show that elastic modulus and strength of Zr-20Nb-xTi (x=0, 3) increase slightly with plastic deformation after 40% of transformation. Furthermore, stripping of the oxidized layer from the alloy matrix did not occur during the whole experiments. As the surface oxidized Zr-20Nb-3Ti alloy has a combination of excellent performance
Microstructure and mechanical properties of Ti-15Zr alloy used as dental implant material.
Medvedev, Alexander E; Molotnikov, Andrey; Lapovok, Rimma; Zeller, Rolf; Berner, Simon; Habersetzer, Philippe; Dalla Torre, Florian
2016-09-01
Ti-Zr alloys have recently started to receive a considerable amount of attention as promising materials for dental applications. This work compares mechanical properties of a new Ti-15Zr alloy to those of commercially pure titanium Grade4 in two surface conditions - machined and modified by sand-blasting and etching (SLA). As a result of significantly smaller grain size in the initial condition (1-2µm), the strength of Ti-15Zr alloy was found to be 10-15% higher than that of Grade4 titanium without reduction in the tensile elongation or compromising the fracture toughness. The fatigue endurance limit of the alloy was increased by around 30% (560MPa vs. 435MPa and 500MPa vs. 380MPa for machined and SLA-treated surfaces, respectively). Additional implant fatigue tests showed enhanced fatigue performance of Ti-15Zr over Ti-Grade4. Copyright © 2016 Elsevier Ltd. All rights reserved.
Effect of Zr on the Corrosion Properties of Mg-Li-Al Alloy
International Nuclear Information System (INIS)
Kim, Soon Ho; Choi, Sang Hyun; Kim, In Bae; Kim, Kyung Hyun
1994-01-01
Effect of Zr on the electrochemical corrosion characteristics of Mg-Li-Al alloy has been investigated by means of potentiodynamic polarization study. The electrochemical behaviors were evaluated in 0.03% NaCl solution and the solution buffered with KH 2 PO 5 · NaOH at room temperature. It was found that the addition of very small quantity of Zr (0.03wt%) in Mg-Li-Al alloy increased corrosion rates and amount of corrosion products and decreased the pitting resistance of the alloy. From the results it was concluded that Zr which is added to increase the strength of Mg-Li-Al alloy is harmful to corrosion properties of the alloy
Effects of TiN coating on the corrosion of nanostructured Ti-30Ta-xZr alloys for dental implants
Kim, Won-Gi; Choe, Han-Cheol
2012-01-01
Electrochemical characteristics of a titanium nitride (TiN)-coated/nanotube-formed Ti-Ta-Zr alloy for biomaterials have been researched by using the magnetic sputter and electrochemical methods. Ti-30Ta-xZr (x = 3, 7 and 15 wt%) alloys were prepared by arc melting and heat treated for 24 h at 1000 °C in an argon atmosphere and then water quenching. The formation of oxide nanotubes was achieved by anodizing a Ti-30Ta-xZr alloy in H3PO4 electrolytes containing small amounts of fluoride ions at room temperature. Anodization was carried out using a scanning potentiostat, and all experiments were conducted at room temperature. The microstructure and morphology of nanotube arrays were characterized by optical microscopy (OM), field emission scanning electron microscopy (FE-SEM) and X-ray diffraction (XRD). The TiN coatings were obtained by the radio-frequency (RF) magnetron sputtering technique. The depositions were performed from pure Ti targets on Ti-30Ta-xZr alloys substrates. The corrosion properties of the specimens were examined using potentiodynamic test in a 0.9% NaCl solution by using potentiostat. The microstructures of Ti-30Ta-xZr alloys were changed from an equiaxed to a needle-like structure with increasing Zr content. The interspace between the nanotubes was approximately 20, 80 and 200 nm for Zr contents of 3, 7 and 15 wt%, respectively. The corrosion resistance of the TiN-coated on the anodized Ti-30Ta-xZr alloys was higher than that of the untreated Ti alloys, indicating a better protective effect.
Effect of Fe and Zr additions on ω phase formation in β-type Ti-Mo alloys
International Nuclear Information System (INIS)
Min, X.H.; Emura, S.; Zhang, L.; Tsuzaki, K.
2008-01-01
The effect of 1% Fe and/or 5% Zr (mass%) additions on ω phase formation was investigated for the Ti-15Mo alloy by means of X-ray diffraction analysis and hardness testing. Upon water quenching following solution treatment in the β phase region, the athermal ω phase formation could not be observed in all the alloys, regardless of Fe and Zr additions. The lattice parameter of the β phase decreases with Fe addition, while it increases with Zr addition. Solid solution strengthening by Fe and Zr is not recognized for the β phase. The isothermal ω phase formed after aging at 723 K and 773 K for 3.6 ks, which results in a decrease in the lattice parameter of the β phase and an increase in the hardness. The isothermal ω phase formation is suppressed with Fe and/or Zr additions. This is interpreted as the consequence of the increase in the average value of the bond order (Bo) for the Ti-15Mo-5Zr and Ti-15Mo-5Zr-1Fe alloys, and of the decrease in the average value of the metal d-orbital energy level (Md) for the Ti-15Mo-1Fe alloy. In addition, the degree of the suppression of isothermal ω phase can be predicted by the average values of Bo and Md
Ti-25Ta-Zr alloys for biomedical applications
Energy Technology Data Exchange (ETDEWEB)
Kuroda, Pedro Akira Bazaglia; Quadros, Fernanda Freitas; Grandini, Carlos Roberto, E-mail: pedro@fc.unesp.br [Universidade Estadual Paulista Julio de Mesquita Filho (UNESP), Bauru, SP (Brazil). Faculdade de Ciencias
2016-07-01
Full text: The most widely used titanium alloy for biomedical applications is Ti-6Al-4V, however, previous studies showed that vanadium cause allergic reactions in human tissue and aluminum has been associated with neurological disorders. Then, to solve this problem, new titanium alloys without the presence of these elements are being developed, with the addition of different elements, usually the β-stabilizers, which can change its microstructure and mechanical properties, and may make the titanium and its alloys, most promising for use as biomaterial. In this paper the development and characterization of Ti-25Ta-(10-40)Zr alloys, for biomedical applications are discussed. X-ray diffraction results show the coexistence of α', α” and β phases, which are corroborated by SEM results. The results of microhardness and elastic modulus present an anomaly for the alloy with 10 wt% Zr, due, probably the presence of ω phase. (author)
Electrochemical and surface behavior of hydyroxyapatite/Ti film on nanotubular Ti-35Nb-xZr alloys
International Nuclear Information System (INIS)
Jeong, Yong-Hoon; Choe, Han-Cheol; Brantley, William A.
2012-01-01
In this paper, we investigated the electrochemical and surface behavior of hydroxyapatite (HA)/Ti films on the nanotubular Ti-35Nb-xZr alloy. The Ti-35Nb-xZr ternary alloys with 3-10 wt.% Zr content were made by an arc melting method. The nanotubular oxide layers were developed on the Ti-35Nb-xZr alloys by an anodic oxidation method in 1 M H 3 PO 4 electrolyte containing 0.8 wt% NaF at room temperature. The HA/Ti composite films on the nanotubular oxide surfaces were deposited by a magnetron sputtering method. Their surface characteristics were analyzed by field-emission scanning electron microscopy (FE-SEM), energy-dispersive X-ray spectroscopy (EDS) and an X-ray diffractometer (XRD). The corrosion behavior of the specimens was examined through potentiodynamic and AC impedance tests in 0.9% NaCl solution. From the results, the Ti-35Nb-xZr alloys showed a solely β phase microstructure that resulted from the addition of Zr. The nanotubular structure formed with a diameter of about 200 nm, and the HA/Ti thin film was deposited on the nanotubular structure. The HA/Ti thin film-coated nanotubular Ti-35Nb-xZr alloys showed good corrosion resistance in 0.9% NaCl solution.
International Nuclear Information System (INIS)
Moiseev, V.N.; Dolzhanskij, Yu.M.; Zakharov, Yu.I.; Znamenskaya, E.V.
1979-01-01
The alloys of martensitic type in the Ti-Al-Mo-V-Fe-Cu-Zr-Sn system after heat treatment are investigated. To determine the composition of the titanium alloy methods of mathematical planning of the experiment are applied. Results of mechanical tests of the alloys are presented, as well as coefficients of models for the properties, calculated according to these data. The investigation establishes the composition of a high-strength titanium alloy of a martensitic type, containing 4.5-60 % Al, 2.0-4.0 % Mo, 0.5-1.9 % V, 0.3-1.5 % Fe, 0.3-1.5 % Cu, 1.5-3.0 % Sn, 2.0-4.0 % Zr. The semiproducts, produced by deformation in β-field, after heat treatment have an ultimate strength >=120 kg/mm 2 , satisfactory ductility and reliability. The alloy possesses rather a high heat resistance and can be operated at 400-500 deg C
International Nuclear Information System (INIS)
Dongxia, Yang; Xiaoyan, Li; Dingyong, He; Hui, Huang
2013-01-01
Samples of Al–Mg–Mn and Al–Mg–Mn–Er–Zr alloys were welded using the method of laser welding. The influence of Er and Zr on microstructure, microhardness and mechanical properties of the Al–Mg–Mn alloy welded joints were investigated. It has been found that addition of Er and Zr refines the grain size in the fusion zone, due to the formation of primary Al 3 Zr and Al 3 Er. Fine equiaxed grains are dominated near the fusion boundary of the Al–Mg–Mn–Er–Zr alloy joint, which is contrary with the columnar crystal in the Al–Mg–Mn alloy joint. Microhardness of the center of the fusion zone rises from 74HV 0.1 to 84HV 0.1 owing to the grain refinement by Er and Zr. The tensile test result shows that the ultimate tensile strength and yield strength are improved by adding Er and Zr. The main reason for this is related to grain refining strengthening.
3D-AP and positron annihilation study of precipitation behavior in Cu-Cr-Zr alloy
DEFF Research Database (Denmark)
Hatakeyama, M.; Toyama, T.; Yang, J.
2009-01-01
Precipitation behavior in a Cu-0.78%Cr-0.13%Zr alloy during aging and reaging has been studied by laser-assisted local electrode three-dimensional atom probe (Laser-LEAP) and positron annihilation spectroscopy (PAS). After the prime aging at 460 degrees C, Cr clusters enriched with Zr were observed...
Microstructural studies of suck cast (Zr-SS)-3 and 5 AI alloys for nuclear metallic waste form
International Nuclear Information System (INIS)
Kumar, P.; Das, N.; Sengupta, P.; Arya, A.; Dey, G.K.
2015-01-01
Management of radioactive metallic waste using 'alloy melting route' is currently being investigated. For disposal of Zr and SS base nuclear metallic wastes, Zr-stainless steel (SS) hybrid alloys are being considered as baseline alloys for developing metallic-waste-form (MWF) alloys. In this context Zr-16 wt. %55 has been selected for MWF alloy in our previous study. In present study, to include amorphous phase in this alloy, 3 and 5 wt. % Al has been added in order to improve desirable properties and useful features of MWF and the two alloys have been prepared by suck casting techniques. Microstructure of these alloys have been investigated by optical and electron microscopy which shows occurrence of two different phases, e.g. dark grey and white phases, in (Zr-16 SS)-3 Al and three different phases, e.g. grey, dark grey and white phases in (Zr-16 SS)-5 AI. Electron diffraction and X-ray diffraction (XRD) analyses of these two alloy specimens revealed the occurrence of Zr (Fe, Cr, AI) (dark grey) and Zr 2 (Fe, Cr, AI) (white) phases in (Zr-16 SS)-3 Al whereas, Zr (Fe, Cr, AI) (dark grey), Zr 2 (Fe, Cr, AI) (grey) and Zr 3 (Fe, Cr, AI) (white) phases were found in (Zr-16 SS)-5 AI. In addition, presence of amorphous phase was indicated by XRD analysis that could be confirmed by transmission electron microscopy of these two alloys. (author)
Energy Technology Data Exchange (ETDEWEB)
Mareci, D., E-mail: danmareci@yahoo.com [Technical University “Gheorghe Asachi” of Iasi, Faculty of Chemical Engineering and Environmental Protection, D. Mangeron, Iasi, 700050 (Romania); Trincă, L.C. [“Ion Ionescu de la Brad” University of Agricultural Science and Veterinary Medicine, Faculty of Horticulture, Science Department, 3, Mihail Sadoveanu Alley, Iaşi, 700490 (Romania); Căilean, D. [Technical University “Gheorghe Asachi” of Iasi, Faculty of Chemical Engineering and Environmental Protection, D. Mangeron, Iasi, 700050 (Romania); Souto, R.M., E-mail: rsouto@ull.es [Department of Chemistry, Universidad de La Laguna, E-38200 La Laguna (Tenerife, Canary Islands) (Spain); Institute of Material Science and Nanotechnology, Universidad de La Laguna, E-38200 La Laguna (Tenerife, Canary Islands) (Spain)
2016-12-15
Highlights: • Hydroxyapatite-zirconia coated ZrTi alloys were characterized for biocompatibility. • Silver nanoparticles added for antimicrobial activity. • Electrochemical behaviour consistent with surface layer of duplex structure. • Porous coating forms on passivating oxide layer. • HA-ZrO{sub 2}-Ag coated Zr45Ti exhibits high potential for implant application. - Abstract: The degradation characteristics of hydroxyapatite-zirconia-silver films (HA-ZrO{sub 2}-Ag) coatings on three ZrTi alloys were investigated in Ringer’s solution containing 10% human albumin protein at 37 °C. Samples were immersed for 7 days while monitored by electrochemical impedance spectroscopy (EIS) and linear potentiodynamic polarization (LPP). The electrochemical analysis in combination with surface analytical characterization by scanning electron microscopy (SEM/EDX) reveals the stability and corrosion resistance of the HA-ZrO{sub 2}-Ag coated ZrTi alloys. The characteristic feature that describes the electrochemical behaviour of the coated alloys is the coexistence of large areas of the coating presenting pores in which the ZrTi alloy substrate is exposed to the simulated physiological environment. The EIS interpretation of results was thus performed using a two-layer model of the surface film. The blocking effect in the presence the human albumin protein produces an enhancement of the corrosion resistance. The results disclose that the Zr45Ti alloy is a promising material for biomedical devices, since electrochemical stability is directly associated to biocompatibility.
Microstructural and thermodynamic evaluation of as-cast U-rich U-Zr alloys
International Nuclear Information System (INIS)
Basak, Chandrabhanu; Prasad, G.J.; Kamath, H.S.
2009-01-01
The present study involves evaluation of microstructures and some basic properties of as-cast uranium rich U-Zr alloys; i.e. uranium alloys containing 2wt%, 5wt%, 7wt% and 10 wt% zirconium. Microstructural evaluation, both optical and SEM, with hardness values are reported. It was shown that a definite correlation exists between the microstructure and the hardness of the alloy. Lattice parameter and densities are determined with the help of XRD analysis. Also the phase transformation mechanism is proposed based on the microstructures and XRD analysis. Thermodynamic analysis coupled with the experimental observation reveals that the lamellar structure found in the as-cast U-rich U-Zr alloys originates from the monotectoid reaction (γ→β + γ'). As Zr concentration increases in the alloy the gamma phase can remain in the metastable state even at lower T. So, with increasing Zr content the monotectoid reaction takes place at lower temperature causing generation of finer lamellae. (author)
The Zr-Ti-Cr system. Equilibria at 900 and 1100 C degrees
International Nuclear Information System (INIS)
Arico, Sergio F.; Gribaudo, Luis M.
2003-01-01
Main contributions to the knowledge of the ternary system Zr-Ti-Cr were published in the sixties. Stability domains of phases at temperatures between 500 and 1400 C degrees were there presented. Here, results related to the phase diagram at 900 and 1100 C degrees are informed. Three alloys with 40 at.% Cr and different Zr/Ti ratios and one more, richer in Cr, were elaborated. Specimens of the alloys were heat treated 1000 and 800 h at 900 and 1100 C degrees respectively. Phase characterizations were performed by optic metallography and X-ray diffraction analysis. Compositions were determined by microprobe. Alloys with 40 at.% Cr at both temperatures have biphasic equilibria between the intermetallic Laves phase AB 2 and the body-centered cubic solid solution containing principally zirconium and titanium. The Cr-rich alloy presents equilibrium of the AB 2 compound and the Cr-rich solid solution. Results of the present and previous works are used in order to propose new isothermal sections at 900 and 1100 C degrees. (author)
Energy Technology Data Exchange (ETDEWEB)
Tahara, Masaki [Institute of Materials Science, University of Tsukuba, Tsukuba, Ibaraki 305-8573 (Japan); Kim, Hee Young, E-mail: heeykim@ims.tsukuba.ac.jp [Institute of Materials Science, University of Tsukuba, Tsukuba, Ibaraki 305-8573 (Japan); Hosoda, Hideki [Precision and Intelligence Laboratory, Tokyo Institute of Technology, Yokohama 226-8503 (Japan); Nam, Tae-hyun [School of Materials Science and Engineering. A, Structural Materials: Properties, Microstructure and Processingnd ERI, Gyeongsang National University, 900 Gazwadong, Jinju, Gyeongnam 660-701 (Korea, Republic of); Miyazaki, Shuichi, E-mail: miyazaki@ims.tsukuba.ac.jp [Institute of Materials Science, University of Tsukuba, Tsukuba, Ibaraki 305-8573 (Japan); School of Materials Science and Engineering. A, Structural Materials: Properties, Microstructure and Processingnd ERI, Gyeongsang National University, 900 Gazwadong, Jinju, Gyeongnam 660-701 (Korea, Republic of)
2010-10-15
Research highlights: In this study, the effects of composition and annealing temperature on microstructure, shape memory effect and superelastic properties were investigated in Ti-Nb-4Zr-2Ta-N alloys by measuring stress-strain curves at various temperatures and using transmission electron microscopy. Dissolution of {alpha} phase increases M{sub s} and decreases the critical stress for slip for the Ti-22Nb-4Zr-2Ta alloy while it causes the decrease of M{sub s} and the increase of the critical stress for slip for the Ti-20Nb-4Zr-2Ta-0.6N alloy. The different effect of dissolution of {alpha} phase can be attributed to the fact that N is absorbed in {alpha} phase. - Abstract: The composition dependence of the mechanical properties and martensitic transformation behavior of Ti-Nb-4Zr-2Ta-N alloys is investigated. The effect of annealing temperature on the microstructural evolution and superelastic properties in the N-added and N-free alloys is compared. The addition of N decreases M{sub s} of Ti-Nb-4Zr-2Ta alloys by about 200 K per 1 at.%N and improves the superelastic properties of Ti-Nb-4Zr-2Ta alloys. The dissolution of {alpha} phase increases the martensitic transformation start temperature and decreases the superelastic recovery strain for the N-free alloy, whereas it causes opposite effects for the N-added alloy. The different annealing temperature dependences of superelastic properties are discussed on the basis of microstructure observation.
International Nuclear Information System (INIS)
Tahara, Masaki; Kim, Hee Young; Hosoda, Hideki; Nam, Tae-hyun; Miyazaki, Shuichi
2010-01-01
Research highlights: In this study, the effects of composition and annealing temperature on microstructure, shape memory effect and superelastic properties were investigated in Ti-Nb-4Zr-2Ta-N alloys by measuring stress-strain curves at various temperatures and using transmission electron microscopy. Dissolution of α phase increases M s and decreases the critical stress for slip for the Ti-22Nb-4Zr-2Ta alloy while it causes the decrease of M s and the increase of the critical stress for slip for the Ti-20Nb-4Zr-2Ta-0.6N alloy. The different effect of dissolution of α phase can be attributed to the fact that N is absorbed in α phase. - Abstract: The composition dependence of the mechanical properties and martensitic transformation behavior of Ti-Nb-4Zr-2Ta-N alloys is investigated. The effect of annealing temperature on the microstructural evolution and superelastic properties in the N-added and N-free alloys is compared. The addition of N decreases M s of Ti-Nb-4Zr-2Ta alloys by about 200 K per 1 at.%N and improves the superelastic properties of Ti-Nb-4Zr-2Ta alloys. The dissolution of α phase increases the martensitic transformation start temperature and decreases the superelastic recovery strain for the N-free alloy, whereas it causes opposite effects for the N-added alloy. The different annealing temperature dependences of superelastic properties are discussed on the basis of microstructure observation.
Sitdikov, O. Sh.; Avtokratova, E. V.; Mukhametdinova, O. E.; Garipova, R. N.; Markushev, M. V.
2017-12-01
The effect of Al3(Sc,Zr) dispersoids on the evolution of the cast Al-Mg-Sc-Zr alloy structure under multi-directional isothermal forging (MIF) has been investigated. The alloy, which has an equiaxed grain structure with a grain size of 25 μm and contains dispersoids 5-10 and 20-50 nm in size after onestage (at 360°C for 6 h) and two-stage (360°C for 6 h + 520°C for 1 h) annealing, respectively, was deformed at 325°C ( 0.65 T m) up to cumulative strains of e = 8.4. In the initial stages of MIF, new fine (sub)grains surrounded by low-angle and high-angle boundaries (HABs) were formed near the initial grain boundaries. With increasing strain, the volume fraction and misorientation of these crystallites increased, which led to the replacement of a coarse-grained structure with a fine-grained one with a grain size of 1.5-2.0 μm. Dynamic recrystallization occurred in accordance to a continuous mechanism and was controlled by the interaction of lattice dislocations and/or (sub)grain boundaries with dispersoids that effectively inhibited the migration of boundaries, as well as the rearrangement of lattice dislocations and their annihilation. The particle size and the density of their distribution significantly affected the parameters of the evolved structure; in an alloy with smaller particles, a structure with a smaller grain size and a larger HAB fraction developed.
High thermal shock resistance of the hot rolled and swaged bulk W–ZrC alloys
Energy Technology Data Exchange (ETDEWEB)
Xie, Z.M.; Liu, R.; Miao, S.; Yang, X.D. [Key Laboratory of Materials Physics, Institute of Solid State Physics, Hefei Science Center, Chinese Academy of Sciences, Hefei 230031 (China); University of Science and Technology of China, Hefei 230026 (China); Zhang, T., E-mail: zhangtao@issp.ac.cn [Key Laboratory of Materials Physics, Institute of Solid State Physics, Hefei Science Center, Chinese Academy of Sciences, Hefei 230031 (China); University of Science and Technology of China, Hefei 230026 (China); Fang, Q.F.; Wang, X.P. [Key Laboratory of Materials Physics, Institute of Solid State Physics, Hefei Science Center, Chinese Academy of Sciences, Hefei 230031 (China); University of Science and Technology of China, Hefei 230026 (China); Liu, C.S., E-mail: csliu@issp.ac.cn [Key Laboratory of Materials Physics, Institute of Solid State Physics, Hefei Science Center, Chinese Academy of Sciences, Hefei 230031 (China); University of Science and Technology of China, Hefei 230026 (China); Lian, Y.Y. [Southwestern Institute of Physics, Chengdu (China); Liu, X., E-mail: xliu@swip.ac.cn [Southwestern Institute of Physics, Chengdu (China); Luo, G.N. [Institute of Plasma Physics, Chinese Academy of Sciences, Hefei 230031 (China)
2016-02-15
The thermal shock (single shot) resistance and mechanical properties of the W–0.5wt% ZrC (WZC) alloys manufactured by ordinary sintering followed by swaging or rolling process were investigated. No cracks or surface melting were detected on the surface of the rolled WZC alloy plates after thermal shock at a power density of 0.66 GW/m{sup 2} for 5 ms, while primary intergranular cracks appear on the surface of the swaged WZC samples after thermal shock at a power density of 0.44 GW/m{sup 2} for 5 ms. Three point bending tests indicate that the rolled WZC alloy has a flexural strength of ∼2.4 GPa and a total strain of 1.8% at room temperature, which are 100% and 260% higher than those of the swaged WZC, respectively. The fracture energy density of the rolled WZC alloy is 3.23 × 10{sup 7} J/m{sup 3}, about 10 times higher than that of the swaged WZC (2.9 × 10{sup 6} J/m{sup 3}). The high thermal shock resistance of the rolled WZC alloys can be ascribed to their extraordinary ductility and plasticity. - Graphical abstract: (Left panel) surface morphology observed by optical microscope after a single pulse for 5 ms with various absorbed power densities at RT on the rolled WZC. (Right panel) curves of flexural stress versus strain at RT (a) and the calculated fracture energy (b) for the swaged WZC and rolled WZC alloys. - Highlights: • No cracks or surface melting were detected on the rolled WZC alloy samples after thermal shock at 0.66 GW/m{sup 2} for 5 ms. • Hot rolled WZC alloy plates exhibit a flexural strength of 2.4 GPa and a strain of 1.8% at RT. • The fracture energy of the rolled WZC alloy is 3.23 × 10{sup 7} J/m{sup 3} at RT, about 10 times higher than that of the swaged WZC. • A detailed analysis of the relationships between the mechanical properties and the thermal shock resistance is given.
EXAFS study of short range order in Fe-Zr amorphous alloys
International Nuclear Information System (INIS)
Fernandez-Gubieda, M.L.; Gorria, P.; Barandiaran, J.M.; Barquin, L.F.
1995-01-01
Room temperature X-ray absorption spectra on Fe K-edge have been performed in Fe 100-x-y Zr x B y and Fe 86 Zr 7 Cu 1 B 6 alloys (x=7, 7.7, 9; y=0, 2, 4, 6). Fe-Fe coordination number and interatomic distances do not change in any sample. However, small changes in the Fe-Zr short range order, which could explain the evolution of the magnetic properties, have been observed. (orig.)
Evidence of zirconium nano-agglomeration in as-cast dilute U–Zr alloys
International Nuclear Information System (INIS)
Mukherjee, S.; Kaity, S.; Saify, M.T.; Jha, S.K.; Pujari, P.K.
2014-01-01
Microstructure evaluation of as-cast and annealed U–Zr (Zr = 2, 6 and 10 wt.%) alloys has been carried out for the first time using positrons as a probe. The chemical signature in the matter–antimatter annihilation gamma and the positron lifetime data suggests that majority of positrons are annihilating from Zr sites in the as-cast alloys. The results have been interpreted as due to the presence of Zr nano-agglomerates in the as-cast alloys which have a higher positron affinity as compared to the rest of the U matrix. A minimum agglomerate size of ∼2 nm diameter has been calculated from the difference in positron affinity between the agglomerates and the matrix. Upon annealing, the Zr signature in the annihilation gamma photons vanishes suggesting that the Zr agglomerates diffuse out of U matrix and form micron-sized precipitates. This has been confirmed by scanning electron microscopy which shows a 3 times increase in the surface density of the precipitates in the annealed alloys as compared to the as-cast ones. Shorter positron diffusion length (measured using slow positron beam) as compared to precipitate separation has been invoked to explain the observed data
Yoo, Hyo-Sang; Kim, Yong-Ho; Lee, Seong-Hee; Son, Hyeon-Taek
2018-09-01
The microstructure and mechanical properties of as-extruded Al-0.1 wt%Si-0.2 wt%Fe- 0.4 wt%Cu-0.04 wt%Zr-xMn-xAlTiB (x = 1.0 wt%) alloys under various annealing processes were investigated and compared. After the as-cast billets were kept at 400 °C for 1 hr, hot extrusion was carried out with a reduction ratio of 38:1. In the case of the as-extruded Al-Si-Fe-Cu-Zr alloy at annealed at 620 °C, large equiaxed grain was observed. When the Mn content is 1.0 wt%, the phase exhibits a skeleton morphology, the phase formation in which Mn participated. Also, the volume fraction of the intermetallic compounds increased with Mn and AlTiB addition. For the Al-0.1Si-0.2Fe-0.4Cu-0.04Zr alloy with Mn and AlTiB addition from 1.0 wt%, the ultimate tensile strength increased from 100.47 to 119.41 to 110.49 MPa. The tensile strength of the as-extruded alloys improved with the addition of Mn and AlTiB due to the formation of Mn and AlTiB-containing intermetallic compounds.
Solubility and partitioning of hydrogen in meta-stable ZR-based alloys used in the nuclear industry
International Nuclear Information System (INIS)
Khatamian, D.
1998-11-01
Terminal solubility and partitioning of hydrogen in Zr-Nb alloys with different Nb concentrations were examined using differential scanning calorimetry and hot vacuum extraction mass spectrometry. Specimens were charged to different concentrations of hydrogen and annealed at 1123 K to generate a two-phase structure consisting of α-Zr (Zr-0.6 wt.% Nb) and meta-stable β-Zr (Zr-20 wt.% Nb) within the alloy. Specimens were aged at 673 and 773 K for up to 1000 h to evaluate the effect of the decomposition of the meta-stable β-Zr to α-Zr + β-Nb on the solubility limit. The results show that the solubility limit for hydrogen in the annealed Zr-Nb alloys is higher than in unalloyed Zr and that the solubility limit increases with the Nb concentration of the alloy. They also show that the hydrogen solubility limits of the completely aged Zr-Nb alloys are similar and approach the values for pure α-Zr. The solubility ratio of hydrogen in β-Zr (Zr-20 wt.% Nb) to that in α-Zr (Zr-0.6 wt.% Nb) was found to range from 9 to 7 within the temperature range of 520 to 580 K. (author)
Energy Technology Data Exchange (ETDEWEB)
Lee, S.-M.; Lee, H.; Kim, J.-H.; Lee, P.S.; Lee, J.-Y. [Korea Advanced Inst. of Science and Technology, Taejon (Korea). Dept. of Materials Science and Engineering
2000-08-10
Some hypo-stoichiometric Zr-based Laves phase alloys were prepared and studied from a viewpoint of discharge capacity for electrochemical application. After careful alloy design of ZrMn{sub 2}-based hydrogen storage alloys through changing their stoichiometry while substituting or adding some alloying elements, the Zr(Mn{sub 0.2}V{sub 0.2}Ni{sub 0.6}){sub 1.8} alloy reveals relatively good properties with regard to hydrogen storage capacity, hydrogen equilibrium pressure and electrochemical discharge capacity. In order to improve the discharge capacity and rate-capability, Zr is partially replaced by Ti. The discharge capacity of Zr{sub 1-x}Ti{sub x}(Mn{sub 0.2}V{sub 0.2}Ni{sub 0.6}){sub 1.8} (x=0.0, 0.2, 0.3, 0.4, 0.6) alloy electrodes at 30 C reaches a maximum value and decreases as the Ti fraction increases. In view of electrochemical and thermodynamic characteristics, the occurrence of a maximal phenomenon of the electrochemical discharge capacity of the alloy is attributed to a competition between decreasing hydrogen storage capacity and increasing rate-capability with Ti fraction. However, as the Ti fraction increases, the discharge capacity decreases drastically with repeated electrochemical cycling. Judging from the analysis of surface composition by Auger electron spectroscopy (AES), the rapid degradation with increasing Ti fraction in Zr-based alloy is ascribed to the fast growth of the oxygen-penetrated layer with cycling. Therefore, it is assured that the stoichiometry and Ti fraction should be optimized to obtain a good cycle life of the electrode maintaining high discharge capacity. On the basis of above results, the hydrogen storage capacity of the alloy with optimized composition (Zr{sub 0.65}Ti{sub 0.35}(Mn{sub 0.3}V{sub 0.14}Cr{sub 0.11}Ni{sub 0.65}){sub 1.76}) is about 1.68 wt% under 10 atm of equilibrium hydrogen pressure. (orig.)
A new Ti-Zr-Hf-Cu-Ni-Si-Sn bulk amorphous alloy with high glass-forming ability
Energy Technology Data Exchange (ETDEWEB)
Huang, Y.J. [School of Materials Science and Engineering, Harbin Institute of Technology, Harbin 150001 (China); Shen, J. [School of Materials Science and Engineering, Harbin Institute of Technology, Harbin 150001 (China)]. E-mail: junshen@hit.edu.cn; Sun, J.F. [School of Materials Science and Engineering, Harbin Institute of Technology, Harbin 150001 (China); Yu, X.B. [Lab of Energy Science and Technology, Shanghai Institute of Microsystem and Information Technology, Chinese Academy of Sciences, Shanghai 200050 (China)]. E-mail: yuxuebin@hotmail.com
2007-01-16
The effect of Sn substitution for Cu on the glass-forming ability was investigated in Ti{sub 41.5}Zr{sub 2.5}Hf{sub 5}Cu{sub 42.5-x}Ni{sub 7.5}Si{sub 1}Sn {sub x} (x = 0, 1, 3, 5, 7) alloys by using differential scanning calorimetry (DSC) and X-ray diffractometry. The alloy containing 5% Sn shows the highest glass-forming ability (GFA) among the Ti-Zr-Hf-Cu-Ni-Si-Sn system. Fully amorphous rod sample with diameters up to 6 mm could be successfully fabricated by the copper mold casting Ti{sub 41.5}Zr{sub 2.5}Hf{sub 5}Cu{sub 37.5}Ni{sub 7.5}Si{sub 1}Sn{sub 5} alloy. The activation energies for glass transition and crystallization for Ti{sub 41.5}Zr{sub 2.5}Hf{sub 5}Cu{sub 37.5}Ni{sub 7.5}Si{sub 1}Sn{sub 5} amorphous alloy are both larger than those values for the Sn-free alloy. The enhancement in GFA and thermal stability after the partial replacement of Cu by Sn may be contributed to the strong atomic bonding nature between Ti and Sn and the increasing of atomic packing density. The amorphous Ti{sub 41.5}Zr{sub 2.5}Hf{sub 5}Cu{sub 37.5}Ni{sub 7.5}Si{sub 1}Sn{sub 5} alloy also possesses superior mechanical properties.
Passivation kinetics of Mg-Nd-Gd-Zn-Zr (EV31A and Mg-Y-Nd-Gd-Zr (WE43C in NaOH solutions
Directory of Open Access Journals (Sweden)
Jakraphan Ninlachart
2017-09-01
Full Text Available Passivation kinetics of two Mg-RE alloys, such as Mg-Nd-Gd-Zn-Zr (EV31A, and Mg-Y-Nd-Gd-Zr (WE43C were investigated in two different heat treated conditions (solution treated and overaged in 0.01 - 1.0 M NaOH solutions under potentiostatic conditions. Negative reaction order was observed in dilute NaOH which transitioned to positive values as the passivation time increased and in the 1 M NaOH as well. The passive layers showed platelet morphology and the size of the platelets decreased with increase in the NaOH concentration. The hydrogen evolution reaction (HER kinetics was not improved on the passive layer covered surface of the Mg-RE alloys in contrast to the improvements reported on the hydroxide covered pure magnesium. The electrochemical impedance increased with increase in the NaOH concentration in the solution treated condition of both Mg-RE alloys, whereas the overaged EV31A alloy showed a reverse trend. The passive layer of EV31A showed almost 100% higher charge carrier density than the film formed on the WE43C in the overaged condition. A better passivation behavior was observed in the solution treated condition than that in the overaged condition which could be attributed to the uniform distribution of the RE elements in the solution treated specimens. The WE43C alloy revealed better corrosion resistance in the alkaline solution than the EV31A alloy.
Peruzzi, A.; Bolcich, J.
1990-11-01
Zr alloys with 2.5 to 8.0 at% Nb and 0 to 6.7 at% Al were subjected to dynamic and static treatments between 730-900° C and studied by qualitative and quantitative optical metallography, electrical resistance, X-ray diffractometry and electron microanalysis. The experimental data were analyzed by taking into account the effects of oxygen and nitrogen impurities. The main results for Zn-Nb-Al alloys with 750 at ppm O and 250 at ppm N are the following: (i) Equilibrium relationships are established between the α (hcp), β (bcc) and Zr 3Al (Cu 3Au) phases along isothermal sections at 730, 771 and 800°C. (ii) The β/ α + β boundaries are determined along iso-aluminum vertical sections at 6.7, 3.3 and 0 at% Al. (iii) The addition of Al to Zr-Nb alloys increases the solubility of Nb in the α phase, its maximum value at 730° C being about 0.7-0.8 at% for 4 at% Al. (iv) Solubility values for Al in the α-phase of Zr-Al were estimated by extrapolation from ternary alloys. These estimates help to solve an existing discrepancy in the Zr-Al system.
International Nuclear Information System (INIS)
Peruzzi, A.; Bolcich, J.
1990-01-01
Zr alloys with 2.5 to 8.0 at% Nb and 0 to 6.7 at% Al were subjected to dynamic and static treatments between 730-900deg C and studied by qualitative and quantitative optical metallography, electrical resistance, X-ray diffractometry and electron microanalysis. The experimental data were analyzed by taking into account the effects of oxygen and nitrogen impurities. The main results for Zn-Nb-Al alloys with 750 atppm O and 250 atppm N are the following: (i) Equilibrium relationships are established between the α (hcp), β (bcc) and Zr 3 Al (Cu 3 Au) phases along isothermal sections at 730, 771 and 800deg C. (ii) The β/α+β boundaries are determined along iso-aluminum vertical sections at 6.7, 3.3 and 0 at% Al. (iii) The addition of Al to Zr-Nb alloys increases the solubility of Nb in the α phase, its maximum value at 730deg C being about 0.7-0.8 at% for 4 at% Al.(iv) Solubility values for Al in the α-phase of Zr-Al were estimated by extrapolation from ternary alloys. These estimates help to solve an existing discrepancy in the Zr-Al system. (orig.)
Phase Transformation and Shape Memory Effect of Ti-Pd-Pt-Zr High-Temperature Shape Memory Alloys
Yamabe-Mitarai, Yoko; Takebe, Wataru; Shimojo, Masayuki
2017-12-01
To understand the potential of high-temperature shape memory alloys, we have investigated the phase transformation and shape memory effect of Ti-(50 - x)Pt- xPd-5Zr alloys ( x = 0, 5, and 15 at.%), which present the B2 structure in the austenite phase and B19 structure in the martensite phase. Their phase transformation temperatures are very high; A f and M f of Ti-50Pt are 1066 and 1012 °C, respectively. By adding Zr and Pd, the phase transition temperatures decrease, ranging between 804 and 994 °C for A f and 590 and 865 °C for M f. Even at the high phase transformation temperature, a maximum recovery ratio of 70% was obtained for one cycle in a thermal cyclic test. A work output of 1.2 J/cm3 was also obtained. The recovery ratio obtained by the thermal cyclic test was less than 70% because the recovery strain was training effect was also investigated.
Structure and mechanical properties of as-cast (ZrTi){sub 100−x}B{sub x} alloys
Energy Technology Data Exchange (ETDEWEB)
Xia, C.Q.; Jiang, X.J.; Wang, X.Y.; Zhou, Y.K.; Feng, Z.H. [State Key Laboratory of Metastable Materials Science and Technology, Yanshan University, Qinhuangdao 066004 (China); Tan, C.L. [Beijing Institute of Spacecraft System Engineering, Beijing 100094 (China); Ma, M.Z. [State Key Laboratory of Metastable Materials Science and Technology, Yanshan University, Qinhuangdao 066004 (China); Liu, R.P., E-mail: riping@ysu.edu.cn [State Key Laboratory of Metastable Materials Science and Technology, Yanshan University, Qinhuangdao 066004 (China)
2015-07-15
Highlights: • Trace boron additions result in significant grain refinement. • Large numbers of stacking faults are observed in ZrB{sub 2} and TiB intermetallics. • The tensile strength is enhanced by increasing the amount of B. • Intermetallics microcracking causes the failure of the alloys. - Abstract: The microstructure, mechanical properties, and fracture characteristics of (Zr{sub 50}Ti{sub 50}){sub 100−x}B{sub x} alloys (x = 0, 0.5, 1, 2 at.%) obtained by casting were investigated. Trace additions of boron (B) to the Zr{sub 50}Ti{sub 50} alloys induced significant microstructural changes. Changes included the promotion of dendritic growth and refinement in prior-β grain and α′-lath size. Large numbers of stacking faults were also observed in ZrB{sub 2} and TiB intermetallics. The location of B atoms and the lattice mismatch energy between intermetallics and matrix were responsible for the stacking faults. (ZrTi)B alloys demonstrated higher tensile strength than matrix material. Both the intermetallics with high strength and modulus and the grain refinement played important roles in improving the mechanical properties of alloys. This result could be explained in terms of a shear-lag model based on the load transfer concept and Hall–Petch mechanism. The elongation-to-failure of (ZrTi)B alloys decreased with increased B concentration. The reduction in elongation-to-failure of (ZrTi)B alloys could be attributed to the presence of ZrB{sub 2} and TiB intermetallics and refinement of α′-laths.
U-Zr alloy: XPS and TEM study of surface passivation
Paukov, M.; Tkach, I.; Huber, F.; Gouder, T.; Cieslar, M.; Drozdenko, D.; Minarik, P.; Havela, L.
2018-05-01
Surface reactivity of Uranium metal is an important factor limiting its practical applications. Bcc alloys of U with various transition metals are much less reactive than pure Uranium. So as to specify the mechanism of surface protection, we have been studying the U-20 at.% Zr alloy by photoelectron spectroscopy and transmission electron microscopy. The surface was studied in as-obtained state, in various stages of surface cleaning, and during an isochronal annealing cycle. The analysis based on U-4f, Zr-3p, and O-1 s spectra shows that a Zr-rich phase segregates at the surface at temperatures exceeding 550 K, which provides a self-assembled coating. The comparison of oxygen exposure of the stoichiometric and coated surfaces shows that the coating is efficiently preventing the oxidation of uranium even at elevated temperatures. The coating can be associated with the UZr2+x phase. TEM study indicated that the coating is about 20 nm thick. For the clean state, the U-4f core-level lines of the bcc alloy are practically identical to those of α-U, revealing similar delocalization of the 5f electronic states.
FeCrAl and Zr alloys joined using hot isostatic pressing for fusion energy applications
International Nuclear Information System (INIS)
Park, Dong Jun; Kim, Hyun Gil; Park, Jeong Yong; Jung, Yang Il; Park, Jung Hwan; Koo, Yang Hyun
2016-01-01
Highlights: • FeCrAl and Zr alloys were successfully joined by hot isostatic pressing (HIP). • The thickness of diffusion layer increased with an increase in HIP temperature. • Significant inter-diffusion was observed for HIP at 1150 °C. • Maximum joint strength was achieved at HIP temperature of 700 °C. - Abstract: FeCrAl and Zr alloys were joined by a hot isostatic pressing (HIP) method for fusion energy applications. The optimum conditions for the joining process were studied. The HIP temperatures were varied from 700 to 1050 °C. The mechanical properties of the HIPed samples were evaluated by four-point bending and tensile tests. The FeCrAl and Zr alloys HIPed at 700 °C showed higher joint strength than the other samples. The joint strength decreased with an increase in the HIP temperature from 700 to 950 °C and significantly dropped at 1050 °C. Transmission electron microscopy, scanning electron microscopy, and optical microscopy were used to characterize the joints and interface region of the HIPed samples. The joints appeared to be tightly bonded and no intermetallic compounds or gaps were observed at the interface for HIP temperatures up to 950 °C. A diffusion layer formed at the interface and its thickness increased with the HIP temperature. HIP at 1050 °C, on the other hand, resulted in significant inter-diffusion and formation of brittle inter-metallic compounds at the interface.
Adsorption behavior of glycidoxypropyl-trimethoxy-silane on titanium alloy Ti-6.5Al-1Mo-1V-2Zr
Energy Technology Data Exchange (ETDEWEB)
Liu Jianhua; Zhan Zhongwei [School of Materials Science and Engineering, Beihang University, Beijing 100191 (China); Yu Mei, E-mail: yumei@buaa.edu.cn [School of Materials Science and Engineering, Beihang University, Beijing 100191 (China); Li Songmei [School of Materials Science and Engineering, Beihang University, Beijing 100191 (China)
2013-01-01
Highlights: Black-Right-Pointing-Pointer The adsorption isotherm of glycidoxypropyl-trimethoxy-silane (GTMS) on a titanium alloy was found fitting Temkin isotherm by XPS. Black-Right-Pointing-Pointer From an electrochemical point of view, the in situ adsorption process of GTMS molecules agreed with XPS results. Black-Right-Pointing-Pointer At 30 Degree-Sign C, the adsorption of GTMS molecules is spontaneous, and follows a chemisorption-based mechanism. - Abstract: The adsorption behavior of glycidoxypropyl-trimethoxy-silane (GTMS) on titanium alloy Ti-6.5Al-1Mo-1V-2Zr was investigated by using X-ray photoelectron spectroscopy (XPS), Tafel polarization test, and electrochemical impedance spectroscopy (EIS). From the XPS results, it was found that the silane coverage on the titanium surface generally increased with GTMS concentration, with a slight decrease at concentration of 0.1%. Based on the relationship between isoelectronic point (IEP) of titanium surface and the pH values of silane solutions, adsorption mechanisms at different concentrations were proposed. The surface coverage data of GTMS on titanium surface was also derived from electrochemical measurements. By linear fitting the coverage data, it revealed that the adsorption of GTMS on the titanium alloy surface at 30 Degree-Sign C was of a physisorption-based mechanism, and obeyed Langmuir adsorption isotherm. The adsorption equilibrium constant (K{sub ads}) and free energy of adsorption process ({Delta}G{sub ads}) were calculated to elaborate the mechanism of GTMS adsorption.
Preparation and Properties of Ti-TiN-Zr-ZrN Multilayer Films on Titanium Alloy Surface
Directory of Open Access Journals (Sweden)
LIN Song-sheng
2017-06-01
Full Text Available 24 cycles Ti-TiN-Zr-ZrN soft-hard alternating multilayer film was deposited on TC11 titanium alloy by vacuum cathodic arc deposition method. The structure and performance of the multilayer film, especially wear and sand erosion resistance were investigated by various analytical methods including pin on disc wear tester, sand erosion tester, 3D surface topography instrument, scanning electron microscopy (SEM, X-ray diffraction(XRD, micro-hardness tester and scratch adhesion tester. The results indicate that the Vickers-hardness of the multilayer film with thickness of 5.8μm can reach up to 28.10GPa. The adhesive strength of these coatings can be as high as 56N. Wear rate of the multilayer coated alloy is one order of magnitude smaller than bare one, which decreased from 7.06×10-13 m3·N-1·m-1 to 3.03×10-14m3·N-1·m-1. Multilayer films can play the role in hindering the extension of cracks, and thus sand erosion properties of the TC11 titanium alloy substrates are improved.
International Nuclear Information System (INIS)
Mareci, Daniel; Bolat, Georgiana; Chelariu, Romeu; Sutiman, Daniel; Munteanu, Corneliu
2013-01-01
Titanium and zirconium are in the same group in the periodic table of elements and are known to have similar physical and chemical properties. Both Ti and Zr usually have their surfaces covered by a thin oxide film spontaneously formed in air. However, the cytotoxicity of ZrO 2 is lower than that of TiO 2 rutile. Treatments with fluoride are known as the main methods to prevent plaque formation and dental caries. The corrosion behaviour of ZrTi alloys with Ti contents of 5, 25 and 45 wt.% and cp-Ti was investigated for dental applications. All samples were tested by linear potentiodynamic polarisation and electrochemical impedance spectroscopy (EIS) performed in artificial saliva with different pH levels (5.6 and 3.4) and different fluoride (1000 ppm F − ) and albumin protein (0.6%) contents. In addition, scanning electron microscopy (SEM) was employed to observe the surface morphology of the test materials after linear potentiodynamic polarisation. The corrosion current densities for the ZrTi alloys increased with the titanium content. The Zr5Ti and Zr25Ti alloys were susceptible to localised corrosion. The role that Ti plays as an alloying element is that of increasing the resistance of ZrTi alloy to localised corrosion. The presence of 0.6% albumin protein in fluoridated acidified artificial saliva with 1000 ppm F − could protect the cp-Ti and ZrTi alloys from attack by fluoride ions. - Highlights: • Electrochemical and corrosion behaviour of the new ZrTi alloys were investigated. • The passive behaviour for all the ZrTi alloys is observed. • Addition of Ti to Zr improves the corrosion resistance in some fluoridated saliva. • The presence of albumin could prevent the ZrTi alloys from attack by fluoride ions
Energy Technology Data Exchange (ETDEWEB)
Mareci, Daniel [“Gheorghe Asachi” Technical University of Iasi, Faculty of Chemical Engineering and Environmental Protection, Iasi (Romania); Bolat, Georgiana, E-mail: georgiana20022@yahoo.com [“Gheorghe Asachi” Technical University of Iasi, Faculty of Chemical Engineering and Environmental Protection, Iasi (Romania); Chelariu, Romeu [“Gheorghe Asachi” Technical University of Iasi, Faculty of Materials Science and Engineering, Iasi (Romania); Sutiman, Daniel [“Gheorghe Asachi” Technical University of Iasi, Faculty of Chemical Engineering and Environmental Protection, Iasi (Romania); Munteanu, Corneliu [“Gheorghe Asachi” Technical University of Iasi, Faculty of Mechanical, Iasi (Romania)
2013-08-15
Titanium and zirconium are in the same group in the periodic table of elements and are known to have similar physical and chemical properties. Both Ti and Zr usually have their surfaces covered by a thin oxide film spontaneously formed in air. However, the cytotoxicity of ZrO{sub 2} is lower than that of TiO{sub 2} rutile. Treatments with fluoride are known as the main methods to prevent plaque formation and dental caries. The corrosion behaviour of ZrTi alloys with Ti contents of 5, 25 and 45 wt.% and cp-Ti was investigated for dental applications. All samples were tested by linear potentiodynamic polarisation and electrochemical impedance spectroscopy (EIS) performed in artificial saliva with different pH levels (5.6 and 3.4) and different fluoride (1000 ppm F{sup −}) and albumin protein (0.6%) contents. In addition, scanning electron microscopy (SEM) was employed to observe the surface morphology of the test materials after linear potentiodynamic polarisation. The corrosion current densities for the ZrTi alloys increased with the titanium content. The Zr5Ti and Zr25Ti alloys were susceptible to localised corrosion. The role that Ti plays as an alloying element is that of increasing the resistance of ZrTi alloy to localised corrosion. The presence of 0.6% albumin protein in fluoridated acidified artificial saliva with 1000 ppm F{sup −} could protect the cp-Ti and ZrTi alloys from attack by fluoride ions. - Highlights: • Electrochemical and corrosion behaviour of the new ZrTi alloys were investigated. • The passive behaviour for all the ZrTi alloys is observed. • Addition of Ti to Zr improves the corrosion resistance in some fluoridated saliva. • The presence of albumin could prevent the ZrTi alloys from attack by fluoride ions.
International Nuclear Information System (INIS)
El-khair, M.T. Abou; Lotfy, A.; Daoud, A.; El-Sheikh, A.M.
2011-01-01
Research highlights: → ZA27 with 5% SiC, ZrO2 or C particles are synthesized by stirring then squeezed. → Particles refine the structure. 50 MPa decreases porosity% and increases density. → α and β nucleation temperatures of the composites are lower than those of the matrix. → Particles accelerate age hardening and increase peak hardness of the composites → Particles reduce the CTEs of composites compared to those of the matrix. - Abstract: ZA27 alloy based composites were synthesized by stirring method, followed by squeeze casting. Stir casting was employed successfully to incorporate 5 vol.% of various reinforcement particulates, namely, SiC, ZrO 2 or C. The porosity in the composites was decreased by squeeze pressure. The presence of particles and/or application of squeeze pressure during solidification resulted in considerable refinement in the structure of the composites. The microstructures, X-ray diffraction (XRD) and energy dispersive X-ray analysis (EDXA) results indicated that no significant reactions occurred at the interface between the SiC or C particles and ZA27 alloy. However, in case of ZrO 2 reinforced ZA27, the ZrO 2 reacted with Cu present in the molten ZA27 alloy, forming Cu 5 Zr. Thermal analysis showed that both α and β nucleation and growth temperatures of the composites were lower than those of the ZA27 alloy. The presence of particles in the as-cast or squeezed composites led to not only an accelerated age hardening response, but also an increase in the peak hardness of the composites. The values of coefficient of thermal expansion (CTE) of the composites were drastically lower as compared to those of the ZA27 alloy. The tensile properties of the composites decreased as a result of the addition of the particles. Scanning electron microscope (SEM) pictures of the composites indicated that cracks mainly initiated at particle-matrix interface, propagated through the matrix and linked up with other cracks leading to failure of the
Energy Technology Data Exchange (ETDEWEB)
Meng, Yi, E-mail: yimonmy@sina.com; Cui, Jianzhong; Zhao, Zhihao; He, Lizi
2014-06-01
The Al-1.6Mg-1.2Si-1.1Cu-0.15Cr (all in wt. %) alloys with and without Zr addition prepared by low frequency electromagnetic casting process were investigated by using the optical microscope, scanning electron microscope and transmission electron microscope equipped with energy dispersive analytical X-ray. The effects of Al{sub 3}Zr phases on the microstructures and mechanical properties during solidification, homogenization, hot extrusion and solid solution were studied. The results show that Al{sub 3}Zr phases reduce the grain size by ∼ 29% and promote the formation of an equiaxed grain structure during solidification. Numerous spherical Al{sub 3}Zr dispersoids with 35–60 nm in diameters precipitate during homogenization, and these fine dispersoids change little during subsequent hot extrusion and solid solution. Adding 0.15 wt. % Zr results in no recrystallization after hot extrusion and partial recrystallization after solid solution, while the recrystallized grain size is 400–550 μm in extrusion direction in the Zr-free alloy. In addition, adding 0.15 wt. % Zr can obviously promote Q′ phase precipitation, while the β″ phases are predominant in the alloy without Zr. Adding 0.15 wt. % Zr, the ultimate tensile strength of the T6 treated alloy increases by 45 MPa, while the elongation remains about 16.7%. - Highlights: • Minor Zr can refine as-cast grains of the LFEC Al-Mg-Si-Cu-Cr alloy. • L1{sub 2} Al{sub 3}Zr phases with 35–60 nm in diameter precipitate during homogenization. • L1{sub 2} and DO{sub 22} Al{sub 3}Zr phases result in partial recrystallization after solid solution. • Minor Zr can promote the precipitation of Q′ phases. • Mechanical properties of Al-Mg-Si-Cu-Cr-Zr alloy are higher than those of AA7005.
International Nuclear Information System (INIS)
Meng, Yi; Cui, Jianzhong; Zhao, Zhihao; He, Lizi
2014-01-01
The Al-1.6Mg-1.2Si-1.1Cu-0.15Cr (all in wt. %) alloys with and without Zr addition prepared by low frequency electromagnetic casting process were investigated by using the optical microscope, scanning electron microscope and transmission electron microscope equipped with energy dispersive analytical X-ray. The effects of Al 3 Zr phases on the microstructures and mechanical properties during solidification, homogenization, hot extrusion and solid solution were studied. The results show that Al 3 Zr phases reduce the grain size by ∼ 29% and promote the formation of an equiaxed grain structure during solidification. Numerous spherical Al 3 Zr dispersoids with 35–60 nm in diameters precipitate during homogenization, and these fine dispersoids change little during subsequent hot extrusion and solid solution. Adding 0.15 wt. % Zr results in no recrystallization after hot extrusion and partial recrystallization after solid solution, while the recrystallized grain size is 400–550 μm in extrusion direction in the Zr-free alloy. In addition, adding 0.15 wt. % Zr can obviously promote Q′ phase precipitation, while the β″ phases are predominant in the alloy without Zr. Adding 0.15 wt. % Zr, the ultimate tensile strength of the T6 treated alloy increases by 45 MPa, while the elongation remains about 16.7%. - Highlights: • Minor Zr can refine as-cast grains of the LFEC Al-Mg-Si-Cu-Cr alloy. • L1 2 Al 3 Zr phases with 35–60 nm in diameter precipitate during homogenization. • L1 2 and DO 22 Al 3 Zr phases result in partial recrystallization after solid solution. • Minor Zr can promote the precipitation of Q′ phases. • Mechanical properties of Al-Mg-Si-Cu-Cr-Zr alloy are higher than those of AA7005
Phase equilibria in the Zr-Si-B ternary system (Zr-Si-ZrB{sub 2} region) at 1 173 K
Energy Technology Data Exchange (ETDEWEB)
Han, Feng; Luo, Hao [Guangxi Univ., Nanning (China). College of Materials Science and Engineering; Guangxi Univ., Nanning (China). Guangxi Key Lab. of Processing for Non-ferrous Metal and Featured Materials; Zhan, Yongzhong [Guangxi Univ., Nanning (China). College of Materials Science and Engineering; Guangxi Univ., Nanning (China). Guangxi Key Lab. of Processing for Non-ferrous Metal and Featured Materials; Guangxi Univ., Nanning (China). Center of Ecological Collaborative Innovation for Aluminum Industry
2017-10-15
The isothermal section of the Zr-Si-B ternary system (Zr-Si-ZrB{sub 2} region) at 1 173 K has been experimentally determined. All equilibrated alloys were characterized via X-ray powder diffraction and scanning electron microscopy equipped with energy-dispersive X-ray analysis. A ternary phase Zr{sub 5}(Si{sub 0.86}B{sub 0.14}){sub 3} was found at 1 173 K. The experimental results show that the isothermal section consists of 11 single-phase regions, 26 two-phase regions and 13 three-phase regions. The existence of eight compounds, i.e. ZrSi{sub 2}, ZrSi, Zr{sub 5}Si{sub 4}, Zr{sub 3}Si{sub 2}, Zr{sub 2}Si, ZrB, ZrB{sub 2} and Zr{sub 5}(Si{sub 0.86}B{sub 0.14}){sub 3} in this system has been confirmed in the Zr-Si-ZrB{sub 2} region at 1 173 K.
Effect of Bi on the corrosion resistance of zirconium alloys
International Nuclear Information System (INIS)
Yao Meiyi; Zhou Bangxin; Li Qiang; Zhang Weipeng; Zhu Li; Zou Linghong; Zhang Jinlong; Peng Jianchao
2014-01-01
In order to investigate systematically the effect of Bi addition on the corrosion resistance of zirconium alloys, different zirconium-based alloys, including Zr-4 (Zr-l.5Sn-0.2Fe-0.1Cr), S5 (Zr-0.8Sn-0.35Nb-0.4Fe-0.1Cr), T5 (Zr-0.7Sn-l.0Nb-0.3Fe-0.1Cr) and Zr-1Nb, were adopted to prepare the zirconium alloys containing Bi of 0∼0.5% in mass fraction. These alloys were denoted as Zr-4 + xBi, S5 + xBi, T5 + xBi and Zr-1Nb + xBi, respectively. The corrosion behavior of these specimens was investigated by autoclave testing in lithiated water with 0.01 M LiOH or deionized water at 360 ℃/18.6 MPa and in superheated steam at 400 ℃/10.3 MPa. The microstructure of the alloys was examined by TEM and the second phase particles (SPPs) were analyzed by EDS. Microstructure observation shows that the addition of Bi promotes the precipitation of Sn as second phase particles (SPPs) because Sn is in solid solution in α-Zr matrix in Zr-4, S5 and T5 alloys. The concentration of Bi dissolved in α-Zr matrix increase with the increase of Nb in the alloys, and the excess Bi precipitates as Bi-containing SPPs. The corrosion results show that the effect of Bi addition on the corrosion behavior of different zirconium-based alloys is very complicated, depending on their compositions and corrosion conditions. In the case of higher Bi concentration in α-Zr, the zirconium alloys exhibit better corrosion resistance. However, in the case of precipitation of Bi-containing SPPs, the corrosion resistance gets worse. This indicates that the solid solution of Bi in α-Zr matrix can improve the corrosion resistance, while the precipitation of the Bi-containing SPPs is harmful to the corrosion resistance. (authors)
Diffusion studies in amorphous NiZr alloys
International Nuclear Information System (INIS)
Hahn, H.; Averback, R.S.; Hoshino, K.; Rothman, S.J.
1987-06-01
Tracer impurity and self diffusion measurements have been made on amorphous (a-) NiZr alloys using radioactive tracer, Secondary Ion Mass Spectrometry and Rutherford backscattering techniques. The temperature dependence of diffusion in a-NiZr can be represented in the form D = D 0 exp(-Q/kT), with no structural relaxation effects being observed. The mobility of an atom in a-NiZr increased dramatically with decreasing atomic radius of the diffusing atom and also with decreasing Ni content for Ni concentrations below ≅40 at. %. These diffusion characteristics in a-NiZr are remarkably similar to those in α-Zr and α-Ti. These mechanisms assume that Zr and Ti provide a close packed structure, either crystalline or amorphous, through which small atoms diffuse by an interstitial mechanism and large atoms diffuse by a vacancy mechanism. 12 refs., 2 figs., 2 tabs
Energy Technology Data Exchange (ETDEWEB)
Dongxia, Yang, E-mail: yangdongxia116@emails.bjut.edu.cn [Department of Materials Science and Engineering, Beijing University of Technology, Beijing 100124 (China); Xiaoyan, Li; Dingyong, He; Hui, Huang [Department of Materials Science and Engineering, Beijing University of Technology, Beijing 100124 (China)
2013-01-20
Samples of Al-Mg-Mn and Al-Mg-Mn-Er-Zr alloys were welded using the method of laser welding. The influence of Er and Zr on microstructure, microhardness and mechanical properties of the Al-Mg-Mn alloy welded joints were investigated. It has been found that addition of Er and Zr refines the grain size in the fusion zone, due to the formation of primary Al{sub 3}Zr and Al{sub 3}Er. Fine equiaxed grains are dominated near the fusion boundary of the Al-Mg-Mn-Er-Zr alloy joint, which is contrary with the columnar crystal in the Al-Mg-Mn alloy joint. Microhardness of the center of the fusion zone rises from 74HV{sub 0.1} to 84HV{sub 0.1} owing to the grain refinement by Er and Zr. The tensile test result shows that the ultimate tensile strength and yield strength are improved by adding Er and Zr. The main reason for this is related to grain refining strengthening.
Studies on Al-Cu-Li-Mg-Ag-Zr alloy processed through vacuum induction melting (VIM) technique
International Nuclear Information System (INIS)
Nayan, Niraj; Govind; Nair, K. Suseelan; Mittal, M.C.; Sudhakaran, K.N.
2007-01-01
A new technique of lithium addition has been adapted for the processing of Al-Cu-Li-Ag-Mg-Zr alloy, which gives more than 90% recovery of lithium throughout the billet. Processing studies on this alloy include casting, three step homogenization, to avoid incipient melting, and mechanical working particularly forging and rolling. The products in the form of sheets were subjected to various T6 (solution treatment + water quenching + aging) tempers. Mechanical properties were evaluated at room temperature and correlated with microstructure. Characterizations using optical microscope and post-fracture analysis have been carried out using Scanning electron microscope (SEM). Experimental investigation shows highest mechanical properties for the Al-1.3%Li alloy in T6 (500 deg. C/1 h + WQ + 190 deg. C/24 h) condition
Energy Technology Data Exchange (ETDEWEB)
Jiang, S.T.; Zhang, J.; Shun, S.Z. [School of Materials Science and Engineering, Tianjin University of Technology, Tianjin (China); Chen, M.F., E-mail: mfchentj@126.com [School of Materials Science and Engineering, Tianjin University of Technology, Tianjin (China); Tianjin Key Laboratory of Display Materials and Photoelectric Device, Tianjin University of Technology , Tianjin (China)
2016-12-01
Highlights: • Use a two-step chemical treatment method for formation of FHA coating on biodegradable Mg-Zn-Zr alloy;. • We reported the formation mechanism of FHA coating on Mg-Zn-Zr alloy and achieved optimum properties;. • The MgF{sub 2} coating and FHA coating provide effective protection for the Mg alloy substrate and the FHA coating showed better corrosion resistance. - Abstract: To improve the corrosion resistance of the biomedical magnesium alloy, a two-step chemical treatment method has been employed to prepare an FHA coating on the alloy surface. Prior to forming an FHA layer, the samples of Mg-3 wt% Zn-0.5 wt% Zr alloy were soaked in HF with concentration of 20% (v/v) at 37 °C temperature for 2 h, and were then placed into an aqueous solution with 0.1 mol/L Ca(NO{sub 3}).4H{sub 2}O and 0.06 mol/L NH{sub 4}H{sub 2}PO{sub 4} at 90 °C to prepare the Ca-P coating. The concentrations of Mg{sup 2+}, F{sup −} ions, and pH variation with immersing time in the solution were investigated to explore the growth mechanism of FHA. The surface morphologies and compositions of the coatings were characterized by X-ray diffraction, scanning electron microscopy, and energy dispersive spectroscopy. The results showed that the alloy surface treated with acid formed a layer of MgF{sub 2} nanoparticles with a thickness of 0.7 μm. The corrosion resistance of coatings in SBF solution was evaluated by electrochemical impedance spectroscopy (EIS) and potentiodynamic polarization. The results showed that the substrate with FHA coating had good corrosion resistance. After immersing into the calcium phosphate solution, some small spherical particles were first formed on the surface; these then cover the surface completely after 20 min. Some clusters consisting of needle-like crystal were observed in the spherical particles covering the surface, and the Ca/P ratio of the needle-like crystal was 1.46, clearly growing along the c axis preferred orientation growth. After
Directory of Open Access Journals (Sweden)
Mengxian Zhang
2015-09-01
Full Text Available ZrC-ZrB2-based composites were prepared by combustion synthesis (CS reaction from 10 wt.% to 50 wt.% Co-Zr-B4C powder mixtures. With increasing Co contents, the particle sizes of near-spherical ZrC and platelet-like ZrB2 decreased from 1 μm to 0.5 μm and from 5 μm to 2 μm, respectively. In addition, the formation mechanism of ZrC and ZrB2 was explored by the phase transition and microstructure evolution on the combustion wave quenched sample in combination with differential scanning calorimeter analysis. The results showed that the production of ZrC was ascribed to the solid-solid reaction between Zr and C and the precipitation from the Co-Zr-B-C melt, while ZrB2 was prepared from the saturated liquid. The low B concentration in the Co-Zr-B-C liquid and high cooling rate during the CS process led to the presence of Co2B and ZrCo3B2 in the composites. The addition of Co in the Co-Zr-B4C system not only prevented ZrC and ZrB2 particulates from growing, but also promoted the occurrence of ZrC-ZrB2-forming reaction.
Yang, Yan; Feng, Zhong-Ying; Zhang, Jian-Min
2018-05-01
The spin-polarized first-principles are used to study the surface thermodynamic stability, electronic and magnetic properties in various (001) surfaces of Zr2CoSn Heusler alloy, and the bulk Zr2CoSn Heusler alloy are also discussed to make comparison. The conduction band minimum (CBM) of half-metallic (HM) bulk Zr2CoSn alloy is contributed by ZrA, ZrB and Co atoms, while the valence band maximum (VBM) is contributed by ZrB and Co atoms. The SnSn termination is the most stable surface with the highest spin polarizations P = 77.1% among the CoCo, ZrCo, ZrZr, ZrSn and SnSn terminations of the Zr2CoSn (001) surface. In the SnSn termination of the Zr2CoSn (001) surface, the atomic partial density of states (APDOS) of atoms in the surface, subsurface and third layers are much influenced by the surface effect and the total magnetic moment (TMM) is mainly contributed by the atomic magnetic moments of atoms in fourth to ninth layers.
B2 intermetallic compounds of Zr. New class of the shape memory alloys
International Nuclear Information System (INIS)
Koval, Yu.N.; Delaey, L.; Jang, W.Y.
1995-01-01
It is known that the B2 equiatomic intermetallic compounds of Zr (ZrCo-based) undergo a martensitic transformation (MT) with wide temperature hysteresis. It was found that the MT is accompanied by the perfect shape memory effect (SME) for ZrCu and ZrRh. In this report we represent the results of structural analysis, electrical resistivity, calorimetric and SME measurements for ZrCu- and ZrCo-based compounds. Interrelation between structural, thermodynamical parameters of MT and SME in this alloys will be described. The shape memory aspects of this potential alloys for the application at high temperatures will be discussed. (orig.)
The effect of minor alloying elements on oxidation and hydrogen pickup in Zr-2.5Nb
International Nuclear Information System (INIS)
Ploc, R.A.
2002-01-01
In CANDU reactors, fuel and coolant are contained in horizontal pressure tubes made of Zr-2.5 wt% Nb alloy. In the past decade, the effect of more than 20 impurity elements, in various concentrations, on oxidation and deuterium pickup (at 300 o C, pD = 10.5, Li 2 O) have been investigated in over 70 Zr-2.5Nb alloys. The studies were performed using non-consumable arc-melted alloy logs that were rolled and made into corrosion coupons and corroded in autoclaves. This study represents one of the largest collections of previously unpublished data on the effect of impurity elements on oxide film growth and deuterium pickup in a zirconium alloy. Elements such as Al, Ti, Mn, and Pt, to name but a few, were found to significantly accelerate the corrosion process. Some elements, such as tin, had a positive effect on oxidation (lowers the rate of oxide film development) and a negative effect on hydrogen pickup (increases pickup). Three parameters were important to the corrosion process, namely, microstructure, surface finish, and synergistic interactions between the impurity elements. The above studies culminated in two response surface analyses (RSA). The first was conducted on the effect of C and Fe on oxygen and deuterium pickup in Zr-2.5Nb drop castings corroded at 325 o C in CANDU conditions. The second study was performed in autoclaves at 300 o C on the affect of four impurity elements, C, Fe, Cr, and Si, in Zr-2.5Nb micro-tubes, which possess the same microstructure as full-size pressure tubes. The first RSA revealed a quadratic dependence of corrosion on C and Fe concentrations, with an optimum resistance at about 30 ppm (wt) C and 1100 ppm (wt) Fe. This has been partially confirmed by out-reactor corrosion of Zr-2.5Nb-Fe micro-pressure tubes. Trends in- and out-reactor were similar for oxidation but different in magnitude for deuterium pickup. There is no linear dependence on the Fe concentration in-reactor, implying that Fe and C form a complex. The second RSA
The effect of minor alloying elements on oxidation and hydrogen pickup in Zr-2.5Nb
International Nuclear Information System (INIS)
Ploc, R.A.
2002-01-01
In CANDU reactors, fuel and coolant are contained in horizontal pressure tubes made of Zr-2.5 wt% Nb alloy. In the past decade, the effect of more than 20 impurity elements, in various concentrations, on oxidation and deuterium pickup (at 300 deg C, pD = 10.5, Li 2 O) have been investigated in over 70 Zr-2.5Nb alloys. The studies were performed using non-consumable arc-melted alloy logs that were rolled and made into corrosion coupons and corroded in autoclaves. This study represents one of the largest collections of previously unpublished data on the effect of impurity elements on oxide film growth and deuterium pickup in a zirconium alloy. Elements such as Al, Ti, Mn, and Pt, to name but a few, were found to significantly accelerate the corrosion process. Some elements, such as tin, had a positive effect on oxidation (lowers the rate of oxide film development) and a negative effect on hydrogen pickup (increases pickup). Three parameters were important to the corrosion process, namely, microstructure, surface finish, and synergistic interactions between the impurity elements. The above studies culminated in two response surface analyses (RSA). The first was conducted on the effect of C and Fe on oxygen and deuterium pickup in Zr-2.5Nb drop castings corroded at 325 deg C in CANDU conditions. The second study was performed in autoclaves at 300 deg C on the affect of four impurity elements, C, Fe, Cr, and Si, in Zr-2.5Nb micro-tubes, which possess the same microstructure as full-size pressure tubes. The first RSA revealed a quadratic dependence of corrosion on C and Fe concentrations, with an optimum resistance at about 30 ppm (wt) C and 1100 ppm (wt) Fe. This has been partially confirmed by out-reactor corrosion of Zr-2.5Nb-Fe micro-pressure tubes. Trends in- and out-reactor were similar for oxidation but different in magnitude for deuterium pickup. There is no linear dependence on the Fe concentration in-reactor, implying that Fe and C form a complex. The second
Cermet Ni-ZrO2 by mechanical alloying
International Nuclear Information System (INIS)
Leite, Douglas Will
2010-01-01
The ZrO 2 and metallic Ni Cermet obtained by Mechanical Alloying - MA is studied in the present work with the objective to prepare solid oxide fuel cells anodes (SOFC). Metallic Ni is added under three different concentrations: 30, 40 and 50% volume. The millings were conducted in SPEX vibratory mill where the influence of milling time, process control additives efficiency, type and geometry of milling vessels were studied. The study of the influence of these variables was made under particle size analysis, surface area determination and resulting material morphology. The use of teflon vessel causes contamination by carbon. On the other side, steel vessel increases the contamination by metallic impurities. The several geometries projected and analyzed for the vessels showed that vessels with larger bottom radius (R.15) showed the best results. After conformation and sintering at 1300 degree C in argon atmosphere the samples reached densities between 60 and 80% of the theoretical density. Microstructures observed by scanning electron microscopy reveal good homogeneity in the Cermet phases distribution. The mechanical alloying technique was considered a good option to obtain Ni- ZrO 2 Cermet. (author)
Superconducting properties of the hexagonal-close-packed alloy system TcZr
International Nuclear Information System (INIS)
Chatterjee, P.
1984-01-01
The theoretical formula of McMillan, modified via the multiple-scattering theory of Gomersall and Gyorffy, is very successful in computing the electron-phonon coupling constant (lambda) and the superconducting transition temperature (T/sub c/) of elements and compounds from quantities readily obtainable from band structure work or approaches based on the scattering theory. However, for disordered solids this theory fails because of the breakdown of the translational symmetry used in the multiple scattering theory. In the particular case of substitutional alloys, the problem can still be solved however if, at each lattice point, the t-matrix of an individual scatterer is replaced by a configurational average of the t-matrices of the alloying materials (average t-matrix approximation). This modified theory, which has already been successfully applied to some cubic substitutional alloys, is herein used to predict lambda and T/sub c/ for the h.c.p. TcZr alloy system. The results indicate that this system has good superconducting properties. (author)
International Nuclear Information System (INIS)
Saikawa, Seiji; Nakai, Kiyoshi; Sugiura, Yasuo; Kamio, Akihiko.
1995-01-01
Mechanical properties and microstructures of various Al-Li-Mg alloy castings containing small amount of Zr and/or Ti were investigated. The δ(AlLi) phase was observed to crystallize in the dendrite-cell gaps as well as on the grain boundaries. Microsegregation of Mg also occurred in the solidified castings. The β(Al 3 Zr) or Al-Zr-Ti compounds crystallize during solidification and remain even after solid solution treatment at 803 K for 36 ks. The grain sizes of Al-2.5%Li-2%Mg alloy castings become finer by the addition of 0.15%Zr and 0.12%Ti compared with each addition of 0.15%Zr or 0.12%Ti. The age hardening is accelerated by the addition of 0.15%Zr. In an Al-2.5%Li-2%Mg-0.15%Zr-0.12%Ti alloy casting poured into a metallic mold and aged at 453 K for 36 ks, ultimate tensile strength, Young's modulus and density were 417 MPa, 80 GPa and was 2.52 g/cm 3 , respectively. Its specific strength and modulus are higher by 50.3 and 13.9% than those of the conventional AC4C-T6 casting. (author)
von Rohr, Fabian O.; Cava, Robert J.
2018-03-01
High-entropy alloys (HEAs) are a new class of materials constructed from multiple principal elements statistically arranged on simple crystallographic lattices. Due to the large amount of disorder present, they are excellent model systems for investigating the properties of materials intermediate between crystalline and amorphous states. Here we report the effects of systematic isoelectronic replacements, using Mo-Y, Mo-Sc, and Cr-Sc mixtures, for the valence electron count 4 and 5 elements in the body-centered cubic (BCC) Ta-Nb-Zr-Hf-Ti high-entropy alloy (HEA) superconductor. We find that the superconducting transition temperature Tc strongly depends on the elemental makeup of the alloy, and not exclusively its electron count. The replacement of niobium or tantalum by an isoelectronic mixture lowers the transition temperature by more than 60%, while the isoelectronic replacement of hafnium, zirconium, or titanium has a limited impact on Tc. We further explore the alloying of aluminium into the nearly optimal electron count [TaNb] 0.67(ZrHfTi) 0.33 HEA superconductor. The electron count dependence of the superconducting Tc for (HEA)Al x is found to be more crystallinelike than for the [TaNb] 1 -x(ZrHfTi) x HEA solid solution. For an aluminum content of x =0.4 the high-entropy stabilization of the simple BCC lattice breaks down. This material crystallizes in the tetragonal β -uranium structure type and superconductivity is not observed above 1.8 K.
Strain and strain-rate hardening characteristics of a superplastic Al-Li-Cu-Zr alloy
International Nuclear Information System (INIS)
Ash, B.A.; Hamilton, C.H.
1988-01-01
A number of alloys based on the composition of Al-Li-Zr have been shown to be superplastic under at least one of two different microstructural conditions: 1. fully recrystallized to a fine, stable grain size, and 2. warm- or cold-worked and unrecrystallized prior to superplastic deformation. For the latter case, static recrystallization was impaired by the presence of fine Al 3 Zr particles, and dynamic recrystallization was observed to occur during superplastic deformation in which the heavily worked microstructure evolved into a fine grained fully recrystallized microstructure. This process is observed in other Al alloys as well, such as the Al-Cu-Zr alloys (Supral alloys), Al-Zn-Mg-Zr alloys, Al-Mn-Zr alloys, and Al-Mg-Mn alloys where the dynamic recrystallization has been suggested to be a continuous reaction in which recrystallization occurs by a gradual and homogeneous process during deformation rather than by the more common nucleation and growth process. Experimental observations of continuous recrystallization show development of a subgrain structure which coarsens continuously while deformation proceeds, with a concurrent increase in the misorientation angle between adjacent subgrains which ultimately approaches that of a high-angle boundary, characteristic of a fully- recrystallized microstructure. During the first 50 to 300% deformation, the microstructure evolves from the heavily worked to a fully recrystallized microstructure after which the fully recrystallized microstructure apparently exhibits the typical micro-grain superplastic characteristics. Superplasticity under continuous dynamic recrystallization is of interest both from scientific and technological standpoints since the rates at which superplastic deformation can be obtained are often higher than those for the fully recrystallized microstructures
Ultra-thin zirconia films on Zr-alloys
Energy Technology Data Exchange (ETDEWEB)
Choi, Joong Il Jake; Mayr-Schmoelzer, Wernfried; Mittendorfer, Florian; Redinger, Josef; Diebold, Ulrike; Schmid, Michael [Institute of Applied Physics, Vienna University of Technology (Austria); Li, Hao; Rupprechter, Guenther [Institute of Materials Chemistry, Vienna University of Technology (Austria)
2014-07-01
Zirconia ultra-thin films have been prepared by oxidation of Pt{sub 3}Zr(0001) and showed a structure equivalent to (111) of cubic zirconia. Following previous work, we have prepared ultra-thin zirconia by oxidation of a different alloy, Pd{sub 3}Zr(0001), which resulted in a similar structure with a slightly different lattice parameter, 351.2 ±0.4 pm. Unlike the oxide on Pt{sub 3}Zr, where Zr of the oxide binds to Pt in the substrate, here the oxide binds to substrate Zr via oxygen. This causes stronger distortion of the oxide structure, i.e. a stronger buckling of Zr in the oxide. After additional oxidation of ZrO{sub 2}/Pt{sub 3}Zr, a different ultra-thin zirconia phase is observed. A preliminary structure model for this film is based on (113)-oriented cubic zirconia. 3D oxide clusters are also present after growing ultra-thin zirconia films. They occur at the step edges, and the density is higher on Pd{sub 3}Zr. These clusters also appear on terraces after additional oxidation. XPS reveals different core level shifts of the oxide films, bulk, and oxide clusters.
High strain rate superplasticity in an Al–Mg–Sc–Zr alloy processed via simple rolling
Energy Technology Data Exchange (ETDEWEB)
Li, Mengjia [School of Materials Science and Engineering, Central South University, Changsha 410083 (China); Pan, Qinglin, E-mail: csupql@163.com [Nonferrous Metal Oriented Advanced Structural Materials and Manufacturing Cooperative Innovation Center, Central South University, Changsha 410083 (China); Shi, Yunjia; Sun, Xue; Xiang, Hao [School of Materials Science and Engineering, Central South University, Changsha 410083 (China)
2017-02-27
The superplastic behavior of Al–Mg–Sc–Zr samples with standard gauge size (18 mm by 6 mm) were prepared using simple rolling and were tested in the temperature range from 450 °C to 525 °C at strain rates ranging from 1.67×10{sup –3} s{sup −1} to 1×10{sup –1} s{sup −1}. With proper deformation parameters, the Al–Mg–Sc–Zr alloy has an elongation to failure much higher than 300% and the maximum elongation is 740%. The Microstructure and dislocation substructure investigation using optical microscopy (OM) and transmission electron microscopy (TEM) revealed a dynamic recrystallization in it. The grain size and activation energy on the deformation mechanisms of superplastic is discussed. Results also show that these nano-scale Al{sub 3}(Sc{sub 1−x}Zr{sub x}) particles play an important role in the superplastic process. Al{sub 6}FeMn particles were found to induce the formation and growth of cavities, which can lead to the fracture of specimens.
Decomposition of the γ phase in as-cast and quenched U–Zr alloys
Energy Technology Data Exchange (ETDEWEB)
Irukuvarghula, S., E-mail: sandeep.irukuvarghula@manchester.ac.uk [Department of Nuclear Engineering, Texas A& M University, College Station (United States); School of Materials, University of Manchester (United Kingdom); Ahn, Sangjoon [Department of Nuclear Engineering, Texas A& M University, College Station (United States); Department of Mechanical and Nuclear Engineering, UNIST (Korea, Republic of); McDeavitt, S.M. [Department of Nuclear Engineering, Texas A& M University, College Station (United States)
2016-05-15
An investigation of the decomposition of the high temperature γ phase in as-cast and quenched U–Zr alloys was conducted. Differential scanning calorimetry data clearly showed δ⇌γ transformations in alloys with <10 wt% Zr while XRD data did not contain any peaks which uniquely identify it's presence. Since δ phase forms via ω transformation, a comparison of the theoretical diffraction patterns for ω and δ revealed that the intensities of the peaks which uniquely identify the existence of δ when α-U is present, were either very weak, or were zero in ω, suggesting that the ambiguity can be explained if the phase present in these alloys is ω as opposed to δ. Our data are consistent with the presence of δ and ω in as-cast and quenched U–50Zr alloy, respectively, and (α + ω) in rest of the as-cast and quenched alloys. Based on the experimental data, the transformation sequence from γ phase in U–Zr alloys is proposed.
Study of microstructure evolution and strengthening mechanisms in novel TiZrAlB alloy
Energy Technology Data Exchange (ETDEWEB)
Liu, S.G.; Feng, Z.H.; Xia, C.Q.; Zhang, Z.G.; Zhang, X.; Zhang, X.Y., E-mail: xyzhang@ysu.edu.cn; Ma, M.Z.; Liu, R.P., E-mail: riping@ysu.edu.cn
2017-04-24
In this paper, the microstructural evolution and mechanical properties of the as-cast Ti-χZr-4Al-0.005B (TχZAB and χ=0, 10, 20, 30, 40 wt%) alloys were systematically investigated. Only the α phase was detected from the X-ray diffraction patterns of the as-cast TχZAB quaternary alloy series. As the Zr content increased, the average size and length-diameter ratio of the α grains were decreased from 69.8 μm to 17.1 µm and 37.5 to 8.4, respectively. The analysis of the results from the tensile and microhardness tests demonstrated that both the strength and hardness increased significantly as the Zr content increased (from 0 wt% to 40 wt%). Nevertheless, the ductility exhibited an opposite trend. The fracture mode of the ductile-brittle transfer was consistent with the ductility alteration. The as-cast Ti-40Zr-4Al-0.005B alloys demonstrated the highest tensile strength (σ{sub b}=1134 MPa), which increased by 53% compared to the Ti-4Al-0.005B alloys, whereas the lowest elongation-to-failure was of 6.77%. The mechanical properties of the TχZAB alloy series were discussed based on the microstructural evolution and the solid solution strengthening mechanisms.
Influence of aging at 180C on the corrosion behaviour of a ternary Al-Li-Zr alloy
DEFF Research Database (Denmark)
Ambat, Rajan; Prasad, R.K.; Dwarakadasa, E.S.
1994-01-01
decreased for samples aged up to 6 h at 180 °C whereas Icorr increased for samples aged for longer times. Values of OCP and pitting potential initially shifted in the noble direction and then towards more active values. This change in OCP was observed on samples that had been aged for 20 h while in the case...... of pitting potential an aging time of only 6 h was required. The overall change in passive current density was small, although at longer aging times (> 40h) it showed an increase. As the amount of lithium depletion increased, OCP and pitting potential shifted in the active direction while passive current......The influence of aging at 180 °C on the corrosion behaviour of an Al-1.5%Li-0.1%Zr alloy has been studied using weight loss, open circuit potential (OCP) measurements and potentiodynamic polarization measurements in 3.5% NaCl solution. Corrosion rates obtained from weight loss and Icorr values...
Energy Technology Data Exchange (ETDEWEB)
Zhang, Xiaobo, E-mail: xbxbzhang2003@163.com [School of Materials Science and Engineering, Nanjing Institute of Technology, Nanjing, 211167 (China); Wang, Zhangzhong [School of Materials Science and Engineering, Nanjing Institute of Technology, Nanjing, 211167 (China); Yuan, Guangyin [National Engineering Research Center of Light Alloy Net Forming, Shanghai Jiao Tong University, Shanghai, 200240 (China); Xue, Yajun [School of Materials Science and Engineering, Nanjing Institute of Technology, Nanjing, 211167 (China)
2012-08-01
Highlights: Black-Right-Pointing-Pointer Microstructure of Mg-Nd-Zn-Zr alloys was refined and homogenized by double extrusion process. Black-Right-Pointing-Pointer The mechanical properties of the alloys were significantly enhanced by double extrusion. Black-Right-Pointing-Pointer The biocorrosion resistance of the alloys was improved by double extrusion. - Abstract: Mg-Nd-Zn-Zr alloy is a novel and promising biodegradable magnesium alloy due to good biocompatibility, desired uniform corrosion mode and outstanding corrosion resistance in simulated body fluid (SBF). However, the corrosion resistance and mechanical properties should be improved to meet the requirement of the biodegradable implants, such as plates, screws and cardiovascular stents. In the present study, double extrusion process was adopted to refine microstructure and improve mechanical properties of Mg-2.25Nd-0.11Zn-0.43Zr and Mg-2.70Nd-0.20Zn-0.41Zr alloys. The corrosion resistance of the alloys after double extrusion was also studied. The results show that the microstructure of the alloys under double extrusion becomes much finer and more homogeneous than those under once extrusion. The yield strength, ultimate tensile strength and elongation of the alloys under double extrusion are over 270 MPa, 300 MPa and 32%, respectively, indicating that outstanding mechanical properties of Mg-Nd-Zn-Zr alloy can be obtained by double extrusion. The results of immersion experiment and electrochemical measurements in SBF show that the corrosion resistance of Alloy 1 and Alloy 2 under double extrusion was increased by 7% and 8% respectively compared with those under just once extrusion.
International Nuclear Information System (INIS)
Zhang, Xiaobo; Wang, Zhangzhong; Yuan, Guangyin; Xue, Yajun
2012-01-01
Highlights: ► Microstructure of Mg–Nd–Zn–Zr alloys was refined and homogenized by double extrusion process. ► The mechanical properties of the alloys were significantly enhanced by double extrusion. ► The biocorrosion resistance of the alloys was improved by double extrusion. - Abstract: Mg–Nd–Zn–Zr alloy is a novel and promising biodegradable magnesium alloy due to good biocompatibility, desired uniform corrosion mode and outstanding corrosion resistance in simulated body fluid (SBF). However, the corrosion resistance and mechanical properties should be improved to meet the requirement of the biodegradable implants, such as plates, screws and cardiovascular stents. In the present study, double extrusion process was adopted to refine microstructure and improve mechanical properties of Mg–2.25Nd–0.11Zn–0.43Zr and Mg–2.70Nd–0.20Zn–0.41Zr alloys. The corrosion resistance of the alloys after double extrusion was also studied. The results show that the microstructure of the alloys under double extrusion becomes much finer and more homogeneous than those under once extrusion. The yield strength, ultimate tensile strength and elongation of the alloys under double extrusion are over 270 MPa, 300 MPa and 32%, respectively, indicating that outstanding mechanical properties of Mg–Nd–Zn–Zr alloy can be obtained by double extrusion. The results of immersion experiment and electrochemical measurements in SBF show that the corrosion resistance of Alloy 1 and Alloy 2 under double extrusion was increased by 7% and 8% respectively compared with those under just once extrusion.
Kaiser, Md. Salim
2018-04-01
The effects of T6 solution treatment on tensile, impact and fracture properties of cast Al-12Si-1Mg-1Cu piston alloys with trace of zirconium were investigated. Cast alloys were given precipitation strengthening treatment having a sequence of homogenizing, solutionizing, quenching and ageing. Both cast and solutionized samples are isochronally aged for 90 min at different temperatures up to 300 °C. Tensile and impact properties of the differently processed alloys have been studied to understand the precipitation strengthening of the alloys. Fractograpy of the alloys were observed to understand the mode of fracture. It is observed that the improvement in tensile properties in the aged alloys through heat treatment is mainly attributed to the formation of the Al2Cu and Mg2Si precipitates within the Al matrix. Solution treatment improves the tensile strength for the reason that during solution treatment some alloying elements are re-dissolved to produce a solute-rich solid solution. Impact energy decreases with ageing temperature due to formation of GP zones, β' and β precipitates. The fractography shows large and small dimple structure and broken or cracked primary Si, particles. Microstructure study of alloys revealed that the solution treatment improved distribution of silicon grains. The addition of Zr produces an improvement in the tensile properties as a result of its grain refining action and grain coarsening resistance in the matrix at a higher temperature.
Design of high-temperature high-strength Al-Ti-V-Zr alloys
International Nuclear Information System (INIS)
Lee, H.M.
1990-01-01
This paper reports that it seems plausible to develop high-strength Al-base alloys useful up to 698K in view of the behavior of nickel base superalloys which resist degradation of mechanical properties to 75 pct of their absolute melting temperature. For high temperature Al alloys, the dispersed hardening phase must not undergo phase transformation to an undesirable phase during long time exposure at the temperature of interest. An additional factor to be considered is the stability of the hardening phase with respect to Ostwald ripening. This coarsening resistance is necessary so that the required strength level can be maintained after the long-time service at high temperatures. The equilibrium crystal structures of Al 3 Ti, Al 3 V and Al 3 Zr are tetragonal D0 22 , D0 22 and D0 23 , respectively. At the temperatures of interest, around 698K, vanadium and titanium are mutually substitutable in the form of Al 3 (Ti, V). Much of titanium and vanadium can be substituted for zirconium in the D0 23 - type Al 3 Zr compound, creating Al 3 (Ti, Zr) and Al 3 (V, Zr), respectively. In particular, it has been reported that fcc L1 2 -structured Al 3 M dispersoids form in the rapidly solidified Al-V-Zr and Al-Ti-Zr systems and both L1 2 and D0 23 -structured Al 3 M phases showed slow coarsening kinetics
Energy Technology Data Exchange (ETDEWEB)
Zhang, Fei; Yu, Zhiguo; Xiong, Chengyang [School of Materials Science and Engineering, Beihang University, Beijing 100191 (China); Key Laboratory of Aerospace Materials and Performance (Ministry of Education), Beihang University, Beijing 100191 (China); Qu, Wentao; Yuan, Bifei [School of Mechanical Engineering, Xi’an Shiyou University, Xi’an 710065 (China); Wang, Zhenguo [School of Materials Science and Engineering, Beihang University, Beijing 100191 (China); Key Laboratory of Aerospace Materials and Performance (Ministry of Education), Beihang University, Beijing 100191 (China); Li, Yan, E-mail: liyan@buaa.edu.cn [School of Materials Science and Engineering, Beihang University, Beijing 100191 (China); Key Laboratory of Aerospace Materials and Performance (Ministry of Education), Beihang University, Beijing 100191 (China)
2017-01-02
The microstructures, phase transformations, mechanical properties and shape memory effect of Ti-20Zr-10Nb-xAl (x=1, 2, 3, 4 at%) alloys were investigated. The X-ray diffraction results show that the alloys are composed of a single martensitic α″-phase and that the corresponding unit cell volume decreases with increasing Al content. The reverse martensitic transformation start temperature (A{sub s}) of the Ti-20Zr-10Nb-Al alloy is 534 K and decreases with increasing Al content. The addition of Al results in solid solution strengthening and grain refinement strengthening, thus improving the mechanical properties and the shape memory effect of the Ti-20Zr-10 Nb-xAl alloys. The Ti-20Zr-10Nb-3Al alloy shows the greatest shape memory strain (3.2%) and the largest tensile strain (17.6%) as well as a very high tensile strength (886 MPa).
Mechanical and electrochemical characterization of Ti-12Mo-5Zr alloy for biomedical application
International Nuclear Information System (INIS)
Zhao Changli; Zhang Xiaonong; Cao Peng
2011-01-01
Highlights: → A new β metastable titanium alloy with composition of Ti-12Mo-5Zr that comprised of non-toxic elements Mo and Zr has been developed. → The elastic modulus of the Ti-12Mo-5Zr alloy is as low as 64 GPa, which is much lower than those of pure Ti and Ti-6Al-4V alloy. → The Ti-12Mo-5Zr alloy has moderate strength and much higher microhardness as compared with Ti-6Al-4V, which showing better mechanical biocompatibility. → The corrosion resistance is much higher than that of Ti-6Al-4V in a simulated body fluid (Hank's solution). - Abstract: We have fabricated a new β metastable titanium alloy that comprised of non-toxic elements Mo and Zr. Ingot with composition of Ti-12Mo-5Zr is prepared by melting pure metals in a vacuum non-consumable arc melting furnace. The alloy is then homogenized and solution treated under different temperature. The alloy is characterized by optical microscopy, X-ray diffraction, tensile tests and found to have an acicular martensitic α'' + β structure and dominant β phase for the 1053 K and 1133 K solution treatment samples, respectively. The elastic modulus of the latter is about 64 GPa, which is much lower than those of pure Ti and Ti-6Al-4V alloy. In addition, it had moderate strength and much higher microhardness as compared with Ti-6Al-4V alloy. The results show better mechanical biocompatibility of this alloy, which will avoid stress shielding and thus prevent bone resorption in orthopedic implants applications. As long-term stability in biological environment is required, we have also evaluated the electrochemical behavior in a simulated body fluid (Hank's solution). Potentiodynamic polarization curves exhibits that the 1133 K solution treatment Ti-12Mo-5Zr sample has better corrosion properties than Ti-6Al-4V and is comparable to the pure titanium. The good corrosion resistance combined with better mechanical biocompatibility makes the Ti-12Mo-5Zr alloy suitable for use as orthopedic implants.
Crystallization of the amorphous Fe80Zr12B8 alloy under controlled heating
International Nuclear Information System (INIS)
Huang, H.; Shao, G.; Tsakiropoulos, P.
2008-01-01
The devitrification process of amorphous Fe 80 Zr 12 B 8 alloy ribbons were studied under controlled thermal conditions. The major crystallization event during continuous heating with differential scanning calorimetory (DSC) is dictated by diffusion controlled growth and the associated atom mobility of the slow diffusing species Zr. The existence of prior nano-crystals formed by pre-annealing below the crystallization temperature had little effect on the major crystallization temperature. The crystallization sequence during heating was: amorphous → amorphous + α-Fe + Fe 3 Zr(B) → amorphous + α-Fe + Fe 3 Zr(B) + Fe 2 Zr. Different from previous findings in alloys of lower Zr and B contents, the peak for the crystallization of the α-Fe phase alone is missing in the DSC traces of this alloy
Early Stages of Precipitation Process in Al-(Mn-)Sc-Zr Alloy Characterized by Positron Annihilation
Vlach, Martin; Cizek, Jakub; Melikhova, Oksana; Stulikova, Ivana; Smola, Bohumil; Kekule, Tomas; Kudrnova, Hana; Gemma, Ryota; Neubert, Volkmar
2015-01-01
Thermal effects on the precipitation stages in as-cast Al-0.70 at. pct Mn-0.15 at. pct Sc-0.05 at. pct Zr alloy were studied. The role of lattice defects was elucidated by positron annihilation spectroscopy (lifetime and coincidence Doppler broadening) enabling investigation of solutes clustering at the atomic scale. This technique has never been used in the Al-Sc- and/or Al-Zr-based alloys so far. Studies by positron annihilation were combined with resistometry, hardness measurements, and microstructure observations. Positrons trapped at defects are preferentially annihilated by Sc electrons. Lifetime of trapped positrons indicates that Sc atoms segregate at dislocations. Maximum fraction of positrons annihilated by Sc electrons occurring at 453 K (180 °C) suggests that clustering of Sc bound with vacancies takes place. It is followed by peak of this fraction at 573 K (300 °C). A rise of the contribution of trapped positrons annihilated by Zr electrons starting at 513 K (240 °C) and attaining maximum also at 573 K (300 °C) confirms that Zr participates in precipitation of the Al3Sc particles already at these temperatures. The pronounced hardening at 573 K (300 °C) has its nature in the precipitation of the Al3Sc particles with a Zr-rich shell. The contribution of trapped positrons annihilated by Mn electrons was found to be negligible. © 2015, The Minerals, Metals & Materials Society and ASM International.
Early Stages of Precipitation Process in Al-(Mn-)Sc-Zr Alloy Characterized by Positron Annihilation
Vlach, Martin
2015-01-29
Thermal effects on the precipitation stages in as-cast Al-0.70 at. pct Mn-0.15 at. pct Sc-0.05 at. pct Zr alloy were studied. The role of lattice defects was elucidated by positron annihilation spectroscopy (lifetime and coincidence Doppler broadening) enabling investigation of solutes clustering at the atomic scale. This technique has never been used in the Al-Sc- and/or Al-Zr-based alloys so far. Studies by positron annihilation were combined with resistometry, hardness measurements, and microstructure observations. Positrons trapped at defects are preferentially annihilated by Sc electrons. Lifetime of trapped positrons indicates that Sc atoms segregate at dislocations. Maximum fraction of positrons annihilated by Sc electrons occurring at 453 K (180 °C) suggests that clustering of Sc bound with vacancies takes place. It is followed by peak of this fraction at 573 K (300 °C). A rise of the contribution of trapped positrons annihilated by Zr electrons starting at 513 K (240 °C) and attaining maximum also at 573 K (300 °C) confirms that Zr participates in precipitation of the Al3Sc particles already at these temperatures. The pronounced hardening at 573 K (300 °C) has its nature in the precipitation of the Al3Sc particles with a Zr-rich shell. The contribution of trapped positrons annihilated by Mn electrons was found to be negligible. © 2015, The Minerals, Metals & Materials Society and ASM International.
Nanostructured Al–Zn–Mg–Cu–Zr alloy prepared by mechanical alloying followed by hot pressing
International Nuclear Information System (INIS)
Azimi, Amin; Shokuhfar, Ali; Zolriasatein, Ashkan
2014-01-01
Nanostructured Al–7.8 wt% Zn–2.6 wt% Mg–2 wt% Cu–0.1 wt% Zr alloy was mechanically alloyed (MA) from elemental powders and consolidated by hot press technique. The effect of the milling time and hot pressing process on microstructure was investigated by means of X-ray diffraction measurements (XRD) and analytical and scanning electron microscopy (SEM). Furthermore mechanical properties of samples with different MA time as well as pure aluminum were investigated by microhardness and compression tests. The results show that an Al–Zn–Mg–Cu–Zr homogenous supersaturated solid solution with a crystallite size of 27 nm was obtained after 40 h of milling time. Microstructure refinement and morphological changes of powders from flake to spherical shape were observed by increasing milling time. Phase and microstructural characterization of high density bulk nanostructured samples revealed that increasing milling time up to 40 h leads to formation of MgZn 2 precipitation in the alloy matrix. With increasing milling time, density of the samples and crystalline size decrease. Significant enhancement of hardness and compressive strength is observed in the aluminum alloy by increasing milling time up to 40 h which is much higher than pure aluminum. Crystallite size refinement in pure aluminum samples from micro- to nanoscales resulted in 107% and 100% improvement in compressive strength and hardness, respectively. Furthermore the compressive strength and hardness of Al–Zn–Mg–Cu–Zr alloy nanostructured samples increased to 179% and 172%, respectively, compared to nanostructured pure Al, which was produced as reference specimen. 40 h of MA was the optimum case for preparing such an Al alloy and more milling up to 50 h led to deterioration of mechanical properties
International Nuclear Information System (INIS)
Inoue, A.; Matsuzaki, K.; Toyota, N.; Chen, H.S.; Masumoto, T.; Fukase, T.
1985-01-01
The anneal-induced change in the superconducting properties together with the irrecoverable relaxation enthalpy (ΔHsub(i,exo)) and recoverable relaxation enthalpy (ΔHsub(r,endo)) of amorphous Zr 70 Cu 30 and Zr 70 Ni 30 alloys was examined. The increase in ΔHsub(i,exo) and the degradation of Tsub(c) progress logarithmically with annealing time tsub(a) in a temperature range of 373 to 523 K. The activation energy and the attempted frequency were respectively estimated to be 1.5 eV and 6.6 x 10 13 sec -1 for the increase in ΔHsub(i,exo) and 1.5 eV and 1.9 x 10 14 sec -1 for the degradation of Tsub(c). The recoverable structure relaxation exerts little effect on Tsub(c). Based on the agreement between the kinetic parameters for the changes of ΔHsub(i,exo) and Tsub(c), it appears that the degradation of Tsub(c) on annealing is associated with the irrecoverable structural relaxation as a result of the annihilation of frozen-in defects and the topological and compositional atomic rearrangement. The values of the attempted frequency being of the order of Debye frequency suggest that the irrecoverable structural relaxation processes occur more or less independently from each other. (author)
Technology of electron beam welding for Zr-4 alloy spacer grid
International Nuclear Information System (INIS)
Pei Qiusheng; Wu Xueyi; Yang Qishun
1989-10-01
The welding technology for Zr-4 alloy spacer grid by using vacuum electron beam was studied. Through a series of welding technological experiments, metallographic examinations of seam structure and detecting tests for welding defect by X-ray defectoscopy, a good welding technology was selected to meet the requirements. The experimental results indicated that the Zr-4 alloy spacer grid welded by vacuum electron beam welding is feasible
International Nuclear Information System (INIS)
Samuel, Sonia; Nag, Soumya; Scharf, Thomas W.; Banerjee, Rajarshi
2008-01-01
The inherently poor wear resistance of titanium alloys limits their application as femoral heads in femoral (hip) implants. Reinforcing the soft matrix of titanium alloys (including new generation β-Ti alloys) with hard ceramic precipitates such as borides offers the possibility of substantially enhancing the wear resistance of these composites. The present study discusses the microstructure and wear resistance of laser-deposited boride reinforced composites based on Ti-Nb-Zr-Ta alloys. These composites have been deposited using the LENS TM process from a blend of elemental Ti, Nb, Zr, Ta, and boron powders and consist of complex borides dispersed in a matrix of β-Ti. The wear resistance of these composites has been compared with that of Ti-6Al-4V ELI, the current material of choice for orthopedic femoral implants, against two types of counterfaces, hard Si 3 N 4 and softer SS440C stainless steel. Results suggest a substantial improvement in the wear resistance of the boride reinforced Ti-Nb-Zr-Ta alloys as compared with Ti-6Al-4V ELI against the softer counterface of SS440. The presence of an oxide layer on the surface of these alloys and composites also appears to have a substantial effect in terms of enhanced wear resistance
Evirgen, A.; Pons, J.; Karaman, I.; Santamarta, R.; Noebe, R. D.
2018-03-01
The distributions of H-phase precipitates in Ni50.3Ti29.7Hf20 and Ni50.3Ti29.7Zr20 alloys formed by aging treatments at 500 and 550 °C or slow furnace cooling and their effects on the thermal martensitic transformation have been investigated by TEM and calorimetry. The comparative study clearly reveals faster precipitate-coarsening kinetics in the NiTiZr alloy than in NiTiHf. For precipitates of a similar size of 10-20 nm in both alloys, the martensite plates in Ni50.3Ti29.7Zr20 have larger widths and span a higher number of precipitates compared with the Ni50.3Ti29.7Hf20 alloy. However, for large H-phase particles with hundreds of nm in length, no significant differences in the martensitic microstructures of both alloy systems have been observed. The martensitic transformation temperatures of Ni50.3Ti29.7Hf20 are 80-90 °C higher than those of Ni50.3Ti29.7Zr20 in the precipitate-free state and in the presence of large particles of hundreds on nm in length, but this difference is reduced to only 10-20 °C in samples with small H-phase precipitates. The changes in the transformation temperatures are consistent with the differences in the precipitate distributions between the two alloy systems observed by TEM.
International Nuclear Information System (INIS)
Warren, J.; Reznikov, G.
2001-01-01
The microstructure and elevated temperature quasi-static tensile yield and ultimate strength observed in a novel, forged Mo-based alloy (Mo-0.25 Hf-0.25 Zr-0.25 Ta-0.025 C) has been analyzed and compared to a standard forged TZM composition (Mo-0.50 Ti-0.08 Zr-0.02 C). The novel material exhibits the desirable forging characteristics typical of the widely used TZM composition yet possess a higher ultimate strength and 0.2 % offset yield strength in both the stress-relieved and recrystallized conditions over a 400 o -1200 o C temperature range. The greater strength measured in the novel composition has been attributed to the combined effects of precipitation of Hf, Zr and Mo-(carbide) precipitates that strengthen the matrix in the classical Orowan fashion and improved resistance to recrystallization after high temperature exposure. Elevated temperature creep behavior, not addressed in the study presented here, will be reported on in a subsequent analysis. (author)
Microstructure and magnetic properties of alnico permanent magnetic alloys with Zr-B additives
Rehman, Sajjad Ur; Jiang, Qingzheng; Ge, Qing; Lei, Weikai; Zhang, Lili; Zeng, Qingwen; ul Haq, A.; Liu, Renhui; Zhong, Zhenchen
2018-04-01
Alnico alloys are prepared with nominal composition of 31.4-xFe-7.0Al-36.0Co-4.0Cu-1.0Nb-14.0Ni-6.0Ti-0.6Zr-xB (x = 0.02, 0.04, 0.06, 0.08, in wt%) by arc melting and casting techniques and subsequent heat treatment. The alloys are characterized by X-ray diffraction method, optical microscope, scanning electron microscope and pulse field magnetometer by plotting magnetic hysteresis demagnetization curve. The results of HRSEM show at least two new phases at α-grain boundaries and triple junctions. These phases, when retained at low concentration, help in enhancing magnetic properties of alnico alloys by purifying spinodal phases and reducing the adverse effects of impurity elements. Two different heat treatment cycles are employed. In the first phase, the alloys are processed by using heat treatment cycles without magnetic field; and Hc of 1.35 kOe, Br of 4.87 kGs and (BH)max of 1.96 MGOe are obtained by furnace cooling below TC and subsequent tempering at 680 °C and 550 °C. In the second phase, the alloy with best magnetic properties is treated thermo-magnetically; and Hc of 1.68 kOe, Br of 7.1 kG and (BH)max of 4.45 MGOe are obtained.
Microstructure control of Zr-Nb-Sn alloy with Mo addition for HWR pressure tube application
International Nuclear Information System (INIS)
Hwang, S. K.; Kim, M. H.; Kim, J. H.; Kwon, S. I.; Kim, Y. S.
1997-01-01
As a basic research to develop the material for heavy water reactor pressure tube application the effect of Mo addition to Zr-Nb-Sn alloy was studied for the purpose of minimizing the amount of cold working while maintaining a high strength. To select the target alloy system we first designed various alloy compositions and chose Zr-Nb-Sn and Zr-Nb-Mo through multi-regression analysis of the relationship between the basic properties and the compositions. Plasma arc melting was used to produce the alloys and the microstructure change introduced by the processing steps including hot forging, beta-heat treatment, hot rolling, cold rolling and recrystallization heat treatment was investigated. Recrystallization of Zr-Nb-Sn was retarded by adding Mo and this resulted in a fine grain structure in Zr-Nb-Sn-Mo alloy. Beside the retarding effect recrystallization, Mo increased the amount of residual beta phase and showed an indication of precipitation hardening, which added up to the possibility of applying the alloy for the desired usage. (author)
Analysis of precipitation in a Cu-Cr-Zr alloy
Institute of Scientific and Technical Information of China (English)
Zhao Mei; Lin Guobiao; Wang Zidong; Zhang Maokui
2008-01-01
Precipites in Cu-0.42%Cr-0.21%Zr alloy were analyzed by using scanning electron microscope (SEM), energy dispersive X-ray spectroscopy (EDXS) and transmission electron microscope (TEM). After the solid solution was performed at 980℃ for 2 h, water-quenched and aged at 450℃ for 20 h, the precipite had a bimodal distribution of precipitate size. The coarse precipitates are pure Cr and Cu5Zr, the dispersed fine precipitate is CrCu2(Zr, Mg) and pure Cr ranging from 1 to 50 nm. The coarse phases formed during solidification and were left undissolved during solid solution. The fine precipitates are the hardening precipitates that form due to decomposition of the supersaturated solid solution during aging.
Yang, S. J.; Hu, L.; Wang, L.; Wei, B.
2018-06-01
The liquid structures of undercooled Zr90Nb10, Zr70Nb30 and Zr50Nb50 alloys were studied by molecular dynamics simulation combined with electrostatic levitation experiments. The densities of three alloys were measured by electrostatic levitation to modify the Zr-Nb potential functions by adjusting parameters in potential functions. In simulation, the atomic packing in Zr-Nb alloys was more ordered at lower temperatures. The Voronoi tessellation analyses indicated Nb-centered clusters were easier to form than Zr-centered clusters although the Nb content was less than 50%. The partial pair distribution functions showed that the interactions among Zr atoms are quite different to that among Nb atoms.
International Nuclear Information System (INIS)
Shi, Yunjia; Pan, Qinglin; Li, Mengjia; Huang, Xing; Li, Bo
2015-01-01
Stress corrosion cracking (SCC) behavior of Al–Zn–Mg–Cu alloys with different Sc, Zr contents and heat treatments was studied using slow strain rate test. Grain boundary microstructures were identified by transmission electron microscopy (TEM) and statistical analysis. It was found that the SCC resistance of alloys is improved by increasing Sc, Zr contents and aging degree. Grain boundary precipitates (GBPs) area fraction was found to be an important parameter to evaluate the SCC susceptibility. The results reveal that for Al–Zn–Mg–Cu–0.25Sc–0.10Zr (wt%) alloy with different aging degrees, hydrogen induced cracking dominates the SCC when the area fraction of GBPs is relatively low. For peak-aged Al–Zn–Mg–Cu alloy and Al–Zn–Mg–Cu–0.10Sc–0.10Zr (wt%) alloy, anodic dissolution dominates the SCC when the area fraction of GBPs is sufficiently high
International Nuclear Information System (INIS)
Kermajani, M.; Raygan, Sh.; Hanayi, K.; Ghaffari, H.
2013-01-01
Highlights: • Effect of ESR process on microstructure of Cu–Cr–Zr alloy was investigated. • The hardness, strength and electrical conductivity are sensitive to thermomechanical treatment. • The microstructure of the alloy can be optimized for obtaining the best combination of mechanical and electrical properties. - Abstract: Effect of thermomechanical treatment (TMT) on aging behavior of electroslag remelted Cu–Cr–Zr alloy was investigated. The relationship between microstructure, mechanical and electrical properties was clarified using hardness, tensile and electrical conductivity testing methods and optical and scanning electron microscopy techniques. The results showed that an appropriate processing and aging treatment may improve the properties of the alloy due to the formation of fine, dispersive and coherent precipitates within the matrix. Indeed, the optimum condition for electrical conductivity and mechanical properties was obtained after cold working of 40% followed by aging at 500 °C for 150 min
The development of octagon Zr-4 alloy tube for heating reactors
International Nuclear Information System (INIS)
Yang Fanglin; Yang Yingli; Wang Guangshen
1989-10-01
The asymmetrical octagon Zr-4 alloy tubes which are used for fuel assembly in the heating reactor have been developed. The thickness of tube wall is 1.5 mm and the length is 1725 mm. The long side of the octagon is 138.7 0.3 +0.2 mm, the short side is 93.1 ± 0.1 mm. To manufacture these tubes a stretch draw forming processing method is adopted. The process is divided into two phases. In the first phase, a short draw mould is used to stretch the Zr-4 alloy tube. In the second phase, a long draw mould, its length is equal to the end-produt length, is used to complete the final processing. The size accuracy and repeatability of this method are excellent and can fully meet the design requirements
Strong composition-dependence on glass-forming ability in Ni-(Ti,Zr)-Si pseudo-ternary alloys
International Nuclear Information System (INIS)
Yang, H.; Wang, J.Q.; Li, Y.
2006-01-01
The glass formation in Ni-(Ti,Zr)-Si pseudo-ternary alloys was studied. For suction casting, by carefully adjusting the alloy composition and studying the microstructure changes, the best glass-forming alloy with a 2 mm diameter is pinpointed in a narrow composition region of 57.5-58.5 at.% Ni, 36.5-38.5 at.% (Ti + Zr) and 5-5.5 at.% Si. The main competing crystalline phases, identified by XRD and SEM, were Ni 10 (Zr,Ti) 7 , Ni(Ti,Zr) and an unidentified Si-containing phase. Our results indicate a clear need for monitoring the microstructure change in the cross section of the ingots to locate the best glass-forming alloys
Final report on in-reactor creep-fatigue deformation behaviour of a CuCrZr alloy: COFAT 1
DEFF Research Database (Denmark)
Singh, Bachu Narain; Tähtinen, S.; Moilanen, P.
CrZr(HT1) alloy exposed concurrently to flux of neutrons and creep-fatigue cyclic loading directly in a fission reactor. Special experimental facilities were designed and fabricated for this purpose. A number of in-reactor creep-fatigue experiments were successfully carried out in the BR-2 reactor at Mol...
Evaluation of corrosion resistance of implant-use Ti-Zr binary alloys with a range of compositions.
Akimoto, Teisuke; Ueno, Takeshi; Tsutsumi, Yusuke; Doi, Hisashi; Hanawa, Takao; Wakabayashi, Noriyuki
2018-01-01
Although titanium-zirconium (Ti-Zr) alloy has been adopted for clinical applications, the ideal proportion of Zr in the alloy has not been identified. In this study, we investigated the biocompatibility of Ti-Zr alloy by evaluating its corrosion resistance to better understand whether there is an optimal range or value of Zr proportion in the alloy. We prepared pure Ti, Ti-30Zr, Ti-50Zr, Ti-70Zr, and pure Zr (mol% of Zr) samples and subjected them to anodic polarization and immersion tests in a lactic acid + sodium chloride (NaCl) solution and artificial saliva. We observed pitting corrosion in the Ti-70Zr and Zr after exposure to both solutions. After the immersion test, we found that pure Ti exhibited the greatest degree of dissolution in the lactic acid + NaCl solution, with the addition of Zr dramatically reducing Ti ion dissolution, with the reduction ultimately exceeding 90% in the case of the Ti-30Zr. Hence, although the localized corrosion resistance under severe conditions was compromised when the Zr content was more than 70%, metal ion release reduced owing to Zr addition and the corresponding formation of a stable passive layer. The results suggest that Ti-30Zr or a Zr proportion of less than 50% would offer an ideal level of corrosion resistance for clinical applications. © 2016 Wiley Periodicals, Inc. J Biomed Mater Res Part B: Appl Biomater, 106B: 73-79, 2018. © 2016 Wiley Periodicals, Inc.
Superconducting properties of Zr1+xNi2-xGa and Zr1-xNi2+xGa Heusler compounds
Directory of Open Access Journals (Sweden)
Saad Alzahrani
2017-05-01
Full Text Available The superconducting properties of a series of Zr1+xNi2-xGa and Zr1-xNi2+xGa compounds have been investigated by x-ray diffraction, electrical resistivity, dc magnetization, and ac susceptibility measurements. While the parent compound, ZrNi2Ga, exhibited the cubic L21 Heusler structure, multiple non-cubic structures formed in the Zr and Ni rich doped materials. For x ≤ 0.3, all Zr1-xNi2+xGa compounds demonstrated superconducting behavior, but no superconductivity was observed in the Zr1+xNi2-xGa alloys for x > 0.2. The magnetization data revealed that all materials in both Zr1+xNi2-xGa and Zr1-xNi2+xGa series exhibited type-II superconductivity. With increasing doping concentration x, the paramagnetic ordering were enhanced in both systems while the superconducting properties were found to weaken. The observations are discussed considering the structural disorders in the systems.
Phase transformations in the rapidly solidified Ti{sub 40}Zr{sub 20}Hf{sub 20}Pd{sub 20} alloy
Energy Technology Data Exchange (ETDEWEB)
Chen, N. [Division of Engineering Materials, Department of Mechanical Engineering, Tsinghua University, Beijing 100084 (China); Yao Kefu [Division of Engineering Materials, Department of Mechanical Engineering, Tsinghua University, Beijing 100084 (China)], E-mail: kfyao@tsinghua.edu.cn; Louzguine-Luzgin, D.V. [Institute for Materials Research, Tohoku University, Katahira 2-1-1, Aoba-Ku, Sendai 980-8577 (Japan); Qiu Shengbao [Division of Engineering Materials, Department of Mechanical Engineering, Tsinghua University, Beijing 100084 (China); Ranganathan, S. [Department of Metallurgy, Indian Institute of Science, Bangalore 560 012 (India); Inoue, A. [Institute for Materials Research, Tohoku University, Katahira 2-1-1, Aoba-Ku, Sendai 980-8577 (Japan)
2007-10-15
We report that an approximant phase was initially obtained in amorphous Ti{sub 40}Zr{sub 20}Hf{sub 20}Pd{sub 20} alloy. In the initial stage of the devitrification process, the approximant phase transforms into an icosahedral (I) phase with a high thermal stability while the cF96 Zr{sub 2}Ni-type (space group Fd3-bar m with a=1.25nm and 96 atoms cell{sup -1}) particles precipitate from the amorphous matrix. Eventually the I phase grows to several hundred nanometers when annealed at about 1000K and then transforms into the Zr{sub 2}Ni-type phase with an endothermic reaction.
Synthetic of Zr2Al3C5 material
International Nuclear Information System (INIS)
Leela-Adisorn, U.; Yamaguchi, A.
2005-01-01
Synthesis method of Zr 2 Al 3 C 5 via solid state reaction between Al, ZrC and carbon powder was studied. Al-ZrC-C compact with equivalent mol ratio of Zr 2 Al 3 C 5 was heated up to 1600 C in Ar atmosphere for 1 h and 4 h but ZrC phase still existed as major phase with very small amount of Zr 2 Al 3 C 5 . Because ZrC started to oxidize at low temperature under very low oxygen partial pressure, the same mol ratio of Al-ZrC-C compact was heated at 1600 C in vacuum for 1 h as parallel test. After firing in vacuum, some carbon still exist with small amount of AlZrC 2 occurred with Zr 2 Al 3 C 5 as a main phase, but no ZrC was found. Different result from firing in Ar atmosphere and in vacuum had been discussed here. It was believed that very small amount of impurities in Ar had some effect on the formation of Al-Zr-C compound. The effect of very small amount of impurities in Ar was studied by thermal analysis (DTA/TG) and XRD. It was found that very small amount of impurities in Ar has effect on the reaction between Al, ZrC and carbon by diffusion through the surface and form Zr-C-O-N solid solution. This solid solution cannot differentiate from ZrC by XRD. With help of thermal analysis method (DTA/TG), Zr-C-O-N solid solution can be differentiated from ZrC. Therefore, synthesis of Al-Zr-C compound should be done in vacuum. Zr 2 Al 3 C 5 can be prepared from mixture of Al-ZrC-C with excess amount of Al at 1600 C for 1 h. (orig.)
Energy Technology Data Exchange (ETDEWEB)
Wang, Ning; Tian, Jie; Jiang, Tao; Yang, Yanqiu; Hu, Sheng [Institute of Nuclear Physics and Chemistry, China Academy of Engineering Physics, Mianyang 621999 (China); Peng, Shuming, E-mail: pengshuming@caep.cn [Institute of Nuclear Physics and Chemistry, China Academy of Engineering Physics, Mianyang 621999 (China); Yan, Liuming [Department of Chemistry, Shanghai University, 99 Shangda Road, Shanghai 200444 (China)
2015-11-15
Gaseous and volatile fission products have a number of adverse effects on the safety and efficiency of the U–10Zr alloy fuel. The theoretical calculations were applied to investigate the energetics related to the formation, nucleation, and degassing of gaseous and volatile fission products (Kr, Xe and I) in molten U–10Zr alloy. The molecular dynamics (MD) simulations were applied to generate equilibrium configurations. The density functional theory (DFT) calculations were used to build atomistic models including molten U–10Zr alloy as well as its fission products substituted systems. The vacancy formation in liquid U–10Zr alloy were studied using DFT calculations, with average Gibbs free formation energies at 8.266 and 6.333 eV for U- and Zr-vacancies, respectively. And the interaction energies were −1.911 eV, −2.390 eV, and −1.826 eV for the I–I, Xe–Xe, and Kr–Kr interaction in lattice when two of the adjacent uranium atoms were substituted by gaseous atoms. So it could be concluded that the interaction between I, Kr, and Xe in lattice is powerful than the interaction between these two atoms and the other lattice atoms in U–10Zr.
Phase transformation and microstructure evolution of the deformed Ti-30Zr-5Nb shape memory alloy
Energy Technology Data Exchange (ETDEWEB)
Qu, Wentao, E-mail: wtqu@xsyu.edu.cn [School of Mechanical Engineering, Xi' an Shiyou University, Xi' an 710065 (China); Sun, Xuguang; Yuan, Bifei [School of Mechanical Engineering, Xi' an Shiyou University, Xi' an 710065 (China); Xiong, Chengyang [School of Materials Science and Engineering, Beihang University, Beijing 100191 (China); Li, Yan, E-mail: liyan@buaa.edu.cn [School of Materials Science and Engineering, Beihang University, Beijing 100191 (China); Nie, Yongsheng [Lanzhou Seemine SMA Co. Ltd., Lanzhou 730010 (China)
2017-04-15
The phase transformation and microstructures of the deformed Ti-30Zr-5Nb shape memory alloy were investigated. The X-ray diffraction measurements indicated that the Ti-30Zr-5Nb alloy was composed of a single orthorhombic α″-martensite phase. The alloy exhibited one yielding behavior in the tensile test, with a critical stress of ~ 600 MPa and a tensile strain of approximately 15%. A shape memory recovery accompanied by a permanent strain was exhibited in the deformed alloys when heated at 873 K. The permanent strain increased with increasing pre-strain. The microstructure evolution of the deformed alloy was investigated by transmission electron microscopy. The results showed that the martensite reorientation occurred and the dislocations were generated during deformation. The alloy displayed a reversible martensite transformation start temperature as high as 763 K. However, no strain-induced martensite stabilization was found in the deformed alloy with different pre-strain levels, potentially because the large chemical energy of the Ti-30Zr-5Nb alloy depressed the effects of the elastic energy and the dissipative energy. - Highlights: • Ti-30Zr-5Nb alloy is composed of single orthorhombic α″-martensite phase with M{sub s} of 721 K. • No martensite stabilization has been found in Ti-30Zr-5Nb alloy with different pre-strain. • Ti-30Zr-5Nb shows the maximum shape memory effect of 2.75% with a pre-strain of 8%.
Characterization of semi-solid processing of aluminium alloy 7075 with Sc and Zr additions
Energy Technology Data Exchange (ETDEWEB)
Rogal, Ł., E-mail: l.rogal@imim.pl [Institute of Metallurgy and Materials Science of the Polish Academy of Sciences, 25 Reymonta St., 30-059 Krakow (Poland); Dutkiewicz, J. [Institute of Metallurgy and Materials Science of the Polish Academy of Sciences, 25 Reymonta St., 30-059 Krakow (Poland); Atkinson, H.V. [The University of Leicester, Department of Engineering University Road, Leicester, LE1 7RH (United Kingdom); Lityńska-Dobrzyńska, L.; Czeppe, T. [Institute of Metallurgy and Materials Science of the Polish Academy of Sciences, 25 Reymonta St., 30-059 Krakow (Poland); Modigell, M. [RWTH Aachen—Department of Mechanical Process Engineering, 55 Templergraben St., Aachen (Germany)
2013-09-15
For thixoforming (semi-solid processing) it is necessary to have a fine globular microstructure in a semi-solid range. Here this has been obtained for 7075 aluminium alloy by addition of modifying agents: 0.5 weight % of scandium and zirconium. The thixoforming process was carried out at 632 °C which gave about 23 volume % of liquid phase. The microstructure of the thixo-formed part (a rotor) consisted of globular grains surrounded by precipitates of secondary phase. The average hardness of thixo-formed parts was 105 HV{sub 5} and the tensile strength 300 MPa. T6 heat treatments were performed with solutionisation at 450 °C for 30 min and 10 h. In both cases the ageing time was set as 18 h at 120 °C. The heat treatments led to an increase in average tensile strength up to 495 MPa. Transmission Electron Microscopy (TEM) analysis enabled the identification of precipitates of the metastable dispersoids of L1{sub 2}–Al{sub 3} (Zr, Sc) and η′ (MgZn{sub 2}) phases in the alloy after the thixoforming and T6 treatment. The measurements of rheological properties of 7075Al alloy with Sc and Zr additions in the semi-solid range indicated an increase of particle size and spheroidization leading to an observable decrease of viscosity during isothermal shearing. A shear rate jump experiment showed that with increasing shear rate the viscosity rapidly falls.
TEM characterization of corrosion products formed on a SS-15ZR alloy
International Nuclear Information System (INIS)
Luo, J. S.; Abraham, D. P.
2000-01-01
The corrosion products formed on a stainless steel-15Zr (SS-15Zr) alloy have been characterized by transmission electron microscopy (TEM) and energy dispersive x-ray spectroscopy (EDS). Examination of alloy particles that were immersed in 90 C deionized water for two years revealed that different corrosion products were formed on the stainless steel and intermetallic phases. Two corrosion products were identified on an austenite particle: trevorite (NiFe 2 O 4 ) in the layer close to the metal and maghemite (Fe 2 O 3 ) in the outer layer. The corrosion layer formed on the intermetallic was uniform, adherent, and amorphous. The EDS analysis indicated that the layer was enriched in zirconium when compared with the intermetallic composition. High-resolution TEM images of the intermetallic-corrosion layer interface show an interlocking metal-oxide interface which may explain the relatively strong adherence of the corrosion layer to the intermetallic surface. These results will be used to evaluate corrosion mechanisms and predict long-term corrosion behavior of the alloy waste form
Mechanical properties of irradiated and non-irradiated Zr1%Nb and Zircaloy claddings
International Nuclear Information System (INIS)
Griger, Agnes
2004-01-01
The mechanical properties of irradiated and non-irradiated Zr1%Nb were determined and they were compared with the analogous properties of Zircaloy-4 to establish connections between the evolution of mechanical parameters of Zr1%Nb and Zircaloy-4 cladding materials and the measure of irradiation. Samples were irradiated in the vertical channels of the Budapest Research Reactor for different time periods at 50-65 C temperature. The measure of irradiation (fluent) for different samples was estimated by means of flux measurement and using the effective irradiation time. Post irradiation uniaxial tension tests in transverse direction were carried out on ring specimens. The mechanical parameters of the Zr1%Nb alloy significantly improve due to the effect of irradiation. However, the values of mechanical parameters do not further increase when the fluent increases above 10 20 n/cm 2 . These results are in good accordance with the Russian ones [1]. Contrary to the behaviour of Zr1%Nb alloy, the mechanical parameters of the Zircaloy practically do not change on the effect of irradiation. The originally high values of ultimate tensile strength and yield stress change only slightly with the increasing fluent in the investigated fluent-region. (Author)
International Nuclear Information System (INIS)
Kikuchi, Tatsuya; Yoshida, Masumi; Taguchi, Yoshiaki; Habazaki, Hiroki; Suzuki, Ryosuke O.
2014-01-01
Highlights: • A metallic Ti–Zr alloy was obtained by electroless reduction for capacitor applications. • The reduction mechanisms were studied by SEM, XRD, EPMA, and an oxygen analyzer. • The alloy was obtained by electroless reduction in the presence of excess calcium reductant. • A micro-porous Ti–Zr alloy was successfully obtained. • The alloy has a low oxygen content and a large surface area. -- Abstract: A metallic titanium and zirconium micro-porous alloy for electrolytic capacitor applications was produced by electroless reduction with a calcium reductant in calcium chloride molten salt at 1173 K. Mixed TiO 2 –70 at%ZrO 2 oxides, metallic calcium, and calcium chloride were placed in a titanium crucible and heated under argon atmosphere to reduce the oxides with the calcium reductant. A metallic Ti–Zr alloy was obtained by electroless reduction in the presence of excess calcium reductant and showed a micro-porous morphology due to the sintering of each of the reduced particles during the reduction. The residual oxygen content and surface area of the reduced Ti–Zr alloy decreased over time during the electroless reduction. The element distributions were slightly different at the positions of the alloy and were in the composition range of Ti-69.3 at% to 74.3 at%Zr. A micro-porous Ti–Zr alloy with low oxygen content (0.20 wt%) and large surface area (0.55 m 2 g −1 ) was successfully fabricated by electroless reduction under optimal conditions. The reduction mechanisms of the mixed and pure oxides by the calcium reductant are also discussed
The Development of Corrosion Resistant Zirconium Alloy
International Nuclear Information System (INIS)
Abdul-Latief; Noor-Yudhi; Isfandi; Djoko-Kisworo; Pranjono
2000-01-01
Corrosion test of Zr alloy consisting of quenching and tempering Zry-2,Zry-4 cast, Zr-1% Nb cast, has been. conducted. In corrosion test, thechanges during β-quenching, tempering and corrosion test at varioustemperature and time in autoclave water medium, can be seen. The treatmentconsisted of heating at 1050 o C for 30 minutes, quenching in water andtempering at 200 o C, 300 o C, 400 o C, 500 o C, 600 o C as well as corrosiontests at 225 o C, 275 o C, 325 o C at 4, 8, 12 hours. Sample preparation forcorrosion test was based on ASTM G-2 procedure, which consisted of washing,rinsing, pickling (3.5 cc HF 50%; 2.9 cc HNO 3 65% and 57 cc AMB),neutralizing in 0.1 M Al(NO 3 ) 3 , 9 H 2 O and ultrasonic rinsing/washing.Measurement performed are weight gain during corrosion, hardness test andmicrostructure observation using microscope optic. The results show thatβ-quenching of Zr alloy which was followed by tempering can turn αmartensite into tempered α 1 martensit. The increase of temperingtemperature decreases the Zr alloy hardness and the lowest hardness ispossessed by Zr-1% Nb alloy. The corrosion test at 275 o C and 325 o C showsthat the weight gain depends on the tempering temperature, the temperingtemperature of 400 o C and 200 o C gives the maximum weight gain for Zry-2,Zry-4 cast, Zr-1% Nb. The largest number of hydride formed during corrosionis found in Zry-2, while the small one is in Zr-1% Nb. (author)
Energy Technology Data Exchange (ETDEWEB)
Eymann, K., E-mail: Konrad.Eymann@tu-dresden.de [Institute of Materials Science, Technische Universitaet Dresden, 01062 Dresden (Germany); Riedl, T.; Bram, A.; Ruhnow, M.; Boucher, R.; Kirchner, A.; Kieback, B. [Institute of Materials Science, Technische Universitaet Dresden, 01062 Dresden (Germany)
2012-09-15
Highlights: Black-Right-Pointing-Pointer Solid solution of Cu-Nb was achieved by mechanically alloying Cu, Nb and ZrO{sub 2}. Black-Right-Pointing-Pointer In as-milled state the Cu-Nb-ZrO{sub 2} powders show an average Cu grain size of 16 nm. Black-Right-Pointing-Pointer Mechanical and electrical properties are studied in dependence of thermal exposure. Black-Right-Pointing-Pointer Compaction at 1000 Degree-Sign C/1 min using SPS increases Cu grain size to 43 nm. Black-Right-Pointing-Pointer Bulk samples reach a maximum IACS of 16% and 98% relative density. - Abstract: This work presents the synthesis of ultra fine grained high-strength Cu-Nb-ZrO{sub 2} bulk samples via mechanical alloying and spark plasma sintering. Technologically relevant properties such as density, micro-hardness, and electrical conductivity were studied in terms of the compaction parameters, in particular the sintering temperature and holding time. An optimum process parameter combination has been found T = 950 Degree-Sign C, t = 1 min, and 65 MPa, which yield a micro-hardness of 325 HV, 97.5% relative density, and electrical conductivity of 10% IACS. The dependence of these properties on the compaction parameters is explained by analyzing the microstructure, i.e. grain size, presence and distribution of phases, and porosity, with X-ray diffraction, optical and electron microscopy as well as with an Archimedes densitometer.
Acute Pharmacological Effects of 2C-B in Humans: An Observational Study
Directory of Open Access Journals (Sweden)
Esther Papaseit
2018-03-01
Full Text Available 2,5-dimethoxy-4-bromophenethylamine (2C-B is a psychedelic phenylethylamine derivative, structurally similar to mescaline. It is a serotonin 5-hydroxytryptamine-2A (5-HT2A, 5-hydroxytryptamine-2B (5-HT2B, and 5-hydroxytryptamine-2C (5-HT2C receptor partial agonist used recreationally as a new psychoactive substance. It has been reported that 2C-B induces mild psychedelic effects, although its acute pharmacological effects and pharmacokinetics have not yet been fully studied in humans. An observational study was conducted to assess the acute subjective and physiological effects, as well as pharmacokinetics of 2C-B. Sixteen healthy, experienced drug users self-administered an oral dose of 2C-B (10, 15, or 20 mg. Vital signs (blood pressure and heart rate were measured at baseline 1, 2, 3, 4, and 6 hours (h. Each participant completed subjective effects using three rating scales: the visual analog scale (VAS, the Addiction Research Centre Inventory (ARCI, and the Evaluation of the Subjective Effects of Substances with Abuse Potential (VESSPA-SSE at baseline, 2–3 and 6 h after self-administration (maximum effects along 6 h, and the Hallucinogenic Rating Scale (maximum effects along 6 h. Oral fluid (saliva was collected to assess 2C-B and cortisol concentrations during 24 h. Acute administration of 2C-B increased blood pressure and heart rate. Scores of scales related to euphoria increased (high, liking, and stimulated, and changes in perceptions (distances, colors, shapes, and lights and different body feelings/surrounding were produced. Mild hallucinating effects were described in five subjects. Maximum concentrations of 2C-B and cortisol were reached at 1 and 3 h after self-administration, respectively. Oral 2C-B at recreational doses induces a constellation of psychedelic/psychostimulant-like effects similar to those associated with serotonin-acting drugs.
Ideal solution behaviour of glassy Cu–Ti, Zr, Hf alloys and properties of amorphous copper
International Nuclear Information System (INIS)
Ristić, R.; Cooper, J.R.; Zadro, K.; Pajić, D.; Ivkov, J.; Babić, E.
2015-01-01
Highlights: • Ideal solution behaviour (ISB) is established in all Cu–Ti, Zr, Hf glassy alloys. • ISB enables reliable estimates for various properties of amorphous Cu. • ISB also impacts glass forming ability in these and probably other similar alloys. - Abstract: A comprehensive study of selected properties of amorphous (a) Cu–TE alloys (TE = Ti, Zr and Hf) has been performed. Data for average atomic volumes of a-Cu–Hf, Ti alloys combined with literature data show that ideal solution behaviour (Vegard’s law) extends over the whole glass forming range (GFR) in all a-Cu–TE alloys. This enables one to obtain an insight into some properties and probable atomic arrangements for both, a-TEs (Ristić et al., 2010) and a-Cu by extrapolation of the data for alloys. Indeed the atomic volumes and other properties studied for all a-Cu–TE alloys extrapolate to the same values for a-Cu. Depending on the property, these values are either close to those of crystalline (c) Cu, or are close to those for liquid (L) Cu. In particular, the electronic transport properties of a-Cu seem close to those of L-Cu, whereas the static properties, such as the density of states, and Young’s modulus, converge to those of c-Cu. The possible impact of these results on our understanding of a-Cu–TE alloys, including glass forming ability, is discussed
Magnetic properties of ZrNi{sub 5-x}In{sub x} (0{<=}x{<=}1) ternary system
Energy Technology Data Exchange (ETDEWEB)
Drulis, H. E-mail: drulis@int.pan.wroc.pl; Iwasieczko, W.; Zaremba, V
2003-01-01
Magnetisation was measured for the series of ZrNi{sub 5-x}In{sub x} (x=0, 0.25. 0.50, 0.75 and 1.0) alloys over the temperature range 1.75-700 K in applied field up to 50 kOe. All materials studied crystallise in the AuGe{sub 5}-type crystal structure. Alloys with x=0, 0.25 and 0.5 were found to be ferromagnets with relatively high transition temperatures, T{sub c}, dependent on the indium concentration (from T{sub c}=368 K for x=0.5 up to 647 K for x=0). The measured saturation magnetic moments are fully connected with nickel atom; the Zr and In moments are negligible. An environment-dependent model for the formation of Ni moments is suggested. The critical concentration of Ni for the onset of long-range ferromagnetic order in ZrNi{sub 5-x}In{sub x} is estimated as 4.5 atoms/f.u. (75 at%), approximately. The long-range magnetic order is determined by the number of the nearest neighbours of Ni atoms occupying 16(e) positions. Alloys with x=0.75 and 1.0 exhibit Pauli paramagnetism.
International Nuclear Information System (INIS)
Li, G.P.; Li, D.; Liu, Y.Y.; Hu, Z.Q.
1995-01-01
The composition (wt%) of ingot fir this investigation is 86.75%Ti, 5%Al, 4%Sn, 2%Zr, 1%Mo, 0.25%Si, 1%Nd. The alloy was prepared by vacuum arc melting in the form of buttons of mass 500 kg, which was remelted three times repeatedly to obtain homogeneous composition. The Nd-rich phase particles in the as-cast Ti-55 alloy are about 1.2∼11.07 microm and uniformly distribute in the matrix. The shapes of the particles are mainly ellipsoids together with short needle-like and blocky morphologies. The calculated diameter of the Nd-rich phase particles is ∼ 10 microm, which is within the 1.2∼11.07 microm range of the particle diameter experimentally measured in the as-cast Ti-55 alloy. The practical interface velocity is three orders of magnitude greater than V c, and the Nd-rich phase particles in the as-cast Ti-55 alloy are trapped by the liquid-solid interface
International Nuclear Information System (INIS)
Mokhracheva, L.P.; Gel'd, P.V.; Tskhaj, V.A.
1983-01-01
The results of ZrC zone structure calculation conducted using the strong bond method in the three-centre variant are given. Essentially higher degree of M-C chemical bond ionicity than in TiC is shown to take place for it. Solid solution formation in TiC-ZrC, TiN-ZrC and ZrC-ZrN systems differing from TiC-TiN, TiN-ZrN and TiC-TiN is stated to be followed by essential deformation of component zone structures that, obviously, should prevent formation of solid solutions without vacancies in sublatices in these systems
Effect of Si addition on the glass-forming ability of a NiTiZrAlCu alloy
International Nuclear Information System (INIS)
Liang, W.Z.; Shen, J.; Sun, J.F.
2006-01-01
The effect of Si addition on the glass-forming ability (GFA) of a NiTiZrAlCu alloy was investigated by using differential scanning calorimetry (DSC), differential thermal analysis (DTA), X-ray diffraction (XRD), scanning electron microscopy (SEM) and transmission electron microscopy (TEM). The maximum diameter of glassy rods increased from 0.5 mm for the Ni 42 Ti 20 Zr 25 Al 8 Cu 5 alloy (the base alloy) to 2.5 mm for the Ni 42 Ti 20 Zr 21.5 Al 8 Cu 5 Si 3.5 alloy and to 3 mm for the Ni 42 Ti 19 Zr 22.5 Al 8 Cu 5 Si 3.5 alloy, when prepared by using the copper mould casting. The GFA of the alloys can be assessed by the reduced glass transition temperature T rg (=T g /T l ) and a newly proposed parameter, δ(=T x /T l - T g ). An addition of a proper amount of Si and a minor substitution of Ti with Zr can enhance the GFA of the base alloy by suppressing the formation of primary Ni(TiZr) and (TiZr)(CuAl) 2 phases and inducing the composition close to eutectic
Creep and stress rupture behaviour of zircaloy-2 and Zr-2.5% Nb alloy tubes at 573 K
International Nuclear Information System (INIS)
Laha, K.; Bhanu Sankara Rao, K.; Chandravathi, K.S.; Mannan, S.L.
1992-01-01
Zirconium alloys are extensively used for coolant tubes of pressurised heavy water reactors. The choice of these materials is based on their good corrosion resistance in water, low capture cross section for thermal neutrons and good mechanical properties. In this paper the results of an investigation performed on the creep and rupture behaviour of indigenously produced zircaloy-2 and Zr-2.5% Nb alloy are presented. Samples for creep testing were cut longitudinally from finished pressure tubes. Creep rupture tests were carried out in air under constant load conditions at 300 C employing five stress levels in the range 300-360 MPa. Zr-2.5% Nb alloy displayed higher rupture lives at all stress levels compared to zircaloy-2. Steady state creep rate of Zr-2.5%Nb was lower than that zircaloy-2 at identical stress levels. In the stress range of the experiments, the dependence of the steady state creep rate (ε s ) on applied stress (σ) for both the alloys could be represented by a power law, ε s =A σ n The stress sensitivity (n) for Zr-2.5% Nb was lower than that of zircaloy-2. For both the alloys the time to creep rupture t r was found related to the steady state creep rate through the modified Monkman-Grant relation (ε s ) α . t r = constant. Similar value of α was obtained for both the materials. Zr-2.5%Nb exhibited higher ductility (% elongation to rupture) compared to zircaloy-2 at stress levels ≥ 320 MPa. At lower stresses significant difference in ductility was not noticed. Percentage reduction in area was lower in Zr-2.5%Nb at all stress levels indicating better resistance for necking. The time for onset of tertiary was longer for Zr-2.5% Nb alloy. The proportion of life spent by Zr-2.5% Nb in steady state creep regime was higher compared to that of zircaloy-2. Metallographic investigations on longitudinal sections in both the alloys showed large number of intragranular pores close to the fracture surface. A few number of cracks which are characteristic of
Precipitation hardening of cast Zr-containing A356 aluminium alloy
International Nuclear Information System (INIS)
Baradarani, B.; Raiszadeh, R.
2011-01-01
The effect of small additions of zirconium on the hardness, grain size, precipitate type and size of cast A356 aluminium alloy was investigated. The cast alloys were solution treated and then artificially aged for different periods of time. Hardness tests and scanning electron microscope (SEM), energy dispersive X-ray (EDX) and X-ray diffraction (XRD) studies were carried out on the as-cast, as-solutionised and age-hardened specimens. Incoherent, coarse Al 3 Zr particles formed in the microstructure during the solidification of the alloy and caused grain refinement in the as-cast structure. These particles dissolved and reprecipitated as smaller-size particles during the solution treatment, causing the hardness of the alloy to remain constant at high temperatures for long periods of time due to the slow diffusion of Zr in the α-Al.
Correlation between the oxide impedance and corrosion behavior of Zr-Nb-Sn-Fe-Cu alloys
Park, Sang-Yoon; Lee, Myung-Ho; Jeong, Yong-Hwan; Jung, Youn-Ho
2004-12-01
The correlation between the oxide impedance and corrosion behavior of two series of Zr-Nb-Sn-Fe-Cu alloys was evaluated. Corrosion tests were performed in a 70 ppm LiOH aqueous solution at 360°C for 300 days. The results of the corrosion tests revealed that the corrosion behavior of the alloys depended on the Nb and Sn content. The impedance characteristics for the pre- and post-transition oxide layers formed on the surface of the alloys were investigated in sulfuric acid at room temperature. From the results, a pertinent equivalent circuit model was preferably established, explaining the properties of double oxide layers. The impedance of the oxide layers correlated with the corrosion behavior; better corrosion resistance always showed higher electric resistance for the inner layers. It is thus concluded that a pertinent equivalent circuit model would be useful for evaluating the long-term corrosion behavior of Zr-Nb-Sn-Fe-Cu alloys.
Study of Influence of an Annealing on Corrosion Stability of Pipes-shells for Fuel of Zr1Nb Alloy
International Nuclear Information System (INIS)
Petel'guzov, I.A.; Rodak, A.G.; Pasenov, F.A.; Ishchenko, N.I.
2006-01-01
Explored influence an annealing to the kinetics of corrosion and mechanical characteristics of pipe material for shells fuel elements made from the experimental zirconium alloy Zr1Nb calcium-thermal way of production, in the comparison with the staff alloy E110 electrolytic way of production. Determined parameters of kinetics of corrosion depending on temperature and duration annealing before testing. Conducted also mechanical testing the alloys on the ring samples. Determined ranges of temperatures, within which corrosion characteristics save values, close to source, and connecting temperatures, under which is observed reduction research; investigating features
Nb effect on Zr-alloy oxidation under high pressure steam at high temperatures
International Nuclear Information System (INIS)
Park, Kwangheon; Yang, Sungwoo; Kim, Kyutae
2005-01-01
The high-pressure steam effects on the oxidation of Zircaloy-4 (Zry-4) and Zirlo (Zry-1%Nb) claddings at high temperature have been analyzed. Test temperature range was 700-900degC, and pressures were 1-150 bars. High pressure-steam enhances oxidation of Zry-4, and the dependency of enhancement looks exponential to steam pressure. The origin of the oxidation enhancement turned out to be the formation of cracks in oxide. The loss of tetragonal phase by high-pressure steam seems related to the crack formation. Addition of Nb as an alloying element to Zr alloy reduces significantly the steam pressure effects on oxidation. The higher compressive stresses and the smaller fraction of tetragonal oxides in Zry-1%Nb seem to be the diminished effect of high-pressure steam on oxidation. (author)
Energy Technology Data Exchange (ETDEWEB)
Li, Xiu-Mei [School of Stomatology, China Medical University, 117 Nanjing North Street, Shenyang 110002 (China); Li, Hui-Zhe; Wang, Shao-Ping [Shenyang National Laboratory for Materials Science, Institute of Metal Research, Chinese Academy of Sciences, 72 Wenhua Road, Shenyang 110016 (China); Huang, Hsun-Miao; Huang, Her-Hsiung [Biomaterials and Electrochemistry Lab, Department of Dentistry, National Yang-Ming University, Taipei City 112, Taiwan (China); Ai, Hong-Jun, E-mail: aih0620@yahoo.com.cn [School of Stomatology, China Medical University, 117 Nanjing North Street, Shenyang 110002 (China); Xu, Jian, E-mail: jianxu@imr.ac.cn [Shenyang National Laboratory for Materials Science, Institute of Metal Research, Chinese Academy of Sciences, 72 Wenhua Road, Shenyang 110016 (China)
2014-09-01
Nb–60Ta–2Zr is a newly developed MRI-compatible alloy used for vascular stents. In this work, its haemocompatibility was investigated, including platelet adhesion (lactate dehydrogenase activity), platelet activation (P-selectin expression), coagulation and haemolysis. For comparison, parallel assessments for these factors were performed for the niobium, tantalum, 316L stainless steel (316L SS) and L605 Co–Cr alloy (L605). In addition, albumin and fibrinogen were selected to examine the correlation of protein adsorption with platelet adhesion and metal surface properties. The propensity for platelet adhesion and activation on the Nb–60Ta–2Zr alloy was at nearly the same level as that for Nb and Ta but was slightly less than those of 316L SS and L605. The mitigated platelet adhesion and activation of the Nb–60Ta–2Zr alloy is associated with its decreased adsorption of fibrinogen. The Nb–60Ta–2Zr alloy has a longer clotting time and exhibits significantly superior thromboresistance than 316L SS and L605. Moreover, the haemolysis rate of the Nb–60Ta–2Zr alloy satisfies the bio-safety requirement of the ISO 10993–4 standard. The favourable haemocompatiblity of the Nb–60Ta–2Zr alloy provides evidence of its good biocompatibility and of its suitability as a candidate stent material. - Highlights: • The Nb–60Ta–2Zr alloy is less hydrophobic than the 316L SS and L605 alloy. • The Nb–60Ta–2Zr has slightly weak propensity for platelet adhesion and activation. • The Nb–60Ta–2Zr alloy results in a longer clotting time. • Haemolysis of Nb–60Ta–2Zr is slightly lower than that of 316L SS and L605. • The Nb–60Ta–2Zr alloy is a promising MRI-compatible stent material.
International Nuclear Information System (INIS)
Yang, H.L.; Shibukawa, S.; Abe, H.; Satoh, Y.; Matsukawa, Y.; Kido, T.
2014-01-01
The effects of Mo in Zr-Nb alloys are investigated in terms of their mechanical properties associated with microstructure, as well as their behavior under hydrogen environment. Zr-Nb-Mo alloys were fabricated by arc melting and subsequently cold rolling and annealing below the eutectoid temperature. Hydrogen was absorbed in a furnace under argon and hydrogen gas flow environment at high temperature. X-Ray diffraction, electron backscatter diffraction, and tensile test were jointly utilized to carry out detailed microstructural characterization and mechanical properties. Results showed that fcc-δ-ZrH 1.66 was formed in all hydrogen-absorbed alloys, and the amount of hydride enhanced with increasing of hydrogen content. In addition, it was clear that δ-ZrH 1.66 was precipitated both in grain boundary and interior, and preferential precipitation was observed on the habit planes of (0001) and {101-bar7}. Moreover, the strengthening effect by Mo addition was observed. The ductility loss by hydrogen absorption was found from fracture surface observation. Large area cleavage facets were found in Mo-free specimen, and less cleavage facets was observed in Mo-containing specimen, showing an appropriate addition of Mo can increase the tolerance to hydrogen embrittlement. (author)
Stacking faults in Zr(Fe, Cr)2 Laves structured secondary phase particle in Zircaloy-4 alloy.
Liu, Chengze; Li, Geping; Yuan, Fusen; Han, Fuzhou; Zhang, Yingdong; Gu, Hengfei
2018-02-01
Stacking faults (SFs) in secondary phase particles (SPPs), which generally crystallize in the Laves phase in Zircaloy-4 (Zr-4) alloy, have been frequently observed by researchers. However, few investigations on the nano-scale structure of SFs have been carried out. In the present study, an SF containing C14 structured SPP, which located at grain boundaries (GBs) in the α-Zr matrix, was chosen to be investigated, for its particular substructure as well as location, aiming to reveal the nature of the SFs in the SPPs in Zr-4 alloy. It was indicated that the SFs in the C14 structured SPP actually existed in the local C36 structured Laves phase, for their similarities in crystallography. The C14 → C36 phase transformation, which was driven by synchroshearing among the (0001) basal planes, was the formation mechanism of the SFs in the SPPs. By analyzing the strained regions near the SPP, a model for understanding the driving force of the synchroshear was proposed: the interaction between SPP and GB resulted in the Zener pinning effect, leading to the shearing parallel to the (0001) basal planes of the C14 structured SPP, and the synchroshear was therefore activated.
International Nuclear Information System (INIS)
Pais, Rafael Witter Dias
2015-01-01
Metal fuels are relevant in the nuclear area due to the versatility of its use in the nuclear fuel cycle. Among the alloys of uranium investigated with high potential for use in nuclear power reactors, U-Zr-Nb alloys appear as an important alternative because of their superior physico-chemical and metallurgical properties. These alloys have also potential for use in nuclear testing, research and production radioisotopes of high performance nuclear reactors. Therefore, the development of these alloys is strategic since they are planned to be used in national reactors as RMB (Brazilian Multipurpose Reactor) and LABGENE (Electrical Generation Core Laboratory), currently under development in Brazil. In this work it was realized a extensive study in the scope of the manufacturing, heat treatment and phase transformations of U-2,5Zr-7,5Nb (m/m%) and U-3ZR-9NB (m/m%) fuel alloys. Ingots of both alloys were produced employing a specific methodology developed in this study. This methodology comprised the melting process in a vacuum induction furnace at high temperatures (1500 °C) and thermal-mechanical processing to break the as-cast structure. Samples with typical dimensions (17 x 7 x 2.5 mm) free from macrostructural defects were homogenized at 1000 °C in vacuum of 10 -5 torr for 17.5 hours with a 10°C/min cooling rate until to 820 °C and, subsequently, quenched in water. The samples, randomly selected, were subjected to isothermal treatment tests under different conditions of time and temperature. Isothermal treatments for transformation and retention phases were carried out in a special assembly designed for this work. After the tests, the samples were characterized by the usual phase characterization techniques with particular emphasis for the X-ray diffraction technique. In this way, the Rietveld refinement method was applied. In the case of uranium based alloys it is quite challenging due to the lack of data in the literature. In this work a strategy for the
Mössbauer spectroscopic studies in U-Fe and U-Fe-Zr alloys
Energy Technology Data Exchange (ETDEWEB)
Panda, Alaka; Singh, L. Herojit; Rajagopalan, S.; Govindaraj, R., E-mail: govind@igcar.gov.in; Ramachandran, Renjith; Kalavathi, S.; Amarendra, G. [Materials Science Group, Indira Gandhi Centre for Atomic Research, Kalpakkam (India)
2016-05-23
{sup 57}Fe Mössbauer studies have been carried out in an alloy of U and Fe with atomic percentage in the ratio of 68%:32% in order to understand the local structure and valence of Fe atoms associated with different phases that may get formed. The effect of changes in the hyperfine parameters such as isomer shift and quadrupole splitting at Fe sites due to additional alloying of Zr has been studied in an alloy of U, Fe and Zr in the ratio of 44%:33%:23% respectively with respect to that of the U-Fe alloy chosen in the present study. Possible effect of solute clustering in these systems has been addressed in an analogous alloy of uranium and zirconium using positron lifetime spectroscopy.
Field ion microscopy and 3-D atom probe analysis of Al3Zr particles in 7050 Al alloy
International Nuclear Information System (INIS)
Sha, G.; Cerezo, A.
2004-01-01
Full text: For high strength 7xxx series Al alloys, Zr is an important trace alloy element which is often added to optimise properties, having effects such as refining grain size, inhibiting recrystallization, and improving stress corrosion cracking resistance and quench sensitivity. In addition, it has been reported recently that Zr addition also has a significant influence on early stage ageing behaviour of a 7xxx series Al alloy. Zr equilibrium solubility in solid Al is extremely low. After solution or ageing treatment, most Zr is present as small spherical Ai 3 Zr dispersoids approximately 20 nm in diameter, distributed at grain boundaries as well as within the Al matrix. The crystallographic nature of intermetallic phase Al 3 Zr has been well studied in the literatures. So far, no direct measurement of the chemistry of the Al 3 Zr particles in 7xxx series Al alloys has been published. It is unclear if there is significant Zn, Mg or Cu included in the particles. In this research, 3DAP has been employed for the first time to investigate ionisation behaviour of Al 3 Zr particles and determine the chemistry of the particles in 7050 Al alloy. Using field ion microscopy, the local evaporation radius of the Al 3 Zr particle has been measured to be equivalent to 36 nm for a 10 kV tip, less than the equivalent tip radius for the Al matrix of ∼68 nm. Using the matrix Al evaporation field (19 V/nm) as a reference, this allows the evaporation field of Al 3 Zr to be calculated as 35 V/nm, the same as the field calculated for evaporation of Al as Al 2+ (35 V/nm), and that of Zr as Zr 3+ (35 V/nm). This result is consistent with Al 2+ and Zr 3+ being the main species observed in the mass spectrum during analysis of Al 3 Zr particles. Using 3DAP, the chemical compositions of Al 3 Zr particles are determined to be 64.8∼67.7 at% Al, 23.6∼24.8 at% Zr, 6.9∼9.1 at% Zn, 0.4∼0.7 at% Cu, 0.5∼1.2 at% Mg, with a (Al+Zn)/Zr ratio close to 3. Choice of specimen temperature of
Shaha, S. K.; Czerwinski, F.; Kasprzak, W.; Friedman, J.; Chen, D. L.
2016-05-01
Uniaxial static and cyclic tests were used to assess the role of Cr, Ti, V, and Zr additions on properties of the Al-7Si-1Cu-0.5Mg (wt pct) alloy in as-cast and T6 heat-treated conditions. The microstructure of the as-cast alloy consisted of α-Al, eutectic Si, and Cu-, Mg-, and Fe-rich phases Al2.1Cu, Al8.5Si2.4Cu, Al5.2CuMg4Si5.1, and Al14Si7.1FeMg3.3. In addition, the micro-sized Cr/Zr/Ti/V-rich phases Al10.7SiTi3.6, Al6.7Si1.2TiZr1.8, Al21.4Si3.4Ti4.7VZr1.8, Al18.5Si7.3Cr2.6V, Al7.9Si8.5Cr6.8V4.1Ti, Al6.3Si23.2FeCr9.2V1.6Ti1.3, Al92.2Si16.7Fe7.6Cr8.3V1.8, and Al8.2Si30.1Fe1.6Cr18.8V3.3Ti2.9Zr were present. During solution treatment, Cu-rich phases were completely dissolved, while the eutectic silicon, Fe-, and Cr/Zr/Ti/V-rich intermetallics experienced only partial dissolution. Micro-additions of Cr, Zr, Ti, and V positively affected the alloy strength. The modified alloy in the T6 temper during uniaxial tensile tests exhibited yield strength of 289 MPa and ultimate tensile strength of 342 MPa, being significantly higher than that for the Al-Si-Cu-Mg base. Besides, the cyclic yield stress of the modified alloy in the T6 state increased by 23 pct over that of the base alloy. The fatigue life of the modified alloy was substantially longer than that of the base alloy tested using the same parameters. The role of Cr, Ti, V, and Zr containing phases in controlling the alloy fracture during static and cyclic loading is discussed.
Roles of texture in controlling oxidation, hydrogen ingress and hydride formation in Zr alloys
International Nuclear Information System (INIS)
Szpunar, Jerzy A.; Qin, Wen; Li, Hualong; Kumar, Kiran
2011-01-01
Experimental observations shows that the oxide formed on Zr alloys are strongly textured. The texture and grain-boundary characteristics of oxide are dependent on the texture of metal substrate. Computer simulation and thermodynamic modeling clarify the effect of metal substrate on structure of oxide film, and intrinsic factors affecting the microstructure. Models of diffusion process of hydrogen atoms and oxygen diffusion through oxide are presented. Both intra-granular and inter-granular hydrides were found following (0001) α-Zr //(111) δ-ZrH1.5 relationship. The through-thickness texture inhomogeneity in cladding tubes, the effects of hoop stress on the hydride orientation and the formation of interlinked hydride structure were studied. A thermodynamic model was developed to analyze the nucleation and the stress-induced reorientation of intergranular hydrides. These works provide a framework for understanding the oxidation, the hydrogen ingress and the hydride formation in Zr alloys. (author)
Dănăilă, E.; Benea, L.
2017-06-01
The tribocorrosion behaviour of Ti-10Zr alloy and porous TiO2-ZrO2 thin film electrochemical formed on Ti-10Zr alloy was evaluated in Fusayama-Mayer artificial saliva solution. Tribocorrosion experiments were performed using a unidirectional pin-on-disc experimental set-up which was mechanically and electrochemically instrumented, under various solicitation conditions. The effect of applied normal force on tribocorrosion performance of the tested materials was determined. Open circuit potential (OCP) measurements performed before, during and after sliding tests were applied in order to determine the tribocorrosion degradation. The applied normal force was found to greatly affect the potential during tribocorrosion experiments, an increase in the normal force inducing a decrease in potential accelerating the depassivation of the materials studied. The results show a decrease in friction coefficient with gradually increasing the normal load. It was proved that the porous TiO2-ZrO2 thin film electrochemical formed on Ti-10Zr alloy lead to an improvement of tribocorrosion resistance compared to non-anodized Ti-10Zr alloy intended for biomedical applications.
International Nuclear Information System (INIS)
Graff, St.
2006-10-01
The anomalous strain rate sensitivity of zirconium alloys over the temperatures range 20-600 C has been widely reported in the literature. This unconventional behavior is related to the existence of strain ageing phenomenon which results from the combined action of thermally activated diffusion of foreign atoms to and along dislocation cores and the long range of dislocations interactions. The important role of interstitial and substitutional atoms in zirconium alloys, responsible for strain ageing and the lack of information about the domain where strain ageing is active have not been yet adequately characterized because of the multiplicity of alloying elements and chemical impurities. The aim of this work is to characterize experimentally the range of temperatures and strain rates where strain ageing is active on the macroscopic and mesoscopic scales. We propose also a predictive approach of the strain ageing effects, using the macroscopic strain ageing model suggested by McCormick (McCormick, 1988; Zhang et al., 2000). Specific zirconium alloys were elaborated starting from a crystal bar of zirconium with 2.2 wt% hafnium and very low oxygen content (80 wt ppm), called ZrHf. Another substitutional atom was added to the solid solution under the form of 1 wt% niobium. Some zirconium alloys were doped with oxygen, others were not. All of them were characterized by various mechanical tests (standard tensile tests, tensile tests with strain rate changes, relaxation tests with unloading). The experimental results were compared with those for the standard oxygen doped zirconium alloy (1300 wt ppm) studied by Pujol (Pujol, 1994) and called Zr702. The following experimental evidences of the age-hardening phenomena were collected and then modeled: 1) low and/or negative strain rate sensitivity around 200-300 C, 2) creep arrest at 200 C, 3) relaxation arrest at 200 C and 300 C, 4) plastic strain heterogeneities observed in laser extensometry on the millimeter scale
Energy Technology Data Exchange (ETDEWEB)
Graff, St
2006-10-15
The anomalous strain rate sensitivity of zirconium alloys over the temperatures range 20-600 C has been widely reported in the literature. This unconventional behavior is related to the existence of strain ageing phenomenon which results from the combined action of thermally activated diffusion of foreign atoms to and along dislocation cores and the long range of dislocations interactions. The important role of interstitial and substitutional atoms in zirconium alloys, responsible for strain ageing and the lack of information about the domain where strain ageing is active have not been yet adequately characterized because of the multiplicity of alloying elements and chemical impurities. The aim of this work is to characterize experimentally the range of temperatures and strain rates where strain ageing is active on the macroscopic and mesoscopic scales. We propose also a predictive approach of the strain ageing effects, using the macroscopic strain ageing model suggested by McCormick (McCormick, 1988; Zhang et al., 2000). Specific zirconium alloys were elaborated starting from a crystal bar of zirconium with 2.2 wt% hafnium and very low oxygen content (80 wt ppm), called ZrHf. Another substitutional atom was added to the solid solution under the form of 1 wt% niobium. Some zirconium alloys were doped with oxygen, others were not. All of them were characterized by various mechanical tests (standard tensile tests, tensile tests with strain rate changes, relaxation tests with unloading). The experimental results were compared with those for the standard oxygen doped zirconium alloy (1300 wt ppm) studied by Pujol (Pujol, 1994) and called Zr702. The following experimental evidences of the age-hardening phenomena were collected and then modeled: 1) low and/or negative strain rate sensitivity around 200-300 C, 2) creep arrest at 200 C, 3) relaxation arrest at 200 C and 300 C, 4) plastic strain heterogeneities observed in laser extensometry on the millimeter scale
Directory of Open Access Journals (Sweden)
Fan Zhang
2013-09-01
Full Text Available Microstructure and phase composition of a CrMo0.5NbTa0.5TiZr high entropy alloy were studied in the as-solidified and heat treated conditions. In the as-solidified condition, the alloy consisted of two disordered BCC phases and an ordered cubic Laves phase. The BCC1 phase solidified in the form of dendrites enriched with Mo, Ta and Nb, and its volume fraction was 42%. The BCC2 and Laves phases solidified by the eutectic-type reaction, and their volume fractions were 27% and 31%, respectively. The BCC2 phase was enriched with Ti and Zr and the Laves phase was heavily enriched with Cr. After hot isostatic pressing at 1450 °C for 3 h, the BCC1 dendrites coagulated into round-shaped particles and their volume fraction increased to 67%. The volume fractions of the BCC2 and Laves phases decreased to 16% and 17%, respectively. After subsequent annealing at 1000 °C for 100 h, submicron-sized Laves particles precipitated inside the BCC1 phase, and the alloy consisted of 52% BCC1, 16% BCC2 and 32% Laves phases. Solidification and phase equilibrium simulations were conducted for the CrMo0.5NbTa0.5TiZr alloy using a thermodynamic database developed by CompuTherm LLC. Some discrepancies were found between the calculated and experimental results and the reasons for these discrepancies were discussed.
International Nuclear Information System (INIS)
Long Woyun; Ouyang Xueqiong; Luo Zhiwei; Li Jing; Lu Anxian
2011-01-01
Amorphous Zr 50 Al 15-x Ni 10 Cu 25 Y x alloy powders were fabricated by mechanical alloying at low vacuum with commercial pure element powders. The effects on glass forming ability of Al partial substituted by Y in Zr 50 Al 15 Ni 10 Cu 25 and thermal stability of Si 3 N 4 powders addition were investigated. The as-milled powders were characterized by X-ray diffraction, scanning electron microscopy and differential scanning calorimeter. The results show that partial substitution of Al can improve the glass forming ability of Zr 50 Al 15 Ni 10 Cu 25 alloy. Minor Si 3 N 4 additions raise the crystallization activation energy of the amorphous phase and thus improve its thermal stability. -- Research Highlights: → ZrAlNiCu amorphous alloys can be synthesized by MA in low cost. → Appropriate amount of Al substituted by Y in ZrAlNiCu alloy can improve its glass forming ability. → A second phase particle addition helps to improve the thermal stability of the amorphous matrix.
Semiempirical quantum model approach for hydrogen adsorption in ZrNi alloys
Energy Technology Data Exchange (ETDEWEB)
Chen, Bin-Hao, E-mail: binhao17@gmail.com [Department of Energy Application Engineering, Far East University, No. 49, Zhonghua Rd., Xinshi Dist., Tainan City 74448, Taiwan, ROC (China); Huang, Chien-Chung [Department of Hydrogen Energy and Fuel Cells, Green Energy and Eco-Technology Center, ITRI, No. 49, Zhonghua Rd., Xinshi Dist., Tainan City 74448, Taiwan, ROC (China); Yeh, Yen-Lian; Jang, Ming-Jyi [Department of Automation and Control Engineering, Far East University, No. 49, Zhonghua Rd., Xinshi Dist., Tainan City 74448, Taiwan, ROC (China)
2013-12-15
Highlights: •The hydrogen diffusion behavior in solid ZrNi alloy performs clearly by MD. •Shear and Young’s modulus agree with the experiment study very well. •Current model can apply to hydrogen-tech material development. -- Abstract: Hydrogen storage is an important topic because of its relevance to the future energy economy. Hydrogen diffusivity in materials plays an important role in hydrogen technology both for hydrogen separation and hydrogen storage. To clarify the mechanism of the rate-controlling step, diffusion mechanism of hydrogen in metallic materials is studied by molecular dynamics method. This study performs semi-empirical-quantum molecular dynamic simulations in order to clarify hydrogen atom diffusion behavior in ZrNi alloys materials. We investigate the mechanical properties change associated with temperature variation for ZrNi base alloys and also consider the influence of materials micro-structure change of hydrogen diffusion. Finally, current work presents a theoretically prediction of dynamical diffusion coefficient to compare diffusion kinetics of crystalline and amorphous structure.
Wettability of zirconium diboride ceramics by Ag, Cu and their alloys with Zr
International Nuclear Information System (INIS)
Muolo, M.L.; Ferrera, E.; Novakovic, R.; Passerone, A.
2003-01-01
Sintered ZrB 2 ceramics, pure and with 4 wt.% Ni as sintering aid, have been tested in contact with liquid Ag, Cu, Ag-Cu and Ag-Cu-Zr. ''Pure'' ZrB 2 ceramics are wetted by Ag-Zr alloys, and ZrB 2 /Ni ceramics also by pure Cu. The wetting behaviour is briefly discussed in terms of existing wetting theories
Directory of Open Access Journals (Sweden)
Sungkono Sungkono
2015-07-01
Full Text Available KARAKTERISTIK MIKROSTRUKTUR DAN FASA PADUAN Zr-0,3%Nb-0,5%Fe-0,5%Cr PASCA PERLAKUAN PANAS DAN PENGEROLAN DINGIN. Logam paduan Zr-Nb-Fe-Cr dikembangkan sebagai material kelongsong elemen bakar dengan fraksi bakar tinggi untuk reaktor daya maju. Dalam penelitian ini telah dibuat paduan Zr-0,3%Nb-0,5%Fe-0,5%Cr yang mendapat perlakuan panas pada temperatur 650 dan 750°C dengan waktu penahanan 1–2 jam. Tujuan penelitian adalah mendapatkan karakter paduan Zr-0,3%Nb-0,5%Fe-0,5%Cr pasca perlakuan panas dan pengerolan dingin yaitu mikrostruktur, struktur kristal dan fasa-fasa yang ada dalam paduan. Hasil penelitian menunjukkan bahwa paduan Zr-0,3%Nb-0,5%Fe-0,5%Cr pasca perlakuan panas (650ºC, 1-2 jam mempunyai struktur butir ekuiaksial dengan ukuran butir bertambah besar seiring dengan bertambahnya waktu penahanan. Sementara itu, pasca perlakuan panas (750ºC, 1-2 jam terjadi perubahan mikrostruktur paduan dari butir ekuiaksial dan kolumnar menjadi butir ekuiaksial lebih besar. Paduan Zr-0,3%Nb-0,5%Fe-0,5%Cr pasca perlakuan panas (650°C, 1 jam dan (750°C, 1 jam tidak dapat dirol dingin dengan reduksi tebal 5 – 10%, sedangkan pasca perlakuan panas (650ºC, 2 jam dan (750°C, 1.5-2 jam mampu menerima deformasi dingin dengan reduksi ketebalan 5-10% tanpa mengalami keretakan. Senyawa Zr2Fe, ZrCr2 dan FeCr teridentifikai dari hasil uji kristalografi paduan Zr-0,3%Nb-0,5%Fe-0,5%Cr. MICROSTRUCTURE AND PHASE CHARACTERISTICSOF Zr-0.3%Nb-0.5%Fe-0.5%Cr ALLOY POST HEAT TREATMENT AND COLD ROLLING. Zr-Nb-Fe-Cr alloys was developed as fuel elements cladding with high burn up for advanced power reactors. In this research has been made of Zr-0.3% Nb-0.5% Fe-0.5% Cr alloy were heat treated with varying temperatures at650 and 750°C for 1 until 2 hours. The objectives of this research was to obtain the character of Zr-0.3% Nb-0.5% Fe-0.5% Cr alloy post heat treatment and cold rolling, microstructure nomenclature, crystal structure and phases that presents in the
The corrosion properties of Zr-Cr-NM alloy metallic waste form for longterm disposal
Energy Technology Data Exchange (ETDEWEB)
Han, Seung Youb; Jang, Seon Ah; Eun, Hee Chul; Choi, Jung Hoon; Lee, Ki Rak; Park, Hwan Seo; Ahn, Do Hee [Korea Atomic Energy Research Institute, Daejeon (Korea, Republic of)
2017-06-15
KAERI is conducting research on spent cladding hulls and additive metals to generate a solidifcation host matrix for the noble metal fssion product waste in anode sludge from the electro-refning process to minimize the volume of waste that needs to be disposed of. In this study, alloy compositions Zr-17Cr, Zr-22Cr, and Zr-27Cr were prepared with or without eight noble metals representing fuel waste using induction melting. The microstructures of the resulting alloys were characterized and electrochemical corrosion tests were conducted to evaluate their corrosion characteristics. All the compositions had better corrosion characteristics than other Zr-based alloys that were evaluated for comparison. Analysis of the leach solution after the corrosion test of the Zr-22Cr-8NM specimen indicated that the noble metals were not leached during corrosion under 500 mV imposed voltage, which simulates a highly oxidizing disposal environment. The results of this study confrm that Zr-Cr based compositions will likely serve as chemically stable waste forms.
International Nuclear Information System (INIS)
Conway, J.B.; Stentz, R.H.; Berling, J.T.
1974-11-01
Short-term tensile and low-cycle fatigue data are reported for five advance Cu-base alloys: Sputtered Zr--Cu as received, sputtered Zr--Cu heat-treated, Glidcop AL-10, and alloys 1-1A and 1-1B. Tensile tests were performed in argon at 538 0 C using an axial strain rate of 0.002/s. Yield strength and ultimate tensile strength data are reported along with reduction in area values. Axial strain controlled low-cycle fatigue tests were performed in argon at 538 0 C using an axial strain rate of 0.002/s to define the fatigue life over the range from 100 to 3000 cycles for the five materials studied. Fatigue characteristics of the NASA 1-1A and NASA 1-1B compositions are identical and represent fatigue life values which are much greater than those for the other materials tested. The effect of temperature on NASA 1-1B alloy at a strain rate of 0.002/s and effect of strain rates of 0.0004 and 0.01/s at 538 0 C were evaluated. Hold-time data are reported for the NASA 1-1B alloy at 538 0 C using 5 minute hold periods in tension only and compression only at two different strain range values. (U.S.)
CB1 and CB2 receptors are novel molecular targets for Tamoxifen and 4OH-Tamoxifen
International Nuclear Information System (INIS)
Prather, Paul L.; FrancisDevaraj, FeAna; Dates, Centdrika R.; Greer, Aleksandra K.; Bratton, Stacie M.; Ford, Benjamin M.; Franks, Lirit N.; Radominska-Pandya, Anna
2013-01-01
Highlights: •Tamoxifen produces cytotoxicity via estrogen-receptor (ER) independent mechanisms. •Tamoxifen binds to CB1 and CB2 cannabinoid receptors and acts as an inverse agonist. •CB1 and CB2 receptors are novel molecular targets for Tamoxifen. •ER-independent effects for Tamoxifen may be mediated via CB1 and/or CB2 receptors. -- Abstract: Tamoxifen (Tam) is classified as a selective estrogen receptor modulator (SERM) and is used for treatment of patients with ER-positive breast cancer. However, it has been shown that Tam and its cytochrome P450-generated metabolite 4-hydroxy-Tam (4OH-Tam) also exhibit cytotoxic effects in ER-negative breast cancer cells. These observations suggest that Tam and 4OH-Tam can produce cytotoxicity via estrogen receptor (ER)-independent mechanism(s) of action. The molecular targets responsible for the ER-independent effects of Tam and its derivatives are poorly understood. Interestingly, similar to Tam and 4OH-Tam, cannabinoids have also been shown to exhibit anti-proliferative and apoptotic effects in ER-negative breast cancer cells, and estrogen can regulate expression levels of cannabinoid receptors (CBRs). Therefore, this study investigated whether CBRs might serve as novel molecular targets for Tam and 4OH-Tam. We report that both compounds bind to CB1 and CB2Rs with moderate affinity (0.9–3 μM). Furthermore, Tam and 4OH-Tam exhibit inverse activity at CB1 and CB2Rs in membrane preparations, reducing basal G-protein activity. Tam and 4OH-Tam also act as CB1/CB2R-inverse agonists to regulate the downstream intracellular effector adenylyl cyclase in intact cells, producing concentration-dependent increases in intracellular cAMP. These results suggest that CBRs are molecular targets for Tam and 4OH-Tam and may contribute to the ER-independent cytotoxic effects reported for these drugs. Importantly, these findings also indicate that Tam and 4OH-Tam might be used as structural scaffolds for development of novel
CB1 and CB2 receptors are novel molecular targets for Tamoxifen and 4OH-Tamoxifen
Energy Technology Data Exchange (ETDEWEB)
Prather, Paul L. [Department of Pharmacology and Toxicology, College of Medicine, University of Arkansas for Medical Sciences, 4301 W. Markham, Little Rock, AR 72205 (United States); FrancisDevaraj, FeAna; Dates, Centdrika R.; Greer, Aleksandra K.; Bratton, Stacie M. [Department of Biochemistry and Molecular Biology, College of Medicine, University of Arkansas for Medical Sciences, 4301 W. Markham, Little Rock, AR 72205 (United States); Ford, Benjamin M.; Franks, Lirit N. [Department of Pharmacology and Toxicology, College of Medicine, University of Arkansas for Medical Sciences, 4301 W. Markham, Little Rock, AR 72205 (United States); Radominska-Pandya, Anna, E-mail: RadominskaAnna@uams.edu [Department of Biochemistry and Molecular Biology, College of Medicine, University of Arkansas for Medical Sciences, 4301 W. Markham, Little Rock, AR 72205 (United States)
2013-11-15
Highlights: •Tamoxifen produces cytotoxicity via estrogen-receptor (ER) independent mechanisms. •Tamoxifen binds to CB1 and CB2 cannabinoid receptors and acts as an inverse agonist. •CB1 and CB2 receptors are novel molecular targets for Tamoxifen. •ER-independent effects for Tamoxifen may be mediated via CB1 and/or CB2 receptors. -- Abstract: Tamoxifen (Tam) is classified as a selective estrogen receptor modulator (SERM) and is used for treatment of patients with ER-positive breast cancer. However, it has been shown that Tam and its cytochrome P450-generated metabolite 4-hydroxy-Tam (4OH-Tam) also exhibit cytotoxic effects in ER-negative breast cancer cells. These observations suggest that Tam and 4OH-Tam can produce cytotoxicity via estrogen receptor (ER)-independent mechanism(s) of action. The molecular targets responsible for the ER-independent effects of Tam and its derivatives are poorly understood. Interestingly, similar to Tam and 4OH-Tam, cannabinoids have also been shown to exhibit anti-proliferative and apoptotic effects in ER-negative breast cancer cells, and estrogen can regulate expression levels of cannabinoid receptors (CBRs). Therefore, this study investigated whether CBRs might serve as novel molecular targets for Tam and 4OH-Tam. We report that both compounds bind to CB1 and CB2Rs with moderate affinity (0.9–3 μM). Furthermore, Tam and 4OH-Tam exhibit inverse activity at CB1 and CB2Rs in membrane preparations, reducing basal G-protein activity. Tam and 4OH-Tam also act as CB1/CB2R-inverse agonists to regulate the downstream intracellular effector adenylyl cyclase in intact cells, producing concentration-dependent increases in intracellular cAMP. These results suggest that CBRs are molecular targets for Tam and 4OH-Tam and may contribute to the ER-independent cytotoxic effects reported for these drugs. Importantly, these findings also indicate that Tam and 4OH-Tam might be used as structural scaffolds for development of novel
Manivasagam, Geetha; Anbarasan, V.; Kamachi Mudali, U.; Raj, Baldev
2011-09-01
This article reports the development, microstructure, and corrosion behavior of two new alloys such as Ti-4Nb-4Zr and Ti-2Nb-2Zr in boiling nitric acid environment. The corrosion test was carried out in the liquid, vapor, and condensate phases of 11.5 M nitric acid, and the potentiodynamic anodic polarization studies were performed at room temperature for both alloys. The samples subjected to three-phase corrosion testing were characterized using scanning electron microscopy (SEM) and energy-dispersive X-ray microanalysis (EDAX). As Ti-2Nb-2Zr alloy exhibited inferior corrosion behavior in comparison to Ti-4Nb-4Zr in all three phases, weldability and heat treatment studies were carried out only on Ti-4Nb-4Zr alloy. The weldability of the new alloy was evaluated using tungsten inert gas (TIG) welding processes, and the welded specimen was thereafter tested for its corrosion behavior in all three phases. The results of the present investigation revealed that the newly developed near alpha Ti-4Nb-4Zr alloy possessed superior corrosion resistance in all three phases and excellent weldability compared to conventional alloys used for nitric acid application in spent nuclear reprocessing plants. Further, the corrosion resistance of the beta heat-treated Ti-4Nb-4Zr alloy was superior when compared to the sample heat treated in the alpha + beta phase.
International Nuclear Information System (INIS)
Yu, J.; Jiang, C.; Zhang, Y.
2017-01-01
This report summarizes the progress on modeling hydrogen diffusivity in Zr-based alloys. The presence of hydrogen (H) can detrimentally affect the mechanical properties of many metals and alloys. To mitigate these detrimental effects requires fundamental understanding of the thermodynamics and kinetics governing H pickup and hydride formation. In this work, we focus on H diffusion in Zr-based alloys by studying the effects of alloying elements and stress, factors that have been shown to strongly affect H pickup and hydride formation in nuclear fuel claddings. A recently developed accelerated kinetic Monte Carlo method is used for the study. It is found that for the alloys considered here, H diffusivity depends weakly on composition, with negligible effect at high temperatures in the range of 600-1200 K. Therefore, the small variation in compositions of these alloys is likely not a major cause of the very different H pickup rates. In contrast, stress strongly affects H diffusivity. This effect needs to be considered for studying hydride formation and delayed hydride cracking.
Energy Technology Data Exchange (ETDEWEB)
Yu, J. [Idaho National Lab. (INL), Idaho Falls, ID (United States); Jiang, C. [Idaho National Lab. (INL), Idaho Falls, ID (United States); Zhang, Y. [Idaho National Lab. (INL), Idaho Falls, ID (United States)
2017-06-01
This report summarizes the progress on modeling hydrogen diffusivity in Zr-based alloys. The presence of hydrogen (H) can detrimentally affect the mechanical properties of many metals and alloys. To mitigate these detrimental effects requires fundamental understanding of the thermodynamics and kinetics governing H pickup and hydride formation. In this work, we focus on H diffusion in Zr-based alloys by studying the effects of alloying elements and stress, factors that have been shown to strongly affect H pickup and hydride formation in nuclear fuel claddings. A recently developed accelerated kinetic Monte Carlo method is used for the study. It is found that for the alloys considered here, H diffusivity depends weakly on composition, with negligible effect at high temperatures in the range of 600-1200 K. Therefore, the small variation in compositions of these alloys is likely not a major cause of the very different H pickup rates. In contrast, stress strongly affects H diffusivity. This effect needs to be considered for studying hydride formation and delayed hydride cracking.
Similar and dissimilar friction welding of Zr-Cu-Al bulk glassy alloys
International Nuclear Information System (INIS)
Shin, Hyung-Seop; Park, Jung-Soo; Jung, Yoon-Chul; Ahn, Jung-Ho; Yokoyama, Yoshihiko; Inoue, Akihisa
2009-01-01
The friction welding of three kinds of Zr-Cu-Al bulk glassy alloys (BGAs) which show eutectic or hypoeutectic compositions to similar and dissimilar BGAs and crystalline metals has been tried. The shape and volume of the protrusion formed at the weld interface were investigated. In order to characterize the friction welded interface, micrographic observation and X-ray diffraction analysis on the weld cross-section were carried out. A successful joining of Zr-Cu-Al bulk glassy alloys to similar and dissimilar BGAs was achieved without occurrence of crystallizations at the weld interface through the precise control of friction conditions. In addition, the joining of Zr 50 Cu 40 Al 10 BGA to crystalline alloys was tried, but it was only successful for specific material combinations. The residual strength after welding of dissimilar BGAs was evaluated by the four-point bending test.
Samuel, Sonia; Nag, Soumya; Nasrazadani, Seifollah; Ukirde, Vaishali; El Bouanani, Mohamed; Mohandas, Arunesh; Nguyen, Kytai; Banerjee, Rajarshi
2010-09-15
While direct metal deposition of metallic powders, via laser deposition, to form near-net shape orthopedic implants is an upcoming and highly promising technology, the corrosion resistance and biocompatibility of such novel metallic biomaterials is relatively unknown and warrants careful investigation. This article presents the results of some initial studies on the corrosion resistance and in vitro response of laser-deposited Ti-Nb-Zr-Ta alloys. These new generation beta titanium alloys are promising due to their low elastic modulus as well as due the fact that they comprise of completely biocompatible alloying elements. The results indicate that the corrosion resistance of these laser-deposited alloys is comparable and in some cases even better than the currently used commercially-pure (CP) titanium (Grade 2) and Ti-6Al-4V ELI alloys. The in vitro studies indicate that the Ti-Nb-Zr-Ta alloys exhibit comparable cell proliferation but enhanced cell differentiation properties as compared with Ti-6Al-4V ELI. (c) 2010 Wiley Periodicals, Inc.
Creep behavior and threshold stress of an extruded Al-6Mg-2Sc-1Zr alloy
International Nuclear Information System (INIS)
Deshmukh, S.P.; Mishra, R.S.; Kendig, K.L.
2004-01-01
Creep experiments were performed on extruded Al-6Mg-2Sc-1Zr (wt.%) alloy in a temperature range of 423-533 K. A threshold type creep behavior was measured and explained by observed dislocation-particle interactions. The experimental threshold stress values at various temperatures were compared with existing theoretical models. None of the available models could account for the decrease in threshold creep strength with increasing temperature
Low silicon U(Al,Si)3 stabilization by Zr addition
International Nuclear Information System (INIS)
Pizarro, L.M.; Alonso, P.R.; Rubiolo, G.H.
2009-01-01
Previous knowledge states that (U,Zr)Al 3 and U(Al,Si) 3 phases with Zr and Si content higher than 6 at.% (7.7 wt%) and 4 at.% (1.4 wt%), respectively, does not partially transform to UAl 4 at 600 o C. In this work, four alloys within the quaternary system U-Al-Si-Zr were made with a fixed nominal 0.18 at.% (0.1 wt%) Si content in order to assess the synergetic effect of both Zr and Si alloying elements to the thermodynamic stability of the (U,Zr)(Al,Si) 3 phase. Heat treatments at 600 deg. C were undertaken and samples were analyzed by means of XRD, EPMA and EDS techniques. A remarkable conclusion is that addition of 0.3 at.% Si in the (U,Zr)(Al,Si) 3 phase reduces in 2.7 at.% the necessary Zr content to inhibit its transformation to U(Al,Si) 4 .
Effect of heat treatments on precipitate microstructure and mechanical properties of CuCrZr alloy
Singh, B.N; Edwards, D.J.; Tähtinen, S.
2004-01-01
A number of specimens of CuCrZr alloy was prime aged and then overaged at 600oC for 1, 2 and 4 hours and for 4 hours at 700 and 850oC. After different heat treatments, both the precipitate microstructure and mechanical properties were characterized.Mechanical properties were determined at 50 and 300oC. Some selected specimens in the prime aged as well as overaged conditions were irradiated in the BR-2 reactor at Mol at 60 and 300oC to a displacement dose level of ~0.3 dpa. Irradiated specimen...
Microstructure, mechanical and corrosion properties of Mg-Dy-Gd-Zr alloys for medical applications.
Yang, L; Huang, Y; Feyerabend, F; Willumeit, R; Mendis, C; Kainer, K U; Hort, N
2013-11-01
In previous investigations, a Mg-10Dy (wt.%) alloy with a good combination of corrosion resistance and cytocompatibility showed great potential for use as a biodegradable implant material. However, the mechanical properties of Mg-10Dy alloy are not satisfactory. In order to allow the tailoring of mechanical properties required for various medical applications, four Mg-10(Dy+Gd)-0.2Zr (wt.%) alloys were investigated with respect to microstructure, mechanical and corrosion properties. With the increase in Gd content, the number of second-phase particles increased in the as-cast alloys, and the age-hardening response increased at 200°C. The yield strength increased, while the ductility reduced, especially for peak-aged alloys with the addition of Gd. Additionally, with increasing Gd content, the corrosion rate increased in the as-cast condition owing to the galvanic effect, but all the alloys had a similar corrosion rate (~0.5 mm year(-1)) in solution-treated and aged condition. Copyright © 2013 Acta Materialia Inc. Published by Elsevier Ltd. All rights reserved.
Trotter, B Wesley; Nanda, Kausik K; Burgey, Christopher S; Potteiger, Craig M; Deng, James Z; Green, Ahren I; Hartnett, John C; Kett, Nathan R; Wu, Zhicai; Henze, Darrell A; Della Penna, Kimberly; Desai, Reshma; Leitl, Michael D; Lemaire, Wei; White, Rebecca B; Yeh, Suzie; Urban, Mark O; Kane, Stefanie A; Hartman, George D; Bilodeau, Mark T
2011-04-15
A new series of imidazopyridine CB2 agonists is described. Structural optimization improved CB2/CB1 selectivity in this series and conferred physical properties that facilitated high in vivo exposure, both centrally and peripherally. Administration of a highly selective CB2 agonist in a rat model of analgesia was ineffective despite substantial CNS exposure, while administration of a moderately selective CB2/CB1 agonist exhibited significant analgesic effects. Copyright © 2011 Elsevier Ltd. All rights reserved.
Preparation technology of 103Pd-110Agm composite alloy membranes
International Nuclear Information System (INIS)
Liu Zhuo; Chen Daming; Jin Xiaohai; Li Zhongyong; Guo Feihu; Qin Hongbin
2012-01-01
The preparation of 103 Pd- 110 Ag m alloy membranes was the basis for the production of 103 Pd- 125 I composite sources. Taking 103 Pd and 110 Ag m as trace elements, the method of non-electrolytical plating was chosen to prepare the alloy membrane. A γ-detector and electron microscope (SEM) were used for quantitative and qualitative analysis, respectively. The pre-treatment of the support before the preparation of Palladium-silver composite membranes was discussed in detail. It was found that when the concentration of PdCl 2 was between 0.5 and 2.0 mmol/L the result was good. The effects of various factors were investigated, including the proportion of Pd and Ag, the concentrations of the total metal, ammonium hydroxide hydrazine and ethylenediaminetetraacetic acid, temperature, the time, and the rotation speed. By improving the reaction conditions the alloy membrane with metallic luster was obtained. Besides, the presence of Pd and Ag was observed in the alloy membranes by qualitative analysis. (authors)
Energy Technology Data Exchange (ETDEWEB)
Yuan, Lin, E-mail: yuanlin@hit.edu.cn; Shi, Wenchao; Jiang, WenMao; Zhao, Zhe; Shan, Debin
2016-03-21
The light and heavy rare earth elements are added to the magnesium alloys to improve the strengths and the creep resistance. The age hardening behaviors of the extruded Mg–6Gd–4Y–Nd–0.7Zr alloy aged at 200, 225 and 250 °C were investigated. Tensile tests and creep tests of the extruded and extruded-T5 Mg–6Gd–4Y–Nd–0.7Zr were carried out at 150–300 °C. The relationship between the microstructure and the properties of the extruded-T5 Mg–6Gd–4Y–Nd–0.7Zr alloy was studied. The result shows that the extruded Mg–6Gd–4Y–Nd–0.7Zr (contained less than 10 wt% Gd) peak aged at 225 °C for 72 h has the excellent creep resistance and high strengths with the UTS more than 350 MPa from room temperature to 200 °C, which are correlative with the precipitates. The high dense and uniform distribution of β′ phase with good heat stability precipitates inhibiting the dislocation motion contributes to age hardening, accelerates the ageing hardening response and increases the creep resistance. The artificially aged (T5) at low temperature further creep tested and tensile tested at higher temperatures decreases the resistance to the dislocation motion and the grain boundary sliding, resulting in the reduction in creep properties and strengths of the extruded-T5 Mg–6Gd–4Y–Nd–0.7Zr alloy above 225 °C.
Origin of nondetectable x-ray diffraction peaks in nanocomposite CuTiZr alloys
DEFF Research Database (Denmark)
Jiang, Jianzhong; Kato, H.; Ohsuna, T.
2003-01-01
Microscopic structures of Cu60Ti10+xZr30-x (x=0 and 10) alloys have been investigated by transmission electron microscopy, x-ray diffraction (XRD) and differential scanning calorimeter (DSC). In the Cu60Ti10Zr30 samples annealed at 708 K for times ranging from 0 to 130 min, where the enthalpy...... of the first exothermic peak decreases by 80%, the corresponding XRD patterns still look similar to that for the as-prepared sample. However, the simulated XRD patterns for the pure Cu51Zr14 phase, which is the crystalline phase formed during the first exothermic reaction, with small grain sizes and defects...... clearly show a broadened amorphous-like feature. This might be the reason that no diffraction peaks from the nanocrystalline component were detected in the XRD patterns recorded for the as-cast or as-spun Cu60Ti10+xZr30-x (x=0 and 10) alloys and for the alloys annealed at lower temperatures, in which...
Wang, Shao-Ping; Xu, Jian
2017-04-01
Combining the high-entropy alloy (HEA) concept with property requirement for orthopedic implants, we designed a Ti 20 Zr 20 Nb 20 Ta 20 Mo 20 equiatomic HEA. The arc-melted microstructures, compressive properties and potentiodynamic polarization behavior in phosphate buffer solution (PBS) were studied in detail. It was revealed that the as-cast TiZrNbTaMo HEA consisted of dual phases with bcc structure, major bcc1 and minor bcc2 phases with the lattice parameters of 0.3310nm and 0.3379nm, respectively. As confirmed by nanoindentation tests, the bcc1 phase is somewhat harder and stiffer than the bcc2 phase. The TiZrNbTaMo HEA exhibited Young's modulus of 153GPa, Vickers microhardness of 4.9GPa, compressive yield strength of σ y =1390MPa and apparent plastic strain of ε p ≈6% prior to failure. Moreover, the TiZrNbTaMo HEA manifested excellent corrosion resistance in PBS, comparable to the Ti6Al4V alloy, and pitting resistance remarkably superior to the 316L SS and CoCrMo alloys. These preliminary advantages of the TiZrNbTaMo HEA over the current orthopedic implant metals in mechanical properties and corrosion resistance offer an opportunity to explore new orthopedic-implant alloys based on the TiZrNbTaMo concentrated composition. Copyright © 2016 Elsevier B.V. All rights reserved.
Investigation of reactivity between SiC and Nb-1Zr in planned irradiation creep experiments
Energy Technology Data Exchange (ETDEWEB)
Lewinsohn, C.A.; Hamilton, M.L.; Jones, R.H.
1997-08-01
Thermodynamic calculations and diffusion couple experiments showed that SiC and Nb-1Zr were reactive at the upper range of temperatures anticipated in the planned irradiation creep experiment. Sputter-deposited aluminum oxide (Al{sub 2}O{sub 3}) was selected as a diffusion barrier coating. Experiments showed that although the coating coarsened at high temperature it was an effective barrier for diffusion of silicon from SiC into Nb-1Zr. Therefore, to avoid detrimental reactions between the SiC composite and the Nb-1Zr pressurized bladder during the planned irradiation creep experiment, a coating of Al{sub 2}O{sub 3} will be required on the Nb-1Zr bladder.
Effects of Ce and Zr addition on microstructure and hardness of Al-Si-Cu-Mg alloy
International Nuclear Information System (INIS)
Bevilaqua, William Lemos; Reguly, Afonso; Froehlich, Andre Ronaldo; Stadtlander, Antonio Ricardo
2016-01-01
The effects of cerium and zirconium contents (0.3%-0.16%Zr; 0.3%-0.27%Zr e 0.3%-0.36%Zr) to aluminum alloy 354.0 was investigated by microstructural analysis and hardness measurements in as-cast and heat-treated conditions. The macrostructure show an excellent grain refinement for all Ce and Zr contents used. Additionally, the Cu-Ce reaction during solidification changes significantly the age hardening process of modified alloys. (author)
Time-temperature-transformation diagram of Zr-based Zr-Al-Cu-Ni metallic glasses
International Nuclear Information System (INIS)
Goh, T.T.; Li, Y.; Ng, S.C.
1996-01-01
The critical cooling rates R c for glass formation in four Zr-based Zr-Al-Cu-Ni alloys were determined using techniques developed by Uhlmann based on theories of homogeneous nucleation, crystal growth and transformation kinetics. It involves the construction of a time-temperature-transformation curve which requires the knowledge of the viscosity-temperature curve of the alloys. Two types of viscosity-temperature expressions, namely Andrade expression and Doolittle expression, were used to model the viscosity of the Zr-based alloys and the choice of the viscosity-temperature expression which gives the best estimate of the calculated time-temperature-transformation curve is discussed. (author)
Phase diagram of the Fe-Sn-Zr system at 800 °C
International Nuclear Information System (INIS)
Nieva, N.; Corvalán, C.; Jiménez, M.J.; Gómez, A.; Arreguez, C.; Joubert, J.-M.; Arias, D.
2017-01-01
New experimental results on the Fe-Sn-Zr phase diagram at 800 °C are presented, particularly in the central, Fe rich and Sn rich regions of the Gibbs triangle. Seven ternary alloys were designed, produced and examined by different techniques: optical and scanning electron microscopy, semi-quantitative microanalysis, quantitative microanalysis and X-ray diffraction. The results of this work and previous experimental data were used to determine the phase diagram section at 800 °C which contains at least five ternary compounds: Fe 6 Sn 6 Zr, Y, X′, θ and C36. - Highlights: •A phase diagram of Fe-Sn-Zr system at 800 °C is proposed. •The isothermal section of Fe-Sn-Zr system at 800 °C and that at 900 °C determined previously allow reliable extrapolations at low temperatures. •The study at different temperatures (900 °C and 800 °C in this case) is highly desirable because it allows the separation between enthalpic and entropic effects in a future Calphad modelling.
Phase diagram of the Fe-Sn-Zr system at 800 °C
Energy Technology Data Exchange (ETDEWEB)
Nieva, N. [Laboratorio de Física del Sólido, Departamento de Física, Facultad de Ciencias Exactas y Tecnología, Universidad Nacional de Tucumán (Argentina); Corvalán, C., E-mail: corvalan@cnea.gov.ar [Gerencia de Materiales, Comisión Nacional de Energía Atómica Argentina (CNEA), Universidad Nacional de Tres de Febrero, Argentina, CONICET, Consejo Nacional de Ciencia y Técnica (Argentina); Jiménez, M.J. [IFISUR, CONICET, Departamento de Física, Universidad Nacional del Sur, Bahía Blanca (Argentina); Gómez, A. [Grupo LMFAE – PPFAE, Centro Atómico Ezeiza, Comisión Nacional de Energía Atómica (Argentina); Arreguez, C. [Laboratorio de Física del Sólido, Departamento de Física, Facultad de Ciencias Exactas y Tecnología, Universidad Nacional de Tucumán (Argentina); Joubert, J.-M. [Chimie Métallurgique des Terres Rares (CMTR), Institut de Chimie et des Matériaux Paris-Est (ICMPE), CNRS, Université Paris-Est Créteil, 2-8 rue Henri Dunant, 94320 Thiais Cedex (France); Arias, D. [Instituto de Tecnología J. Sabato, Universidad Nacional de San Martín-CNEA (Argentina)
2017-04-15
New experimental results on the Fe-Sn-Zr phase diagram at 800 °C are presented, particularly in the central, Fe rich and Sn rich regions of the Gibbs triangle. Seven ternary alloys were designed, produced and examined by different techniques: optical and scanning electron microscopy, semi-quantitative microanalysis, quantitative microanalysis and X-ray diffraction. The results of this work and previous experimental data were used to determine the phase diagram section at 800 °C which contains at least five ternary compounds: Fe{sub 6}Sn{sub 6}Zr, Y, X′, θ and C36. - Highlights: •A phase diagram of Fe-Sn-Zr system at 800 °C is proposed. •The isothermal section of Fe-Sn-Zr system at 800 °C and that at 900 °C determined previously allow reliable extrapolations at low temperatures. •The study at different temperatures (900 °C and 800 °C in this case) is highly desirable because it allows the separation between enthalpic and entropic effects in a future Calphad modelling.
Sahoo, R. R.; Patra, A.; Karak, S. K.
2017-02-01
A high energy planetary ball-mill was employed to synthesize tungsten (W) based alloy with nominal composition of W79Ni10Ti5Nb5(ZrO2)1 (in wt. %) for 20 h with chrome steel as grinding media, toluene as process control agent (PCA) along with compaction at 500 MPa pressure for 5 mins and sintering at 1500°C for 2 h using Ar atmosphere. X-ray diffraction (XRD), Scanning electron microscopy (SEM), Energy dispersive spectroscopy (EDS), elemental mapping and Transmission electron microscopy (TEM) was used to study the phase formation, microstructure of both milled powder and consolidated alloy. The crystallite size of W in W79Ni10Ti5Nb5(ZrO2)1 powder was 37 nm, 14.7 nm at 10 h and 20 h of milling respectively and lattice strain enhances to 0.54% at 20 h of milling. The crystallite size reduction is more at 10 h of milling and the rate drop beyond 10 to 20 h of milling. The intense improvement in dislocation density was evident upto 10 h of milling and the rate decreases between 10 to 20 h of milling. Increase in the lattice parameter of tungsten in W79Ni10Ti5Nb5(ZrO2)1 alloy upto 0.09% was observed at 10 h of milling owing to severe stress assisted deformation followed by contraction upto 0.07% at 20 h of milling due to formation of solid solution. The large spherical particles at 0 h of milling transformed to elongated shape at 10 h of milling and finer morphology at 20 h of milling. The average particle size reduced from 100 µm to 4.5 µm with the progress of milling from 0 to 20 h. Formation of fine polycrystallites of W was revealed by bright field TEM analysis and the observed crystallite size from TEM study was well supported by the evaluated crystallite size from XRD. XRD pattern and SEM micrograph of sintered alloy revealed the formation of NbNi, Ni3Ti intermetallic phases. Densification of 91.5% was attained in the 20 h milled and sintered alloy. Mechanical behaviour of the sintered product was evaluated by hardness and wear study. W79Ni10Ti5Nb5(ZrO2)1 alloy
Energy Technology Data Exchange (ETDEWEB)
Kuroda, Pedro Akira Bazaglia [UNESP - Univ Estadual Paulista, Laboratório de Anelasticidade e Biomateriais, 17.033-360, Bauru, SP (Brazil); IBTN/Br – Institute of Biomaterials, Tribocorrosion and Nanomedicine, Brazilian Branch, 17.033-360 Bauru, SP (Brazil); Buzalaf, Marília Afonso Rabelo [USP – Universidade de São Paulo, Departamento de Ciências Biológicas, 17.012-901, Bauru, SP (Brazil); Grandini, Carlos Roberto, E-mail: betog@fc.unesp.br [UNESP - Univ Estadual Paulista, Laboratório de Anelasticidade e Biomateriais, 17.033-360, Bauru, SP (Brazil); IBTN/Br – Institute of Biomaterials, Tribocorrosion and Nanomedicine, Brazilian Branch, 17.033-360 Bauru, SP (Brazil)
2016-10-01
Titanium has an allotropic transformation around 883 °C. Below this temperature, the crystalline structure is hexagonal close-packed (α phase), changing to body-centered cubic (β phase). Zirconium has the same allotropic transformation around 862 °C. Molybdenum has body-centered cubic structure, being a strong β-stabilizer for the formation of titanium alloys. In this paper, the effect of substitutional molybdenum was analyzed on the structure, microstructure and selected mechanical properties of Ti-20 Zr-Mo (wt%) alloys to be used in biomedical applications. The samples were prepared by arc-melting and characterized by x-ray diffraction with subsequent refinement by the Rietveld method, optical and scanning electron microscopy. The mechanical properties were analyzed by Vickers microhardness and dynamic elasticity modulus. X-ray measurements and Rietveld analysis revealed the presence of α′ phase without molybdenum, α′ + α″ phases with 2.5 wt% of molybdenum, α″ + β phases with 5 and 7.5 wt% of molybdenum, and only β phase with 10 wt% of molybdenum. These results were corroborated by microscopy results, with a microstructure composed of grains of β phase and lamellae and needles of α′ and α″ phase in intra-grain the region. The hardness of the alloy was higher than the commercially pure titanium, due to the action of zirconium and molybdenum as hardening agents. The samples have a smaller elasticity modulus than the commercially pure titanium. - Highlights: • Ti-20Zr-Mo system alloys were developed. • β-Stabilizer effect of Zr in the presence of another β-stabilizer element • Alloys with low elastic modulus.
International Nuclear Information System (INIS)
Panicaud, B.; Grosseau-Poussard, J.-L.; Retraint, D.; Guérain, M.; Li, L.
2013-01-01
Highlights: ► Raman spectroscopy is performed to determine the stress evolution in a Zr/ZrO 2 system. ► Analytical relations are used to determine material characteristics. ► A specific modelling of the mechanical fields within the oxide is done. ► Relaxation and growth parameters are identified from an inverse method. - Abstract: In the present work, mechanical features are investigated in the case of ZrO 2 thermal oxide films growing on a Zr alloy at the temperature of 550 °C. The effects of a nanocrystallisation treatment on high temperature oxidation of a zirconium alloy are specifically studied. High temperature oxidation is performed in order to show benefits of such a nanocrystallisation on corrosion resistance and its influence on the mechanical fields. Experimental results obtained by Raman spectroscopy give the growth stress evolution in ZrO 2 films. Using a modelling of the system, both asymptotic forms and an optimization procedure are developed to determine the mechanical characteristic parameters of the system.
International Nuclear Information System (INIS)
Mirji, K.V.; Sheela; Saibaba, N.
2016-01-01
Nb master alloy, Zr2.5%Nb, Nb47%Ti, C-103, Nb1%Zr0.1%C, Nb5%Mo1%Zr0.1%C Nb10%W, Nb10%W2.5% Zr, Ta10%W etc. These alloys are produced by electron beam melting. Towards enhancement of melting capacity of the refractory and reactive metals and alloys, a collaborative programme has been taken up with BARC for indigenization of electron beam melting furnace of capacity 300 kW. The paper gives developments, details of parameters standardized and adopted at SMP/NFC along with the experience in production of refractory metals and their alloys. (author)
Effect of sulphur on the strengthening of a Zr-Nb alloy
International Nuclear Information System (INIS)
Chang, K.I.; Hong, S.I.
2008-01-01
The effect of sulphur on the strengthening and the thermally activated deformation of cold-worked Zr-1 Nb alloy was investigated. In the present study, the sulphur strengthening was observed even at room temperature unlike the previous study of Ferrer et al. The flow stress increased by 65 MPa at room temperature with the addition of sulphur as little as 20 ppm. With further increase of sulphur content up to 300 ppm, negligible change of the flow stress was observed. The additive strengthening behavior in which the entire stress-strain curve shift upward by the friction stress due to the addition of sulphur was observed in the Zr-Nb alloy of the present study. The activation volume decreased slightly (from 110b 3 to 80b 3 ) with the addition of 300 ppm sulphur at room temperature. The rate-controlling mechanism of the deformation can best be explained by the dislocation interaction mechanism in which the segregation of alloying elements such as oxygen and sulphur atoms affects the activation length of dislocations
Energy Technology Data Exchange (ETDEWEB)
Wang Yan [Key Laboratory of Liquid Structure and Heredity of Materials, Shandong University, 73 Jingshi Road, Jinan 250061 (China); School of Materials Science and Engineering, University of Jinan, 106 Jiwei Road, Jinan 250022 (China); Chen Xiuxiu [School of Materials Science and Engineering, University of Jinan, 106 Jiwei Road, Jinan 250022 (China); Geng Haoran [School of Materials Science and Engineering, University of Jinan, 106 Jiwei Road, Jinan 250022 (China)], E-mail: mse_wangy@ujn.edu.cn; Yang Zhongxi [Key Laboratory of Liquid Structure and Heredity of Materials, Shandong University, 73 Jingshi Road, Jinan 250061 (China); School of Materials Science and Engineering, University of Jinan, 106 Jiwei Road, Jinan 250022 (China)
2009-04-17
In the present paper, the effect of Nb and different rotation speeds on the amorphization and crystallization of Zr{sub 66.7-x}Cu{sub 33.3}Nb{sub x} (x = 0, 2, 4) alloys during mechanical alloying has been investigated using X-ray diffraction (XRD), transmission electron microscopy (TEM), scanning electron microscopy (SEM), and differential scanning calorimetry (DSC). The results show that the minor addition of Nb can shorten the start time of the amorphization reaction, improve the glass forming ability of Zr-Cu alloys, but cannot promote the formation of a single amorphous phase at a lower rotation speed of 200 rpm. The glass forming ability of the Zr{sub 66.7-x}Cu{sub 33.3}Nb{sub x} (x = 0, 2, 4) alloys increases with increasing Nb additions. At a higher rotation speed of 350 rpm, a single amorphous phase of Zr{sub 66.7-x}Cu{sub 33.3}Nb{sub x} (x = 0, 2, 4) can be successfully fabricated. Moreover, the Nb addition into Zr-Cu alloys can accelerate the amorphization process and improve the stability of the amorphous phase against the mechanically induced crystallization. Furthermore, the amorphous Zr{sub 66.7}Cu{sub 33.3} phase gradually transforms into a metastable fcc-Zr{sub 2}Cu phase with increasing milling time.
International Nuclear Information System (INIS)
Vasilescu, C.; Drob, P.; Vasilescu, E.; Demetrescu, I.; Ionita, D.; Prodana, M.; Drob, S.I.
2011-01-01
Graphical abstract: Display Omitted Research highlights: → EIS spectra for Ti6Al4V1Zr alloy were fitted with one time constant electric equivalent circuit. → For covered alloy the equivalent circuit contains two time constants. → Resistances of films increased in time revealing the improvement of the alloy protection capacity. → Surface roughness significantly increased by apatite formation, being favourably to cell adhesion. - Abstract: A new titanium base Ti-6Al-4V-1Zr alloy covered with hydroxyapatite or bovine serum albumin/hydroxyapatite was characterized in this paper in order to be used as implant material. Following techniques were used: linear polarization, electrochemical impedance spectroscopy, scanning electronic microscopy, Fourier transform infrared spectroscopy and atomic force microscopy. For HA or BSA/HA covered alloy, the electric equivalent circuit contains two time constants (for the passive film and for coatings). The resistance of the protective films increased in time and BSA/HA coating was slightly rougher than HA coating, this situation being favourably to the cell adhesion.
Energy Technology Data Exchange (ETDEWEB)
Vasilescu, C.; Drob, P. [Institute of Physical Chemistry ' Ilie Murgulescu' of Romanian Academy, Spl. Independentei 202, P.O. Box 12-194, 060021 Bucharest (Romania); Vasilescu, E., E-mail: ec_vasilescu@yahoo.co [Institute of Physical Chemistry ' Ilie Murgulescu' of Romanian Academy, Spl. Independentei 202, P.O. Box 12-194, 060021 Bucharest (Romania); Demetrescu, I.; Ionita, D.; Prodana, M. [Politehnica University of Bucharest, Faculty of Applied Chemistry and Material Science, Str. Polizu 1-7, 011061 Bucharest (Romania); Drob, S.I. [Institute of Physical Chemistry ' Ilie Murgulescu' of Romanian Academy, Spl. Independentei 202, P.O. Box 12-194, 060021 Bucharest (Romania)
2011-03-15
Graphical abstract: Display Omitted Research highlights: {yields} EIS spectra for Ti6Al4V1Zr alloy were fitted with one time constant electric equivalent circuit. {yields} For covered alloy the equivalent circuit contains two time constants. {yields} Resistances of films increased in time revealing the improvement of the alloy protection capacity. {yields} Surface roughness significantly increased by apatite formation, being favourably to cell adhesion. - Abstract: A new titanium base Ti-6Al-4V-1Zr alloy covered with hydroxyapatite or bovine serum albumin/hydroxyapatite was characterized in this paper in order to be used as implant material. Following techniques were used: linear polarization, electrochemical impedance spectroscopy, scanning electronic microscopy, Fourier transform infrared spectroscopy and atomic force microscopy. For HA or BSA/HA covered alloy, the electric equivalent circuit contains two time constants (for the passive film and for coatings). The resistance of the protective films increased in time and BSA/HA coating was slightly rougher than HA coating, this situation being favourably to the cell adhesion.
Microstructure and mechanical properties of Al-Cu-Mg-Mn-Zr alloy with trace amounts of Ag
International Nuclear Information System (INIS)
Liu Xiaoyan; Pan Qinglin; Lu Congge; He Yunbin; Li Wenbin; Liang Wenjie
2009-01-01
The microstructure and mechanical properties of Al-Cu-Mg-(Ag)-Mn-Zr alloys were studied by means of tensile testing, optical microscopy (OM), scanning electron microscopy (SEM) and transmission electron microscopy (TEM). The results show that small additions of Ag to Al-Cu-Mg-Mn-Zr alloy can accelerate the hardening effect of the aged alloy and reduce the time to peak-aged. The mechanical properties can be improved both at room temperature and at elevated temperatures, which is attributed to the fine and uniform plate-like Ω precipitates. Meanwhile the ductility of the studied alloys remains at relatively high level. The major strengthening phases of the Ag-free alloy are θ' and less S', while that of Al-Cu-Mg-Mn-Zr alloy containing trace amounts of Ag are Ω and less θ'.
Chou, Da-Tren; Hong, Daeho; Saha, Partha; Ferrero, Jordan; Lee, Boeun; Tan, Zongqing; Dong, Zhongyun; Kumta, Prashant N
2013-11-01
This study introduces a class of biodegradable Mg-Y-Ca-Zr alloys novel to biological applications and presents evaluations for orthopedic and craniofacial implant applications. Mg-Y-Ca-Zr alloys were processed using conventional melting and casting techniques. The effects of increasing Y content from 1 to 4 wt.% as well as the effects of T4 solution treatment were assessed. Basic material phase characterization was conducted using X-ray diffraction, optical microscopy and scanning electron microscopy. Compressive and tensile tests allowed for the comparison of mechanical properties of the as-cast and T4-treated Mg-Y-Ca-Zr alloys to pure Mg and as-drawn AZ31. Potentiodynamic polarization tests and mass loss immersion tests were used to evaluate the corrosion behavior of the alloys. In vitro cytocompatibility tests on MC3T3-E1 pre-osteoblast cells were also conducted. Finally, alloy pellets were implanted into murine subcutaneous tissue to observe in vivo corrosion as well as local host response through H&E staining. SEM/EDS analysis showed that secondary phase intermetallics rich in yttrium were observed along the grain boundaries, with the T4 solution treatment diffusing the secondary phases into the matrix while increasing the grain size. The alloys demonstrated marked improvement in mechanical properties over pure Mg. Increasing the Y content contributed to improved corrosion resistance, while solution-treated alloys resulted in lower strength and compressive strain compared to as-cast alloys. The Mg-Y-Ca-Zr alloys demonstrated excellent in vitro cytocompatibility and normal in vivo host response. The mechanical, corrosion and biological evaluations performed in this study demonstrated that Mg-Y-Ca-Zr alloys, especially with the 4 wt.% Y content, would perform well as orthopedic and craniofacial implant biomaterials. Copyright © 2013 Acta Materialia Inc. Published by Elsevier Ltd. All rights reserved.
Energy Technology Data Exchange (ETDEWEB)
Chęcmanowski, Jacek Grzegorz, E-mail: jacek.checmanowski@pwr.wroc.pl [Wrocław University of Technology, Faculty of Chemistry, Wybrzeże Wyspiańskiego 27, 50-370 Wrocław (Poland); Szczygieł, Bogdan, E-mail: bogdan.szczygiel@pwr.wroc.pl [Wrocław University of Technology, Faculty of Chemistry, Wybrzeże Wyspiańskiego 27, 50-370 Wrocław (Poland)
2013-05-15
One-, three- and five-layer protective ZrO{sub 2} coatings were deposited on a FeCrAl alloy base by the sol–gel method. A zirconium(IV) isopropoxide isopropanol complex was used as the zirconium precursor. It has been shown that zirconium in the amount of 0.3–0.5 wt.% improves the resistance of FeCrAl alloy in high-temperature oxidation conditions (in air at T = 1060 °C for t = 2400 h). Even a very low Zr content affects the morphology, porosity and composition of the forming scale (SEM, EDS). An analysis of the chemical composition of the material after oxidation indicated to-core Zr diffusion. The presence of zirconium prevents catastrophic corrosion of the FeCrAl alloy during oxidation. In the case of the alloy without the reactive element (Zr) this type of corrosion occurred after about 1800 h. The oxidation of the FeCrAl alloy covered with ZrO{sub 2} coatings proceeds in three stages. In the first stage, lasting about 50 h, the mass of the sample grows rapidly, then for 700 h the mass changes minimally and in the third stage the oxidation proceeds according to a parabolic dependence. The presence of Zr on the surface of the FeCrAl alloy significantly contributes to the protective effect of the coatings. - Highlights: ► Multilayer ZrO{sub 2} coatings were deposited on FeCrAl alloy by sol–gel method. ► Study of alloy composition indicates to-core Zr diffusion in high temperature. ► Even very low content affects morphology and porosity of forming scale. ► Zirconium improves the resistance of FeCrAl alloy in high temperature conditions. ► Presence of ZrO{sub 2} prevents catastrophic corrosion of FeCrAl alloy during oxidation.
Characterization of electrolytic HA/ZrO{sub 2} double layers coatings on Ti-6Al-4V implant alloy
Energy Technology Data Exchange (ETDEWEB)
Yen, S.K. [Department of Materials Engineering, National Chung Hsing University, Taichung 40227, Taiwan (China)]. E-mail: skyen@dragon.nchu.edu.tw; Chiou, S.H. [Graduate Institute of Veterinary Microbiology, National Chung Hsing University, Taichung 40227, Taiwan (China); Wu, S.J. [Department of Materials Engineering, National Chung Hsing University, Taichung 40227, Taiwan (China); Chang, C.C. [Department of Materials Engineering, National Chung Hsing University, Taichung 40227, Taiwan (China); Lin, S.P. [Department of Materials Engineering, National Chung Hsing University, Taichung 40227, Taiwan (China); Lin, C.M. [Department of Materials Engineering, National Chung Hsing University, Taichung 40227, Taiwan (China)
2006-01-15
Hydroxyapatite (HA) coating was proved having bioactive property and hence improving the bonding strength on bone tissue without inducing the growth of fiber tissue. However, the weak adhesion between HA and metal implants is still the major problem. In this study, a novel method of electrolytic HA/ZrO{sub 2} double layers coating was successfully conducted on F-136 Ti-6Al-4V implant alloy in ZrO{sub 2}(NO{sub 3}){sub 2} aqueous solution and subsequently in the mixed solution of Ca(NO{sub 3}){sub 2} and NH{sub 4}H{sub 2}PO{sub 4}. After annealing at 400 deg. C, 500 deg. C and 600 deg. C for 4 h in air, the coated specimens were evaluated by X-ray diffraction analyses, surface morphology observations, scratch tests, dynamic polarization tests, immersion tests and cell culture assays. In addition to corrosion resistance, the adhesion strength of electrolytic deposited HA on Ti alloy was dramatically improved from the critical scratch load 2 N to 32 N by adding the intermediate electrolytic deposition of ZrO{sub 2}, which showed the strong bonding effects between Ti alloy substrate and HA coating. Based on the cell morphology and cell proliferation data, HA/ZrO{sub 2} double layers coating revealed the better substrate for the adhesion and proliferation of osteoblasts than the others. It was also found that the crystallization of HA had positive effect on the proliferation of osteoblasts.
Effects of Zr alloying on the microstructure and magnetic properties of Alnico permanent magnets
Rehman, Sajjad Ur; Ahmad, Zubair; Haq, A. ul; Akhtar, Saleem
2017-11-01
Alnico-8 permanent magnets were produced through casting and subsequent thermal treatment process. Magnetic alloy of nominal composition 32.5 Fe-7.5 Al-1.0 Nb-35.0 Co-4.0 Cu-14.0 Ni-6.0 Ti were prepared by arc melting and casting technique. The Zr was added to 32.5 Fe-7.5 Al-1.0 Nb-35.0 Co-4.0 Cu-14.0 Ni-6.0 Ti alloy ranging from 0.3 to 0.9 wt%. The magnets were developed by employing two different heat treatment cycles known as conventional treatment and thermo-magnetic annealing treatment. The samples were characterized by X-ray diffraction method, Scanning electron microscope and magnetometer by plotting magnetic hysteresis demagnetization curves. The results indicate that magnetic properties are strongly depended upon alloy chemistry and process. The 0.6 wt% Zr added alloys yielded the best magnetic properties among the studied alloys. The magnetic properties obtained through conventional heat treatment are Hc = 1.35 kOe, Br = 5.2 kG and (BH)max = 2 MGOe. These magnetic properties were enhanced to Hc = 1.64 kOe, Br = 6.3 kG and (BH)max = 3.7 MGOe by thermo-magnetic annealing treatment.
Precipitation sequence and kinetics in a Mg-4Sm-1Zn-0.4Zr (wt%) alloy
Energy Technology Data Exchange (ETDEWEB)
Xia, Xiangyu, E-mail: xxia5@wisc.edu [Materials Science Program, University of Wisconsin – Madison, 1509 University Ave., Madison, WI 53706 (United States); Department of Materials Science and Engineering, University of Wisconsin – Madison, 1509 University Ave, Madison, WI 53706 (United States); Luo, Alan A. [Department of Materials Science and Engineering, University of Wisconsin – Madison, 1509 University Ave, Madison, WI 53706 (United States); Department of Materials Science and Engineering, The Ohio State University, 116 W. 19th Ave, Columbus, OH 43210 (United States); Stone, Donald S. [Materials Science Program, University of Wisconsin – Madison, 1509 University Ave., Madison, WI 53706 (United States); Department of Materials Science and Engineering, University of Wisconsin – Madison, 1509 University Ave, Madison, WI 53706 (United States)
2015-11-15
The present research presents a series of investigations into phase identification and precipitation sequence in Mg-4Sm-1Zn-0.4Zr alloy, using differential scanning calorimetry (DSC), transmission electron microscopy (TEM) and high angle annular dark field scanning transmission electron microscopy (HAADF-STEM). The precipitation sequence is: super saturated solid solution (S.S.S.S) → solute atom clusters → γ″ → γ′ (→stacking faults) → γ. Structure of γ″ has been determined as an ordered hexagonal GP zone, a = 0.556 nm, c = 0.414 nm γ′ is composed of several γ″ layers. Kinetic studies show that quenched-in vacancies play an important role in the formation of solute clusters, while the growth of both precipitates are diffusion controlled. Analysis of microstructure evolution suggests that nucleation of γ′ happens near existing γ″ precipitates. - Highlights: • Precipitation sequence in a high-zinc magnesium-samarium-zinc-zirconium alloy has been identified. • Structures of metastable precipitates are modified directly with HAADF-STEM. • Kinetic calculations were performed to understand nucleation/growth mechanisms of these precipitates.
Crystallization of the amorphous Fe{sub 80}Zr{sub 12}B{sub 8} alloy under controlled heating
Energy Technology Data Exchange (ETDEWEB)
Huang, H. [School of Engineering (H6), University of Surrey, Guildford, Surrey GU2 7XH (United Kingdom); Shao, G. [Centre for Materials Research and Innovation, University of Bolton, Bolton BL3 5AB (United Kingdom)], E-mail: G.Shao@bolton.ac.uk; Tsakiropoulos, P. [Department of Engineering Materials, Sir Robert Hadfirld Building, University of Sheffield, Mappin Street, Sheffield S1 3JD (United Kingdom)
2008-07-14
The devitrification process of amorphous Fe{sub 80}Zr{sub 12}B{sub 8} alloy ribbons were studied under controlled thermal conditions. The major crystallization event during continuous heating with differential scanning calorimetory (DSC) is dictated by diffusion controlled growth and the associated atom mobility of the slow diffusing species Zr. The existence of prior nano-crystals formed by pre-annealing below the crystallization temperature had little effect on the major crystallization temperature. The crystallization sequence during heating was: amorphous {yields} amorphous + {alpha}-Fe + Fe{sub 3}Zr(B) {yields} amorphous + {alpha}-Fe + Fe{sub 3}Zr(B) + Fe{sub 2}Zr. Different from previous findings in alloys of lower Zr and B contents, the peak for the crystallization of the {alpha}-Fe phase alone is missing in the DSC traces of this alloy.
Directory of Open Access Journals (Sweden)
Smołka A.
2015-12-01
Full Text Available Evaluation of corrosion resistance of the self-organized nanotubular oxide layers on the Ti13Zr13Nb alloy, has been carried out in 0.9% NaCl solution at the temperature of 37ºC. Anodization process of the tested alloy was conducted in a solution of 1M (NH42SO4 with the addition of 1 wt.% NH4F. The self-organized nanotubular oxide layers were obtained at the voltage of 20 V for the anodization time of 120 min. Investigations of surface morphology by scanning transmission electron microscopy (STEM revealed that as a result of the anodization under proposed conditions, the single-walled nanotubes (SWNTs can be formed of diameters that range from 10 to 32 nm. Corrosion resistance studies of the obtained nanotubular oxide layers and pure Ti13Zr13Nb alloy were carried out using open circuit potential, anodic polarization curves, and electrochemical impedance spectroscopy (EIS methods. It was found that surface modification by electrochemical formation of the selforganized nanotubular oxide layers increases the corrosion resistance of the Ti13Zr13Nb alloy in comparison with pure alloy.
Effect of heat treatments on precipitate microstructure and mechanical properties of CuCrZr alloy
DEFF Research Database (Denmark)
Singh, B.N; Edwards, D.J.; Tähtinen, S.
2004-01-01
A number of specimens of CuCrZr alloy was prime aged and then overaged at 600oC for 1, 2 and 4 hours and for 4 hours at 700 and 850oC. After different heat treatments, both the precipitate microstructure and mechanical properties were characterized.Mechanical properties were determined at 50...... and 300oC. Some selected specimens in the prime aged as well as overaged conditions were irradiated in the BR-2 reactor at Mol at 60 and 300oC to a displacement dose level of ~0.3 dpa. Irradiated specimens weremechanically tested at 60 and 300oC. The post-deformation microstructure of the irradiated...
International Nuclear Information System (INIS)
Wang Liqiang; Lu Weijie; Qin Jining; Zhang Fan; Zhang Di
2009-01-01
Ti-35Nb-2Ta-3Zr alloy was fabricated by vacuum consumable arc melting furnace and hot pressing. Microstructure and phase transformation of solution-treated (ST) and cold-rolled (CR) plates of Ti-Nb-Ta-Zr alloy were observed. Different microstructure of strain-induced martensite transformation during cold deformation were investigated. With the increase of reduction of cold rolling, microstructure of α''-phase changed from acicular martensite to butterfly shaped martensite and showed variant crossed and cross-hatched when the reduction of cold rolling was over 60%. Mechanical properties and SEM images of the fracture surface indicated that the alloy fabricated by cold deformation showed favorable strength and plasticity. Owing to the excellent cold workability and biomedical safety of elements of Nb, Ta and Zr, Ti-Nb-Ta-Zr alloy contributed much to medical applications
Blackburn, L. B.; Starke, E. A., Jr.
1989-01-01
Minor amounts of cadmium, indium or tin were added to a baseline alloy with the nominal composition of Al-2.4Cu-2.4Li-0.15Zr. These elements were added in an attempt to increase the age-hardening response of the material such that high strengths could be achieved through heat-treatment alone, without the need for intermediate mechanical working. The alloy variant containing indium achieved a higher peak hardness in comparison to the other alloy variations, including the baseline material, when aged at temperatures ranging from 160 C to 190 C. Tensile tests on specimens peak-aged at 160 indicated the yield strength of the indium-bearing alloy increased by approximately 15 percent compared to that of the peak-aged baseline alloy. In addition, the yield strength obtained in the indium-bearing alloy was comparable to that reported for similar baseline material subjected to a 6 percent stretch prior to peak-aging at 190 C. The higher strength levels obtaied for the indium-bearing alloy are attributed to increased number densities and homogeneity of both the T1 and theta-prime phases, as determined by TEM studies.
Grain boundary sinks in neutron-irradiated Zr and Zr-alloys
International Nuclear Information System (INIS)
Griffiths, M.; Gilbert, R.W.; Coleman, C.E.
1988-01-01
Samples of annealed sponge and crystal-bar Zr and Zircaloy-2 have been examined following irradiation in EBR-II at temperatures ≅ 700 K. Loop analysis shows that there is selective denuding of interstitial loops near to some grain boundaries indicating that such boundaries are net sinks for interstitial point defects. Furthermore, in sponge Zr and Zircaloy-2, vacancy c-component loops are observed running into the grain boundaries showing that the grain boundaries are not preferred sinks for vacancies. Cavities are observed in all samples. In crystal-bar Zr and sponge Zr they are mostly observed adjacent to grain boundaries. They are also sometimes found within grains associated with precipitates. The cavities are more common in the crystal-bar Zr and this is probably because both the sponge Zr and Zircaloy-2 contain vacancy c-component loops which compete for vacancies (assuming that the cavities are vacancy sinks). Only some of the grain boundaries have cavities adjacent to them and this may be related to the orientation of the boundary. (orig.)
Glass formation and crystallization in Zr based alloys
International Nuclear Information System (INIS)
Dey, G. K.
2011-01-01
Metallic glasses have come in to prominence in recent times because their nanocrystalline atomic arrangement imparts many useful and unusual properties to these metallic solids. Though these have been produced for the last four decades, the necessity of rapid solidification at cooling rates of 10 5 K/sec or higher for their production, have restricted their geometry to thin ribbons and prevented their application to many areas despite their excellent properties. It has been shown in recent investigations that, many Zr base multicomponent alloys can be obtained in glassy state by cooling at much lower rate typically 10 2 to 10 3 K/sec. This has enabled production of these alloys in the glassy stat in bulk. By now, bulk metallic glasses have been produced in Mg, Ln, Zr, Fe, Pd-Cu, Pd-Fe, Ti and Ni- based alloys. Production of these glasses in bulk has opened avenue for their application in many areas where their excellent mechanical properties an corrosion resistance can be exploited. The transformation of the amorphous phase in these alloys to one or more crystalline phases, is an interesting phase transformation and can lead to formation of crystals in a variety of morphologies and a wide range of crystal sizes, including nanometer size crystals or nanocrystals. The bulk amorphous alloys exhibit higher fracture stress, combined with higher hardness and lower young's modulus than those of any crystalline alloy. The Zr- and Ti-based bulk amorphous alloy exhibit high bending and flexural strength values which are typically 2.0 to 2.5 time higher than those for crystalline counterparts. The composites of bulk metallic glass containing crystalline phases have been found to have special properties. This has been demonstrated in the case of composites of bulk metallic glass and tungsten wires wit the glass forming the matrix. Such a composite has a very high impact strength and is especially suitable for application as an armour penetrator in various types of shells used
International Nuclear Information System (INIS)
Gonzalez, Ruben O.; Gribaudo, Luis M.
2003-01-01
Equilibria among hcp α, bcc β solid solutions and cubic C 15 type intermetallic ZrCr 2 are represented graphically over Gibbs triangles in the Zr-rich zone of the ternary Zr-Cr-O system. Experimental results are obtained from zirconium-based alloys containing different oxygen compositions (0,24 and 0,62 % at.). Phase boundaries of the ternary system are extrapolated to the Zr-O and Zr-Cr binaries. The obtained values are compared to recently published evaluated diagrams of these two systems. Chromium compositions of the studied alloys were 0,3 - 1 - 2 - 4 and 15 at. %. Thermal treatment temperatures in order to allow equilibria in alloys were 840, 860, 900 and 960 C degrees. (author)
Energy Technology Data Exchange (ETDEWEB)
Lee, Jung Gu, E-mail: jglee88@ulsan.ac.kr [School of Materials Science and Engineering, University of Ulsan, Ulsan 44610 (Korea, Republic of); Lee, Gyoung-Ja; Park, Jin-Ju [Nuclear Materials Development Division, Korea Atomic Energy Research Institute (KAERI), Yuseong, Daejeon 34057 (Korea, Republic of); Lee, Min-Ku, E-mail: leeminku@kaeri.re.kr [Nuclear Materials Development Division, Korea Atomic Energy Research Institute (KAERI), Yuseong, Daejeon 34057 (Korea, Republic of)
2017-05-15
The compositional effects of ternary Zr-Cu-X (X: Al, Fe) amorphous filler alloys on galvanic corrosion susceptibility in high-temperature pressurized water were investigated for Zircaloy-4 brazed joints. Through an Al-induced microgalvanic reaction that deteriorated the overall nobility of the joint, application of the Zr-Cu-Al filler alloy caused galvanic coupling to develop readily between the Al-bearing joint and the Al-free base metal, finally leading to massive localized corrosion of the joint. Contrastingly, joints prepared with a Zr-Cu-Fe filler alloy showed excellent corrosion resistance comparable to that of the Zircaloy-4 base metal, since the Cu and Fe elements forming fine intermetallic particles with Zr did not influence the electrochemical stability of the resultant joints. The present results demonstrate that Fe is a more suitable alloying element than Al for brazing filler alloys subjected to high-temperature corrosive environments. - Highlights: •Corrosion of Zircaloy-4 joints brazed with Zr-Cu-X filler alloys was investigated. •Alloyed Al deteriorated the overall nobility of joints by microgalvanic reaction. •Compositional gradient of Al in joints was the driving force for galvanic corrosion. •Cu and Fe did not influence the electrochemical stability of joints. •Zr-Cu-Fe filler alloy yielded excellent high-temperature corrosion resistance.
International Nuclear Information System (INIS)
Lee, Jung Gu; Lee, Gyoung-Ja; Park, Jin-Ju; Lee, Min-Ku
2017-01-01
The compositional effects of ternary Zr-Cu-X (X: Al, Fe) amorphous filler alloys on galvanic corrosion susceptibility in high-temperature pressurized water were investigated for Zircaloy-4 brazed joints. Through an Al-induced microgalvanic reaction that deteriorated the overall nobility of the joint, application of the Zr-Cu-Al filler alloy caused galvanic coupling to develop readily between the Al-bearing joint and the Al-free base metal, finally leading to massive localized corrosion of the joint. Contrastingly, joints prepared with a Zr-Cu-Fe filler alloy showed excellent corrosion resistance comparable to that of the Zircaloy-4 base metal, since the Cu and Fe elements forming fine intermetallic particles with Zr did not influence the electrochemical stability of the resultant joints. The present results demonstrate that Fe is a more suitable alloying element than Al for brazing filler alloys subjected to high-temperature corrosive environments. - Highlights: •Corrosion of Zircaloy-4 joints brazed with Zr-Cu-X filler alloys was investigated. •Alloyed Al deteriorated the overall nobility of joints by microgalvanic reaction. •Compositional gradient of Al in joints was the driving force for galvanic corrosion. •Cu and Fe did not influence the electrochemical stability of joints. •Zr-Cu-Fe filler alloy yielded excellent high-temperature corrosion resistance.
Mechanical spectroscopy study of the Cu36Zr59Al5 and Cu54Zr40Al6 amorphous alloys
Directory of Open Access Journals (Sweden)
Paulo Wilmar Barbosa Marques
2012-12-01
Full Text Available A mechanical spectroscopy study of Cu-Zr-Al bulk metallic glasses, was performed with two types of equipment: a Kê-type inverted torsion pendulum and an acoustic elastometer, working in the frequency ranges of Hz and kHz, respectively, with a heating rate of 1 K/min. The analysis of the anelastic relaxation shows similar spectra for both types of equipment resulting in internal friction patterns that vary with temperature and are not reproducible at each thermal cycle. The normalized of the square of the frequency changes from the first to later measurement cycles. These results indicate that the specimens of Cu-Zr-Al alloys were changing by mechanical relaxation, owing to the motion of atoms or clusters in the glassy state and possible "defects" produced during the processing of alloys.
Atomic-scale microstructures of Zr2Al3C4 and Zr3Al3C5 ceramics
International Nuclear Information System (INIS)
Lin, Z.J.; Zhuo, M.J.; He, L.F.; Zhou, Y.C.; Li, M.S.; Wang, J.Y.
2006-01-01
The microstructures of bulk Zr 2 Al 3 C 4 and Zr 3 Al 3 C 5 ceramics have been investigated using transmission electron microscopy and scanning transmission electron microscopy. These two carbides were determined to have a point group 6/mmm and a space group P6 3 /mmc using selected-area electron diffraction and convergent beam electron diffraction. The atomic-scale microstructures of Zr 2 Al 3 C 4 and Zr 3 Al 3 C 5 were investigated through high-resolution imaging and Z-contrast imaging. Furthermore, intergrowth between Zr 2 Al 3 C 4 and Zr 3 Al 3 C 5 was identified. Stacking faults in Zr 3 Al 3 C 5 were found to result from the insertion of an additional Zr-C layer. Cubic ZrC was occasionally identified to be incorporated in elongated Zr 3 Al 3 C 5 grains. In addition, Al may induce a twinned ZrC structure and lead to the formation of ternary zirconium aluminum carbides
International Nuclear Information System (INIS)
Kato, Hidemi; Inoue, Akihisa; Saida, Junji
2004-01-01
The influences of sample diameter (D), Pd content (x), and hydrostatic pressure (P) in a chamber during casting on the structure of as cast Zr 65 Al 7.5 Ni 10 Cu 17.5-x Pd x (x=10,17.5 at.%) bulk alloys were investigated. Zr 65 Al 7.5 Ni 10 Cu 7.5 Pd 10 and Zr 65 Al 7.5 Ni 10 Pd 17.5 alloys (D=3 mm) cast in a vacuum chamber (P∼4.0x10 -3 Pa) were mainly of the tetragonal-Zr 2 Ni equilibrium phase and nanosize icosahedral primary phase, respectively, while the same alloys cast in inert argon gas at atmospheric pressure (P∼0.1 MPa) were of the single glassy phase. Due to the higher cooling rate obtained by decreasing the sample diameter (D=2 mm) even in the vacuum chamber, the Zr 65 Al 7.5 Ni 10 Pd 17.5 alloy was still of the icosahedral phase, while the Zr 65 Al 7.5 Ni 10 Cu 7.5 Pd 10 alloy froze into a single glassy phase. These results indicate that the temperature- and time- transformation curves for the icosahedral and subsequent equilibrium phase formations in the alloy system shifts to a shorter time side with decreasing P, and the pressure sensitivity of the icosahedral phase formation increases with x
Jiang, S. T.; Zhang, J.; Shun, S. Z.; Chen, M. F.
2016-12-01
To improve the corrosion resistance of the biomedical magnesium alloy, a two-step chemical treatment method has been employed to prepare an FHA coating on the alloy surface. Prior to forming an FHA layer, the samples of Mg-3 wt% Zn-0.5 wt% Zr alloy were soaked in HF with concentration of 20% (v/v) at 37 °C temperature for 2 h, and were then placed into an aqueous solution with 0.1 mol/L Ca(NO3).4H2O and 0.06 mol/L NH4H2PO4 at 90 °C to prepare the Ca-P coating. The concentrations of Mg2+, F- ions, and pH variation with immersing time in the solution were investigated to explore the growth mechanism of FHA. The surface morphologies and compositions of the coatings were characterized by X-ray diffraction, scanning electron microscopy, and energy dispersive spectroscopy. The results showed that the alloy surface treated with acid formed a layer of MgF2 nanoparticles with a thickness of 0.7 μm. The corrosion resistance of coatings in SBF solution was evaluated by electrochemical impedance spectroscopy (EIS) and potentiodynamic polarization. The results showed that the substrate with FHA coating had good corrosion resistance. After immersing into the calcium phosphate solution, some small spherical particles were first formed on the surface; these then cover the surface completely after 20 min. Some clusters consisting of needle-like crystal were observed in the spherical particles covering the surface, and the Ca/P ratio of the needle-like crystal was 1.46, clearly growing along the c axis preferred orientation growth. After immersion for 60 min, the FHA coating with completely uniform growth was obtained on the Mg-Zn-Zr alloy surface with its thickness reaching about 120 μm.
Data of evolutionary structure change: 1A5CB-2QUTC [Confc[Archive
Lifescience Database Archive (English)
Full Text Available 8 2QUT C 2QUTC ...ain>C 2QUTC ence>INKCPLLKPWA HH...T C 2QUTC ence>LKIGE--HTPSA...1A5CB-2QUTC 1A5C 2QUT B C ------LPADVAEELATTAQKLVQAGKGILAADESTQTI... 1A5CB LFGTK-GLGKFence> HHH - <
Directory of Open Access Journals (Sweden)
Jianliang He
2017-10-01
Full Text Available The deformation behavior of homogenized Al–7.5Zn–1.5Mg–0.2Cu–0.2Zr alloy has been studied by a set of isothermal hot compression tests, which were carried out over the temperature ranging from 350 °C to 450 °C and the strain rate ranging from 0.001 s−1 to 10 s−1 on Gleeble-3500 thermal simulation machine. The associated microstructure was studied using electron back scattered diffraction (EBSD and transmission electron microscopy (TEM. The results showed that the flow stress is sensitive to strain rate and deformation temperature. The shape of true stress-strain curves obtained at a low strain rate (≤0.1 s−1 conditions shows the characteristic of dynamic recrystallization (DRX. Two Arrhenius-typed constitutive equation without and with strain compensation were established based on the true stress-strain curves. Constitutive equation with strain compensation has more precise predictability. The main softening mechanism of the studied alloy is dynamic recovery (DRV accompanied with DRX, particularly at deformation conditions, with low Zener-Holloman parameters.
Formation and structure of V-Zr amorphous alloy thin films
King, Daniel J M
2015-01-01
Although the equilibrium phase diagram predicts that alloys in the central part of the V-Zr system should consist of V2Zr Laves phase with partial segregation of one element, it is known that under non-equilibrium conditions these materials can form amorphous structures. Here we examine the structures and stabilities of thin film V-Zr alloys deposited at room temperature by magnetron sputtering. The films were characterized by X-ray diffraction, transmission electron microscopy and computational methods. Atomic-scale modelling was used to investigate the enthalpies of formation of the various competing structures. The calculations confirmed that an amorphous solid solution would be significantly more stable than a random body-centred solid solution of the elements, in agreement with the experimental results. In addition, the modelling effort provided insight into the probable atomic configurations of the amorphous structures allowing predictions of the average distance to the first and second nearest neighbours in the system.
Energy Technology Data Exchange (ETDEWEB)
Cimpean, Anisoara [Department of Biochemistry and Molecular Biology, University of Bucharest, Spl. Independentei, 91-95, 050095 Bucharest (Romania); Vasilescu, Ecaterina; Drob, Paula [Department of Electrochemistry and Corrosion, Institute of Physical Chemistry “Ilie Murgulescu” of Romanian Academy, Spl. Independentei 202, 060021 Bucharest (Romania); Cinca, Ion, E-mail: ion_cinca@hotmail.com [Faculty of Material Science and Engineering, Politehnica University, Spl. Independentei 313, 060042 Bucharest (Romania); Vasilescu, Cora; Anastasescu, Mihai [Department of Electrochemistry and Corrosion, Institute of Physical Chemistry “Ilie Murgulescu” of Romanian Academy, Spl. Independentei 202, 060021 Bucharest (Romania); Mitran, Valentina [Department of Biochemistry and Molecular Biology, University of Bucharest, Spl. Independentei, 91-95, 050095 Bucharest (Romania); Drob, Silviu Iulian [Department of Electrochemistry and Corrosion, Institute of Physical Chemistry “Ilie Murgulescu” of Romanian Academy, Spl. Independentei 202, 060021 Bucharest (Romania)
2014-05-01
A new Ti–25Ta–5Zr alloy based only on non-toxic and non-allergic elements was elaborated in as-cast and thermo-mechanical processed, recrystallized states (XRD and SEM) in order to be used as candidate material for implant applications. Its long-term interactions with Ringer–Brown and Ringer solutions of different pH values and its cytocompatibility were determined. The thermo-mechanically processed alloy has nobler electrochemical behaviour than as-cast alloy due to finer microstructure obtained after the applied treatment. Corrosion and ion release rates presented the lowest values for the treated alloy. Nyquist and Bode plots displayed higher impedance values and phase angles for the processed alloy, denoting a more protective passive film. SEM micrographs revealed depositions from solutions that contain calcium, phosphorous and oxygen ions (EDX analysis), namely calcium phosphate. An electric equivalent circuit with two time constants was modelled. Cell culture experiments with MC3T3-E1 pre-osteoblasts demonstrated that thermo-mechanically processed Ti–25Ta–5Zr alloy supports a better cell adhesion and spreading, and enhanced cell proliferation. Altogether, these data indicate that thermo-mechanical treatment endows the alloy with improved anticorrosion and biological performances. - Highlights: • Ti–25Ta–5Zr alloy exhibited noble electrochemical, passive behaviour in simulated biofluids. • An electric equivalent circuit with two time constants was modelled. • Corrosion rates show the lowest values for the recrystallized Ti–25Ta–5Zr alloy. • In vitro tests revealed good cytocompatibility of as-cast and processed alloy. • Recrystallized treatment endows the alloy with superior biological performances.
International Nuclear Information System (INIS)
Cimpean, Anisoara; Vasilescu, Ecaterina; Drob, Paula; Cinca, Ion; Vasilescu, Cora; Anastasescu, Mihai; Mitran, Valentina; Drob, Silviu Iulian
2014-01-01
A new Ti–25Ta–5Zr alloy based only on non-toxic and non-allergic elements was elaborated in as-cast and thermo-mechanical processed, recrystallized states (XRD and SEM) in order to be used as candidate material for implant applications. Its long-term interactions with Ringer–Brown and Ringer solutions of different pH values and its cytocompatibility were determined. The thermo-mechanically processed alloy has nobler electrochemical behaviour than as-cast alloy due to finer microstructure obtained after the applied treatment. Corrosion and ion release rates presented the lowest values for the treated alloy. Nyquist and Bode plots displayed higher impedance values and phase angles for the processed alloy, denoting a more protective passive film. SEM micrographs revealed depositions from solutions that contain calcium, phosphorous and oxygen ions (EDX analysis), namely calcium phosphate. An electric equivalent circuit with two time constants was modelled. Cell culture experiments with MC3T3-E1 pre-osteoblasts demonstrated that thermo-mechanically processed Ti–25Ta–5Zr alloy supports a better cell adhesion and spreading, and enhanced cell proliferation. Altogether, these data indicate that thermo-mechanical treatment endows the alloy with improved anticorrosion and biological performances. - Highlights: • Ti–25Ta–5Zr alloy exhibited noble electrochemical, passive behaviour in simulated biofluids. • An electric equivalent circuit with two time constants was modelled. • Corrosion rates show the lowest values for the recrystallized Ti–25Ta–5Zr alloy. • In vitro tests revealed good cytocompatibility of as-cast and processed alloy. • Recrystallized treatment endows the alloy with superior biological performances
International Nuclear Information System (INIS)
Long, Woyun; Li, Jing; Lu, Anxian
2013-01-01
Amorphous Zr 50 Al 15-x Ni 10 Cu 25 Y x powders were fabricated by mechanical alloying at a low rotation speed from commercial pure element powders. The beneficial effect of Al partially substituted by Y in Zr 50 Al 15 Ni 10 Cu 25 on glass-forming ability was investigated. The as-milled powders were characterized by X-ray diffraction and transmission electron microscopy. The results show that partial substitution of Al by Y can improve the glass-forming ability of Zr 50 Al 15 Ni 10 Cu 25 Y alloy. Thermodynamic calculation of equivalent free energy shows that Zr 50 Al 13.8 Ni 10 Cu 25 Y 1.2 alloy has the highest glass-forming ability, which is in good agreement with the report of orthogonal experiments. (author)
Experimental investigation of phase equilibria in the Zr-Cu-Ni ternary system
International Nuclear Information System (INIS)
Yang, Mujin; Wang, Cuiping; Yang, Shuiyuan; Shi, Zhan; Han, Jiajia; Liu, Xingjun
2017-01-01
The phase equilibria in the Zr-Cu-Ni ternary system are investigated combined with X-ray diffraction, electron probe micro-analysis and differential scanning calorimetry. Two isothermal sections of the Zr-Cu-Ni ternary system at 1 000 C and 1 100 C are experimentally established. Most of the binary intermetallic compounds, e.g. Zr 7 Ni 10 , ZrNi, ZrNi 5 , Zr 14 Cu 51 , and Zr 2 Cu 9 , show a remarkable ternary solubility. A new ternary compound named τ 3 (Zr 31.1-30.7 . Cu 28.5-40.3 Ni 40.4-29.0 ) is detected at 1 000 C and dissolved at 1 020 C because the nearby large liquid phase field further expands. The newly determined phase equilibria will provide important information for both thermodynamic assessment and alloy design of Zr-based metallic glass.
Data of evolutionary structure change: 1A5CB-2QUUC [Confc[Archive
Lifescience Database Archive (English)
Full Text Available 2QUU C 2QUUC ...in>C 2QUUC INKCPLLKPWAence> HHH...>2 2QUU C 2QUUC LKIGE--HTPSA...1A5CB-2QUUC 1A5C 2QUU B C ------LPADVAEELATTAQKLVQAGKGILAADESTQTI.../pdbChain> 1A5CB ence>LFGTK-GLGKFence> HHH -
Effect of Nb element content in U-Zr-Nb alloy on hardness, microstructure and phase formation
International Nuclear Information System (INIS)
Masrukan; M Husna Al Hasa; Jan Setiawan; Slamet Pribadi
2015-01-01
Experiments to determine the effect of Nb element in the U-Zr alloys on hardness, microstructure and phase formation has been done. The addition of Nb element would effect the hardness, microstructure and phase which formed. The U-Zr-Nb alloy was made with the variation of Nb 2%, 5% and 8% by melting in an electric arc melting furnace that equipped with water cooling and the argon atmosphere. The U-Zr-Nb alloy to be cut divided to some testing, such as hardness test, microstructure, and phase analysis. Hardness testing was done by Vickers hardness testing equipment, microstructure by an optical microscope, and diffraction pattern by XRD and phase analysis was done by GSAS. Hardness testing results showed that the addition of 2% to 5% Nb element in U-Zr alloys will increased in hardness, but the addition of Nb element over 5% the hardness was decreased. Observations the microstructure showed that the addition of 2% to 5% Nb element, grains were formed from fine into coarse. Phase analysis for diffraction pattern showed that the phase changed from αU and γU (Zr,Nb)at 2% Nb to be αU, γU (Zr,Nb) and δ1 (UZr_2) phase at 5% and 8% Nb. Phase changes was followed by changes in its compositions. The composition of αU at 2% Nb was 40% increased to 81% at 5% Nb and decreased to 3.9% at 8% Nb. The composition of γU decreased from 59,86% to 14,91% with increased Nb from 2% to 5% and further increased to 52,74% at 8% Nb. (author)
International Nuclear Information System (INIS)
Correa, D.R.N.; Vicente, F.B.; Grandini, C.R.
2010-01-01
New titanium alloys had been developed with the aim of obtaining materials with improved properties for application as biomaterial, and alloys of the Ti-Zr system are among those most promising. The objective of this study is to analyze the influence of the zirconium concentration on microstructure and hardness of the Ti-5Zr, Ti-10Zr and Ti-15Zr alloys. After arc-melting melting, the samples were analyzed by chemical and gas composition, and characterized by density measurements, optical microscopy, x-ray diffraction and hardness. The results showed a microstructure formed by alpha phase (hexagonal close-packed structure) and increased of hardness. (author)
Effect of the Zr elements with thermal properties changes of U-7Mo-xZr/Al dispersion fuel
International Nuclear Information System (INIS)
Supardjo; Agoeng Kadarjono; Boybul; Aslina Br Ginting
2016-01-01
Thermal properties data of nuclear fuel is required as input data to predict material properties change phenomenon during the fabrication process and irradiated in a nuclear reactor. Study the influence of Zr element in the U-7Mo-xZr/Al (x = 1%, 2% and 3%) fuel dispersion to changes in the thermal properties at various temperatures have been stiffened. Thermal analysis includes determining the melting temperature, enthalpy, and phase changes made using Differential Thermal Analysis (DTA) in the temperature range between 30 °C up to 1400 °C, while the heat capacity of U-7Mo-xZr alloy and U-7Mo-xZr/Al dispersion fuel using Differential Scanning Calorimeter (DSC) at room temperature up to 450 °C. Thermal analyst data DTA shows that Zr levels of all three compositions showed a similar phenomenon. At temperatures between 565.60 °C - 584.98 °C change becomes α + δ to α + γ phase and at 649.22 °C – 650.13 °C happen smelting Al matrix Occur followed by a reaction between Al matrix with U-7Mo-xZr on 670.38 °C - 673.38 °C form U (Al, Mo)x Zr. Furthermore a phase change α + β becomes β + γ Occurs at temperatures 762.08 °C - 776.33 °C and diffusion between the matrix by U-7Mo-xZr/Al on 853.55 °C - 875.20 °C. Every phenomenon that Occurs, enthalpy posed a relative stable. Consolidation of uranium Occur in 1052.42 °C - 1104.99 °C and decomposition reaction of U (Al, Mo)x and U (Al, Zr)_x becomes (UAl_4, UAl_3, UAl_2), U-Mo, and UZr on 1328,34 °C - 1332,06 °C , The existence of Zr in U-Mo alloy increases the heat capacity of the U-7Mo-xZr/Al, dispersion fuel and the higher heat capacity of Zr levels increased due to interactions between the atoms of Zr with Al matrix so that the heat absorbed by the fuel increase. (author)
Energy Technology Data Exchange (ETDEWEB)
Inaekyan, K. [Ecole de Technologie Superieure, 1100, Notre-Dame Str. West, Montreal Quebec H3C 1K3 (Canada); Brailovski, V., E-mail: vladimir.brailovski@etsmtl.ca [Ecole de Technologie Superieure, 1100, Notre-Dame Str. West, Montreal Quebec H3C 1K3 (Canada); Prokoshkin, S. [National University of Science and Technology “MISIS”, Leninskiy prosp. 4, Moscow 119049 (Russian Federation); Pushin, V. [Institute of Metal Physics, Ural Branch of Russian Academy of Sciences, 18, S. Kovalevskoy Str., Ekaterinburg 620199 (Russian Federation); Dubinskiy, S.; Sheremetyev, V. [Ecole de Technologie Superieure, 1100, Notre-Dame Str. West, Montreal Quebec H3C 1K3 (Canada); National University of Science and Technology “MISIS”, Leninskiy prosp. 4, Moscow 119049 (Russian Federation)
2015-05-15
This work sets out to study the peculiar effects of aging treatment on the structure and mechanical behavior of cold-rolled and annealed biomedical Ti–21.8Nb–6.0Zr (TNZ) and Ti–19.7Nb–5.8Ta (TNT) (at.%) shape memory alloys by means of transmission electron microscopy, X-ray diffractometry, functional fatigue and thermomechanical testing techniques. Dissimilar effects of aging treatment on the mechanical behavior of Zr- and Ta-doped alloys are explained by the differences in the ω-phase formation rate, precipitate size, fraction and distribution, and by their effect on the alloys' critical stresses and transformation temperatures. Even short-time aging of the TNZ alloy leads to its drastic embrittlement caused by “overaging”. On the contrary, during aging of the TNT alloy, formation of finely dispersed ω-phase precipitates is gradual and controllable, which makes it possible to finely adjust the TNT alloy functional properties using precipitation hardening mechanisms. To create in this alloy nanosubgrained dislocation substructure containing highly-dispersed coherent nanosized ω-phase precipitates, the following optimum thermomechanical treatment is recommended: cold rolling (true strain 0.37), followed by post-deformation annealing (600 °C, 15–30 min) and age-hardening (300 °C, 30 min) thermal treatments. It is shown that in TNT alloy, pre-transition diffraction effects (diffuse reflections) can “mask” the β-phase substructure and morphology of secondary phases. - Highlights: • TNZ alloy is characterized by much higher ω-phase precipitation rate than TNT alloy. • Difference in precipitation rates is linked to the difference in Zr and Ta diffusion mobility. • Aging of nanosubgrained TNZ alloy worsens its properties irrespective of the aging time. • Aging time of nanosubgrained TNT alloy can be optimized to improve its properties.
Mechanism and deuterium pickup in Zr-2.5Nb alloy
International Nuclear Information System (INIS)
Ploc, R.A.
1999-12-01
There are approximately 400 Zr-2.5Nb pressure tubes in a CANDU reactor. During operation, the pressure tubes contain heavy water at about 300 deg C, 10.3 NPa with a room-temperature pD of 10.5. Operation of the pressure tube in the environment leads to oxide formation and absorption of deuterium. Excess deuterium absorption leads to precipitation of zirconium deuterides in the metal. A knowledge of how the deuterium passes through the oxide film to enter into the metal is an important step in gaining control over ingress rates. Fresnel fringe imaging of cross-sectioned oxides grown on pressure tubes, combined with tilting in the electron microscope, has revealed the three-dimensional nature of porosity in the oxide films. Two primary types exist, flake and ribbon. The main route for deuterium ingress is via ribbon porosity, as shown by electrochemical impedance spectroscopy. The location of the ribbon porosity is along the boundary between the oxidized α-Zr and β-Zr phases. Modifications to reduce ribbon porosity are possible and this, in turn, leads to significantly lower rates of deuterium absorption and extension of pressure-tube lifetime. (author)
Pressure-induced positive electrical resistivity coefficient in Ni-Nb-Zr-H glassy alloy
Fukuhara, M.; Gangli, C.; Matsubayashi, K.; Uwatoko, Y.
2012-06-01
Measurements under hydrostatic pressure of the electrical resistivity of (Ni0.36Nb0.24Zr0.40)100-xHx (x = 9.8, 11.5, and 14) glassy alloys have been made in the range of 0-8 GPa and 0.5-300 K. The resistivity of the (Ni0.36Nb0.24Zr0.40)86H14 alloy changed its sign from negative to positive under application of 2-8 GPa in the temperature range of 300-22 K, coming from electron-phonon interaction in the cluster structure under pressure, accompanied by deformation of the clusters. In temperature region below 22 K, the resistivity showed negative thermal coefficient resistance by Debye-Waller factor contribution, and superconductivity was observed at 1.5 K.
Search for high entropy alloys in the X-NbTaTiZr systems (X = Al, Cr, V, Sn)
Energy Technology Data Exchange (ETDEWEB)
Poletti, Marco Gabriele, E-mail: marcogabriele.poletti@unito.it [Dipartimento di Chimica, Università di Torino, Via P. Giuria 7, 10125 Torino (Italy); Fiore, Gianluca [Dipartimento di Chimica, Università di Torino, Via P. Giuria 7, 10125 Torino (Italy); Szost, Blanka A. [Strategic and Emerging Technologies Team (TEC-TS), European Space Agency, ESTEC, 1 Keplerlaan, 2201 AZ Noordwijk (Netherlands); Battezzati, Livio [Dipartimento di Chimica, Università di Torino, Via P. Giuria 7, 10125 Torino (Italy)
2015-01-25
Highlights: • Composition of refractory high entropy alloys predicted. • Solid solutions found in VNbTaTiZr and AlNbTaTiZr. • Alloys containing Cr and Sn are multi-phased. - Abstract: High entropy alloys, i.e. solid solution phases, are sought in the X-NbTaTiZr equiatomic system where the X element was chosen as Al, Cr, V and Sn by applying recent criteria based on size and electronegativity mismatch of alloy components, number of itinerant and total valence electrons, and the temperature at which the free energy of mixing changes at the alloy composition. The alloys containing V and Al are mostly constituted by solid solutions in good agreement with prediction.
Miscibility of amorphous ZrO2-Al2O3 binary alloy
Zhao, C.; Richard, O.; Bender, H.; Caymax, M.; De Gendt, S.; Heyns, M.; Young, E.; Roebben, G.; Van Der Biest, O.; Haukka, S.
2002-04-01
Miscibility is a key factor for maintaining the homogeneity of the amorphous structure in a ZrO2-Al2O3 binary alloy high-k dielectric layer. In the present work, a ZrO2/Al2O3 laminate thin layer has been prepared by atomic layer chemical vapor deposition on a Si (100) wafer. This layer, with artificially induced inhomogeneity (lamination), enables one to study the change in homogeneity of the amorphous phase in the ZrO2/Al2O3 system during annealing. High temperature grazing incidence x-ray diffraction (HT-XRD) was used to investigate the change in intensity of the constructive interference peak of the x-ray beams which are reflected from the interfaces of ZrO2/Al2O3 laminae. The HT-XRD spectra show that the intensity of the peak decreases with an increase in the anneal temperature, and at 800 °C, the peak disappears. The same samples were annealed by a rapid thermal process (RTP) at temperatures between 700 and 1000 °C for 60 s. Room temperature XRD of the RTP annealed samples shows a similar decrease in peak intensity. Transmission electronic microscope images confirm that the laminate structure is destroyed by RTP anneals and, just below the crystallization onset temperature, a homogeneous amorphous ZrAlxOy phase forms. The results demonstrate that the two artificially separated phases, ZrO2 and Al2O3 laminae, tend to mix into a homogeneous amorphous phase before crystallization. This observation indicates that the thermal stability of ZrO2-Al2O3 amorphous phase is suitable for high-k applications.
Wei, Dongbo; Zhang, Pingze; Liu, Yingchao; Chen, Xiaohu; Ding, Feng; Li, Fengkun
2018-02-01
The Zr coating and Zr-Er coating are grown on TC11 substrate by double-glow plasma surface metallurgy technique, followed by the wear tests at ambient temperature and 500 °C. The data of nanohardness and elastic modulus of the samples are collected by the nano-indentation test. The adhesion strength of coatings is investigated by means of the scratch test. The study of wear resistance is performed using a ball-on-disc wear test system by running against the Si3N4 ball and measured by scanning electron microscope (SEM) and X-ray diffraction (XRD). Experimental results indicate that the nanohardness of the Zr coating and Zr-Er coating are 5.94 GPa and 7.98 GPa, respectively, which are 1.79 times and 2.41 times greater than that of TC11 substrate. Zr coating and Zr-Er coating realize the metallurgical bonding with TC11 substrate with continuous and compact structure. Compared with the Zr coating and TC11, the Zr-Er coating presents the lowest specific wear rates, which are 1.689 × 10-6 mm3 Nm-1 and 1.851 × 10-6 mm3 Nm-1 at ambient temperature and 500 °C respectively, indicating the excellent and improved wear resistance of TC11.
U-Zr-RE Fuel Alloy with Minor Actinides
Energy Technology Data Exchange (ETDEWEB)
Song, Hoon; Kim, Jong Hwan; Ko, Young Mo; Kim, Ki Hwan; Park, Jeong Yong; Lee, Chan Bock [KAERI, Daejeon (Korea, Republic of)
2016-05-15
Metallic fuels, such as the U-Pu-Zr alloys, have been considered as a nuclear fuel for a sodium-cooled fast reactor (SFR) related to the closed fuel cycle for managing minor actinides and reducing the amount of highly radioactive spent nuclear fuels since the 1980s. Metallic fuels fit well with such a concept owing to their high thermal conductivity, high thermal expansion, compatibility with a pyro-metallurgical reprocessing scheme, and their demonstrated fabrication at engineering scale in a remote hot cell environment. To increase the productivity and efficiency of the fuel fabrication process waste streams must be minimized and fuel losses quantified and reduced to lower levels. In this study, U-Zr alloy system fuel slugs were fabricated by an injection casting method. After casting a considerable number of fuel slugs in the casting furnaces, the fuel loss in the melting chamber, the crucible, and the molds have been evaluated quantitatively.
Swelling behavior detection of irradiated U-10Zr alloy fuel using indirect neutron radiography
Energy Technology Data Exchange (ETDEWEB)
Sun, Yong; Huo, He-yong; Wu, Yang [Institute of Nuclear Physics and Chemistry, Chinese Academy of Engineering Physics, Mianyang (China); Key Laboratory of Neutron Physics, Chinese Academy of Engineering Physics, Mianyang (China); Li, Jiangbo [Institute of Nuclear Physics and Chemistry, Chinese Academy of Engineering Physics, Mianyang (China); Zhou, Wei; Guo, Hai-bing [Institute of Nuclear Physics and Chemistry, Chinese Academy of Engineering Physics, Mianyang (China); Key Laboratory of Neutron Physics, Chinese Academy of Engineering Physics, Mianyang (China); Li, Hang, E-mail: lihang32@gmail.com [Institute of Nuclear Physics and Chemistry, Chinese Academy of Engineering Physics, Mianyang (China); Key Laboratory of Neutron Physics, Chinese Academy of Engineering Physics, Mianyang (China); Cao, Chao; Yin, Wei; Wang, Sheng; Liu, Bin; Feng, Qi-jie; Tang, Bin [Institute of Nuclear Physics and Chemistry, Chinese Academy of Engineering Physics, Mianyang (China); Key Laboratory of Neutron Physics, Chinese Academy of Engineering Physics, Mianyang (China)
2016-11-21
It is hopeful that fusion-fission hybrid energy system will become an effective approach to achieve long-term sustainable development of fission energy. U-10Zr alloy (which means the mass ratio of Zr is 10%) fuel is the key material of subcritical blanket for fusion-fission hybrid energy system which the irradiation performance need to be considered. Indirect neutron radiography is used to detect the irradiated U-10Zr alloy because of the high residual dose in this paper. Different burnup samples (0.1%, 0.3%, 0.5% and 0.7%) have been tested with a special indirect neutron radiography device at CMRR (China Mianyang Research Reactor). The resolution of the device is better than 50 µm and the quantitative analysis of swelling behaviors was carried out. The results show that the swelling behaviors relate well to burnup character which can be detected accurately by indirect neutron radiography.
Energy Technology Data Exchange (ETDEWEB)
Izquierdo, Javier [Department of Chemistry, Universidad de La Laguna, P.O. Box 456, E-38200 La Laguna, Tenerife (Spain); Bolat, Georgiana [“Gheorghe Asachi” Technical University of Iasi, Faculty of Chemical Engineering and Environmental Protection, 73 Prof. Dr. Doc. D. Mangeron Street, 700050 Iasi (Romania); Cimpoesu, Nicanor [“Gheorghe Asachi” Technical University of Iasi, Faculty of Materials Science, 61-63 Prof. Dr. Doc. D. Mangeron Street, 700050 Iasi (Romania); Trinca, Lucia Carmen [Science Department, University of Agricultural Sciences and Veterinary Medicine, M. Sadoveanu Alley 3, 700490 Iasi (Romania); Mareci, Daniel, E-mail: danmareci@yahoo.com [“Gheorghe Asachi” Technical University of Iasi, Faculty of Chemical Engineering and Environmental Protection, 73 Prof. Dr. Doc. D. Mangeron Street, 700050 Iasi (Romania); Souto, Ricardo Manuel, E-mail: rsouto@ull.es [Department of Chemistry, Universidad de La Laguna, P.O. Box 456, E-38200 La Laguna, Tenerife (Spain); Institute of Material Science and Nanotechnology, Universidad de La Laguna, E-38200 La Laguna, Tenerife (Spain)
2016-11-01
Highlights: • New quarternary Ti-based alloy for biomaterial application. • Combined hydroxyapatite-zirconia coating produced by pulsed laser deposition. • Porous layer formed on the coated alloy blocks electron transfer reactions. • Electrochemical behaviour consistent with passive film with duplex structure. • HA–ZrO{sub 2} coated Ti-21Nb-15Ta-6Zr exhibits high potential for osseointegration. - Abstract: A new titanium base Ti-21Nb-15Ta-6Zr alloy covered with hydroxyapatite-zirconia (HA–ZrO{sub 2}) by pulsed laser deposition (PLD) technique was characterized regarding its corrosion resistance in simulated physiological Ringer’s solution at 37 °C. For the sake of comparison, Ti-6Al-4V standard implant alloy, with and without hydroxyapatite-zirconia coating, was also characterized. Multiscale electrochemical analysis using both conventional averaging electrochemical techniques, namely electrochemical impedance spectroscopy (EIS) and potentiodynamic polarization, and spatially-resolved microelectrochemical techniques (scanning electrochemical microscopy, SECM) were used to investigate the electrochemical behaviour of the materials. In addition, scanning electron microscopy evidenced that no relevant surface morphology changes occurred on the materials upon immersion in the simulated physiological solution, despite variations in their electrochemical behaviour. Although uncoated metals appear to show better performances during conventional corrosion tests, the response is still quite similar for the HA–ZrO{sub 2} coated materials while providing superior resistance towards electron transfer due to the formation of a more dense film on the surface, thus effectively behaving as a passive material. It is believed corrosion of the HA–ZrO{sub 2} coated Ti-21Nb-15Ta-6Zr alloy will have negligible effect upon biochemical and cellular events at the bone-implant interface and could facilitate osseointegration.
Effects of Al content on structure and mechanical properties of hot-rolled ZrTiAlV alloys
International Nuclear Information System (INIS)
Liang, S.X.; Yin, L.X.; Che, H.W.; Jing, R.; Zhou, Y.K.; Ma, M.Z.; Liu, R.P.
2013-01-01
Highlights: • Phase structure is greatly dependent on the Al content. • Intermetallic compound will precipitates while Al content is over 6.9 wt%. • Equiaxed α-phase grains present in the hot-rolled alloy with 6.9 wt% Al. • Alloys with Al content from 3.3 wt% to 5.6 wt% have good mechanical properties. - Abstract: Zirconium alloys show attractive properties for astronautic applications where the most important factors are anti-irradiation, corrosion resistance, anti-oxidant, very good strength-to-weight ratio. The effects of Al content (2.2–6.9 wt%) on structure and mechanical properties of the hot-rolled ZrTiAlV alloy samples were investigated in this study. Each sample of the hot-rolled ZrTiAlV alloys with Al contents from 2.2 wt% to 5.6 wt% is composed of the α phase and β phase, meanwhile, the relative content of the α phase increased with the Al content. However, the (ZrTi) 3 Al intermetallic compound was observed as the Al content increased to 6.9 wt%. Changes of phase compositions and structure with Al content distinctly affected mechanical properties of ZrTiAlV alloys. Yield strength of the alloy with 2.2 wt% Al is below 200 MPa. As Al content increased to 5.6 wt%, the yield strength, tensile strength and elongation of the examined alloy are 1088 MPa, 1256 MPa and 8%, respectively. As Al content further increased to 6.9 wt%, a rapid decrease in ductility was observed as soon as the (ZrTi) 3 Al intermetallic compound precipitated. Results show that the ZrTiAlV alloys with Al contents between 3.3 wt% and 5.6 wt% have excellent mechanical properties
Internal friction and Young's modulus measurements in Zr-2.5Nb alloy doped with hydrogen
International Nuclear Information System (INIS)
Ritchie, I.G.; Pan, Z.-L.
1992-01-01
The presence of hydrides is an important factor in assessing the potential for delayed hydride cracking in Zr-2.5Nb alloys, and consequently, the terminal solid solubility (TSS) of hydrogen in the material is an important parameter. In pure zirconium doped with hydrogen, the TSS is marked by a dissolution peak of internal friction on heating and a truncated precipitation peak associated with hydride nucleation on cooling. These phenomena occur only at low frequencies and are accompanied in torsion pendulum studies by autotwisting of the sample (or zero-point drift) that stops abruptly at the TSS. Neither the dissolution/precipitation peaks nor the autotwisting phenomena are observed in Zr-2.5Nb. However, the TSS is also marked by an abrupt change in the slope of Young's modulus as a function of temperature. This phenomenon is observed regardless of the frequency (in the range 1 Hz to 120 kHz) and in both pure zirconium and Zr-2.5Nb alloys. The reasons for the absence of the dissolution/precipitation peak in Zr-2.5Nb alloys are discussed and the use of Young's modulus changes to investigate the TSS of hydrogen and the hysteresis between heat-up and cool-down TSS curves is demonstrated. (author)
Grain refinement of an AZ63B magnesium alloy by an Al-1C master alloy
Energy Technology Data Exchange (ETDEWEB)
Yichuan Pan; Xiangfa Liu; Hua Yang [The Key Lab. of Liquid Structure and Heredity of Materials, Shandong Univ., Jinan (China)
2005-12-01
In order to develop a refiner of Mg-Al alloys, an Al-1C (in wt.%) master alloy was synthesized using a casting method. The microstructure and grain-refining performance of the Al-1C master alloy were investigated using X-ray diffraction (XRD), electron probe microanalysis (EPMA) and a grain-refining test. The microstructure of the Al-1C master alloy is composed of {alpha}-Al solid solution, Al{sub 4}C{sub 3} particles, and graphite phases. After grain refinement of AZ63B alloy by the Al-1C master alloy, the mean grain size reached a limit when 2 wt.% Al-C master alloy was added at 800 C and held for 20 min in the melt before casting. The minimum mean grain size is approximately 48 {mu}m at the one-half radius of the ingot and is about 17% of that of the unrefined alloy. The Al-1C master alloy results in better grain refinement than C{sub 2}Cl{sub 6} and MgCO{sub 3} carbon-containing refiners. (orig.)
Ni.sub.3 Al-based intermetallic alloys having improved strength above 850.degree. C.
Liu, Chain T.
2000-01-01
Intermetallic alloys composed essentially of: 15.5% to 17.0% Al, 3.5% to 5.5% Mo, 4% to 8% Cr, 0.04% to 0.2% Zr, 0.04% to 1.5% B, balance Ni, are characterized by melting points above 1200.degree. C. and superior strengths at temperatures above 1000.degree. C.
Serpa, Andr?; Correia, Sara; Ribeiro, Joaquim A.; Sebasti?o, Ana M.; Cascalheira, Jos? F.
2015-01-01
Adenosine A1 and cannabinoid CB1 receptors are highly expressed in hippocampus where they trigger similar transduction pathways. We investigated how the combined acute activation of A1 and CB1 receptors modulates cAMP accumulation in rat hippocampal slices. The CB1 agonist WIN55212-2 (0.3?30??M) decreased forskolin-stimulated cAMP accumulation with an EC50 of 6.6 ? 2.7??M and an E max? of 31% ? 2%, whereas for the A1 agonist, N6-cyclopentyladenosine (CPA, 10?150?nM), an EC50 of 35 ? 19?nM, an...
Effect of heavy ion irradiation on thermodynamically equilibrium Zr-Excel alloy
Energy Technology Data Exchange (ETDEWEB)
Yu, Hongbing [Department of Mechanical and Materials Engineering, Queen' s University, Kingston, ON, K7L 3N6 (Canada); Liang, Jianlie [Department of Mechanical and Materials Engineering, Queen' s University, Kingston, ON, K7L 3N6 (Canada); College of Science, Guangxi University for Nationalities, 188, East Da Xue Rd., Nanning, Guangxi, 530006 P.R.C (China); Yao, Zhongwen, E-mail: yaoz@queensu.ca [Department of Mechanical and Materials Engineering, Queen' s University, Kingston, ON, K7L 3N6 (Canada); Kirk, Mark A. [Material Science Division Argonne National Laboratory, Argonne, IL 60439 (United States); Daymond, Mark R., E-mail: mark.daymond@queensu.ca [Department of Mechanical and Materials Engineering, Queen' s University, Kingston, ON, K7L 3N6 (Canada)
2017-05-15
The thermodynamically equilibrium state was achieved in a Zr-Sn-Nb-Mo alloy by long-term annealing at an intermediate temperature. The fcc intermetallic Zr(Mo, Nb){sub 2} enriched with Fe was observed at the equilibrium state. In-situ 1 MeV Kr{sup 2+} heavy ion irradiation was performed in a TEM to study the stability of the intermetallic particles under irradiation and the effects of the intermetallic particle on the evolution of <c> type dislocation loops at different temperatures from 80 to 550 °C. Chemi-STEM elemental maps were made at the same particles before and after irradiation up to 10 dpa. It was found that no elemental redistribution occurs at 200 °C and below. Selective depletion of Fe was observed from some precipitates under irradiation at higher temperatures. No change in the morphology of particles and no evidence showing a crystalline to amorphous transformation were observed at all irradiation temperatures. The formation of <c> type dislocation loops was observed under irradiation at 80 and 200 °C, but not at 450 and 550 °C. The <c> loops were non-uniformly distributed; a localized high density of <c> type dislocation loops were observed near the second phase particles; we suggest that <c> loop nucleation is favored as a result of the stress induced by the particles, rather than by elemental redistribution. The stability of the second phase particles and the formation of the <c> type loops under heavy ion irradiation are discussed.
International Nuclear Information System (INIS)
Gorria, P.; Orue, I.; Fernandez-Gubieda, M.L.; Plazaola, F.; Zabala, N.; Barandiaran, J.M.
1996-01-01
The stress and annealing dependence of the Curie temperature in FeZrBCu alloys is presented. A change of about 50 /GPa has been observed. The change in amorphous matrix composition upon crystallization produces an expected increase in T C (about 200 C) which is similar to the experimentally observed increase. This behaviour is opposite to that observed in Fe-Nb based alloys. (orig.)
Experimental investigation of phase equilibria in the Co-Ni-Zr ternary system
Energy Technology Data Exchange (ETDEWEB)
Liu, Xingjun; Yang, Shuiyuan; Yu, Wenjie; Wang, Cuiping [Xiamen Univ. (China). Fujian Key Laboratory of Materials Genome; Xiong, Huaping; Cheng, Yaoyong; Wu, Xin [Beijing Institute of Aeronautical Materials (China). Div. of Welding and Forging
2016-10-15
The phase equilibria of the Co-Ni-Zr ternary system at 1 000 C, 1 100 C and 1 200 C were experimentally investigated by means of back-scattered electron imaging, electron probe microanalysis and X-ray diffraction on the equilibrated ternary alloys. In this study, no ternary compound is found. The (αCo, Ni) phase region extends from the Ni-rich corner to the Co-rich corner with small solubility of Zr at three sections. At 1 000 C and 1 100 C, Ni{sub 5}Zr, Co{sub 2}Zr and Ni{sub 10}Zr{sub 7} phases have large solid solution ranges, but Ni{sub 10}Zr{sub 7} phase disappears at 1 200 C. The Ni{sub 7}Zr{sub 2}, NiZr, Co{sub 11}Zr{sub 2}, Co{sub 23}Zr{sub 6} and CoZr phases exhibit nearly linear compounds in the studied sections, and have large composition ranges. Additionally, some differences in phase relationship exist among the above three isothermal sections.
International Nuclear Information System (INIS)
Singh, B.N.; Eldrup, M.; Toft, P.; Edwards, D.J.
1998-05-01
The final irradiation experiment in a series of screening experiments aimed at investigating the effects of bonding and bakeout thermal cycles on irradiated copper alloys is described herein. Tensile specimens of CuCrZr and CuNiBe alloys were given various heat treatments corresponding to solution anneal, prime-ageing and bonding thermal treatment. Additional specimens were reaged and given a reactor bakeout treatment at 350 deg. C for 100 h. GlidCop TM CuAl-15 (previously referred to as CuAl-25) was given a heat treatment corresponding to a bonding thermal cycle only. Specimens were neutron irradiated at 100 deg. C to a dose level of ∼0.3 dpa. Post-irradiation tensile tests at (100 deg. C), electrical resistivity measurements (at 23 deg. C), and microstructural examinations were performed. The post-irradiation tests at 100 deg. C revealed that the greatest loss of ductility occurred in the CuCrZr alloys irradiated at 100 deg. C, irrespective of the pre-irradiation heat treatment, with the uniform elongation dropping to levels of less than 1.5%. The yield and ultimate strengths for all of the individual heat treated samples increased substantially after irradiation. The same trend was observed for the CuNiBe alloys, which exhibited much higher uniform elongation and strength after irradiation than that observed in the case of CuCrZr alloys. In both alloys irradiation-induced precipitation lead to a large increase in the strength of the solution annealed specimens with a noticeable decrease in uniform elongation. The CuAl-25 alloy also experienced an increase in the overall strength of the alloy after irradiation, accompanied by approximately a 50% decrease in the uniform and total elongation. The additional bakeout treatments given to the CuCrZr and CuNiBe before irradiation served to increase the strength, but in terms of the ductility no improvement or degradation resulted from the additional thermal exposure
Energy Technology Data Exchange (ETDEWEB)
Huang, Her-Hsiung [Department of Dentistry, National Yang-Ming University, Taipei, 112 Taiwan (China); Graduate Institute of Basic Medical Science, China Medical University, Taichung, 404 Taiwan (China); Department of Biomedical Informatics, Asia University, Taichung, 413 Taiwan (China); Department of Stomatology, Taipei Veterans General Hospital, Taipei, 112 Taiwan (China); Wu, Chia-Ping; Sun, Ying-Sui; Huang, Hsun-Miao [Institute of Oral Biology, National Yang-Ming University, Taipei, 112 Taiwan (China); Lee, Tzu-Hsin, E-mail: biomaterials@hotmail.com [School of Dentistry, Chung Shan Medical University, Taichung, 402 Taiwan (China); Oral Medicine Center, Chung Shan Medical University Hospital, Taichung, 402 Taiwan (China)
2013-12-31
The biocompatibility of implants is largely determined by their surface characteristics. This study presents a novel method for performing electrochemical anodization on β-type Ti–25Nb–25Zr alloy with a low elastic modulus (approximately 70 GPa). This method results in a thin hybrid layer capable of enhancing the surface characteristics of the implants. We investigated the surface topography and microstructure of the resulting Ti–25Nb–25Zr alloy. The corrosion resistance was evaluated using potentiodynamic polarization curve measurements in simulated body fluid. The cytotoxicity was evaluated according to International Organization for Standardization 10993–5 specification. Cell adhesion of human bone marrow mesenchymal stem cells on the test specimens was observed using scanning electron microscopy and fluorescence microscopy. The anodization produced a thin (approximately 40 nm-thick) hybrid oxide layer with a nanoporous outer sublayer (pore size < 15 nm) and a dense inner layer. The thin hybrid oxide layer increased the corrosion resistance of the Ti–25Nb–25Zr alloy by increasing the corrosion potential and decreasing both the corrosion rate and passive current. Ti–25Nb–25Zr alloys with and without anodization treatment were non-toxic. Surface nanotopography on the anodized Ti–25Nb–25Zr alloy enhanced protein adsorption and cell adhesion. Our results demonstrate that electrochemical anodization increases the corrosion resistance and cell adhesion of β-type Ti–25Nb–25Zr alloy while providing a lower elastic modulus suitable for implant applications. - Highlights: • An electrochemical anodization was applied to β-type Ti–25Nb–25Zr alloy surface. • Anodized surface had nanoscale hybrid oxide layer. • Anodized surface increased corrosion resistance due to dense inner sublayer. • Anodized surface enhanced cell adhesion due to nanoporous outer sublayer. • Electrochemical anodization has potential as implant surface treatment.
International Nuclear Information System (INIS)
Huang, Her-Hsiung; Wu, Chia-Ping; Sun, Ying-Sui; Huang, Hsun-Miao; Lee, Tzu-Hsin
2013-01-01
The biocompatibility of implants is largely determined by their surface characteristics. This study presents a novel method for performing electrochemical anodization on β-type Ti–25Nb–25Zr alloy with a low elastic modulus (approximately 70 GPa). This method results in a thin hybrid layer capable of enhancing the surface characteristics of the implants. We investigated the surface topography and microstructure of the resulting Ti–25Nb–25Zr alloy. The corrosion resistance was evaluated using potentiodynamic polarization curve measurements in simulated body fluid. The cytotoxicity was evaluated according to International Organization for Standardization 10993–5 specification. Cell adhesion of human bone marrow mesenchymal stem cells on the test specimens was observed using scanning electron microscopy and fluorescence microscopy. The anodization produced a thin (approximately 40 nm-thick) hybrid oxide layer with a nanoporous outer sublayer (pore size < 15 nm) and a dense inner layer. The thin hybrid oxide layer increased the corrosion resistance of the Ti–25Nb–25Zr alloy by increasing the corrosion potential and decreasing both the corrosion rate and passive current. Ti–25Nb–25Zr alloys with and without anodization treatment were non-toxic. Surface nanotopography on the anodized Ti–25Nb–25Zr alloy enhanced protein adsorption and cell adhesion. Our results demonstrate that electrochemical anodization increases the corrosion resistance and cell adhesion of β-type Ti–25Nb–25Zr alloy while providing a lower elastic modulus suitable for implant applications. - Highlights: • An electrochemical anodization was applied to β-type Ti–25Nb–25Zr alloy surface. • Anodized surface had nanoscale hybrid oxide layer. • Anodized surface increased corrosion resistance due to dense inner sublayer. • Anodized surface enhanced cell adhesion due to nanoporous outer sublayer. • Electrochemical anodization has potential as implant surface treatment
Comparative study of Cu-Zr and Cu-Ru alloy films for barrier-free Cu metallization
International Nuclear Information System (INIS)
Wang Ying; Cao Fei; Zhang Milin; Liu Yuntao
2011-01-01
The properties of Cu-Zr and Cu-Ru alloy films were comparatively studied to evaluate their potential use as alloying elements. Cu alloy films were deposited on SiO 2 /Si substrates by magnetron sputtering. Samples were subsequently annealed and analyzed by four-point probe measurement, X-ray diffraction, X-ray photoelectron spectroscopy, transmission electron microscopy and Auger electron spectroscopy. X-ray diffraction data suggest that Cu film has preferential (111) crystal orientation and no extra peak corresponding to any compound of Cu, Zr, Ru, and Si. According to transmission electron microscopy results, Cu grains grow in size for both systems but the grain sizes of the Cu alloy films are smaller than that of pure Cu films. These results indicate that Cu-Zr film is suitable for advanced barrier-free metallization in terms of interfacial stability and lower resistivity.
International Nuclear Information System (INIS)
Bernshtejn, L.M.; Zakharov, A.M.; Arbuzov, V.K.
1977-01-01
Change in mechanical properties of hardened low-alloyed molybdenum alloys (Mo-Zr-C and Mo-Zr-Nb-C) at two-stage strengthening during ageing at 1400 deg C is studied. The initial strengthening maximum following ageing for 5 hr is caused by separation of dispersed ZrC particles and is accompanied by worsened plasticity, a development characteristic of precipitation hardening processes. The second increase in strength after a 10-hr ageing is not accompanied by reduced plasticity, this being characteristic of strengthening as a result of reconstruction of the dislocation structure. Niobium (0.16 wt.%) added to Mo-Zr-C alloys simultaneously increases their plastic and strength properties. The said effect is caused by prevention of premature decomposition of alloys on account of increased low-temperature plasticity, which permits to obtain high resistance to plastic deformation
International Nuclear Information System (INIS)
Xie Zhuoming; Liu Rui; Fang Qianfeng; Zhang Tao; Jiang Yan; Wang Xianping; Liu Changsong
2015-01-01
W-(0.2, 0.5, 1.0)wt% ZrC alloys with a relative density above 97.5% were fabricated through the spark plasma sintering (SPS) method. The grain size of W-1.0wt% ZrC is about 2.7 μm, smaller than that of pure W and W-(0.2, 0.5)wt% ZrC. The results indicated that the W-ZrC alloys exhibit higher hardness at room temperature, higher tensile strength at high temperature, and a lower ductile to brittle transition temperature (DBTT) than pure W. The tensile strength and total elongation of W-0.5wt% ZrC alloy at 700 °C is 535 MPa and 24.8%, which are respectively 59% and 114% higher than those of pure W (337 MPa, 11.6%). The DBTT of W-(0.2, 0.5, 1.0)wt% ZrC materials is in the range of 500°C–600°C, which is about 100 °C lower than that of pure W. Based on microstructure analysis, the improved mechanical properties of the W-ZrC alloys were suggested to originate from the enhanced grain boundary cohesion by ZrC capturing the impurity oxygen in tungsten and nano-size ZrC dispersion strengthening. (paper)
Energy Technology Data Exchange (ETDEWEB)
Feng, Xuan-Kai [School of Materials Science and Engineering, Shanghai University, Shanghai 200444 (China); Shi, Siqi, E-mail: sqshi@shu.edu.cn [School of Materials Science and Engineering, Shanghai University, Shanghai 200444 (China); Materials Genome Institute, Shanghai University, Shanghai 200444 (China); Shen, Jian-Yun [General Research Institute for Nonferrous Metals, Beijing 100088 (China); Shang, Shun-Li [Department of Materials Science and Engineering, The Pennsylvania State University, University Park, PA 16802 (United States); Yao, Mei-Yi, E-mail: yaomeiyi@shu.edu.cn [School of Materials Science and Engineering, Shanghai University, Shanghai 200444 (China); Liu, Zi-Kui [Department of Materials Science and Engineering, The Pennsylvania State University, University Park, PA 16802 (United States)
2016-10-15
Since Zr-Fe-Sn is one of the key ternary systems for cladding and structural materials in nuclear industry, it is of significant importance to understand physicochemical properties related to Zr-Fe-Sn system. In order to design the new Zr alloys with advanced performance by CALPHAD method, the thermodynamic model for the lower order systems is required. In the present work, first-principles calculations are employed to obtain phonon, thermodynamic and elastic properties of Zr{sub 6}FeSn{sub 2} with C22 structure and the end-members (C22-Zr{sub 6}FeFe{sub 2}, C22-Zr{sub 6}SnSn{sub 2} and C22-Zr{sub 6}SnFe{sub 2}) in the model of (Zr){sub 6}(Fe, Sn){sub 2}(Fe, Sn){sub 1}. It is found that the imaginary phonon modes are absent for C22-Zr{sub 6}FeSn{sub 2} and C22-Zr{sub 6}SnSn{sub 2}, indicating they are dynamically stable, while the other two end-members are unstable. Gibbs energies of C22-Zr{sub 6}FeSn{sub 2} and C22-Zr{sub 6}SnSn{sub 2} are obtained from the quasiharmonic phonon approach and can be added in the thermodynamic database: Nuclearbase. The C22-Zr{sub 6}FeSn{sub 2}’s single-crystal elasticity tensor components along with polycrystalline bulk, shear and Young’s moduli are computed with a least-squares approach based upon the stress tensor computed from first-principles method. The results indicate that distortion is more difficult in the directions normal the c-axis than along to it.
Corrosion resistance of the niobium-zirconium-oxygen alloys in the molten lithium
International Nuclear Information System (INIS)
Arakelov, A.G.; Vavilova, V.V.; Gekov, A.F.; Zel'tser, A.M.
1977-01-01
Phase behaviour of Nb-Zr-O system alloys after thermal treatment at 1500 deg and 500 deg C has been studied in the concentration range up to 6 at.% Zr and 6 at.% O. Alloys annealed at 1500 deg C, so that the ratio Zr:O was 1:2, displayed intercrystalline corrosion in lithium environment, whereas after annealing at 500 deg C the corrosion was largely transcrystalline. Lithium penetration into these alloys which is much slower than that into Nb-O alloys, results, as in the binary system, in lower microhardness and higher specific electrical resistance
Mastinu, Andrea; Pira, Marilena; Pani, Luca; Pinna, Gérard Aimè; Lazzari, Paolo
2012-10-01
The present work aims to study the effects induced by a chronic treatment with a novel CB1 antagonist (NESS038C6) in C57BL/6N diet-induced obesity (DIO) mice. Mice treated with NESS038C6 and fed with a fat diet (NESS038C6 FD) were compared with the following three reference experimental groups: DIO mice fed with the same fat diet used for NESS038C6 and treated with vehicle or the reference CB1 antagonist/inverse agonist rimonabant, "VH FD" and "SR141716 FD", respectively; DIO mice treated with vehicle and switched to a normal diet (VH ND). NESS038C6 chronic treatment (30 mg/kg/day for 31 days) determined a significant reduction in DIO mice weight relative to that of VH FD. The entity of the effect was comparable to that detected in both SR141716 FD and VH ND groups. Moreover, if compared to VH FD, NESS038C6 FD evidenced: (i) improvement of cardiovascular risk factors; (ii) significant decrease in adipose tissue leptin expression; (iii) increase in mRNA expression of hypothalamic orexigenic peptides and a decrease of anorexigenic peptides; (iv) expression increase of metabolic enzymes and peroxisome proliferator-activated receptor-α in the liver; (v) normalization of monoaminergic transporters and neurotrophic expression in mesolimbic area. However, in contrast to the case of rimonabant, the novel CB1 antagonist improved the disrupted expression profile of genes linked to the hunger-satiety circuit, without altering monoaminergic transmission. In conclusion, the novel CB1 antagonist compound NESS038C6 may represent a useful candidate agent for the treatment of obesity and its metabolic complications, without or with reduced side effects relative to those instead observed with rimonabant. Copyright © 2012 Elsevier B.V. All rights reserved.
Aqueous corrosion behaviour of Zr-1 Nb and Zr-20 Nb with different heat treatments
International Nuclear Information System (INIS)
Jaime Solis, F.; Bordoni, Roberto; Olmedo, Ana M.; Villegas, Marina; Miyagusuku, Marcela
2003-01-01
The corrosion behaviour of Zr-1 Nb and Zr-20 Nb coupons annealed at 850 C degrees during 1 hour and afterwards aged at different temperatures and time periods was studied. The Zr-1 Nb samples were aged at 400 and 500 C degrees and the Zr-20 Nb samples at 265 and 550 C degrees. The results have shown that ageing increases the corrosion resistance because the aged microstructure is somewhat closer to the equilibrium one. This was not the case of Zr-1 Nb aged 72 hs at 400 C degrees. The presence of the ω-phase does not have a deleterious effect in the corrosion behaviour of Zr-20 Nb. Also, an ageing of 2200 h at 265 C degrees induced a relevant decrease in the corrosion rate of Zr-20 Nb indicating a decomposition of the β- Zr phase. This effect was observed at the inlet of pressure tubes in CANDU reactors. The results obtained will be used to establish the relative importance of the α-Zr and β-Zr phases in the corrosion behaviour of pressure tubes. (author)
Energy Technology Data Exchange (ETDEWEB)
Chun, Y.B., E-mail: borobang@gmail.com [Nuclear Materials Division, Korea Atomic Energy Research Institute, Daejeon (Korea, Republic of); Kang, S.H. [Nuclear Materials Division, Korea Atomic Energy Research Institute, Daejeon (Korea, Republic of); Lee, D.W. [Nuclear Fusion Engineering Development Division, Korea Atomic Energy Research Institute, Daejeon (Korea, Republic of); Cho, S. [National Fusion Research Institute, Daejeon (Korea, Republic of); Jeong, Y.H. [Nuclear Materials Division, Korea Atomic Energy Research Institute, Daejeon (Korea, Republic of); Żywczak, A. [AGH University of Science and Technology, Academic Centre of Materials and Nanotechnology, Kraków (Poland); Rhee, C.K. [Nuclear Materials Division, Korea Atomic Energy Research Institute, Daejeon (Korea, Republic of)
2016-11-01
Highlights: • Creep and impact resistances of reduced activation ferritic–martensitic steel are enhanced by the addition of Zr. • A 5 ton scale heat of Zr containing RAFM steel, ARAA, has been produced for material property evaluation. • The physical, thermal, magnetic and mechanical properties of ARAA are quite similar to those of Eurofer 97. - Abstract: Korea has developed an advanced reduced-activation alloy (ARAA) as a structural material for helium-cooled ceramic reflector test blanket module (HCCR-TBM) applications. The present paper describes the history of alloy development and the properties of ARAA, which has been produced at a 5 t scale using vacuum induction melting and electro-slag re-melting methods. ARAA is a 9Cr–1.2W based ferritic–martensitic steel with 0.01 wt.% Zr. The mechanical properties, thermal properties and physical and magnetic properties of ARAA show similar temperature dependencies to those observed for Eurofer 97. However, ARAA exhibits a much longer creep–rupture time than conventional RAFM steel, which suggests a positive effect on Zr addition. The enhanced creep strength of ARAA by the addition of Zr is attributed to the reduced temperature-dependence of the yield strength.
Energy Technology Data Exchange (ETDEWEB)
Buscail, H., E-mail: buscail@iut.u-clermont1.fr [Clermont Universite- LVEEM, 8 rue J.B. Fabre, BP 219, 43006 Le Puy en Velay (France); Issartel, C.; Riffard, F.; Rolland, R.; Perrier, S. [Clermont Universite- LVEEM, 8 rue J.B. Fabre, BP 219, 43006 Le Puy en Velay (France); Fleurentin, A. [CETIM, 52 av Felix Louat, BP 80067, 60304 Senlis (France); Josse, C. [L' ICB UMR5209 CNRS, BP 47870, 21078 Dijon (France)
2011-11-01
The influence of a lanthanum sol-gel coating on the oxide scale adherence has been studied during the 330Cb (Fe-35Ni-18Cr-1Nb-2Si) oxidation at 900 deg. C, in air. The alloy oxidation is performed in order to generate a protective chromia scale acting as a good barrier against carburization. Argon annealing of lanthanum sol-gel coatings have been performed at various temperatures in order to find the best conditions to insure the scale adherence. Kinetic results show that lanthanum sol-gel coatings lead to a lower oxidation rate compared to blank specimens. Thermal cycling tests on lanthanum the sol-gel coated specimen show that the oxide scale formed at 900 deg. C, in air, is adherent.
Aguilera-Correa, John-Jairo; Conde, Ana; Arenas, Maria-Angeles; de-Damborenea, Juan-Jose; Marin, Miguel; Doadrio, Antonio L; Esteban, Jaime
2017-08-11
The Ti-6Al-4V alloy is one of the most commonly used in orthopedic surgery. Despite its advantages, there is an increasing need to use new titanium alloys with no toxic elements and improved biomechanical properties, such as Ti-13Nb-13Zr. Prosthetic joint infections (PJI) are mainly caused by Gram-positive bacteria; however, Gram-negative bacteria are a growing problem due to associated multidrug resistance. In this study, the bacterial adherence and viability on the Ti-13Nb-13Zr alloy have been compared to that of the Ti-6Al-4V alloy using 16 collection and clinical strains of bacterial species related to PJI: Staphylococcus aureus, Staphylococcus epidermidis, Escherichia coli, and Pseudomonas aeruginosa. When compared with the Ti-6Al-4V alloy, bacterial adherence on the Ti-13Nb-13Zr alloy was significantly higher in most staphylococcal and P. aeruginosa strains and lower for E. coli strains. The proportion of live bacteria was significantly lower for both Gram-negative species on the Ti-13Nb-13Zr alloy than on the Ti-6Al-4V alloy pointing to some bactericidal effect of the Ti-13Nb-13Zr alloy. This bactericidal effect appears to be a consequence of the formation of hydroxyl radicals, since this effect is neutralized when dimethylsulfoxide was added to both the saline solution and water used to wash the stain. The antibacterial effect of the Ti-13Nb-13Zr alloy against Gram-negative bacteria is an interesting property useful for the prevention of PJI caused by these bacteria on this potential alternative to the Ti-6Al-4V alloy for orthopedic surgery.
Energy Technology Data Exchange (ETDEWEB)
Guo, Lili; Qin, Lin, E-mail: qinlin@tyut.edu.cn; Kong, Fanyou; Yi, Hong; Tang, Bin
2016-12-01
Highlights: • The Mo alloyed layers were successfully prepared on TLM surface by DG-PSA. • The surface microhardness of TLM is remarkably enhanced by Mo alloying. • The TLM samples after Mo alloying exhibit good wettability. • The Mo alloyed TLM samples show excellent tribological properties. - Abstract: Molybdenum, an alloying element, was deposited and diffused on Ti-5Zr-3Sn-5Mo-15Nb (TLM) substrate by double glow plasma surface alloying technology at 900, 950 and 1000 °C. The microstructure, composition distribution and micro-hardness of the Mo modified layers were analyzed. Contact angles on deionized water and wear behaviors of the samples against corundum balls in simulated human body fluids were investigated. Results show that the surface microhardness is significantly enhanced after alloying and increases with treated temperature rising, and the contact angles are lowered to some extent. More importantly, compared to as-received TLM alloy, the Mo modified samples, especially the one treated at 1000 °C, exhibit the significant improvement of tribological properties in reciprocating wear tests, with lower specific wear rate and friction coefficient. To conclude, Mo alloying treatment is an effective approach to obtain excellent comprehensive properties including optimal wear resistance and improved wettability, which ensure the lasting and safety application for titanium alloys as the biomedical implants.
Effect of Zn on the microstructure and mechanical properties of as-cast Mg–7Gd–3Y–1Nd–0.5Zr alloy
Energy Technology Data Exchange (ETDEWEB)
Li, M.; Zhang, K., E-mail: zhkui@grinm.com; Li, X.G.; Yuan, J.W.; Li, Y.J.; Ma, M.L.; Shi, G.L.; Li, T.; Liu, J.B.
2015-06-25
The microstructure and mechanical properties of as-cast Mg–7Gd–3Y–1Nd–xZn–0.5Zr (x=0, 0.5, 1 and 2 wt%) alloys have been investigated by optical microscopy (OM), scanning electron microscopy equipped with energy dispersive spectrum, transmission electron microscopy (TEM), X-ray diffraction and tensile tests at room temperature (RT). Experimental results reveal that the microstructure of the alloy without Zn contains α-Mg and Mg{sub 5}RE phase, the microstructure of the alloy with 0.5% Zn consists of α-Mg, (Mg, Zn){sub 3}RE phase, Mg{sub 5}(RE, Zn) phase and stacking fault. The addition of 1% and 2% Zn results in the disappearance of the Mg{sub 5}(RE, Zn) phase, but the stacking fault can be seen more clearly. Moreover, a new block-like long period stacking ordered (LPSO) phase is observed in grain boundaries with increasing Zn content up to 2%. TEM analyses indicate that the Mg{sub 5}RE, (Mg, Zn){sub 3}RE and Mg{sub 5}(RE, Zn) phases have a face-centered cubic (f.c.c.) structure with lattice constants of 2.22 nm, 0.73 nm and 2.23 nm, respectively. The new block-like LPSO phase belongs to 10H-type. The tensile tests at RT exhibit that the alloy containing 1% Zn shows the optimal mechanical properties and the ultimate tensile strength (UTS), yield strength (YS) and elongation are 187 MPa, 145 MPa and 3.1%, respectively. As indicated by fracture analyses, the fracture modes of the alloys with 0% and 0.5% Zn are typically intercrystalline fracture, whereas both intercrystalline and transcrystalline fractures are observed in the alloys with 1% and 2% Zn.
Laser cladding of a Mg based Mg–Gd–Y–Zr alloy with Al–Si powders
International Nuclear Information System (INIS)
Chen, Erlei; Zhang, Kemin; Zou, Jianxin
2016-01-01
Graphical abstract: A Mg based Mg–Gd–Y–Zr alloy was treated by laser cladding with Al–Si powders at different laser scanning speeds. The laser clad layer mainly contains Mg_2Si, Mg_1_7Al_1_2 and Al_2(Gd,Y) phases distributed in the Mg matrix. After laser cladding, the corrosion resistance of the Mg alloy was significantly improved together with increased microhardness in the laser clad layers. - Highlights: • A Mg based Mg–Gd–Y–Zr alloy was laser clad with Al–Si powders. • The microstructure and morphology vary with the depth of the clad layer and the laser scanning speed. • Hardness and corrosion resistance were significantly improved after laser cladding. - Abstract: In the present work, a Mg based Mg–Gd–Y–Zr alloy was subjected to laser cladding with Al–Si powders at different laser scanning speeds in order to improve its surface properties. It is observed that the laser clad layer mainly contains Mg_2Si, Mg_1_7Al_1_2 and Al_2(Gd,Y) phases distributed in the Mg matrix. The depth of the laser clad layer increases with decreasing the scanning speed. The clad layer has graded microstructures and compositions. Both the volume fraction and size of Mg_2Si, Mg_1_7Al_1_2 and Al_2(Gd,Y) phases decreases with the increasing depth. Due to the formation of these hardening phases, the hardness of clad layer reached a maximum value of HV440 when the laser scanning speed is 2 mm/s, more than 5 times of the substrate (HV75). Besides, the corrosion properties of the untreated and laser treated samples were all measured in a NaCl (3.5 wt.%) aqueous solution. The corrosion potential was increased from −1.77 V for the untreated alloy to −1.13 V for the laser clad alloy with scanning rate of 2 mm/s, while the corrosion current density was reduced from 2.10 × 10"−"5 A cm"−"2 to 1.64 × 10"−"6 A cm"−"2. The results show that laser cladding is an efficient method to improve surface properties of Mg–Rare earth alloys.
Development of advanced nuclear materials - Fabrication of Zr-Nb alloy used in PHWRs
Energy Technology Data Exchange (ETDEWEB)
Lee, Kang In; Kim, Won Baek; Lee, Chul Kyung; Choi, Kuk Sun; Kang, Dae Kyu; Seo, Chang Ryul [Korea Atomic Energy Research Institute, Taejon (Korea, Republic of)
1995-07-01
The following conclusions can be made from the second year research: 1. Easy control for alloying elements can be made for the following adding metals like Nb, V, Sn, Mo, Fe due to low vapor pressure. In case of Cr and Te= known to have high vapor pressure, they are controlled by adding master alloy(Zr-Cr) or quite excess of aimed composition. However, Bi was found to be very difficult to charging the certain amount into the melt. 2. Oxygen content can be adjusted by adding the Zr-10%O master alloy considering the inherent amount of oxygen in sponge zirconium. 3. The charging rod of 38 mm in diameter, 96 mm in length was made by a series of button melting, casting and vacuum welding, from this, Zr-2.5Nb ingot of 50 mm in diameter and 550 mm in length was fabricated by EB drip melting process. 4. The amount of Nb can be successfully adjusted at 2.8% with charging 15% excess. Nb as adding element is easily controlled due to high-melting -point metal and its low vapor pressure. 5. Oxygen content is not varied during remelting, casting, and drip melting, only slight change was observed in button melting stage due to uptake the desorbed gases during the melting operation. Nuclear materials in domestic nuclear power plants depend on import and this amount reaches 100 million dollars per year. The increase in demand for the development of new zirconium based alloys are expecting. All the results involving this research can be applied for the melting of reactive metals, vacuum refining and alloy design. 13 refs., 6 tabs., 10 figs., 10 ills. (author)
Effect of texture on creep deformation behavior of Zr-2.5Nb alloy
International Nuclear Information System (INIS)
Guguloth, Krishna; Swaminathan, J.; Mitra, Rahul; Ghosh, R.N.; Singh, R.N.; Chakravartty, J.K.
2016-01-01
Zr-2.5%Nb alloys are extensively used as high temperature pressure tubes in nuclear reactor. Therefore creep behavior of this alloy is of considerable importance. The paper presents creep strain-time plots on two sets of specimens made from two as received pressure tubes having different diameters. These tubes were reported to have undergone different processing routes; both tubes were autoclaved at the same temperature in the steam atmosphere. A comparison of the creep strain-time plots of the two sets of specimen under identical test conditions showed a marked difference. The chemical composition and the microstructure of the two sets of samples were also found to be similar. Therefore X-ray diffraction patterns were taken from the two tubes. The ratio of intensity of two prominent reflections from 0002 and 1120 planes of alpha Zr in the case of 90mm tube was found to be 1.79; whereas that from the 110mm tube was 0.25. This suggests that in the case of 110mm tube most of the basal planes were less favorably oriented with respect to the loading axis. This is the reason why creep strength of 110mm tube was found to be higher. The paper also describes how the effect of texture can be incorporated in evaluating the creep behavior of Zr-Nb alloy. This suggests that a relatively larger volume of creep test data on Zr-2.5Nb pressure tube is necessary to account for the effect texture so that a reliable estimate of its creep life could be obtained. (author)
Superplasticity behaviors of Al-Zn-Mg-Zr cold-rolled alloy sheet with minor Sc addition
Energy Technology Data Exchange (ETDEWEB)
Xiang, H. [School of Materials Science and Engineering, Central South University (Light Alloy Research Institute, Central South University), Changsha 410083 (China); Nonferrous Metal Oriented Advanced Structural Materials and Manufacturing Cooperative Innovation Center, Changsha 410083 (China); Pan, Q.L., E-mail: pql2016@126.com [School of Materials Science and Engineering, Central South University (Light Alloy Research Institute, Central South University), Changsha 410083 (China); Nonferrous Metal Oriented Advanced Structural Materials and Manufacturing Cooperative Innovation Center, Changsha 410083 (China); Yu, X.H.; Huang, X.; Sun, X.; Wang, X.D.; Li, M.J.; Yin, Z.M. [School of Materials Science and Engineering, Central South University (Light Alloy Research Institute, Central South University), Changsha 410083 (China); Nonferrous Metal Oriented Advanced Structural Materials and Manufacturing Cooperative Innovation Center, Changsha 410083 (China)
2016-10-31
A refined microstructure of Al-Zn-Mg-Sc-Zr alloy sheet was produced by simple hot and cold rolling to an average grain size of 3 µm. Experiments were completed in electro-fluid servo-fatigue tester and results were investigated by means of optical microscope (OM), scanning electron microscopy (SEM) and transmission electron microscope (TEM). Superplastic deformation was conducted and superplastic ductility of ≥200% was achieved at a testing temperature range from 425 ºC to 500 ºC and relative high strain rate range of 1×10{sup −3} s{sup −1}~1×10{sup −1} s{sup −1}. The maximum elongation of 539% was obtained at 500 ºC and 1×10{sup −2} s{sup −1}. In addition, the scanning electron microscopy (SEM) and transmission electron microscope (TEM) analyses showed that the presence of Al{sub 3} (Sc, Zr) particles in pinning grain boundaries and dislocations had a great influence on the superplastic deformation. The analyses of superplastic test data calculated out the coherent strain rates sensitivity parameter of 0.43 and the average activation energy of 143.762 kJ/mol. The data interpreted that the dominant deformation mechanism was grain boundary sliding controlled by lattice self-diffusion.
International Nuclear Information System (INIS)
Shaha, S.K.; Czerwinski, F.; Kasprzak, W.; Friedman, J.; Chen, D.L.
2014-01-01
Highlights: • Al–Si–Cu–Mg alloy was modified by introducing Zr, V, and Ti. • The chemistry of the phases was identified using SEM/EDX. • The crystal lattice parameters of the phases were characterized using EBSD. • To investigate the phase stability, XRD was performed up to 600 °C. • Thermal analysis was done to find out the possible phase transformation reactions. - Abstract: The Al–Si–Cu–Mg cast alloy was modified with additions of Ti–V–Zr to improve the thermal stability of intermetallics at increased temperatures. A combination of electron microscopy, electron backscatter diffraction, and high temperature X-ray diffraction was explored to identify phases and temperatures of their thermal stability. The micro-additions of transition metals led to formation of several (AlSi) x (TiVZr) phases with D0 22 /D0 23 tetragonal crystal structure and different lattice parameters. While Cu and Mg rich phases along with the eutectic Si dissolved at temperatures from 300 to 500 °C, the (AlSi) x (TiVZr) phases were stable up to 696–705 °C which is the beneficial to enhance the high temperature properties. Findings of this study are useful for selecting temperatures during melting and heat treatment of Al–Si alloys with additions of transition metals
On the Precipitation in an Ag-Containing Mg-Gd-Zr Alloy
Zhang, Yu; Zhu, Yuman; Rong, Wei; Wu, Yujuan; Peng, Liming; Nie, Jian-Feng; Birbilis, Nick
2018-02-01
The evolution of precipitates in a high-strength Mg-2.4Gd-0.4Ag-0.1Zr (at. pct) alloy was investigated using high-angle annular dark-field scanning transmission electron microscopy (HAADF-STEM). The precipitation of Mg-2.4Gd-0.4Ag-0.1Zr includes β- and γ-type precipitates, the latter involving a hitherto unreported precipitation sequence that is the focus of the present study. The β-type precipitation sequence is described as follows: supersaturated solid solution (S.S.S.S.) → ordered solute clusters → zigzag GP zones → β' → βF' → β 1 → β. Compared with the precipitation sequence of the Mg-Gd system, the proposed β-type precipitation sequence includes ordered solute clusters, zigzag GP zones, and βF' , but excludes β″. The strain field around the coarsened β' phase is supposed to stimulate the formation of the β^'F phase. Furthermore, the βF' phase provides preferential nucleation site for the β 1 phase. The γ-type precipitation sequence is proposed as follows: S.S.S.S. → basal GP zones → γ''' → γ″ → γ. The crystal structures, morphologies, and orientations of the basal GP zone, γ''', γ″, γ phases were comprehensively examined and established herein. The results are described in the context of other, but similar, alloy systems. A holistic description of the precipitate evolution in Ag-containing Mg-Gd alloys is discussed and rationalized.
Energy Technology Data Exchange (ETDEWEB)
Wang, W.-M. [Institute for Metallic Materials, IFW Dresden, P.O. 270016, Dresden D-01171 (Germany); Key Lab of Liquid Structure and Heredity of Materials, Shandong University, Jinan 250061 (China); Gebert, A. [Institute for Metallic Materials, IFW Dresden, P.O. 270016, Dresden D-01171 (Germany)], E-mail: a.gebert@ifw-dresden.de; Roth, S.; Kuehn, U.; Schultz, L. [Institute for Metallic Materials, IFW Dresden, P.O. 270016, Dresden D-01171 (Germany)
2008-07-14
This paper presents investigations on the effect of Si on the glass-forming ability, thermal stability and magnetic properties of the Fe-Co-Zr-Mo-W-B samples (group I: Fe{sub 60}Co{sub 8}Zr{sub 10}Mo{sub 5}W{sub 2}B{sub 15-x}Si{sub x}, 1 {<=} x {<=} 4; group II: Fe{sub 60}Co{sub 8}Zr{sub 10-x}Mo{sub 5}W{sub 2}B{sub 15}Si{sub x}, 0 {<=} x {<=} 4; group III: Fe{sub 60}Co{sub 8}Zr{sub 8}Mo{sub 5}W{sub 2}B{sub 17-x}Si{sub x}, 0 {<=} x {<=} 2) prepared by melt spinning, injection casting, and centrifugal casting methods. It is found that the glass-forming ability (GFA) of the alloys in group I is more deteriorated than that in group II, and that the alloys in group III can be cast into the rods of 1-3 mm diameter without crystalline reflections in their XRD patterns. For the amorphous ribbons and rods, a non-monotonic change of the nearest neighbour distance r{sub 1} with increasing Si content c{sub Si} was detected, which is parallel to that of the glass transition and crystallization temperatures T{sub g} and T{sub x}, but opposite to that of the magnetization at room temperature M{sub RT} and the Curie temperature T{sub c}. This correlation can be interpreted by a structure model presuming that iron atoms appear simultaneously in two types of local structures in the amorphous samples.
Biological activity evaluation of magnesium fluoride coated Mg-Zn-Zr alloy in vivo.
Jiang, Hongfeng; Wang, Jingbo; Chen, Minfang; Liu, Debao
2017-06-01
To explore the biodegradable characteristics and biological properties, which could promote new bone formation, of MgF 2 coated magnesium alloy (Mg-3wt%Zn-0.5wt%Zr) in rabbits. Magnesium alloy with MgF 2 coating was made and the MgF 2 /Mg-Zn-Zr was implanted in the femoral condyle of rabbits. Twelve healthy adult Japanese white rabbits in weight of 2.8-3.2kg were averagely divided into A(Mg-Zn-Zr) group and B(MgF 2 /MgZn-Zr) group. Indexes such as microstructural evolution, SEM scan, X-ray, Micro-CT and mechanical properties were observed and detected at 1th day, 2th, 4th, 8th, 12th, 24th week after implantation. Low-density regions occurred around the cancellous bone, and the regions gradually expanded during the 12weeks after implantation. The implant was gradually absorbed from 12 to 24weeks. The density of surrounding cancellous bone increased compared with the 12th week data. The degradation rate of B group was lower than that of A group (Pmagnesium ions. The biological properties of the coating itself presented good biocompatibility and bioactivity. Copyright © 2017 Elsevier B.V. All rights reserved.
International Nuclear Information System (INIS)
Zakharova, M.I.; Kirov, S.A.; Khundzhua, A.G.
1978-01-01
The decomposition of the β solid solution is studied in Zr-Nb alloys with adding Mo, Al, V, Fe by the methods of electron microscopy and X-ray diffraction on single crystals. The intermetallic compounds forming during crystallization of the alloys do not influence the precipitation of the ω- and α-phases during ageing. In the local regions of foils prepared by electropolishing after ageing the formation of the metastable f.c.c. phase and in some cases the inverse transformation of two phase state to the parent phase is observed. (author)
International Nuclear Information System (INIS)
Evirgen, A.; Karaman, I.; Pons, J.; Santamarta, R.; Noebe, R.D.
2016-01-01
The microstructure and shape memory characteristics of the Ni_5_0_._3Ti_3_4_._7Zr_1_5 shape memory alloy were investigated as a function of aging heat treatments that result in nanometer to submicron size precipitates. Microstructure–property relationships were developed by characterizing samples using transmission electron microscopy, differential scanning calorimetry, and load-biased thermal cycling experiments. The precipitate size was found to strongly influence the martensitic transformation–precipitate interactions and ultimately the shape memory characteristics of the alloy. Aging treatments resulting in relatively fine precipitates, which are not an obstacle to twin boundaries and easily bypassed by martensite variants, exhibited higher transformation strain, lower transformation thermal hysteresis, and better thermal and dimensional stability compared to samples with relatively large precipitates. When precipitate dimensions approached several hundred nanometers in size they acted as obstacles to martensite growth, limiting martensite variant and twin size resulting in reduced functional and structural properties. Aging heat treatments were also shown to result in a wide range of transformation temperatures, increasing them above 100 °C in some cases, and affected the stress dependence of the transformation hysteresis and the stress versus transformation temperature relationships for the Ni_5_0_._3Ti_3_4_._7Zr_1_5 alloy.
Microstructure and mechanical behavior of Al-Li-Zr alloys
International Nuclear Information System (INIS)
Wang, Wego; Wells, M.G.H.
1991-01-01
The mechanical properties of two Al-Li-Zr alloys, A and B, are determined at various heat treatment conditions. Alloy B was found to have superior mechanical properties. It shows improvements in yield strength by 31.2-56.2 MPa and in ultimate tensile strength by 14.7-40.7 MPa, and yet still has a 20-25 percent better elongation value. The microstructure and fracture surface were studied by SEM and TEM. A fracture surface with mixed ductile samples and brittle facets was observed in both tensile and notch tensile samples. The fracture was more localized in alloy A than alloy B. Both alloys exhibited good notch toughness with a notch tensile strength to yield a strength ratio larger than one for all heat treatment conditions. 32 refs
Farrakhov, R. G.; Mukaeva, V. R.; Fatkullin, A. R.; Gorbatkov, M. V.; Tarasov, P. V.; Lazarev, D. M.; Babu, N. Ramesh; Parfenov, E. V.
2018-01-01
This research is aimed at improvement of corrosion properties for Zr-1Nb alloy via plasma electrolytic oxidation (PEO). The coatings obtained in DC, pulsed unipolar and pulsed bipolar modes were assessed using SEM, XRD, PDP and EIS techniques. It was shown that pulsed unipolar mode provides the PEO coatings having promising combination of the coating thickness, surface roughness, porosity, corrosion potential and current density, and charge transfer resistance, all contributing to corrosion protection of the zirconium alloy for advanced fuel cladding applications.
Rao, X; Chu, C L; Zheng, Y Y
2014-06-01
Porous Ti-Nb-Zr alloys with different porosities from 6.06 to 62.8% are prepared by a two-step foaming powder metallurgy method using TiH2, Nb, and Zr powders together with 0 to 50wt% of NH4HCO3. The effects of the amounts of Nb and Zr as well as the sintering temperature (1473 to 1673K) on their phase composition, porosity, morphology, and mechanical characteristics are investigated. By controlling the porosity, Nb and Zr concentrations as well as the sintering temperature, porous Ti-Nb-Zr alloys with different mechanical properties can be obtained, for example, the hardness between 290 and 63HV, the compressive strength between 1530.5 and 73.4MPa, and the elastic modulus between 10.8 and 1.2GPa. The mechanical properties of the sintered porous Ti-Nb-Zr alloys can be tailored to match different requirements for the human bones and are thus potentially useful in the hard tissue implants. Copyright © 2014 Elsevier Ltd. All rights reserved.
International Nuclear Information System (INIS)
Machado, Geraldo Correa
2014-01-01
The autocthonal production of nuclear fuel in Brazil for test and research reactors is restricted to MTR (Material Test Reactor) fuel type dispersion plate, using U3Si2 alloy, coated and dispersed in aluminum, developed by IPEN-SP for use in IEA-R1 reactor. Moreover, the UO 2 fuel rod type for power reactors is manufactured by Rezende (RJ) with a German technology by INB under license. Currently, Brazil is performing two programs of developing reactors. Currently, Brazil is developing two reactors. One of them is the development, by CNEN, the Brazilian Multipurpose Reactor (RMB), for testing, research and radioisotope production. The other one is the development a power reactor for naval propulsion, conducted by the Brazilian Navy. This dissertation presents the development and characterization of monolithic fuel miniplate alloy U-2.5Zr-7.5Nb, coated in zircaloy (ZRY), on a laboratory scale. Due to its innovative features and properties, this fuel can be used as fuel in both test reactors, research and producing radioisotopes for power reactors as small and medium sizes. Thus, this high potential fuel can be used in domestic reactors currently under development. The development of monolithic fuel plate type is made using the technique called 'picture-frame' where a sandwich composed of a monolith alloy U-2.5Zr- 7.5Nb coupled to a frame and coated sheets of Zry is obtained. The alloy U-2.5Zr-7.5Nb was obtained by melting in an induction furnace and then was cast into rectangular ingots of graphite, thus achieving an ingot with approximate dimensions of 170 x 50 x 60 mm. The obtained ingot was hot rolled at 850 ºC, with a 50 % reduction in thickness, in order to refine the raw structure of fusion. Samples cut from the alloy U-2.5Zr-7.5Nb, with dimensions 20 x 20 x 6 mm were placed in frames and plates Zry and joined by TIG (Tungsten Inert Gas) under an atmosphere of argon, obtaining a set of 10 mm thick, 45 mm wide and 100 mm long. The sandwiches were hot rolled to
Experimental investigation of phase equilibria in the Zr-Cu-Ni ternary system
Energy Technology Data Exchange (ETDEWEB)
Yang, Mujin; Wang, Cuiping; Yang, Shuiyuan; Shi, Zhan; Han, Jiajia; Liu, Xingjun [Xiamen Univ. (China). College of Materials and Fujian Provincial Key Lab. of Materials Genome
2017-08-15
The phase equilibria in the Zr-Cu-Ni ternary system are investigated combined with X-ray diffraction, electron probe micro-analysis and differential scanning calorimetry. Two isothermal sections of the Zr-Cu-Ni ternary system at 1 000 C and 1 100 C are experimentally established. Most of the binary intermetallic compounds, e.g. Zr{sub 7}Ni{sub 10}, ZrNi, ZrNi{sub 5}, Zr{sub 14}Cu{sub 51}, and Zr{sub 2}Cu{sub 9}, show a remarkable ternary solubility. A new ternary compound named τ{sub 3} (Zr{sub 31.1-30.7} . Cu{sub 28.5-40.3}Ni{sub 40.4-29.0}) is detected at 1 000 C and dissolved at 1 020 C because the nearby large liquid phase field further expands. The newly determined phase equilibria will provide important information for both thermodynamic assessment and alloy design of Zr-based metallic glass.
International Nuclear Information System (INIS)
Rabinkin, A.; Liebermann, H.; Pounds, S.; Taylor, T.
1991-01-01
This paper is the first report on processing, properties and potential application of amorphous titanium/zirconium-base alloys produced in the form of a good quality continuous and ductile ribbon having up to 12.5 mm width. To date, the majority of titanium brazing is accomplished using cooper and aluminum-base brazing filler metals. The brazements produced with these filler metals have rather low (∼300 degrees C) service temperature, thus impeding progress in aircraft and other technologies and industries. The attempt to develop a generation of high temperature brazing filler metals was made in the late sixties-early seventies studies in detail were a large number of Ti-, Zr-Ti-Zr, Ti-V and Zr-V-Ti based alloys. The majority of these alloys has copper and nickel as melting temperature depressants. The presence of nickel and copper converts them into eutectic alloys having [Ti(Zr)] [Cu(Ni)], intermetallic phases as major structural constituents. This, in turn, results in high alloy brittleness and poor, if any, processability by means of conventional, i.e. melting-ingot casting-deformation technology. In spite of good wettability and high joint strength achieved in dozens of promising alloys, only Ti-15Cu-15Ni is now widely used as a brazing filler metal for high service temperature. Up until now this material could not be produced as a homogeneous foil and is instead applied as a clad strip consisting of three separate metallic layers
International Nuclear Information System (INIS)
Wadood, A.; Hosoda, H.; Yamabe-Mitarai, Y.
2014-01-01
Highlights: • Ti–50Au–10Zr exhibited better thermo-mechanical and shape memory properties than Ti–50Au. • Improvement was related to solid solution and precipitation strengthening. • No oxidation problem as oxidation was observed at 100 K higher than A f . • TMA was used not only for thermo-mechanical but also for shape memory and oxidation. - Abstract: In this study, we investigated the phase transformation, oxidation and high temperature mechanical and shape memory properties of Ti–50Au–10Zr (all compositions in atomic%) alloy. Thermo-mechanical analyzer (TMA) was used not only for phase transformation but also for the measurement of shape memory effect and oxidation behavior in air environment. Ti–50Au–10Zr exhibited lower martensitic transformation temperature of 758 K than TiAu stoichiometric alloy exhibiting 870 K since Zr addition stabilizes B2 parent phase. Oxidation was initiated at 873 K that was about 100 K higher than the austenite finish temperature, indicating no such oxidation problems for practical use. Shape memory effect was improved by partial substitution of Ti with Zr in Ti–50Au–10Zr alloy. Compression test of Ti–50Au–10Zr revealed high compressive strength of 1239 MPa of martensite at 691 K (=M f − 50 K) and 924 MPa of B2 parent phase at 834 K (=A f + 50 K) in comparison with Ti–50Au. It is concluded that Zr is effective to improve the mechanical and shape memory properties of TiAu alloy, and that Ti–50Au–10Zr shape memory alloy has potential for high temperature (∼650–850 K) practical applications
Low cycle fatigue behaviour of Ti-6Al-5Zr-0.5Mo-0.25Si alloy at room temperature
International Nuclear Information System (INIS)
Nag, Anil Kumar; Praveen, K.V.U.; Singh, Vakil
2006-01-01
Low cycle fatigue (LCF) behaviour of the near α titanium alloy, Ti-6Al-5Zr-0.5Mo-0.25Si (LT26A), was investigated in the (α+ β) as well as β treated conditions at room temperature. LCF tests were carried out under total strain controlled mode in the range of Δε t /2: from ± 0.60% to ± 1.40%. The alloy shows cyclic softening in both the conditions. Also it exhibits dual slope Coffin-Manson (C-M) relationship in both the treated conditions. (author)
Effect of heavy ion irradiation on thermodynamically equilibrium Zr-Excel alloy
Yu, Hongbing; Liang, Jianlie; Yao, Zhongwen; Kirk, Mark A.; Daymond, Mark R.
2017-05-01
The thermodynamically equilibrium state was achieved in a Zr-Sn-Nb-Mo alloy by long-term annealing at an intermediate temperature. The fcc intermetallic Zr(Mo, Nb)2 enriched with Fe was observed at the equilibrium state. In-situ 1 MeV Kr2+ heavy ion irradiation was performed in a TEM to study the stability of the intermetallic particles under irradiation and the effects of the intermetallic particle on the evolution of type dislocation loops at different temperatures from 80 to 550 °C. Chemi-STEM elemental maps were made at the same particles before and after irradiation up to 10 dpa. It was found that no elemental redistribution occurs at 200 °C and below. Selective depletion of Fe was observed from some precipitates under irradiation at higher temperatures. No change in the morphology of particles and no evidence showing a crystalline to amorphous transformation were observed at all irradiation temperatures. The formation of type dislocation loops was observed under irradiation at 80 and 200 °C, but not at 450 and 550 °C. The loops were non-uniformly distributed; a localized high density of type dislocation loops were observed near the second phase particles; we suggest that loop nucleation is favored as a result of the stress induced by the particles, rather than by elemental redistribution. The stability of the second phase particles and the formation of the type loops under heavy ion irradiation are discussed.
Development of heat treated Zr-2.5% Nb alloy tubes for pressure tubes
International Nuclear Information System (INIS)
Saibaba, N.; Jha, S.K.; Tonpe, S.
2011-01-01
Zr-2.5% Nb alloy is the candidate material for pressure tubes of Pressurized Heavy Water Reactors (PHWR), and are manufactured in cold working condition while heat treated pressure tubes are used in RBMK and FUGEN type of reactors. The diametral creep of these tubes is the life limiting factor. This paper presents the extensive work carried out for the optimization of process parameters to manufacture heat treated Zr-2.5% Nb pressure tubes. Extensive dilactometry study was carried out to establish the transus temperature for the alloy and the effect of soaking temperature and cooling rate on the microstructure was characterized. On the basis of the study, water quenching (at 883 deg C) in the a b region with 20-25% primary a phase was selected, further cold worked, aged and finally autoclaved. Mechanical properties of the finished tubes were found to be comparable to the cold worked route. Large number of full sized tubes of about 700 - 800 mm long was produced to establish the repeatability. (author)
Energy Technology Data Exchange (ETDEWEB)
Park, Jin-Woo, E-mail: jinwoo@knu.ac.kr [Department of Periodontology, School of Dentistry, Kyungpook National University, 188-1, Samduk 2Ga, Jung-Gu, Daegu 700-412 (Korea, Republic of); Tustusmi, Yusuke [Department of Metals, Institute of Biomaterials and Bioengineering, Tokyo Medical and Dental Univeristy, Tokyo 101-0062 (Japan); Lee, Chong Soo; Park, Chan Hee [Department of Materials Science and Engineering, Pohang University of Science and Technology, Pohang 790-784 (Korea, Republic of); Kim, Youn-Jeong; Jang, Je-Hee [Department of Periodontology, School of Dentistry, Kyungpook National University, 188-1, Samduk 2Ga, Jung-Gu, Daegu 700-412 (Korea, Republic of); Khang, Dongwoo; Im, Yeon-Min [School of Materials Science and Engineering, Gyeongsang National University, Jinju 600-701 (Korea, Republic of); Doi, Hisashi; Nomura, Naoyuki; Hanawa, Takao [Department of Metals, Institute of Biomaterials and Bioengineering, Tokyo Medical and Dental Univeristy, Tokyo 101-0062 (Japan)
2011-06-15
This study investigated the surface characteristics and in vitro biocompatibility of a titanium (Ti) oxide layer incorporating calcium ions (Ca) obtained by hydrothermal treatment with or without post heat-treatment in the Ti-13Nb-13Zr alloy. The surface characteristics were evaluated by scanning electron microscopy, thin-film X-ray diffractometry, X-ray photoelectron spectroscopy, atomic force microscopy and contact angle measurements. In vitro biocompatibility of the Ca-containing surfaces was assessed in comparison with untreated surfaces using a pre-osteoblast cell line. Hydrothermal treatment produced a crystalline CaTiO{sub 3} layer. Post heat-treatment at 400 deg. C for 2 h in air significantly decreased water contact angles in the CaTiO{sub 3} layer (p < 0.001). The Ca-incorporated alloy surfaces displayed markedly increased cell viability and ALP activity compared with untreated surfaces (p < 0.001), and also an upregulated expression of various integrin genes ({alpha}1, {alpha}2, {alpha}5, {alpha}v, {beta}1 and {beta}3) at an early incubation time-point. Post heat-treatment further increased attachment and ALP activity in cells grown on Ca-incorporated Ti-13Nb-13Zr alloy surfaces. The results indicate that the Ca-incorporated oxide layer produced by hydrothermal treatment and a simple post heat-treatment may be effective in improving bone healing in Ti-13Nb-13Zr alloy implants by enhancing the viability and differentiation of osteoblastic cells.
Precipitation Behavior and Quenching Sensitivity of a Spray Deposited Al-Zn-Mg-Cu-Zr Alloy
Directory of Open Access Journals (Sweden)
Xiaofei Sheng
2017-09-01
Full Text Available Precipitation behavior and the quenching sensitivity of a spray deposited Al-Zn-Mg-Cu-Zr alloy during isothermal heat treatment have been studied systematically. Results demonstrate that both the hardness and the ultimate tensile strength of the studied alloy decreased with the isothermal treatment time at certain temperatures. More notably, the hardness decreases rapidly after the isothermal heat treatment. During isothermal heat treatment processing, precipitates readily nucleated in the medium-temperature zone (250–400 °C, while the precipitation nucleation was scarce in the low-temperature zone (<250 °C and in the high-temperature zone (>400 °C. Precipitates with sizes of less than ten nanometers would contribute a significant increase in yield strength, while the ones with a larger size than 300 nm would contribute little strengthening effect. Quenching sensitivity is high in the medium-temperature zone (250–400 °C, and corresponding time-temperature-property (TTP curves of the studied alloy have been established.
Cannabinoid Receptors CB1 and CB2 Modulate the Electroretinographic Waves in Vervet Monkeys
Directory of Open Access Journals (Sweden)
Joseph Bouskila
2016-01-01
Full Text Available The expression patterns of the cannabinoid receptor type 1 (CB1R and the cannabinoid receptor type 2 (CB2R are well documented in rodents and primates. In vervet monkeys, CB1R is present in the retinal neurons (photoreceptors, horizontal cells, bipolar cells, amacrine cells, and ganglion cells and CB2R is exclusively found in the retinal glia (Müller cells. However, the role of these cannabinoid receptors in normal primate retinal function remains elusive. Using full-field electroretinography in adult vervet monkeys, we recorded changes in neural activity following the blockade of CB1R and CB2R by the intravitreal administration of their antagonists (AM251 and AM630, resp. in photopic and scotopic conditions. Our results show that AM251 increases the photopic a-wave amplitude at high flash intensities, whereas AM630 increases the amplitude of both the photopic a- and b-waves. In scotopic conditions, both blockers increased the b-wave amplitude but did not change the a-wave amplitude. These findings suggest an important role of CB1R and CB2R in primate retinal function.
International Nuclear Information System (INIS)
Kajgorodova, L.I.; Sel'nikhina, E.I.; Tkachenko, E.A.; Senatorova, O.G.
1996-01-01
A study was made into Sc and Zr addition effects on grain structure formation, supersaturated solid solution decomposition and mechanical properties of Al-7%Zn-2%Mg-1.2%Cu alloy. It is shown that grain structure is determined by volume fraction and distribution character of disperse particles of Al 3 Sc and Al 3 (Sc 1-x Zr x ). The reason for additives influence on decomposition kinetics during natural and artificial ageing are revealed. The structural factors responsible for the enhancement of mechanical properties on alloying are discussed. 17 refs.; 5 figs.; 2 tabs
Determination of activation energy of hydrogen diffusion in Zr-2.5%Nb alloy
International Nuclear Information System (INIS)
Chandra, Komal; Kulkarni, A.S.; Ramanjaneyulu, P.S.; Yadav, C.S.; Saxena, M.K.; Tomar, B.S.; Ramakumar, K.L.; Sunil, Sourav; Singh, R.N.
2013-01-01
The present paper describes the study on the determination of diffusion coefficient of hydrogen in Zr-2.5%Nb alloy. Hydrogen was charged on Zr-2.5% Nb alloy electrolytically. After annealing at required temperature, hydrogen concentration at various depths from the charged end was determined employing hot vacuum extraction-quadrupole mass spectrometer (HVE-QMS). The depth profile was used to obtain the diffusion coefficient employing Fick's second law of diffusion. From the Arrhenius relation between diffusion coefficient and temperature, activation energy of hydrogen diffusion was calculated. (author)
Energy Technology Data Exchange (ETDEWEB)
Shaha, S.K. [Department of Mechanical and Industrial Engineering, Ryerson University, 350 Victoria Street, Toronto, Ontario M5B 2K3 (Canada); Czerwinski, F., E-mail: Frank.Czerwinski@nrcan.gc.ca [CanmetMATERIALS, Natural Resources Canada, 183 Longwood Road South, Hamilton, Ontario L8P 0A5 (Canada); Kasprzak, W. [CanmetMATERIALS, Natural Resources Canada, 183 Longwood Road South, Hamilton, Ontario L8P 0A5 (Canada); Friedman, J.; Chen, D.L. [Department of Mechanical and Industrial Engineering, Ryerson University, 350 Victoria Street, Toronto, Ontario M5B 2K3 (Canada)
2014-11-10
Highlights: • Al–Si–Cu–Mg alloy was modified by introducing Zr, V, and Ti. • The chemistry of the phases was identified using SEM/EDX. • The crystal lattice parameters of the phases were characterized using EBSD. • To investigate the phase stability, XRD was performed up to 600 °C. • Thermal analysis was done to find out the possible phase transformation reactions. - Abstract: The Al–Si–Cu–Mg cast alloy was modified with additions of Ti–V–Zr to improve the thermal stability of intermetallics at increased temperatures. A combination of electron microscopy, electron backscatter diffraction, and high temperature X-ray diffraction was explored to identify phases and temperatures of their thermal stability. The micro-additions of transition metals led to formation of several (AlSi){sub x}(TiVZr) phases with D0{sub 22}/D0{sub 23} tetragonal crystal structure and different lattice parameters. While Cu and Mg rich phases along with the eutectic Si dissolved at temperatures from 300 to 500 °C, the (AlSi){sub x}(TiVZr) phases were stable up to 696–705 °C which is the beneficial to enhance the high temperature properties. Findings of this study are useful for selecting temperatures during melting and heat treatment of Al–Si alloys with additions of transition metals.
International Nuclear Information System (INIS)
Lostak, Thomas; Maljusch, Artjom; Klink, Björn; Krebs, Stefan; Kimpel, Matthias; Flock, Jörg; Schulz, Stephan; Schuhmann, Wolfgang
2014-01-01
Zr-based conversion layers are considered as environmentally friendly alternatives replacing trication phosphatation in the automotive industry. Based on excellent electronic barrier properties they provide an effective corrosion protection of the metallic substrate. In this work, thin protective layers were grown on novel Zn-Al-Mg alloy coated steel sheets by increasing the local pH-value at the sample surface leading to deposition of a Zr-based conversion layer. For this purpose Zn-Al-Mg alloy (ZM) coated steel sheets were treated in an aqueous model conversion solution containing well-defined amounts of hexafluorozirconic acid (H 2 ZrF 6 ) and characterized after different immersion times with SKPFM and field emission SEM (FE-SEM)/EDX techniques. A deposition mechanism of Zr-based conversion coatings on microstructural heterogeneous Zn-Al-Mg alloy surfaces was proposed
Lifescience Database Archive (English)
Full Text Available SF (Link to library) SFF103 (Link to dictyBase) - - - Contig-U11967-1 SFF103Z (Link... to Original site) - - SFF103Z 655 - - - - Show SFF103 Library SF (Link to library) Clone ID SFF103 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U11967-1 Original site URL http://dict...nslated Amino Acid sequence ---rgsf*FLKIIITLLAYKIICTPNHMHLTRGNHETTDMNRFYGFQGEVVAKYSEMVFD LFSELFNWFPLAFVLDESF...*rkrlsnr**wfshhcflc skll*siw*swliykynxdkikittxklxtsexppmhsqk Frame C: ---rgsf*FLKIIITLLAYKIICT
(V,Nb)-doped half Heusler alloys based on {Ti,Zr,Hf}NiSn with high ZT
International Nuclear Information System (INIS)
Rogl, G.; Sauerschnig, P.; Rykavets, Z.; Romaka, V.V.; Heinrich, P.; Hinterleitner, B.; Grytsiv, A.; Bauer, E.; Rogl, P.
2017-01-01
Half Heusler alloys are among the most promising materials for thermoelectric generators as they can be used in a wide temperature range and their starting materials are abundant and cheap, the latter as long as no hafnium is involved. For Sb-doped Ti 0.5 Zr 0.25 Hf 0.25 NiSn Sakurada and Shutoh in 2008 have published ZT max = 1.5 at 690 K, a value that hitherto was never reproduced independently. In this paper we successfully prepared Ti 0.5 Zr 0.25 Hf 0.25 NiSn with ZT max = 1.5, however, at higher temperature (825 K). As the main goal is to produce hafnium – free half Heusler alloys, we investigated the influence of niobium or vanadium dopants on Ti x Zr 1−x NiSn 0.98 Sb 0.02 , reaching ZTs > 1.2 and thermal-electric conversion efficiencies up to 13.1%. For Hf-free n-type TiNiSn-based half Heusler alloys these values are unsurpassed. In order to further improve our thermoelectric materials our study is completed by electrical resistivity and thermal conductivity data in the low temperature range but also by mechanical properties (elastic moduli, hardness) at room temperature. The electrical properties have been discussed in comparison with DFT calculations.
Structure and superconducting properties of Nb-Zr alloy films made by a high-rate sputtering
International Nuclear Information System (INIS)
Sekine, Hisashi; Inoue, Kiyoshi; Tachikawa, Kyoji
1978-01-01
Superconducting Nb-Zr alloy films have been prepared by a continuous high-rate sputtering on tantalum substrates. A deposition rate of 330 nm/min has been attained. The compositional profile in the Nb-Zr film is quite uniform and the film has nearly the same composition as that of the target. The films deposited in a pure argon atmosphere show a columnar structure grown perpendicular to the substrate. The grain size strongly depends on the substrate temperature. The phase transformations in the Nb-Zr film become more apparent and the structure becomes closer to the equilibrium state as the film is deposited in higher atmosphere pressures and/or at lower target voltages. The superconducting transition temperature T sub(c) of the films is about the same as that of bulk samples. The dependence of T sub(c) on the substrate temperature is explainable on the phase transformations in the film. Critical current density J sub(c) and its anisotropy is closely related to the grain structure of the film. Grain boundaries seem to act as the most predominant flux pinning centers in the films. Effects of oxygen in the sputtering atmosphere on the structure and superconducting properties of the Nb-Zr films have been also investigated. Oxygen significantly decreases the grain size of the film. Oxygen increases J sub(c) but decreases T sub(c) of the film. (auth.)
Study on the poisoning resistance of Pd-coated ZrCo alloy prepared by electroless plating method
Energy Technology Data Exchange (ETDEWEB)
Guo, Xiumei, E-mail: xiumei418@163.com; Wang, Shumao; Li, Zhinian; Yuan, Baolong; Ye, Jianhua; Qiu, Haochen; Wu, Yuanfang; Liu, Xiaopeng; Jiang, Lijun
2016-12-15
Highlights: • The Pd membrane was prepared by electroless plating method. • The Pd membrane was compact and uniform. • The effectiveness of Pd membranes was affected by impurity contents and temperatures. - Abstract: To improve the poisoning resistance of ZrCo alloy, Pd membranes have been prepared over the surface of the alloy substrates by using electroless plating method. The characteristics of Pd membranes have been examined by XRD, SEM, EDS and EPMA technologies. From SEM images, the uniform and compact thin Pd film was revealed. The effect of this Pd film was evaluated by comparing the hydrogen absorption properties of bare and Pd-coated ZrCo specimens in contaminated hydrogen gas. The degradation of hydrogen absorption of Pd-coated ZrCo induced by poisoning was less than that of bare ZrCo sample obviously, meaning that the Pd membranes over the surface of substrates appeared to be effective in improving the poisoning resistance of ZrCo alloy. Furthermore, the effect became more significant with the increasing of impurity contents in the experimental gas and the operation temperatures.
Study of the initial oxidation of the U4Zr2Nb alloy by X-ray photoelectron spectroscopy
International Nuclear Information System (INIS)
Mendonca, Renato de; Ferraz, Wilmar B.; Braga, Daniel M.; Macedo, Waldemar A.A.
2009-01-01
In this work, the initial stages of oxidation of the U4Zr2Nb alloy in O 2 atmosphere were studied in-situ, in ultrahigh vacuum, by X-ray photoelectron spectroscopy (XPS), an advanced surface-sensitive technique. After several hours of Ar + ion-sputtering to surface cleanness, the O 2 exposures was realized on the sample at room temperature. The evolution of oxide film formed on the sample surface was followed by XPS measures, by using Mg K α radiation of 1253.6 eV and a CLAM-2 (Vacuum Generator) electron energy analyzer. The changes of U 4f, Nb 3d, Zr 3d and O 1s photoemission peaks with O 2 exposure indicate that the adsorption of oxygen on the U4Zr2Nb alloy surface leads to fast formation of UO 2 . The alloying elements show slower oxidation and different compounds are observed in Nb 3d spectra analysis. This work shows an expressive enlargement of Nb 3d peak at 100 Langmuir exposure, indicating the formation of Nb 2 O 5 and NbO in the oxide. On the other hand, the binding energy of Zr 3d suggests that the ZrO 2 formation is stable as well as uranium dioxide. (author)