WorldWideScience

Sample records for algodoeiro gossypium hirsutum

  1. Selection of Gossypium hirsutum genotypes for interspecific ...

    African Journals Online (AJOL)

    FORRESTER

    ARS), Crop Genetics Research Unit in. Stoneville, Mississippi ... Key words: Cotton, germplasm, immature embryo, tissue culture, wide-hybridization. INTRODUCTION. Tetraploid upland cotton, Gossypium hirsutum L., is comprised of over 90% ...

  2. Evolution and Stress Responses of Gossypium hirsutum SWEET Genes.

    Science.gov (United States)

    Li, Wei; Ren, Zhongying; Wang, Zhenyu; Sun, Kuan; Pei, Xiaoyu; Liu, Yangai; He, Kunlun; Zhang, Fei; Song, Chengxiang; Zhou, Xiaojian; Zhang, Wensheng; Ma, Xiongfeng; Yang, Daigang

    2018-03-08

    The SWEET (sugars will eventually be exported transporters) proteins are sugar efflux transporters containing the MtN3_saliva domain, which affects plant development as well as responses to biotic and abiotic stresses. These proteins have not been functionally characterized in the tetraploid cotton, Gossypium hirsutum , which is a widely cultivated cotton species. In this study, we comprehensively analyzed the cotton SWEET gene family. A total of 55 putative G. hirsutum SWEET genes were identified. The GhSWEET genes were classified into four clades based on a phylogenetic analysis and on the examination of gene structural features. Moreover, chromosomal localization and an analysis of homologous genes in Gossypium arboreum , Gossypium raimondii , and G. hirsutum suggested that a whole-genome duplication, several tandem duplications, and a polyploidy event contributed to the expansion of the cotton SWEET gene family, especially in Clade III and IV. Analyses of cis -acting regulatory elements in the promoter regions, expression profiles, and artificial selection revealed that the GhSWEET genes were likely involved in cotton developmental processes and responses to diverse stresses. These findings may clarify the evolution of G. hirsutum SWEET gene family and may provide a foundation for future functional studies of SWEET proteins regarding cotton development and responses to abiotic stresses.

  3. (Gossypium hirsutum L.) CONTRE LA FUSARIOSE EFFECT ...

    African Journals Online (AJOL)

    EFFECT OFOLIGOSACCHARIDE FRACTION OF Fusarium oxysporum f. sp. vasinfectum ON COTTON PROTECTION (Gossypium hirsutum L.) AGAINST FUSARIUM WILT. R. A. N'GORAN épse BLA1,2, H. T. KOUAKOU2, F. K. Y. KONAN2, B. CAMARA1,. N. K. KOUASSI3 et D. KONE1. 1Laboratoire de Physiologie Végétale, ...

  4. Multiple shoot regeneration of cotton (Gossypium hirsutum L.) via ...

    African Journals Online (AJOL)

    user

    2011-03-14

    Mar 14, 2011 ... Induction of multiple shoots of cotton (Gossypium hirsutum L.) plant in two commercial varieties (Sahel and Varamin) using shoot apex was done. Explants were isolated from 3 - 4 days old seedlings, then they were cultured on a shoot induction media, modified MS nutrient agar with combinations: 1- ...

  5. Utilization of bio-waste cotton ( Gossypium hirsutum L.) stalks and ...

    African Journals Online (AJOL)

    ... three-layer particleboard containing different cotton (Gossypium hirsutum L.) stalks and underutilized paulownia (paulownia fortunie) wood particle ratios (30, 50 and 70%) using urea formaldehyde resin. Addition of cotton stalk and paulownia wood in particleboard improved mechanical properties of resulting composites ...

  6. Cloning and Functional Analysis of the Promoter of an Ascorbate Oxidase Gene from Gossypium hirsutum

    OpenAIRE

    Xin, Shan; Tao, Chengcheng; Li, Hongbin

    2016-01-01

    Apoplastic ascorbate oxidase (AO) plays significant roles in plant cell growth. However, the mechanism of underlying the transcriptional regulation of AO in Gossypium hirsutum remains unclear. Here, we obtained a 1,920-bp promoter sequence from the Gossypium hirsutum ascorbate oxidase (GhAO1) gene, and this GhAO1 promoter included a number of known cis-elements. Promoter activity analysis in overexpressing pGhAO1::GFP-GUS tobacco (Nicotiana benthamiana) showed that the GhAO1 promoter exhibite...

  7. Genome-wide analysis of the MADS-box gene family in polyploid cotton (Gossypium hirsutum) and in its diploid parental species (Gossypium arboreum and Gossypium raimondii).

    Science.gov (United States)

    Nardeli, Sarah Muniz; Artico, Sinara; Aoyagi, Gustavo Mitsunori; de Moura, Stéfanie Menezes; da Franca Silva, Tatiane; Grossi-de-Sa, Maria Fatima; Romanel, Elisson; Alves-Ferreira, Marcio

    2018-06-01

    The MADS-box gene family encodes transcription factors that share a highly conserved domain known to bind to DNA. Members of this family control various processes of development in plants, from root formation to fruit ripening. In this work, a survey of diploid (Gossypium raimondii and Gossypium arboreum) and tetraploid (Gossypium hirsutum) cotton genomes found a total of 147, 133 and 207 MADS-box genes, respectively, distributed in the MIKC, Mα, Mβ, Mγ, and Mδ subclades. A comparative phylogenetic analysis among cotton species, Arabidopsis, poplar and grapevine MADS-box homologous genes allowed us to evaluate the evolution of each MADS-box lineage in cotton plants and identify sequences within well-established subfamilies. Chromosomal localization and phylogenetic analysis revealed that G. raimondii and G. arboreum showed a conserved evolution of the MIKC subclade and a distinct pattern of duplication events in the Mα, Mγ and Mδ subclades. Additionally, G. hirsutum showed a combination of its parental subgenomes followed by a distinct evolutionary history including gene gain and loss in each subclade. qPCR analysis revealed the expression patterns of putative homologs in the AP1, AP3, AGL6, SEP4, AGL15, AG, AGL17, TM8, SVP, SOC and TT16 subfamilies of G. hirsutum. The identification of putative cotton orthologs is discussed in the light of evolution and gene expression data from other plants. This analysis of the MADS-box genes in Gossypium species opens an avenue to understanding the origin and evolution of each gene subfamily within diploid and polyploid species and paves the way for functional studies in cotton species. Copyright © 2018 Elsevier Masson SAS. All rights reserved.

  8. Construction of a complete set of alien chromosome addition lines from Gossypium australe in Gossypium hirsutum: morphological, cytological, and genotypic characterization.

    Science.gov (United States)

    Chen, Yu; Wang, Yingying; Wang, Kai; Zhu, Xiefei; Guo, Wangzhen; Zhang, Tianzhen; Zhou, Baoliang

    2014-05-01

    We report the first complete set of alien addition lines of G. hirsutum . The characterized lines can be used to introduce valuable traits from G. australe into cultivated cotton. Gossypium australe is a diploid wild cotton species (2n = 26, GG) native to Australia that possesses valuable characteristics unavailable in the cultivated cotton gene pool, such as delayed pigment gland morphogenesis in the seed and resistances to pests and diseases. However, it is very difficult to directly transfer favorable traits into cultivated cotton through conventional gene recombination due to the absence of pairing and crossover between chromosomes of G. australe and Gossypium hirsutum (2n = 52, AADD). To enhance the transfer of favorable genes from wild species into cultivated cotton, we developed a set of hirsutum-australe monosomic alien chromosome addition lines (MAAL) using a combination of morphological survey, microsatellite marker-assisted selection, and molecular cytogenetic analysis. The amphidiploid (2n = 78, AADDGG) of G. australe and G. hirsutum was consecutively backcrossed with upland cotton to develop alien addition lines of individual G. australe chromosomes in G. hirsutum. From these backcross progeny, we generated the first complete set of chromosome addition lines in cotton; 11 of 13 lines are monosomic additions, and chromosomes 7G(a) and 13G(a) are multiple additions. MAALs of 1G(a) and 11G(a) were the first to be isolated. The chromosome addition lines can be employed as bridges for the transfer of desired genes from G. australe into G. hirsutum, as well as for gene assignment, isolation of chromosome-specific probes, flow sorting and microdissection of chromosome, development of chromosome-specific ''paints'' for fluorochrome-labeled DNA fragments, physical mapping, and selective isolation and mapping of cDNAs for a particular G. australe chromosome.

  9. Genome-wide divergence, haplotype distribution and population demographic histories for Gossypium hirsutum and Gossypium barbadense as revealed by genome-anchored SNPs

    Science.gov (United States)

    Use of 10,129 singleton SNPs of known genomic location in tetraploid cotton provided unique opportunities to characterize genome-wide diversity among 440 Gossypium hirsutum and 219 G. barbadense cultivars and landrace accessions of widespread origin. Using the SNPs distributed genome-wide, we exami...

  10. Infraspecific DNA methylation polymorphism in cotton (Gossypium hirsutum L.).

    Science.gov (United States)

    Keyte, Anna L; Percifield, Ryan; Liu, Bao; Wendel, Jonathan F

    2006-01-01

    Cytosine methylation is important in the epigenetic regulation of gene expression and development in plants and has been implicated in silencing duplicate genes after polyploid formation in several plant groups. Relatively little information exists, however, on levels and patterns of methylation polymorphism (MP) at homologous loci within species. Here we explored the levels and patterns of methylation-polymorphism diversity at CCGG sites within allotetraploid cotton, Gossypium hirsutum, using a methylation-sensitive amplified fragment length polymorphism screen and a selected set of 20 G. hirsutum accessions for which we have information on genetic polymorphism levels and relationships. Methylation and MP exist at high levels within G. hirsutum: of 150 HpaII/MspI sites surveyed, 48 were methylated at the inner cytosine (32%) and 32 of these were polymorphic (67%). Both these values are higher than comparable measures of genetic diversity using restriction fragment length polymorphisms. The high percentage of methylation-polymorphic sites and potential relationship to gene expression underscore the potential significance of MP within and among populations. We speculate that biased correlation of methylation-polymorphic sites and genes in cotton may be a consequence of polyploidy and the attendant doubling of all genes.

  11. GhNAC18 , a novel cotton ( Gossypium hirsutum L.) NAC gene, is ...

    African Journals Online (AJOL)

    GhNAC18 is a novel NAC gene that was isolated from cotton (Gossypium hirsutum L.). The full-length cDNA was 1511 bp including an open reading frame of 1260 bp in length and encodes a protein of 419 amino acids. With qRT-PCR analysis, GhNAC18 was downregulated during natural and dark-induced senescence, ...

  12. Cloning and Functional Analysis of the Promoter of an Ascorbate Oxidase Gene from Gossypium hirsutum.

    Directory of Open Access Journals (Sweden)

    Shan Xin

    Full Text Available Apoplastic ascorbate oxidase (AO plays significant roles in plant cell growth. However, the mechanism of underlying the transcriptional regulation of AO in Gossypium hirsutum remains unclear. Here, we obtained a 1,920-bp promoter sequence from the Gossypium hirsutum ascorbate oxidase (GhAO1 gene, and this GhAO1 promoter included a number of known cis-elements. Promoter activity analysis in overexpressing pGhAO1::GFP-GUS tobacco (Nicotiana benthamiana showed that the GhAO1 promoter exhibited high activity, driving strong reporter gene expression in tobacco trichomes, leaves and roots. Promoter 5'-deletion analysis demonstrated that truncated GhAO1 promoters with serial 5'-end deletions had different GUS activities. A 360-bp fragment was sufficient to activate GUS expression. The P-1040 region had less GUS activity than the P-720 region, suggesting that the 320-bp region from nucleotide -720 to -1040 might include a cis-element acting as a silencer. Interestingly, an auxin-responsive cis-acting element (TGA-element was uncovered in the promoter. To analyze the function of the TGA-element, tobacco leaves transformed with promoters with different 5' truncations were treated with indole-3-acetic acid (IAA. Tobacco leaves transformed with the promoter regions containing the TGA-element showed significantly increased GUS activity after IAA treatment, implying that the fragment spanning nucleotides -1760 to -1600 (which includes the TGA-element might be a key component for IAA responsiveness. Analyses of the AO promoter region and AO expression pattern in Gossypium arboreum (Ga, diploid cotton with an AA genome, Gossypium raimondii (Gr, diploid cotton with a DD genome and Gossypium hirsutum (Gh, tetraploid cotton with an AADD genome indicated that AO promoter activation and AO transcription were detected together only in D genome/sub-genome (Gr and Gh cotton. Taken together, these results suggest that the 1,920-bp GhAO1 promoter is a functional sequence

  13. Cloning and Functional Analysis of the Promoter of an Ascorbate Oxidase Gene from Gossypium hirsutum.

    Science.gov (United States)

    Xin, Shan; Tao, Chengcheng; Li, Hongbin

    2016-01-01

    Apoplastic ascorbate oxidase (AO) plays significant roles in plant cell growth. However, the mechanism of underlying the transcriptional regulation of AO in Gossypium hirsutum remains unclear. Here, we obtained a 1,920-bp promoter sequence from the Gossypium hirsutum ascorbate oxidase (GhAO1) gene, and this GhAO1 promoter included a number of known cis-elements. Promoter activity analysis in overexpressing pGhAO1::GFP-GUS tobacco (Nicotiana benthamiana) showed that the GhAO1 promoter exhibited high activity, driving strong reporter gene expression in tobacco trichomes, leaves and roots. Promoter 5'-deletion analysis demonstrated that truncated GhAO1 promoters with serial 5'-end deletions had different GUS activities. A 360-bp fragment was sufficient to activate GUS expression. The P-1040 region had less GUS activity than the P-720 region, suggesting that the 320-bp region from nucleotide -720 to -1040 might include a cis-element acting as a silencer. Interestingly, an auxin-responsive cis-acting element (TGA-element) was uncovered in the promoter. To analyze the function of the TGA-element, tobacco leaves transformed with promoters with different 5' truncations were treated with indole-3-acetic acid (IAA). Tobacco leaves transformed with the promoter regions containing the TGA-element showed significantly increased GUS activity after IAA treatment, implying that the fragment spanning nucleotides -1760 to -1600 (which includes the TGA-element) might be a key component for IAA responsiveness. Analyses of the AO promoter region and AO expression pattern in Gossypium arboreum (Ga, diploid cotton with an AA genome), Gossypium raimondii (Gr, diploid cotton with a DD genome) and Gossypium hirsutum (Gh, tetraploid cotton with an AADD genome) indicated that AO promoter activation and AO transcription were detected together only in D genome/sub-genome (Gr and Gh) cotton. Taken together, these results suggest that the 1,920-bp GhAO1 promoter is a functional sequence with a

  14. Genetic diversity and structure of elite cotton germplasm (Gossypium hirsutum L.) using genome-wide SNP data.

    Science.gov (United States)

    Ai, XianTao; Liang, YaJun; Wang, JunDuo; Zheng, JuYun; Gong, ZhaoLong; Guo, JiangPing; Li, XueYuan; Qu, YanYing

    2017-10-01

    Cotton (Gossypium spp.) is the most important natural textile fiber crop, and Gossypium hirsutum L. is responsible for 90% of the annual cotton crop in the world. Information on cotton genetic diversity and population structure is essential for new breeding lines. In this study, we analyzed population structure and genetic diversity of 288 elite Gossypium hirsutum cultivar accessions collected from around the world, and especially from China, using genome-wide single nucleotide polymorphisms (SNP) markers. The average polymorphsim information content (PIC) was 0.25, indicating a relatively low degree of genetic diversity. Population structure analysis revealed extensive admixture and identified three subgroups. Phylogenetic analysis supported the subgroups identified by STRUCTURE. The results from both population structure and phylogenetic analysis were, for the most part, in agreement with pedigree information. Analysis of molecular variance revealed a larger amount of variation was due to diversity within the groups. Establishment of genetic diversity and population structure from this study could be useful for genetic and genomic analysis and systematic utilization of the standing genetic variation in upland cotton.

  15. SELETIVIDADE DE INSETICIDAS AO COMPLEXO DE INIMIGOS NATURAIS NA CULTURA DO ALGODÃO (Gossypium hirsutum L. SELECTIVITY OF INSECTICIDES ON THE COMPLEX OF NATURAL ENEMIES IN COTTON CROP (Gossypium hirsutum L.

    Directory of Open Access Journals (Sweden)

    Fábio Shigeo Takatsuka

    2007-09-01

    Full Text Available

    Avaliou-se a seletividade de inseticidas sobre o complexo de inimigos naturais na cultura do algodão (Gossypium hirsutum L., no município de Goiânia, GO. Utilizou-se a cultivar Deltapine e o delineamento experimental em blocos ao acaso, com sete tratamentos e quatro repetições. Os tratamentos foram: testemunha, thiamethoxam (300 g.ha-1, lufenuron (300 mL.ha-1, betacyflutrin (800 mL.ha-1, imidacloprid (70 g.ha-1, diflubenzuron (6,0 g.ha-1, endosulfan (1500 mL.ha-1, em suas apresentações comerciais. A pulverização dos inseticidas foi efetuada aos 45 dias após a emergência das plantas. Além da avaliação prévia, foram efetuadas avaliações aos três e sete dias após a aplicação dos inseticidas. As amostragens foram realizadas através do método de batida de pano, com duas batidas ao acaso por parcela, identificando-se e contando-se, o número de inimigos naturais presentes. Três dias após a aplicação dos tratamentos, os inseticidas thiamethoxam (300 g.ha-1, lufenuron (300 mL.ha-1 e diflubenzuron (60 g.ha-1, considerando os produtos comerciais, não apresentaram efeito de choque sobre o complexo de inimigos naturais presentes na cultura do algodoeiro. Entretanto, aos sete dias após a aplicação, apenas o tratamento com lufenuron manteve a seletividade.a esses artrópodes predadores.

    PALAVRAS-CHAVE: Inseticida; controle biológico; Gossypium.

  16. Genotype and planting density effects on rooting traits and yield in cotton (Gossypium hirsutum L.)

    NARCIS (Netherlands)

    Zhang, L.Z.; Li, B.G.; Yan, G.T.; Werf, van der W.; Spiertz, J.H.J.; Zhang, S.P.

    2006-01-01

    Root density distribution of plants is a major indicator of competition between plants and determines resource capture from the soil. This experiment was conducted in 2005 at Anyang, located in the Yellow River region, Henan Province, China. Three cotton (Gossypium hirsutum L.) cultivars were

  17. The complete mitochondrial genome of Gossypium hirsutum and evolutionary analysis of higher plant mitochondrial genomes.

    Science.gov (United States)

    Liu, Guozheng; Cao, Dandan; Li, Shuangshuang; Su, Aiguo; Geng, Jianing; Grover, Corrinne E; Hu, Songnian; Hua, Jinping

    2013-01-01

    Mitochondria are the main manufacturers of cellular ATP in eukaryotes. The plant mitochondrial genome contains large number of foreign DNA and repeated sequences undergone frequently intramolecular recombination. Upland Cotton (Gossypium hirsutum L.) is one of the main natural fiber crops and also an important oil-producing plant in the world. Sequencing of the cotton mitochondrial (mt) genome could be helpful for the evolution research of plant mt genomes. We utilized 454 technology for sequencing and combined with Fosmid library of the Gossypium hirsutum mt genome screening and positive clones sequencing and conducted a series of evolutionary analysis on Cycas taitungensis and 24 angiosperms mt genomes. After data assembling and contigs joining, the complete mitochondrial genome sequence of G. hirsutum was obtained. The completed G.hirsutum mt genome is 621,884 bp in length, and contained 68 genes, including 35 protein genes, four rRNA genes and 29 tRNA genes. Five gene clusters are found conserved in all plant mt genomes; one and four clusters are specifically conserved in monocots and dicots, respectively. Homologous sequences are distributed along the plant mt genomes and species closely related share the most homologous sequences. For species that have both mt and chloroplast genome sequences available, we checked the location of cp-like migration and found several fragments closely linked with mitochondrial genes. The G. hirsutum mt genome possesses most of the common characters of higher plant mt genomes. The existence of syntenic gene clusters, as well as the conservation of some intergenic sequences and genic content among the plant mt genomes suggest that evolution of mt genomes is consistent with plant taxonomy but independent among different species.

  18. Ten alien chromosome additions of Gossypium hirsutum-Gossypium bickii developed by integrative uses of GISH and species-specific SSR markers.

    Science.gov (United States)

    Tang, Dong; Feng, Shouli; Li, Sai; Chen, Yu; Zhou, Baoliang

    2018-03-27

    Gossypium bickii: (2n = 26, G 1 G 1 ), a wild diploid cotton, carries many favourable traits. However, these favourable traits cannot be directly transferred into G. hirsutum (2n = 52, AADD) cultivars due to the differences in genomes. Monosomic alien addition lines (MAALs) are considered an invaluable tool for the introgression of genes of interest from wild relatives into cultivated crops. In this study, the G. hirsutum-G. bickii amphidiploid (2n = 78, AADDG 1 G 1 ) was backcrossed with G. hirsutum to develop alien additions containing individual G. bickii chromosomes in a G. hirsutum background. Genomic in situ hybridization was employed to detect the number of alien chromosomes added to the backcross progenies. A total of 183 G. bickii-specific DNA markers were developed to discriminate the identities of the G. bickii chromosomes added to G. hirsutum and assess the alien chromosome transmissibility. Chromosomes 4G b and 13G b showed the highest transmissibility, while chromosomes 1G b , 7G b and 11G b showed the lowest. Ten of the 13 possible G. hirsutum-G. bickii MAALs were isolated and characterized, which will lay the foundation for transferring resistance genes of G. bickii into G. hirsutum, as well as for gene assignment, physical mapping, and selective isolation and mapping of cDNAs for particular G. bickii chromosomes. The strategies of how to use MAALs to develop varieties with the trait of interest from wild species (such as glanded plant-glandless seed) were proposed and discussed.

  19. Produtividade do algodoeiro herbáceo em plantio direto no Cerrado com rotação de culturas Herbaceous cotton yield in no-till system in rainfed Savannah conditions with crop rotation

    Directory of Open Access Journals (Sweden)

    José Carlos Corrêa

    2004-01-01

    Full Text Available O experimento, instalado em um Latossolo Vermelho-Amarelo muito argiloso, teve o objetivo de avaliar o efeito da rotação de culturas na produtividade do algodoeiro herbáceo (Gossypium hirsutum L. r. latifolium Hutch em plantio direto sob condições de sequeiro no Cerrado. O delineamento experimental foi de blocos casualizados com cinco tratamentos e quatro repetições. Os tratamentos consistiram das rotações soja-milheto-soja-milheto-algodoeiro; soja-amaranto-soja-nabo forrageiro-soja-algodoeiro; soja-sorgo granífero-soja-sorgo granífero-algodoeiro; soja-aveia preta-soja-aveia preta-algodoeiro e soja-soja-algodoeiro. A maior produtividade do algodoeiro foi obtida com a rotação de soja e milheto, em que houve melhor controle de plantas daninhas.The experiment was carried out in a heavy red yellow latosol and aimed at evaluating crop rotation on herbaceous cotton yields in no-till system under rainfed Savannah conditions. The experimental design used was a completely randomised blocks with five treatments: soybean-millet-soybean-millet-cotton; soybean-amaranth-soybean-forage radish-soybean-cotton; soybean-grain sorghum-soybean-grain sorghum-cotton; soybean-black rye-soybean-black rye-cotton and soybean-soybean-cotton and four replications. The highest cotton seed yield was obtained in the sequence soybean-millet-soybean-millet-cotton, in which best weed control also occurred.

  20. Tamanho de amostra na parcela para caracterização da altura de plantas de algodoeiro herbáceo Gossypium hirsutum

    Directory of Open Access Journals (Sweden)

    Freitas Joelson André de

    2001-01-01

    Full Text Available Dados da altura individual de dez plantas, obtidos de dez experimentos instalados em blocos casualizados com quatro repetições e quatro cultivares de algodoeiro herbáceo, foram estudados, para determinação do número mínimo de plantas/parcela, necessárias para caracterização da altura média de plantas de algodoeiro herbáceo. Foram estudados cinco tamanhos de amostra na parcela, cada uma, contendo 2, 4, 6, 8 e 10 plantas. Os coeficientes de variação experimental e amostral e as significâncias observadas nas análises de variâncias, indicaram que parcelas contendo seis ou mais plantas, permitiram boa caracterização do porte médio das variedades de algodoeiro testadas. Os resultados sugerem, portanto que, no processo de caracterização da altura média do algodoeiro herbáceo, a avaliação pode ser mais rápida, além de haver uma redução na mão-de-obra de coleta e manuseio dos dados, em decorrência de uma diminuição do número de plantas amostradas na parcela.

  1. Characterization of eleven monosomic alien addition lines added from Gossypium anomalum to Gossypium hirsutum using improved GISH and SSR markers.

    Science.gov (United States)

    Wang, Xiaoxiao; Wang, Yingying; Wang, Chen; Chen, Yu; Chen, Yu; Feng, Shouli; Zhao, Ting; Zhou, Baoliang

    2016-10-07

    Gossypium anomalum (BB genome) possesses the desirable characteristics of drought tolerance, resistance to diseases and insect pests, and the potential for high quality fibers. However, it is difficult to transfer the genes associated with these desirable traits into cultivated cotton (G. hirsutum, AADD genome). Monosomic alien addition lines (MAALs) can be used as a bridge to transfer desired genes from wild species into G. hirsutum. In cotton, however, the high number and smaller size of the chromosomes has resulted in difficulties in discriminating chromosomes from wild species in cultivated cotton background, the development of cotton MAALs has lagged far behind many other crops. To date, no set of G. hirsutum-G. anomalum MAALs was reported. Here the amphiploid (AADDBB genome) derived from G. hirsutum × G. anomalum was used to generate a set of G. hirsutum-G. anomalum MAALs through a combination of consecutive backcrossing, genomic in situ hybridization (GISH), morphological survey and microsatellite marker identification. We improved the GISH technique used in our previous research by using a mixture of two probes from G. anomalum and G. herbaceum (AA genome). The results indicate that a ratio of 4:3 (G. anomalum : G. herbaceum) is the most suitable for discrimination of chromosomes from G. anomalum and the At-subgenome of G. hirsutum. Using this improved GISH technique, 108 MAAL individuals were isolated. Next, 170 G. hirsutum- and G. anomalum-specific codominant markers were obtained and employed for characterization of these MAAL individuals. Finally, eleven out of 13 MAALs were identified. Unfortunately, we were unable to isolate Chrs. 1B a and 5B a due to their very low incidences in backcrossing generation, as these remained in a condition of multiple additions. The characterized lines can be employed as bridges for the transfer of desired genes from G. anomalum into G. hirsutum, as well as for gene assignment, isolation of chromosome

  2. Alterações anatômicas em plantas de algodoeiro com sintomas de murchamento avermelhado Anatomical alterations in cotton plants with reddish withering symptoms

    Directory of Open Access Journals (Sweden)

    Rachel Benetti Queiroz-Voltan

    1995-01-01

    Full Text Available Estudaram-se as alterações anatômicas em plantas de algodoeiro com sintomas de murchamento avermelhado em dezembro de 1993-fevereiro de 94. Analisaram-se amostras de raiz, caule e folha de Gossypium hirsutum L. 'IAC 20' provenientes de áreas de ocorrência do sintoma. Estimou-se o número de glândulas secretoras das folhas dos cultivares IAC 20 e CNPA ITA 90 (que se tem mostrado resistente. Observou-se que as células parenquimáticas apresentavam, no interior, substâncias insolúveis em água, cuja concentração aumentava à medida do grau do sintoma. As folhas apresentaram uma concentração maior dessas substâncias em relação ao restante do corpo vegetal. Os núcleos das células do parênquima paliçádico encontravam-se aumentados e os cloroplastos do mesofilo, parcialmente destruídos. As plantas com alto grau de sintoma apresentavam também um número maior de glândulas secretoras nas folhas.Anatomical alterations in cotton plants (Gossypium hirsutum L. with reddish withering symptons observated between December/93 to February/94 were studied. Samples of root, stem and leaf of Gossypium hirsutum L. 'IAC 20' collected in several sites with symptoms occurrence were analised. The number of secretory glands in the leaves of cultivar IAC 20, and for the resistent cultivar CNPA ITA 90 was estimated. The parenchyma cells included insoluble substances, and these concentrations increased with the crescent symptoms. The leaves presented higher concentration of these substances than the remaining plant body. The nucleus of palisade parenchyma cells was increased and the chloroplasts partially destroyed. The leave secretory glands number increases proportionally to the advance of the symptoms.

  3. Adubação verde e sistemas de manejo do solo na produtividade do algodoeiro Green manure and soil management systems on cotton yield

    Directory of Open Access Journals (Sweden)

    Marco Antonio Camillo de Carvalho

    2004-12-01

    Full Text Available A adoção de sistemas de manejo conservacionistas e a sucessão de culturas com adubos verdes são práticas que visam preservar a qualidade do solo e do ambiente, sem prescindir da obtenção de produtividade elevada das culturas de interesse econômico. O objetivo deste trabalho foi avaliar os efeitos de sistemas de manejo do solo e adubos verdes na produtividade do algodoeiro (Gossypium hirsutum L.. O experimento foi realizado num Latossolo Vermelho distrófico, originalmente sob vegetação de Cerrado. O delineamento utilizado foi o de blocos ao acaso, em esquema de parcela subdividida e quatro repetições. Nas parcelas, utilizaram-se quatro adubos verdes: mucuna-preta, guandu, crotalária e milheto, e área de pousio (vegetação espontânea. Nas subparcelas foram adotados dois sistemas de manejo do solo: plantio direto e preparo convencional (uma gradagem pesada + duas gradagens leves. Os sistemas de manejo do solo não interferiram na produtividade do algodoeiro. O algodoeiro apresentou produtividade semelhante quando cultivado em sucessão a diferentes espécies de adubos verdes, no sistema de plantio direto e convencional de preparo do solo.The adoption of conservation management system and succession of crops after green manures aim at preserving the environment and soil quality, without dispensing the largest cash crop yield. The objective of this work was to evaluate the effects of soil management systems and green manures on cotton yield (Gossypium hirsutum L.. The experiment was carried out in a Typic Hapludox, covered by Savannah vegetation. The experimental design used was that of randomized blocks, in a split plot scheme, with four replications. In plots, four green manures were used: black velvet bean, pigeon pea, sunn hemp, millet and fallow area (spontaneous vegetation. In subplots, two managament soil systems were used: no-tillage and conventional tillage (one disk harrow + two levelling harrow. Soil management systems do

  4. Elevated CO2, warmer temperatures and soil water deficit affect plant growth, physiology and water use of cotton (Gossypium hirsutum L.)

    Science.gov (United States)

    Changes in temperature, atmospheric [CO2] and precipitation under the scenarios of projected climate change present a challenge to crop production, and may have significant impacts on the physiology, growth and yield of cotton (Gossypium hirsutum L.). A glasshouse experiment explored the early growt...

  5. Genetic basis of some yield components in gossypium hirsutum l

    International Nuclear Information System (INIS)

    Javed, A.; Azhar, F.M.; Khan, I.A.; Rana, S.A.

    2014-01-01

    A 5 * 5 diallel analysis was conducted to study the inheritance of seed cotton yield, number of bolls and boll weight in Gossypium hirsutum L. using combining ability technique. The analysis of the data revealed that variance due to specific combining ability was significant for all the three traits signifying the importance of non additive gene action. The comparison of the parents showed that NF-801-2-37 was the best general combiner for seed cotton yield, number of bolls and boll weight followed by Acala-63-75. Best hybrid combinations identified were Acala-63-75 * NF-801-2-37 for seed cotton yield and DPL-61 * NF-801-2-37 for number of bolls and boll weight. Higher proportion of dominance variance in all three traits suggested delayed selection or use of heterosis breeding in crop improvement programs. (author)

  6. Fertigação do algodoeiro utilizando efluente doméstico tratado Fertigation of cotton with treated domestic sewage

    Directory of Open Access Journals (Sweden)

    Osvaldo N Sousa Neto

    2012-02-01

    Full Text Available Conduziu-se um experimento no Campus da Universidade Federal Rural do Semiárido em Mossoró, RN, com o objetivo de avaliar o comportamento do algodoeiro (Gossypium hirsutum L. raça latifolium Hatch cultivar 8H, quanto ao aspecto crescimento, quando irrigado com efluentes domésticos tratados. O delineamento experimental adotado foi o de blocos casualizados com parcelas subdivididas e sendo testadas, nas parcelas, as diluições do efluente doméstico [25% - T1, 50% - T2, 75% - T3 e 100% de água residuária- T4 e água de abastecimento + adubação mineral do solo - T5] em dois solos de texturas contrastantes (Latossolo Vermelho Amarelo - S1 e Cambissolo - S2. A irrigação com água residuária influenciou significativamente o crescimento das plantas de algodoeiro, em referência ao índice de velocidade de emergência, à percentagem de germinação à altura de plantas, ao diâmetro caulinar e número de folhas e à área foliar e massa seca de parte aérea, crescendo com o aumento da proporção de uso do efluente doméstico. Houve efeito positivo do acúmulo de nutrientes no solo aplicados via fertirrigação sobre as variáveis estudadas. A fertirrigação com efluente doméstico tratado pode substituir a adubação convencional do algodoeiro.An experiment was conducted at the Universidade Federal Rural do Semi-arid in Mossoró, RN with the aim of evaluating the behavior of cotton (Gossypium hirsutum L. race latifolium Hatch 8H cultivar, in terms of growth when irrigated with treated domestic sewage. The experimental design was in randomized blocks with split plots and in plots were tested dilutions of wastewater [25% - T1, 50% - T2, 75% - T3 and 100% of wastewater - T4 and supply water with mineral fertilizer - T5] in two soils of contrasting textures. Irrigation with wastewater significantly influenced the growth of cotton plants, the rate of emergence, the germination percentage, plant height, stem diameter and leaf area, growing

  7. CRITICAL COMPETITION PERIOD BETWEEN COTTON AND (Gossypium hirsutum L. HARMFUL WEED COMMUNITIES IN THE GOIÁS STATE PERÍODO CRÍTICO DE COMPETIÇÃO ENTRE COMUNIDADES DE PLANTAS DANINHAS E O ALGODOEIRO (Gossypium hirsutum L. NO ESTADO DE GOIÁS

    Directory of Open Access Journals (Sweden)

    Armando M. Macêdo

    2007-09-01

    Full Text Available

    In order to study the critical time that weeds compete with the cotton plant, five trial experiments were conducted from 1978-1981. Two of the trials were carried out in a dark red latosoil with 4.70% organic matter and 10.73% clay, at the Rio Verde Agricultural School in the state of Goiás, during the 1978—79 and 1979—80 planting seasons. The other three were carried out in dark red latosoil, with a loam clay texture, moderate acidity and a low proportion of organic matter, at the Experimental station in Goiânia, Goiás during the 1978—79, 1979—80 and 1980—81 planting seasons. The treatments designed were: weeding up to 2, 4, 6, 8 first weeks, and weeding during the whole cycle ,and weeding after the 2, 4, 6, 8 first weeks and no weeding at all during the cycle. The results showed that weed competition , when not controlled, determined a yield loss of 88.75% in Goiânia and 90.65% in Rio Verde. Regarding the group control, which was maintained without weed competition, the best yield was obtained when the cotton was maintained without competition during eight weeks after the emergence in Rio Verde and during 4, 6, 8 weeks in Goiânia. The critical competition period occurred between the fourth and sixth weeks after the emergence in Rio Verde and in the fourth week after the emergence in Goiânia.

    Com a finalidade de estudar as épocas críticas de competição de plantas daninhas com o algodoeiro (Gossipium hirsutum L. , foram instalados cinco ensaios em área do Colégio Agrícola de Rio Verde — Goiás, no período de 1978 a 1981, sendo dois ensaios nos anos agrícolas de 1978/79 e 1979/80 em latossolo vermelho—escuro com 4,71% de matéria orgânica e 10,73% de argila. Os outros três ensaios foram instalados nos anos agrícolas 1978/79, 1979/80 e 1980/81, em área da Estação Experimental de

  8. Cytomorphological studies in X-ray induced glandless haploids in Gossypium hirsutum L. (cotton)

    Energy Technology Data Exchange (ETDEWEB)

    Mehetre, S.S.; Thombre, M.V. (Mahatma Phule Krishi Vidyapeeth, Rahuri (India))

    1981-08-01

    Six haploid plants were obtained in M/sub 2/ generation of the 25 kr. X-ray irradiated Gossypium hirsutum L. cotton variety H.G. 108. The cytomorphological studies on these plants indicated highly irregular meiosis, giving on an average six bivalents, the range being 0-9. Unequal separation of chromosomes and chromatids at anaphase-1 and II respectively led to formation of abnormal tetrads and pollens with high size variations leading to high pollen sterility. These plants were characterized by miniature stature, shorter stem and internodes, smaller leaves, flowers and stomata with fewer chloroplasts, male and female sterility and halving of chromosomes. The reduction in morphological characters was nearly in the proportion of 1:2 as compared to their diploid counterparts. 31 refs.; 5 tables; 12 figures.

  9. Effect of factory effluents on physiological and biochemical contents of Gossypium hirsutum l.

    Science.gov (United States)

    Muthusamy, A; Jayabalan, N

    2001-10-01

    The effect of sago and sugar factory effluents was studied on Gossypium hirsutum L. var. MCU 5 and MCU 11. Plants were irrigated with 0, 25, 50, 75 and 100% of effluents of both factories. At lower concentration (25%) of sugar factory effluents had stimulatory effect on all biochemical contents observed. Moreover, all concentration of sago factory effluents were found to have inhibitory effect on all biochemical contents except proline content which increased with increasing concentration of both the effluents. Plants growing on adjacent to sago and sugar factories or they irrigated with such type of polluted water, may accumulate the heavy metals found in both the effluents, at higher levels in plant products and if consumed may have similar effect on living organisms.

  10. Desenvolvimento radicular do algodoeiro em resposta à localização do fertilizante Cotton root development as affected by fertilizer placement

    Directory of Open Access Journals (Sweden)

    Fábio Suano de Souza

    2007-04-01

    Full Text Available A utilização de adubos pode-se tornar prejudicial caso o fertilizante não seja localizado adequadamente. No presente trabalho foram estudados o crescimento radicular do algodoeiro (Gossypium hirsutum, o crescimento inicial e a nutrição da planta, considerando o local de aplicação do fertilizante. O estudo foi realizado em vasos com parede de vidro. O fertilizante foi colocado a 5,0 cm abaixo e 0,0, 2,5, 5,0 e 10,0 cm ao lado das sementes. O crescimento radicular foi avaliado a cada três dias e, aos 21 dias após a emergência, as plantas foram coletadas, sendo avaliada a produção de matéria seca e a absorção de macronutrientes. A aplicação de fertilizante proporcionou crescimento inicial mais vigoroso do sistema radicular mesmo em solo previamente corrigido e adubado, o que é importante no estabelecimento da cultura. Somente houve bom crescimento inicial do sistema radicular e da parte aérea do algodoeiro quando o fertilizante foi aplicado de 5,0 a 10,0 cm ao lado e 5,0 cm abaixo das sementes.Unless fertilizer is properly placed in the soil it can be harmful. This experiment was conducted to study cotton (Gossypium hirsutum root growth and initial plant development and nutrition as affected by fertilizer placement. Cotton plants were grown in pots with a glass wall. The fertilizer was applied 5.0 cm under the seed row and 0, 2.5, 5.0 and 10.0 cm beside the seed row. Root growth was evaluated every 3 days, and 21 days after emergence the plants were harvested. Dry matter production and macronutrient absorption were evaluated. Even in previously limed and fertilized soil, localized fertilizer application reinforced the initial growth of cotton roots, which is very important for a good crop establishment in the field. Normal root growth and adequate initial plant development was only observed when the fertilizer was placed 5.0 cm below and from 5.0 to 10.0 cm distance from the seed row.

  11. Proteomics profiling of fiber development and domestication in upland cotton (Gossypium hirsutum L.).

    Science.gov (United States)

    Hu, Guanjing; Koh, Jin; Yoo, Mi-Jeong; Pathak, Dharminder; Chen, Sixue; Wendel, Jonathan F

    2014-12-01

    Comparative proteomic analyses were performed to detail the evolutionary consequences of strong directional selection for enhanced fiber traits in modern upland cotton (Gossypium hirsutum L.). Using two complementary proteomic approaches, 2-DE and iTRAQ LC-MS/MS, fiber proteomes were examined for four representative stages of fiber development. Approximately 1,000 protein features were characterized using each strategy, collectively resulting in the identification and functional categorization of 1,223 proteins. Unequal contributions of homoeologous proteins were detected for over a third of the fiber proteome, but overall expression was balanced with respect to the genome-of-origin in the allopolyploid G. hirsutum. About 30% of the proteins were differentially expressed during fiber development within wild and domesticated cotton. Notably, domestication was accompanied by a doubling of protein developmental dynamics for the period between 10 and 20 days following pollination. Expression levels of 240 iTRAQ proteins and 293 2-DE spots were altered by domestication, collectively representing multiple cellular and metabolic processes, including metabolism, energy, protein synthesis and destination, defense and stress response. Analyses of homoeolog-specific expression indicate that duplicated gene products in cotton fibers can be differently regulated in response to selection. These results demonstrate the power of proteomics for the analysis of crop domestication and phenotypic evolution.

  12. Preferência de Bemisia tabaci biótipo B em linhagens mutantes de algodoeiro Bemisia tabaci biotype B preference in mutant cotton lines

    Directory of Open Access Journals (Sweden)

    Francisco das Chagas Vidal Neto

    2008-02-01

    Full Text Available Os efeitos de caracteres mutantes morfológicos do algodoeiro (Gossypium hirsutum L. r. latifolium Hutch.: folha okra, bráctea frego e planta vermelha, em relação à resistência à mosca-branca (Bemisia tabaci biótipo B Hemiptera: Aleyrodidae, foram avaliados em experimentos com ou sem chance de escolha. Os experimentos foram conduzidos em casa-de-vegetação, no delineamento de blocos ao acaso, em fatorial 23 + 1, com quatro repetições. O mutante com a característica planta vermelha foi menos atrativo e menos preferido para oviposição, em relação à planta verde, em ambos os ensaios, com ou sem escolha. Não houve preferência quanto à forma da folha e ao tipo de bráctea.The effects of cotton lines (Gossypium hirsutum L. r. latifolium Hutch. with mutants morphologic characteristics: okra leaf, frego bract and red plant in relation to host plant resistance to whitefly (Bemisia tabaci bioyipe B Hemiptera: Aleyrodidae, were evaluated in choice or no choice assays. The assays were carried out in the greenhouse conditions, according to a completely randomized block design, in a 23 + 1 in a factorial arrangement with four replications. The mutant with red plant characteristic was less attractive and less preferred for oviposition than the normal green plant does, in both, whit or without choice tests. It did not have preference in relation to the form of the leaf and bract type.

  13. Overexpression of MIC-3 indicates a direct role for the MIC gene family in mediating Upland cotton (Gossypium hirsutum) resistance to root-knot nematode (Meloidogyne incognita)

    Science.gov (United States)

    Major quantitative trait loci (QTL) have been mapped to Upland cotton (Gossypium hirsutum L.) chromosomes 11 and 14 that govern the highly resistant phenotype in response to infection by root-knot nematode (RKN; Meloidogyne incognita Chitwood & White); however, nearly nothing is known regarding the ...

  14. Effects of rotation of cotton (Gossypium hirsutum L.) and soybean [Glycine max (L.) Merr.] crops on soil fertility in Elizabeth, Mississippi, USA

    OpenAIRE

    H.A., Reddy, K. and Pettigrew, W.T.

    2018-01-01

    The effects of cotton (Gossypium hirsutum L.): soybean [Glycine max (L.) Merr.] rotation on the soil fertility levels are limited. An irrigated soybean: cotton rotation experiment was conducted from 2012 through 2015 near Elizabeth, Mississippi, USA. The crop rotation sequences were included continuous cotton (CCCC), continuous soybean (SSSS), cotton-soybean-cotton-soybean (CSCS), cotton-soybean-soybean-cotton (CSSC), soybean-cotton-cotton-soybean (SCCS), soybean-cotton-soybean-cotton (SCSC)....

  15. Efeito da época de plantio na produção e na ocorrência de pragas em culturas do algodoeiro (Gossypium hirsutum = Effect of planting date on the production and the occurrence of pests in the cotton (Gossypium hirsutum

    Directory of Open Access Journals (Sweden)

    José Janduí Soares

    2006-07-01

    Full Text Available O objetivo deste trabalho foi verificar o efeito da época de plantio na produção e ocorrência de pragas em culturas do algodoeiro. Foi analisada a influência da época de plantio no rendimento e na ocorrência de pragas nos cultivares de algodoeiro CNPA 7H e DeltapineAcala 90, em Formosa do Rio Preto, São Desidério e Luiz Eduardo Magalhães, no estado da Bahia, nos campos experimentais da Embrapa, instalados nas fazendas Independência, Mizote e Poletto, respectivamente. Quatro épocas foram avaliadas e os plantios foram feitos nos meses de novembro, dezembro e janeiro, safras 1998/1999 e 1999/2000, com intervalos de 15 dias entre cada plantio. Os dados foram submetidos à análise da variância e as médias comparadas pelo teste de Tukey a 5% de probabilidade. Realizou-se levantamentos semanais de 5 insetos-praga e pulverizações para manter a infestação abaixo dos níveis de controle. Por meio dos resultados obtidos, pode-se inferir que: a a época de plantio tem uma marcante influência na produção do algodoeiro; b a época de plantio do algodoeiro influencia a ocorrência de insetos-praga com reflexos em sua produtividade.The aim of this research was to determine the effect of planting date and the occurrence of pests on the cotton crop. The influence of the planting date on the output of the cotton CNPA 7H and Deltapine Acala 90, at Formosa do Rio Preto, São Desidério and Luiz Eduardo Magalhães, in the experimental fields of the Embrapa, in the state of Bahia, was analyzed. Four planting dates were evaluated. The plantings were in November, December and January, 1998/1999 and 1999/2000 crops, with intervals of 15 days between each planting. The data were submitted to analysis of variance and the averages compared by Tukey’s test at 5% probability. According to the results, the following conclusions can be inferred: a The planting date has a significant influence on the cotton production; b The cotton planting date

  16. Elargissement de la base génétique de la principale espèce de cotonnier cultivé Gossypium hirsutum L. par la création et l'exploitation de lignées monosomiques d'addition

    Directory of Open Access Journals (Sweden)

    Sarr D.

    2009-01-01

    Full Text Available Genetic broadening of the main cultivated cotton species Gossypium hirsutum L. by creation and exploitation of monosomic alien addition lines. The genus Gossypium is composed of about forty wild diploïd species that constitute an important reservoir of interesting genes for the genetic improvement of Gossypium hirsutum L., the main cultivated cotton species. Creation of monosomic alien addition lines (MAAL, made up of plants having in addition to the chromosome set of the cultivated species one wild species' supernumerary chromosome, is an interesting way to exploit this diversity. Numerous constraints limit the creation of MAAL, among them the most important is doubtless the production of first generation derivatives from pentaploids obtained by backcrossing G. hirsutum with bispecific hexaploid hybrids made of the cultivated species tetraploid genome and the genome of a donor diploid species. Raising this impediment by appropriate techniques allows to develop MAAL offering the possibility to introgress finely traits of interest from diploid species and to better understand genomic relationships between species in the genus Gossypium. Identification and exploitation of these MAAL have been for a long time based on not very reliable morphological characteristics and on the use of classical cytogenetic techniques, very heavy to implement. Nowadays, the exploitation of MAAL benefits from the great advances registered in molecular biology through the development of DNA markers and molecular cytogenetics. These progresses make of MAAL a promising way for the genetic improvement of the main cultivated cotton species.

  17. Genome-Wide Identification and Comparative Analysis of the 3-Hydroxy-3-methylglutaryl Coenzyme A Reductase (HMGR Gene Family in Gossypium

    Directory of Open Access Journals (Sweden)

    Wei Liu

    2018-01-01

    Full Text Available Terpenes are the largest and most diverse class of secondary metabolites in plants and play a very important role in plant adaptation to environment. 3-Hydroxy-3-methylglutaryl coenzyme A reductase (HMGR is a rate-limiting enzyme in the process of terpene biosynthesis in the cytosol. Previous study found the HMGR genes underwent gene expansion in Gossypium raimondii, but the characteristics and evolution of the HMGR gene family in Gossypium genus are unclear. In this study, genome-wide identification and comparative study of HMGR gene family were carried out in three Gossypium species with genome sequences, i.e., G. raimondii, Gossypium arboreum, and Gossypium hirsutum. In total, nine, nine and 18 HMGR genes were identified in G. raimondii, G. arboreum, and G. hirsutum, respectively. The results indicated that the HMGR genes underwent gene expansion and a unique gene cluster containing four HMGR genes was found in all the three Gossypium species. The phylogenetic analysis suggested that the expansion of HMGR genes had occurred in their common ancestor. There was a pseudogene that had a 10-bp deletion resulting in a frameshift mutation and could not be translated into functional proteins in G. arboreum and the A-subgenome of G. hirsutum. The expression profiles of the two pseudogenes showed that they had tissue-specific expression. Additionally, the expression pattern of the pseudogene in the A-subgenome of G. hirsutum was similar to its paralogous gene in the D-subgenome of G. hirsutum. Our results provide useful information for understanding cytosolic terpene biosynthesis in Gossypium species.

  18. Genetic divergence and association among polygenic characters in gossypium hirsutum L

    International Nuclear Information System (INIS)

    BiBi, M.; Khan, N.U.; Mohammad, F.; Gul, R.

    2011-01-01

    Development of promising cotton populations with improved agronomic performance is primary objective of the cotton breeders. Genetic potential and variability in 8 X 8 F/sub 1/diallel hybrids versus their parental lines, traits correlation and heritability estimates were studied in Gossypium hirsutum L., during 2008-09 at Khyber Pakhtunkhwa Agricultural University, Peshawar, Pakistan. Highly significant variations were observed among the parental cultivars and their F/sub 1/ hybrids for all traits. Results indicated that F/sub 1/ hybrids CIM-506 X CIM-554, CIM-473 X CIM-554, CIM-446 X CIM-554 and CIM-446 X CIM-496 (its reciprocal) produced significantly higher seed cotton yield, bolls per sympodia, boll weight and seeds per boll. Most of the F/sub 1/ populations involving CIM-554 as maternal plant also revealed early maturity. Yield related traits revealed significant positive correlations with seed cotton yield. Heritability (broad sense) was high in magnitude for all traits. Results revealed that traits with high heritability and wide range of genetic variability in breeding material can work as a base population, and their significant contribution towards high yield can help in early segregating generations. (author)

  19. Efeito da mucuna e amendoim em rotação com algodoeiro A study on crop rotation for cotton using velvet bean and peanut

    Directory of Open Access Journals (Sweden)

    Carlos A. M. Ferraz

    1977-01-01

    Full Text Available O efeito da rotação de mucuna (Stizolobium atterrimum Piper & Tracy e amendoim (Arachis hypogaea L. e de duas variedades comerciais de algodoeiro, IAC RM3 e IAC 12-2 (Gossypium hirsutum L. foi estudado nos anos agrícolas de 1967/68 a 1972/73. Foram instalados dois ensaios, um em Presidente Bernardes, com fusariose, em solo podzolizado de Lins e Marília var. Lins naturalmente infectado por Fusarium oxysporumf. vasinfectum e o nematóide causador de galhas Meloidogyne incognita (Kofoid & White Chitwood, e outro em Presidente Venceslau, sem fusariose, em latossolo vermelho-escuro f. arenosa não infectado. A variedade comercial IAC RM3 é resistente e a IAC 12-2 é suscetível à fusariose. Para a análise estatística dos dados adotou-se o esquema de parcelas subdivididas, com seis repetições, tendo sido consideradas como parcelas as variedades de algodoeiro IAC RM3 e IAC 12-2, plantadas em 1968/69, 1970/71, 1971/72 e 1972/73, e como subparcelas as culturas em rotação, mucuna, amendoim e as variedades de algodoeiro IAC RM3 e IAC 12-2, plantadas nos anos-agrícolas de 1967/68 e 1969/70. Em solos com fusariose, em 1968/69, e em solos sem fusariose, no ano agrícola de 1970/71, destacou-se o efeito da rotação com mucuna, seguida da rotação com amendoim. Depois do plantio consecutivo de algodoeiro durante três anos (1970/71 a 1972/73, cessaram praticamente os efeitos da rotação para os dois casos. Houve aumento do teor de potássio após o primeiro ano de rotação, sendo maior para a mucuna.The effect of rotation of velvet bean (Stizolobium atterrimum Piper & Tracy, and peanut (Arachis hypogaea L. with two comercial varieties of cotton IAC RM3 and IAC 12-2 (Gossypium hirsutum L. was studied during 1967/68 to 1972/73. One experiment was conducted in a soil naturally infected by Fusarium oxysporum f. vasinfectum (Atk. Snyder & Hansen and by Meloidogyne incognita (Kofoid & White Chitwood, (President Bernardes, State of São Paulo, in

  20. Monitoring nitrogen nutrition in cotton Monitoramento da nutrição nitrogenada do algodoeiro

    Directory of Open Access Journals (Sweden)

    Ciro Antonio Rosolem

    2010-10-01

    Full Text Available Both N excess and deficiency may affect cotton yield and quality. It would therefore be useful to base the N management fertilization on the monitoring of the nutritional status. This study investigated the correlations among the following determination methods of the N nutritional status of cotton (Gossypium hirsutum L., var. Latifolia: chlorophyll readings (SPAD-502®, Minolta, specific-ion nitrate meter (Nitrate Meter C-141, Horiba-Cardy®, and laboratory analysis (conventional foliar diagnosis. Samples were taken weekly from two weeks before flowering to the fifth week after the first flower. The experiment was conducted on the Fazenda Santa Tereza, Itapeva, State of São Paulo, Brazil. The crop was fertilized with 40 kg ha-1 N at planting and 0, 30, 60, 90, and 120 kg ha-1 of side-dressed N. The range of leaf N contents reported as adequate for samples taken 80-90 days after plant emergence (traditional foliar diagnosis may be used as reference from the beginning of flowering when the plant is not stressed. Specific-ion nitrate meter readings can be used as a nutritional indicator of cotton nutrition from one week after pinhead until the third week of flowering. In this case, plants are well-nourished when readings exceed 8,000 mg L-1 NO3-. The chlorophyll meter can also be used to estimate the nutritional status of cotton from the third week of flowering. In this case the readings should be above 48 in well-nourished plants.Tanto o excesso como a deficiência de N podem levar a decréscimos na produção e qualidade do algodão. Assim, o monitoramento do estado nutricional da planta pode ajudar no manejo da adubação nitrogenada. Um experimento foi realizado para estudar as correlações entre métodos de determinação do estado nutricional do algodoeiro (Gossypium hirsutum L., var. Latifolia. Os métodos usados foram um medidor de clorofila (SPAD-502®, Minolta, um medidor específico de ions para nitrato (Nitrate Meter C-141, Horiba

  1. The draft genome of a diploid cotton Gossypium raimondii

    DEFF Research Database (Denmark)

    Wang, Kunbo; Wang, Zhiwen; Li, Fuguang

    2012-01-01

    We have sequenced and assembled a draft genome of G. raimondii, whose progenitor is the putative contributor of the D subgenome to the economically important fiber-producing cotton species Gossypium hirsutum and Gossypium barbadense. Over 73% of the assembled sequences were anchored on 13 G. raim...

  2. Comprehensive cytological characterization of the Gossypium hirsutum genome based on the development of a set of chromosome cytological markers

    Institute of Scientific and Technical Information of China (English)

    Wenbo; Shan; Yanqin; Jiang; Jinlei; Han; Kai; Wang

    2016-01-01

    Cotton is the world’s most important natural fiber crop. It is also a model system for studying polyploidization, genomic organization, and genome-size variation. Integrating the cytological characterization of cotton with its genetic map will be essential for understanding its genome structure and evolution, as well as for performing further genetic-map based mapping and cloning. In this study, we isolated a complete set of bacterial artificial chromosome clones anchored to each of the 52 chromosome arms of the tetraploid cotton Gossypium hirsutum. Combining these with telomere and centromere markers, we constructed a standard karyotype for the G. hirsutum inbred line TM-1. We dissected the chromosome arm localizations of the 45 S and 5S r DNA and suggest a centromere repositioning event in the homoeologous chromosomes AT09 and DT09. By integrating a systematic karyotype analysis with the genetic linkage map, we observed different genome sizes and chromosomal structures between the subgenomes of the tetraploid cotton and those of its diploid ancestors. Using evidence of conserved coding sequences, we suggest that the different evolutionary paths of non-coding retrotransposons account for most of the variation in size between the subgenomes of tetraploid cotton and its diploid ancestors. These results provide insights into the cotton genome and will facilitate further genome studies in G. hirsutum.

  3. Comprehensive cytological characterization of the Gossypium hirsutum genome based on the development of a set of chromosome cytological markers

    Directory of Open Access Journals (Sweden)

    Wenbo Shan

    2016-08-01

    Full Text Available Cotton is the world's most important natural fiber crop. It is also a model system for studying polyploidization, genomic organization, and genome-size variation. Integrating the cytological characterization of cotton with its genetic map will be essential for understanding its genome structure and evolution, as well as for performing further genetic-map based mapping and cloning. In this study, we isolated a complete set of bacterial artificial chromosome clones anchored to each of the 52 chromosome arms of the tetraploid cotton Gossypium hirsutum. Combining these with telomere and centromere markers, we constructed a standard karyotype for the G. hirsutum inbred line TM-1. We dissected the chromosome arm localizations of the 45S and 5S rDNA and suggest a centromere repositioning event in the homoeologous chromosomes AT09 and DT09. By integrating a systematic karyotype analysis with the genetic linkage map, we observed different genome sizes and chromosomal structures between the subgenomes of the tetraploid cotton and those of its diploid ancestors. Using evidence of conserved coding sequences, we suggest that the different evolutionary paths of non-coding retrotransposons account for most of the variation in size between the subgenomes of tetraploid cotton and its diploid ancestors. These results provide insights into the cotton genome and will facilitate further genome studies in G. hirsutum.

  4. Transcriptome Analysis of Cotton (Gossypium hirsutum L. Genotypes That Are Susceptible, Resistant, and Hypersensitive to Reniform Nematode (Rotylenchulus reniformis.

    Directory of Open Access Journals (Sweden)

    Ruijuan Li

    Full Text Available Reniform nematode is a semi-endoparasitic nematode species causing significant yield loss in numerous crops, including cotton (Gossypium hirsutum L.. An RNA-sequencing analysis was conducted to measure transcript abundance in reniform nematode susceptible (DP90 & SG747, resistant (BARBREN-713, and hypersensitive (LONREN-1 genotypes of cotton (Gossypium hirsutum L. with and without reniform nematode infestation. Over 90 million trimmed high quality reads were assembled into 84,711 and 80, 353 transcripts using the G. arboreum and the G. raimondii genomes as references. Many transcripts were significantly differentially expressed between the three different genotypes both prior to and during nematode pathogenesis, including transcripts corresponding to the gene ontology categories of cell wall, hormone metabolism and signaling, redox reactions, secondary metabolism, transcriptional regulation, stress responses, and signaling. Further analysis revealed that a number of these differentially expressed transcripts mapped to the G. raimondii and/or the G. arboreum genomes within 1 megabase of quantitative trait loci that had previously been linked to reniform nematode resistance. Several resistance genes encoding proteins known to be strongly linked to pathogen perception and resistance, including LRR-like and NBS-LRR domain-containing proteins, were among the differentially expressed transcripts mapping near these quantitative trait loci. Further investigation is required to confirm a role for these transcripts in reniform nematode susceptibility, hypersensitivity, and/or resistance. This study presents the first systemic investigation of reniform nematode resistance-associated genes using different genotypes of cotton. The candidate reniform nematode resistance-associated genes identified in this study can serve as the basis for further functional analysis and aid in further development of reniform a nematode resistant cotton germplasm.

  5. Advanced Backcross QTL Analysis of Fiber Strength and Fineness in a Cross between Gossypium hirsutum and G. mustelinum

    Directory of Open Access Journals (Sweden)

    Baohua Wang

    2017-10-01

    Full Text Available The molecular genetic basis of cotton fiber strength and fineness in crosses between Gossypium mustelinum and Gossypium hirsutum (Upland cotton was dissected using 21 BC3F2 and 12 corresponding BC3F2:3 and BC3F2:4 families. The BC3F2 families were genotyped with simple sequence repeat markers from a G. hirsutum by G. mustelinum linkage map, and the three generations of BC3-derived families were phenotyped for fiber strength (STR and fineness (Micronaire, MIC. A total of 42 quantitative trait loci (QTLs were identified through one-way analysis of variance, including 15 QTLs for STR and 27 for MIC, with the percentage of variance explained by individual loci averaging 13.86 and 14.06%, respectively. Eighteen of the 42 QTLs were detected at least twice near the same markers in different generations/families or near linked markers in the same family, and 28 of the 42 QTLs were identified in both mixed model-based composite interval mapping and one-way variance analyses. Alleles from G. mustelinum increased STR for eight of 15 and reduced MIC for 15 of 27 QTLs. Significant among-family genotypic effects (P < 0.001 were detected in 13 and 10 loci for STR and MIC respectively, and five loci showed significant (P < 0.001 genotype × family interaction for MIC. These results support the hypothesis that fiber quality improvement for Upland cotton could be realized by introgressing G. mustelinum alleles although complexities due to the different effects of genetic background on introgressed chromatin might be faced. Building on prior work with G. barbadense, G. tomentosum, and G. darwinii, QTL mapping involving introgression of G. mustelinum alleles offers new allelic variation to Upland cotton germplasm.

  6. Sequencing of allotetraploid cotton (Gossypium hirsutum L. acc. TM-1) provides a resource for fiber improvement.

    Science.gov (United States)

    Zhang, Tianzhen; Hu, Yan; Jiang, Wenkai; Fang, Lei; Guan, Xueying; Chen, Jiedan; Zhang, Jinbo; Saski, Christopher A; Scheffler, Brian E; Stelly, David M; Hulse-Kemp, Amanda M; Wan, Qun; Liu, Bingliang; Liu, Chunxiao; Wang, Sen; Pan, Mengqiao; Wang, Yangkun; Wang, Dawei; Ye, Wenxue; Chang, Lijing; Zhang, Wenpan; Song, Qingxin; Kirkbride, Ryan C; Chen, Xiaoya; Dennis, Elizabeth; Llewellyn, Danny J; Peterson, Daniel G; Thaxton, Peggy; Jones, Don C; Wang, Qiong; Xu, Xiaoyang; Zhang, Hua; Wu, Huaitong; Zhou, Lei; Mei, Gaofu; Chen, Shuqi; Tian, Yue; Xiang, Dan; Li, Xinghe; Ding, Jian; Zuo, Qiyang; Tao, Linna; Liu, Yunchao; Li, Ji; Lin, Yu; Hui, Yuanyuan; Cao, Zhisheng; Cai, Caiping; Zhu, Xiefei; Jiang, Zhi; Zhou, Baoliang; Guo, Wangzhen; Li, Ruiqiang; Chen, Z Jeffrey

    2015-05-01

    Upland cotton is a model for polyploid crop domestication and transgenic improvement. Here we sequenced the allotetraploid Gossypium hirsutum L. acc. TM-1 genome by integrating whole-genome shotgun reads, bacterial artificial chromosome (BAC)-end sequences and genotype-by-sequencing genetic maps. We assembled and annotated 32,032 A-subgenome genes and 34,402 D-subgenome genes. Structural rearrangements, gene loss, disrupted genes and sequence divergence were more common in the A subgenome than in the D subgenome, suggesting asymmetric evolution. However, no genome-wide expression dominance was found between the subgenomes. Genomic signatures of selection and domestication are associated with positively selected genes (PSGs) for fiber improvement in the A subgenome and for stress tolerance in the D subgenome. This draft genome sequence provides a resource for engineering superior cotton lines.

  7. Preferência alimentar do bicudo-do-algodoeiro por frutos de diferentes cultivares e idades

    Directory of Open Access Journals (Sweden)

    Busoli Antonio Carlos

    2004-01-01

    Full Text Available O objetivo deste trabalho foi avaliar a preferência alimentar de adultos do bicudo-do-algodoeiro, Anthonomus grandis Boheman, 1843 (Coleoptera: Curculionidae, por duas cultivares de algodão (Gossypium hirsutum L. com frutos de diferentes idades. Foram realizados quatro experimentos em laboratório, avaliando-se o número de orifícios de alimentação. Maçãs de 2, 8 e 12 dias de idade, das cultivares IAC-20 e Reba P288, foram oferecidas aos insetos, confinados em recipientes, com opção de escolha quanto à idade e cultivar (primeiro experimento, sem opção de escolha quanto à idade e cultivar (segundo experimento, sem opção de escolha quanto à cultivar e com opção quanto a idade (terceiro experimento e sem opção quanto à idade e com opção de escolha quanto à cultivar (quarto experimento. Observou-se preferência por maçãs da cultivar IAC-20 com dois dias de idade, com uma redução de danos de 23,53% e 78,43%, respectivamente, aos oito e aos doze dias de idade.

  8. MicroRNA-target gene responses to lead-induced stress in cotton (Gossypium hirsutum L.).

    Science.gov (United States)

    He, Qiuling; Zhu, Shuijin; Zhang, Baohong

    2014-09-01

    MicroRNAs (miRNAs) play key roles in plant responses to various metal stresses. To investigate the miRNA-mediated plant response to heavy metals, cotton (Gossypium hirsutum L.), the most important fiber crop in the world, was exposed to different concentrations (0, 25, 50, 100, and 200 µM) of lead (Pb) and then the toxicological effects were investigated. The expression patterns of 16 stress-responsive miRNAs and 10 target genes were monitored in cotton leaves and roots by quantitative real-time PCR (qRT-PCR); of these selected genes, several miRNAs and their target genes are involved in root development. The results show a reciprocal regulation of cotton response to lead stress by miRNAs. The characterization of the miRNAs and the associated target genes in response to lead exposure would help in defining the potential roles of miRNAs in plant adaptation to heavy metal stress and further understanding miRNA regulation in response to abiotic stress.

  9. Field-acclimated Gossypium hirsutum cultivars exhibit genotypic and seasonal differences in photosystem II thermostability.

    Science.gov (United States)

    Snider, John L; Oosterhuis, Derrick M; Collins, Guy D; Pilon, Cristiane; Fitzsimons, Toby R

    2013-03-15

    Previous investigations have demonstrated that photosystem II (PSII) thermostability acclimates to prior exposure to heat and drought, but contrasting results have been reported for cotton (Gossypium hirsutum). We hypothesized that PSII thermotolerance in G. hirsutum would acclimate to environmental conditions during the growing season and that there would be differences in PSII thermotolerance between commercially-available U.S. cultivars. To this end, three cotton cultivars were grown under dryland conditions in Tifton Georgia, and two under irrigated conditions in Marianna Arkansas. At Tifton, measurements included PSII thermotolerance (T15, the temperature causing a 15% decline in maximum quantum yield), leaf temperatures, air temperatures, midday (1200 to 1400h) leaf water potentials (ΨMD), leaf-air vapor pressure deficit (VPD), actual quantum yield (ΦPSII) and electron transport rate through PSII (ETR) on three sample dates. At Marianna, T15 was measured on two sample dates. Optimal air and leaf temperatures were observed on all sample dates in Tifton, but PSII thermotolerance increased with water deficit conditions (ΨMD=-3.1MPa), and ETR was either unaffected or increased under water-stress. Additionally, T15 for PHY 499 was ∼5°C higher than for the other cultivars examined (DP 0912 and DP 1050). The Marianna site experienced more extreme high temperature conditions (20-30 days Tmax≥35°C), and showed an increase in T15 with higher average Tmax. When average T15 values for each location and sample date were plotted versus average daily Tmax, strong, positive relationships (r(2) from .954 to .714) were observed between Tmax and T15. For all locations T15 was substantially higher than actual field temperature conditions. We conclude that PSII thermostability in G. hirsutum acclimates to pre-existing environmental conditions; PSII is extremely tolerant to high temperature and water-deficit stress; and differences in PSII thermotolerance exist between

  10. Structural analysis of Gossypium hirsutum fibers grown under greenhouse and hydroponic conditions.

    Science.gov (United States)

    Natalio, Filipe; Tahir, Muhammad Nawaz; Friedrich, Norman; Köck, Margret; Fritz-Popovski, Gerhard; Paris, Oskar; Paschke, Reinhard

    2016-06-01

    Cotton is the one of the world's most important crops. Like any other crop, cotton growth/development and fiber quality is highly dependent on environmental factors. Increasing global weather instability has been negatively impacting its economy. Cotton is a crop that exerts an intensive pressure over natural resources (land and water) and demands an overuse of pesticides. Thus, the search for alternative cotton culture methods that are pesticide-free (biocotton) and enable customized standard fiber quality should be encouraged. Here we describe a culture of Gossypium hirsutum ("Upland" Cotton) utilizing a greenhouse and hydroponics in which the fibers are morphological similar to conventional cultures and structurally fit into the classical two-phase cellulose I model with 4.19nm crystalline domains surrounded by amorphous regions. These fibers exhibit a single crystalline form of cellulose I-Iß, monoclinic unit cell. Fiber quality bulk analysis shows an improved length, strength, whiteness when compared with soil-based cultures. Finally, we show that our fibers can be spun, used for production of non-woven fabrics and indigo-vat stained demonstrating its potential in industrial and commercial applications. Copyright © 2016 Elsevier Inc. All rights reserved.

  11. Differential Cotton leaf crumple virus-VIGS-mediated gene silencing and viral genome localization in different Gossypium hirsutum genetic backgrounds

    KAUST Repository

    Idris, Ali

    2010-12-01

    A Cotton leaf crumple virus (CLCrV)-based gene silencing vector containing a fragment of the Gossypium hirsutum Magnesium chelatase subunit I was used to establish endogenous gene silencing in cotton of varied genetic backgrounds. Biolistic inoculation resulted in systemic and persistent photo-bleaching of the leaves and bolls of the seven cultivars tested, however, the intensity of silencing was variable. CLCrV-VIGS-mediated expression of green fluorescent protein was used to monitor the in planta distribution of the vector, indicating successful phloem invasion in all cultivars tested. Acala SJ-1, one of the cotton cultivars, was identified as a particularly optimal candidate for CLCrV-VIGS-based cotton reverse-genetics. © 2010 Elsevier Ltd.

  12. Effect of ecological management of weed control on economical income, yield and yield components of cotton (Gossypium hirsutum L.

    Directory of Open Access Journals (Sweden)

    A. Zare Feizabadi

    2016-04-01

    Full Text Available In order to compare of ecological management of weed control on economical income, yield and yield components of cotton (Gossypium hirsutum L., a Randomized Complete Block design with 12 treatments and four replications was conducted in Mahvelat of Khorasan Razavi province, Iran. Treatments consisted of weeding, harrowing, burning, two times weeding, weeding + harrowing, weeding + burning, harrowing + harrowing, harrowing + weeding, harrowing + burning, weeding+ harrowing+ burning, weed free and weedy as a check treatment. Investigated traits were plant height, number of boll in plant, 20 boll weight, 20 boll cotton lint weight, cotton lint yield per plant, cotton yield, number and biomass of weeds, outcome, net and gross income. The result showed that treatments had significant effect (p

  13. Genome-wide cloning, identification, classification and functional analysis of cotton heat shock transcription factors in cotton (Gossypium hirsutum).

    Science.gov (United States)

    Wang, Jun; Sun, Na; Deng, Ting; Zhang, Lida; Zuo, Kaijing

    2014-11-06

    Heat shock transcriptional factors (Hsfs) play important roles in the processes of biotic and abiotic stresses as well as in plant development. Cotton (Gossypium hirsutum, 2n=4x=(AD)2=52) is an important crop for natural fiber production. Due to continuous high temperature and intermittent drought, heat stress is becoming a handicap to improve cotton yield and lint quality. Recently, the related wild diploid species Gossypium raimondii genome (2n=2x=(D5)2=26) has been fully sequenced. In order to analyze the functions of different Hsfs at the genome-wide level, detailed characterization and analysis of the Hsf gene family in G. hirsutum is indispensable. EST assembly and genome-wide analyses were applied to clone and identify heat shock transcription factor (Hsf) genes in Upland cotton (GhHsf). Forty GhHsf genes were cloned, identified and classified into three main classes (A, B and C) according to the characteristics of their domains. Analysis of gene duplications showed that GhHsfs have occurred more frequently than reported in plant genomes such as Arabidopsis and Populus. Quantitative real-time PCR (qRT-PCR) showed that all GhHsf transcripts are expressed in most cotton plant tissues including roots, stems, leaves and developing fibers, and abundantly in developing ovules. Three expression patterns were confirmed in GhHsfs when cotton plants were exposed to high temperature for 1 h. GhHsf39 exhibited the most immediate response to heat shock. Comparative analysis of Hsfs expression differences between the wild-type and fiberless mutant suggested that Hsfs are involved in fiber development. Comparative genome analysis showed that Upland cotton D-subgenome contains 40 Hsf members, and that the whole genome of Upland cotton contains more than 80 Hsf genes due to genome duplication. The expression patterns in different tissues in response to heat shock showed that GhHsfs are important for heat stress as well as fiber development. These results provide an improved

  14. Development and bin mapping of gene-associated interspecific SNPs for cotton (Gossypium hirsutum L.) introgression breeding efforts.

    Science.gov (United States)

    Hulse-Kemp, Amanda M; Ashrafi, Hamid; Zheng, Xiuting; Wang, Fei; Hoegenauer, Kevin A; Maeda, Andrea B V; Yang, S Samuel; Stoffel, Kevin; Matvienko, Marta; Clemons, Kimberly; Udall, Joshua A; Van Deynze, Allen; Jones, Don C; Stelly, David M

    2014-10-30

    Cotton (Gossypium spp.) is the largest producer of natural fibers for textile and is an important crop worldwide. Crop production is comprised primarily of G. hirsutum L., an allotetraploid. However, elite cultivars express very small amounts of variation due to the species monophyletic origin, domestication and further bottlenecks due to selection. Conversely, wild cotton species harbor extensive genetic diversity of prospective utility to improve many beneficial agronomic traits, fiber characteristics, and resistance to disease and drought. Introgression of traits from wild species can provide a natural way to incorporate advantageous traits through breeding to generate higher-producing cotton cultivars and more sustainable production systems. Interspecific introgression efforts by conventional methods are very time-consuming and costly, but can be expedited using marker-assisted selection. Using transcriptome sequencing we have developed the first gene-associated single nucleotide polymorphism (SNP) markers for wild cotton species G. tomentosum, G. mustelinum, G. armourianum and G. longicalyx. Markers were also developed for a secondary cultivated species G. barbadense cv. 3-79. A total of 62,832 non-redundant SNP markers were developed from the five wild species which can be utilized for interspecific germplasm introgression into cultivated G. hirsutum and are directly associated with genes. Over 500 of the G. barbadense markers have been validated by whole-genome radiation hybrid mapping. Overall 1,060 SNPs from the five different species have been screened and shown to produce acceptable genotyping assays. This large set of 62,832 SNPs relative to cultivated G. hirsutum will allow for the first high-density mapping of genes from five wild species that affect traits of interest, including beneficial agronomic and fiber characteristics. Upon mapping, the markers can be utilized for marker-assisted introgression of new germplasm into cultivated cotton and in

  15. Response of Cotton (Gossypium Hirsutum L.) to Nitrogen Phosphorous Fertilizers in Western Kenya

    International Nuclear Information System (INIS)

    Kouko, W.O; Owino, G.

    1999-01-01

    The requirements for nitrogen and phosphorous fertilizers for growing cotton (Gossypium hirsutum L.) in Kenya are 26-kg N ha - 1 and 27 kg P ha - 1, respectively. Calcium ammonium nitrate (CAN) was recommended at the rate of 100 kg ha - 1 for black cotton soils while double superphosphate (DSP) was recommended at the rate of 150 kg ha - 1 on reddish brown clays. However, experiments conducted on a major soil types on which cotton is grown in Kenya showed that, soil colour is not the best indicator of nutrients supply power of the soil. It was found that Verto-eutric planosols of National Fibre Research Centres-Kibos requires application of 13-kg ha - 1 as CAN for optimal yields. Ferralo-eurtric Acrisols of Alupe Agricultural Research Sub-Centre, Busia needed 26-kg N ha - 1 and 9 kg P ha - 1 to give high yields. At Siaya FTC 9 kg P ha - 1 was adequate in providing the highest yields without nitrogen. Strict observation of recommended agronomic practices for growing cotton and good soil management practices for growing cotton and good soil management practices were observed a prerequisite for high response and efficient utilisation of fertilizers

  16. A New Synthetic Amphiploid (AADDAA) between Gossypium hirsutum and G. arboreum Lays the Foundation for Transferring Resistances to Verticillium and Drought

    Science.gov (United States)

    Chen, Yu; Wang, Yingying; Zhao, Ting; Yang, Jianwei; Feng, Shouli; Nazeer, Wajad; Zhang, Tianzhen; Zhou, Baoliang

    2015-01-01

    Gossypium arboreum, a cultivated cotton species (2n = 26, AA) native to Asia, possesses invaluable characteristics unavailable in the tetraploid cultivated cotton gene pool, such as resistance to pests and diseases and tolerance to abiotic stresses. However, it is quite difficult to transfer favorable traits into Upland cotton through conventional methods due to the cross-incompatibility of G. hirsutum (2n = 52, AADD) and G. arboreum. Here, we improved an embryo rescue technique to overcome the cross-incompatibility between these two parents for transferring favorable genes from G. arboreum into G. hirsutum. Our results indicate that MSB2K supplemented with 0.5 mgl-1 kinetin and 250 mg-1 casein hydrolysate is an efficient initial medium for rescuing early (3 d after pollination) hybrid embryos. Eight putative hybrids were successfully obtained, which were further verified and characterized by cytology, molecular markers and morphological analysis. The putative hybrids were subsequently treated with different concentrations of colchicine solution to double their chromosomes. The results demonstrate that four putative hybrid plants were successfully chromosome-doubled by treatment with 0.1% colchicine for 24 h and become amphiploid, which were confirmed by cytological observation, self-fertilization and backcrossing. Preliminary assessments of resistance at seedling stage indicate that the synthetic amphiploid showed highly resistant to Verticillium and drought. The synthetic amphiploid between G. hirsutum × G. arboreum would lay the foundation for developing G. arboreum-introgressed lines with the uniform genetic background of G. hirsutum acc TM-1, which would greatly enhance and simplify the mining, isolation, characterization, cloning and use of G. arboreum-specific desirable genes in future cotton breeding programs. PMID:26061996

  17. Métodos de destruição de restos de cultura do algodoeiro e sobrevivência do bicudo

    Directory of Open Access Journals (Sweden)

    Edenilson Batista Ribeiro

    2015-11-01

    Full Text Available Resumo: O objetivo deste trabalho foi avaliar a eficiência de métodos de destruição dos restos de cultura do algodoeiro (Gossypium hirsutum para a redução da população remanescente do bicudo-do-algodoeiro (Anthonomus grandis. O experimento foi conduzido em blocos ao acaso, com quatro repetições e cinco tratamentos: roçagem, com aplicação de 2,4-D e beta-ciflutrina; roçagem, com aplicação de 2,4-D e glifosato; roçagem e gradagem; roçagem, com aplicação de 2,4-D e beta-ciflutrina, além de gradagem; e testemunha (sem destruição. A quantidade de bicudos foi determinada após a destruição dos restos de cultura do algodão, por contagem dos insetos capturados nas armadilhas de feromônio e daqueles encontrados dentro dos carimãs, no interior das gaiolas e na área externa. O número médio de bicudos adultos, capturados nas armadilhas de feromônio no interior das gaiolas, variou de 0,71 a 1,35 indivíduos. O maior número de carimãs e de bicudos dos carimãs, dentro e fora das gaiolas, foi observado na testemunha. Já o menor número de insetos foi observado nos tratamentos com gradagem e roçagem e naqueles com roçagem e gradagem com aplicação de 2,4-D e beta-ciflutrina, que são eficientes na redução de carimãs e de adultos do bicudo. Todos os métodos avaliados reduzem a quantidade de bicudos vivos no interior de carimãs.

  18. Ingestion et digestibilité in vivo du Panicum maximum associé à trois compléments: tourteau de Jatophra curcas, tourteau de coton Gossypium hirsutum et Euphorbia heterophylla chez le cobaye Cavia porcellus L

    Directory of Open Access Journals (Sweden)

    N'G.D.V. Kouakou

    2010-01-01

    Full Text Available The Intake and the in vivo Digestibility of Panicum maximum Associated with Three Supplements: Jatophra curcas Cake, Gossypium hirsutum Cake and Euphorbia heterophylla (Euph in Guinea Pigs (Cavia porcellus L.. The intake and the in vivo digestibility of Panicum maximum associated with three supplements: Jatropha curcas cake, Gossypium hirsutum cake and Euphorbia heterophylla (Euph in guinea pigs (Cavia porcellus L. pigs, its association with Panicum maximum could be popularized wherever its abundance has been reported. In order used weed Euphorbia heterophylla in guinea pigs diet, comparative study of the intake and the in vivo digestibility of four treatments, Panicum maximum (Pan, Panicum maximum and Gossypium hirsutum cake (Pancoton, Panicum maximum and Euphorbia heterophylla (Paneuph and Panicum maximum and Jatropha curcas cake (Panjatro, in male guinea pigs were conducted in Yamoussoukro (Ivory Coast. The means of the intake (g DM/d were 64.8 ± 12.5; 74.3 ± 12.9; 73.7 ± 17.8 and 69.1 ± 12.3 respectively for Pan, Pancoton, Paneuph and Panjatro. Pancoton and Paneuph were significantly better ingested than Pan and Panjatro. Euphorbia heterophylla was significantly better ingested than the other two supplements (P< 0.05 and the mean daily weight gain with its association with Panicum maximum of 3.1 ± 0.6 g/d. The rate of substitution of Panicum maximum by Euphorbia heterophylla was nearly to one (1. The apparent digestibility coefficients (ADC for dry (68.0 ± 10.5% and organic matter (84.1 ± 5.2% of Paneuph were significantly higher (P< 0.05 than the ADC's for the other three treatments. Given the nutritional value of Euphorbia heterophylla in guinea pigs, its association with Panicum maximum could be popularized wherever its abundance has been reported.

  19. KUTUN : a morphogenetic model for cotton (Gossypium hirsitum L.)

    NARCIS (Netherlands)

    Mutsaers, H.J.W.

    1982-01-01

    A whole crop model for growth and development of cotton ( Gossypium hirsutum L.) is presented. The model is based on previous extensive studies on plant morphogenesis, growth of fruits and canopy photosynthesis. The crop model basically is a carbohydrate budget, but all

  20. Isolation and characterization of terpene synthases in cotton (Gossypium hirsutum).

    Science.gov (United States)

    Yang, Chang-Qing; Wu, Xiu-Ming; Ruan, Ju-Xin; Hu, Wen-Li; Mao, Yin-Bo; Chen, Xiao-Ya; Wang, Ling-Jian

    2013-12-01

    Cotton plants accumulate gossypol and related sesquiterpene aldehydes, which function as phytoalexins against pathogens and feeding deterrents to herbivorous insects. However, to date little is known about the biosynthesis of volatile terpenes in this crop. Herein is reported that 5 monoterpenes and 11 sesquiterpenes from extracts of a glanded cotton cultivar, Gossypium hirsutum cv. CCRI12, were detected by gas chromatography-mass spectrometry (GC-MS). By EST data mining combined with Rapid Amplification of cDNA Ends (RACE), full-length cDNAs of three terpene synthases (TPSs), GhTPS1, GhTPS2 and GhTPS3 were isolated. By in vitro assays of the recombinant proteins, it was found that GhTPS1 and GhTPS2 are sesquiterpene synthases: the former converted farnesyl pyrophosphate (FPP) into β-caryophyllene and α-humulene in a ratio of 2:1, whereas the latter produced several sesquiterpenes with guaia-1(10),11-diene as the major product. By contrast, GhTPS3 is a monoterpene synthase, which produced α-pinene, β-pinene, β-phellandrene and trace amounts of other monoterpenes from geranyl pyrophosphate (GPP). The TPS activities were also supported by Virus Induced Gene Silencing (VIGS) in the cotton plant. GhTPS1 and GhTPS3 were highly expressed in the cotton plant overall, whereas GhTPS2 was expressed only in leaves. When stimulated by mechanical wounding, Verticillium dahliae (Vde) elicitor or methyl jasmonate (MeJA), production of terpenes and expression of the corresponding synthase genes were induced. These data demonstrate that the three genes account for the biosynthesis of volatile terpenes of cotton, at least of this Upland cotton. Copyright © 2013 Elsevier Ltd. All rights reserved.

  1. Association mapping of resistance to Verticillium wilt in Gossypium ...

    African Journals Online (AJOL)

    Verticillium wilt is a major disease affecting the growth of cotton. For screening the resistant genes, 320 Gossypium hirsutum germplasms were evaluated in Verticillium nursery, and association mapping was used to detect the markers associated with the Verticillium wilt resistance. 106 microsatellite marker primer pairs ...

  2. Comparative transmission genetics of introgressed chromatin in Gossypium (cotton) polyploids.

    Science.gov (United States)

    Waghmare, Vijay N; Rong, Junkang; Rogers, Carl J; Bowers, John E; Chee, Peng W; Gannaway, John R; Katageri, Ishwarappa; Paterson, Andrew H

    2016-04-01

    Introgression is widely acknowledged as a potential source of valuable genetic variation, and growing effort is being invested in analysis of interspecific crosses conferring transgressive variation. Experimental backcross populations provide an opportunity to study transmission genetics following interspecific hybridization, identifying opportunities and constraints to introgressive crop improvement. The evolutionary consequences of introgression have been addressed at the theoretical level, however, issues related to levels and patterns of introgression among (plant) species remain inadequately explored, including such factors as polyploidization, subgenome interaction inhabiting a common nucleus, and the genomic distribution and linkage relationships of introgressant alleles. We analyze introgression into the polyploid Gossypium hirsutum (upland cotton) from its sister G. tomentosum and compare the level and pattern with that of G. barbadense representing a different clade tracing to the same polyploidization. Across the genome, recurrent backcrossing to Gossypium hirsutum yielded only one-third of the expected average frequency of the G. tomentosum allele, although one unusual region showed preferential introgression. Although a similar rate of introgression is found in the two subgenomes of polyploid (AtDt) G. hirsutum, a preponderance of multilocus interactions were largely within the Dt subgenome. Skewed G. tomentosum chromatin transmission is polymorphic among two elite G. hirsutum genotypes, which suggests that genetic background may profoundly affect introgression of particular chromosomal regions. Only limited correspondence is found between G. hirsutum chromosomal regions that are intolerant to introgression from the two species, G. barbadense and G. tomentosum, concentrated near possible inversion polymorphisms. Complex transmission of introgressed chromatin highlights the challenges to utilization of exotic germplasm in crop improvement. © 2016

  3. Recent long-distance transgene flow into wild populations conforms to historical patterns of gene flow in cotton (Gossypium hirsutum) at its centre of origin.

    Science.gov (United States)

    Wegier, A; Piñeyro-Nelson, A; Alarcón, J; Gálvez-Mariscal, A; Alvarez-Buylla, E R; Piñero, D

    2011-10-01

    Over 95% of the currently cultivated cotton was domesticated from Gossypium hirsutum, which originated and diversified in Mexico. Demographic and genetic studies of this species at its centre of origin and diversification are lacking, although they are critical for cotton conservation and breeding. We investigated the actual and potential distribution of wild cotton populations, as well as the contribution of historical and recent gene flow in shaping cotton genetic diversity and structure. We evaluated historical gene flow using chloroplast microsatellites and recent gene flow through the assessment of transgene presence in wild cotton populations, exploiting the fact that genetically modified cotton has been planted in the North of Mexico since 1996. Assessment of geographic structure through Bayesian spatial analysis, BAPS and Genetic Algorithm for Rule-set Production (GARP), suggests that G. hirsutum seems to conform to a metapopulation scheme, with eight distinct metapopulations. Despite evidence for long-distance gene flow, genetic variation among the metapopulations of G. hirsutum is high (He = 0.894 ± 0.01). We identified 46 different haplotypes, 78% of which are unique to a particular metapopulation, in contrast to a single haplotype detected in cotton cultivars. Recent gene flow was also detected (m = 66/270 = 0.24), with four out of eight metapopulations having transgenes. We discuss the implications of the data presented here with respect to the conservation and future breeding of cotton populations and genetic diversity at its centre of crop origin. © 2011 Blackwell Publishing Ltd.

  4. Analysis of [Gossypium capitis-viridis × (G.hirsutum × G.australe2] Trispecific Hybrid and Selected Characteristics.

    Directory of Open Access Journals (Sweden)

    Di Chen

    Full Text Available Speciation is always a contentious and challenging issue following with the presence of gene flow. In Gossypium, there are many valuable resources and wild diploid cotton especially C and B genome species possess some excellent traits which cultivated cotton always lacks. In order to explore character transferring rule from wild cotton to upland tetraploid cotton, the [G. capitis-viridis × (G. hirsutum × G. australe2] triple hybrid was synthesized by interspecies hybridization and chromosome doubling. Morphology comparisons were measured among this hybrid and its parents. It showed that trispecific hybrid F1 had some intermediate morphological characters like leaf style between its parents and some different characters from its parents, like crawl growth characteristics and two kind flower color. It is highly resistant to insects comparing with other cotton species by four year field investigation. By cytogenetic analysis, triple hybrid was further confirmed by meiosis behavior of pollen mother cells. Comparing with regular meiosis of its three parents, it was distinguished by the occurrence of polyads with various numbers of unbalanced microspores and finally generating various abnormal pollen grains. All this phenomenon results in the sterility of this hybrid. This hybrid was further identified by SSR marker from DNA molecular level. It showed that 98 selected polymorphism primers amplified effective bands in this hybrids and its parents. The genetic proportion of three parents in this hybrid is 47.8% from G. hirsutum, 14.3% from G. australe, 7.0% from G. capitis-viridis, and 30.9% recombination bands respectively. It was testified that wild genetic material has been transferred into cultivated cotton and this new germplasm can be incorporated into cotton breeding program.

  5. The PIN gene family in cotton (Gossypium hirsutum): genome-wide identification and gene expression analyses during root development and abiotic stress responses.

    Science.gov (United States)

    He, Peng; Zhao, Peng; Wang, Limin; Zhang, Yuzhou; Wang, Xiaosi; Xiao, Hui; Yu, Jianing; Xiao, Guanghui

    2017-07-03

    Cell elongation and expansion are significant contributors to plant growth and morphogenesis, and are often regulated by environmental cues and endogenous hormones. Auxin is one of the most important phytohormones involved in the regulation of plant growth and development and plays key roles in plant cell expansion and elongation. Cotton fiber cells are a model system for studying cell elongation due to their large size. Cotton is also the world's most utilized crop for the production of natural fibers for textile and garment industries, and targeted expression of the IAA biosynthetic gene iaaM increased cotton fiber initiation. Polar auxin transport, mediated by PIN and AUX/LAX proteins, plays a central role in the control of auxin distribution. However, very limited information about PIN-FORMED (PIN) efflux carriers in cotton is known. In this study, 17 PIN-FORMED (PIN) efflux carrier family members were identified in the Gossypium hirsutum (G. hirsutum) genome. We found that PIN1-3 and PIN2 genes originated from the At subgenome were highly expressed in roots. Additionally, evaluation of gene expression patterns indicated that PIN genes are differentially induced by various abiotic stresses. Furthermore, we found that the majority of cotton PIN genes contained auxin (AuxREs) and salicylic acid (SA) responsive elements in their promoter regions were significantly up-regulated by exogenous hormone treatment. Our results provide a comprehensive analysis of the PIN gene family in G. hirsutum, including phylogenetic relationships, chromosomal locations, and gene expression and gene duplication analyses. This study sheds light on the precise roles of PIN genes in cotton root development and in adaption to stress responses.

  6. Effects of GhWUS from upland cotton (Gossypium hirsutum L.) on somatic embryogenesis and shoot regeneration.

    Science.gov (United States)

    Xiao, Yanqing; Chen, Yanli; Ding, Yanpeng; Wu, Jie; Wang, Peng; Yu, Ya; Wei, Xi; Wang, Ye; Zhang, Chaojun; Li, Fuguang; Ge, Xiaoyang

    2018-05-01

    The WUSCHEL (WUS) gene encodes a plant-specific homeodomain-containing transcriptional regulator, which plays important roles during embryogenesis, as well as in the formation of shoot and flower meristems. Here, we isolated two homologues of Arabidopsis thaliana WUS (AtWUS), GhWUS1a_At and GhWUS1b_At, from upland cotton (Gossypium hirsutum). Domain analysis suggested that the two putative GhWUS proteins contained a highly conserved DNA-binding HOX domain and a WUS-box. Expression profile analysis showed that GhWUSs were predominantly expressed during the embryoid stage. Ectopic expression of GhWUSs in Arabidopsis could induce somatic embryo and shoot formation from seedling root tips. Furthermore, in the absence of exogenous hormone, overexpression of GhWUSs in Arabidopsis could promote shoot regeneration from excised roots, and in the presence of exogenous auxin, excised roots expressing GhWUS could be induced to produce somatic embryo. In addition, expression of the chimeric GhWUS repressor in cotton callus inhibited embryogenic callus formation. Our results show that GhWUS is an important regulator of somatic embryogenesis and shoot regeneration. Copyright © 2018 Elsevier B.V. All rights reserved.

  7. Genotypic interactions with potassium nutrition on fruit production in cotton (gossypium hirsutum l.) under irrigated conditions

    International Nuclear Information System (INIS)

    Makhdum, M.I.; Pervez, H.; Ashraf, M.

    2005-01-01

    A field experiment was conducted using four (Gossypium hirsutum l.) cultivars (OM-448, OM-I00, NIAB-Karishma, 5-12) at four rates of potassium (0, 62, 5, 125, 250 kg K ha-1) and with two sources of potassium (K/sub 2/S0/sub 4/, KCI) to determine the effects of potassium (K) fertilizer on fruit production under irrigated conditions. Cultivars differed significantly amongst themselves in production and retention of fruits per unit land area. The cultivars were categorized as OM-448>OM-1100>Karishma>5-12 in order of fruit production. The number of total fruiting positions increased with concurrent levels of K-fertilizer. The shedding of fruit was significantly reduced by application of 250 kg K ha-1 compared to zero K-rate treatment. The addition of K-fertilizer in the form of K/sub 2/S0/sub 4/ showed an edge over KCI in fruit production. A high degree of correlation (r 0.89**,0.91**, -0.8**) was measured between seed cotton yield and number of total fruiting positions, number of intact fruit and fruit shedding percentage respectively. (author)

  8. Seed protein electrophoresis for identification of fine fibre cotton line in Gossypium hirsutum L

    International Nuclear Information System (INIS)

    Gao Guoqiang; Lv Tiexin; Su Xuehe; Liu Xiaoyong; Wu Defang; Zhu Doubei

    2003-01-01

    Gel electrophoresis was conducted to test seed ethanol resolvable protein in cotton. 13 lines were used, including a fine fibre cotton line (98301) in G. hirsutum L., 4 varieties in G. barbadense L. and 8 varieties in G. hirsutum L.. In results of the 98301 line, Zhongmiansuo 12 and Shiyuan 321, no different protein electro-phoresis band pattern was shown among different seeds belong to the same variety, respectively. In comparison among the 98301 seeds sampled from seven different growth sets in Shandong province, their protein band patterns were the same. On the gel plate, three special bands were distinctive to all the varieties in G. hirsutum L. and other three special bands were distinctive to all the varieties in G. barbadense L.. The three characteristic bands of G. hirsutum L. appeared in the protein band pattern of the 98301 line. It showed that the seed protein composition of the line was inclined to G. hirsutum L. mainly. And, a characteristic band of G. Barbadense L. in the band pattern of the 98301 line proved that the fine fibre cotton line derived from a hybrid between G. barbadense and G. hirsutum L.. The 98301 line was easily distinguished from other varieties in G. hirsutum L. by its distinctive band, i.e. band No.1, and another island cotton band, i.e. band No.10

  9. Potassium-phosphorus relationships in cotton (gossypium hirsutum L.) as affected by potassium nutrition

    International Nuclear Information System (INIS)

    Makhdum, M.I.; Ashraf, M.

    2007-01-01

    Field studies were undertaken to determine the interrelationship between potassium (K+) concentration in various organs of plant and phosphorus (P) content as influenced by K-nutrition in cotton. The experiment was conducted on Miani soil series silt loam and classified as Calcaric Cambisols, fine silty, mixed Hyperthermic Fluventic Haplocambids. The treatments consisted .of (a) four cotton (Gossypium hirsutum L.) cultivars (CI.M-448, CIM-IIOO, Karishma, S-12); and (b) four potassium fertilizer doses (0, 62.5, 125.0, 250.0 kg K ha-l). The design of experiment was split plot (main: cultivars, sub-plot: K-doses). The plant samples were collected at five stages of growth, i.e., first flower bud., first flower, peak flowering, first boll split and maturity. The various parts of plants were analyzed for phosphorus and potassium concentration at various stages of growth. Phosphorus concentration in leaves, stems, burs, seed and lint decreased with concurrent increase in K-doses. Crop maintained 0.22% phosphorus concentration in leaf tissues at first flower bud and dropped to 0.11% at maturity. Cultivars differed greatly amongst themselves in terms of maintaining P content in their different parts. Averaged across K-doses, cv. CIM-448 maintained the highest P content in all parts than other cultivars. There was a negative and significant correlation co-efficient between K and P concentration in various parts of the plant. The study demonstrated antagonistic interaction between K+ and P in cotton plant under irrigated conditions. (author)

  10. Transcriptome analysis of Gossypium hirsutum flower buds infested by cotton boll weevil (Anthonomus grandis) larvae.

    Science.gov (United States)

    Artico, Sinara; Ribeiro-Alves, Marcelo; Oliveira-Neto, Osmundo Brilhante; de Macedo, Leonardo Lima Pepino; Silveira, Sylvia; Grossi-de-Sa, Maria Fátima; Martinelli, Adriana Pinheiro; Alves-Ferreira, Marcio

    2014-10-04

    Cotton is a major fibre crop grown worldwide that suffers extensive damage from chewing insects, including the cotton boll weevil larvae (Anthonomus grandis). Transcriptome analysis was performed to understand the molecular interactions between Gossypium hirsutum L. and cotton boll weevil larvae. The Illumina HiSeq 2000 platform was used to sequence the transcriptome of cotton flower buds infested with boll weevil larvae. The analysis generated a total of 327,489,418 sequence reads that were aligned to the G. hirsutum reference transcriptome. The total number of expressed genes was over 21,697 per sample with an average length of 1,063 bp. The DEGseq analysis identified 443 differentially expressed genes (DEG) in cotton flower buds infected with boll weevil larvae. Among them, 402 (90.7%) were up-regulated, 41 (9.3%) were down-regulated and 432 (97.5%) were identified as orthologues of A. thaliana genes using Blastx. Mapman analysis of DEG indicated that many genes were involved in the biotic stress response spanning a range of functions, from a gene encoding a receptor-like kinase to genes involved in triggering defensive responses such as MAPK, transcription factors (WRKY and ERF) and signalling by ethylene (ET) and jasmonic acid (JA) hormones. Furthermore, the spatial expression pattern of 32 of the genes responsive to boll weevil larvae feeding was determined by "in situ" qPCR analysis from RNA isolated from two flower structures, the stamen and the carpel, by laser microdissection (LMD). A large number of cotton transcripts were significantly altered upon infestation by larvae. Among the changes in gene expression, we highlighted the transcription of receptors/sensors that recognise chitin or insect oral secretions; the altered regulation of transcripts encoding enzymes related to kinase cascades, transcription factors, Ca2+ influxes, and reactive oxygen species; and the modulation of transcripts encoding enzymes from phytohormone signalling pathways. These

  11. Efeito do manejo da irrigação e de populações de plantas sobre o rendimento do algodoeiro herbáceo Effect of irrigation management and plant population on herbaceous cotton yield

    Directory of Open Access Journals (Sweden)

    Francisco Assis de Oliveira

    1999-12-01

    Full Text Available Objetivou-se estudar, num solo aluvial, franco siltoso, no vale do Açu, no Rio Grande do Norte, o efeito do momento da última irrigação e da população de plantas sobre a altura das plantas e a produtividade do algodoeiro herbáceo (Gossypium hirsutum L.r. latifolium Hutch, cultivar Acala del cerro. Os tratamentos foram definidos pelos momentos da última irrigação aos 65, 80, 95 e 110 dias após a emergência e pela população com 30.000, 60.000, 90.000 e 120.000 plantas/ha. Usou-se o delineamento experimental em blocos ao acaso, com parcelas subdivididas, e quatro repetições. A altura das plantas aumentou com o retardamento da última irrigação e com o tamanho das populações. Houve efeito (P In an alluvial soil, silt loam, of Açu valley, in the state of Rio Grande do Norte, Brazil, a research was carried out to study the effect of time of the last irrigation and plant population on yield and plant height of the herbaceous cotton (Gossypium hirsutum L.r. latifolium Hutch cultivar Acala del cerro. Treatments consisted of times of the last irrigation at 65, 80, 95 and 110 days after emergence and populations with 30,000, 60,000, 90,000 and 120,000 plants/ha. The experimental plan was a randomized complete blocks in a split-plot design, with four replications. Delaying time of last irrigation increased height and plant populations. A significant effect (P <= 0.01 of interaction between time of last irrigation and plant population was found for cotton yield. The highest cotton yield (4,090 kg/ha was obtained with the interaction between time of last irrigation at 95 days and in population of 90,000 plants/ha. Irrigation times at 65 and 80 days were considered too early, and at 110 days too late for cotton yields.

  12. Effect of soil-water tension on herbaceous cotton yield Efeito de tensões de água no solo sobre o rendimento do algodoeiro herbáceo

    Directory of Open Access Journals (Sweden)

    Francisco Assis de Oliveira

    1999-10-01

    Full Text Available A field experiment was conducted during two years, 1990/91, in an alluvial soil, in the State of Paraíba, Brazil, to study the effect of the levels of soil-water tension, 50, 100, 200, 300, 400 and 600 kPa, at 20 cm depth, on upland cotton (Gossypium hirsutum L.r. latifolium Hutch, cv. CNPA-6H yield. The experimental design was a complete randomized block with six treatments and four repetitions. There was an effect of the treatments on plant height, leaf area index and cotton yield, but the precocity index was not modified. Water should be applied when the soil-water tension, measured at 20 cm depth, reaches values around 200 kPa. There was a quadratic (R² = 0.893** response of cotton yields to soil water tension, with the maximum when water was applied at 52% of soil water depletion.Durante dois anos, 1990/91, em solo aluvial, no município de Sousa, PB, estudou-se, em condições de irrigação por sulco, o efeito das tensões de água no solo a 50, 100, 200, 300, 400 e 600 kPa, na profundidade de 20 cm, sobre o rendimento do algodoeiro herbáceo (Gossypium hirsutum L.r. latifolium Hutch, cv. CNPA-6H. Adotou-se o delineamento experimental de blocos ao acaso com quatro repetições. Os resultados mostraram que houve efeito significativo dos tratamentos sobre a altura da planta, índice de área foliar e rendimento de algodão em rama, mas não houve efeito sobre os dados de precocidade. A tensão de 200 kPa mostrou-se como o melhor nível de água no solo para se efetuar as irrigações, uma vez que para as tensões superiores o rendimento foi significativamente reduzido.O efeito sobre o rendimento foi de natureza quadrática (R² = 0,893**, o que indica que o rendimento máximo seria atingido irrigando-se a cultura com 52% de esgotamento da água disponível no solo.

  13. Generation and analysis of a large-scale expressed sequence Tag database from a full-length enriched cDNA library of developing leaves of Gossypium hirsutum L.

    Directory of Open Access Journals (Sweden)

    Min Lin

    Full Text Available BACKGROUND: Cotton (Gossypium hirsutum L. is one of the world's most economically-important crops. However, its entire genome has not been sequenced, and limited resources are available in GenBank for understanding the molecular mechanisms underlying leaf development and senescence. METHODOLOGY/PRINCIPAL FINDINGS: In this study, 9,874 high-quality ESTs were generated from a normalized, full-length cDNA library derived from pooled RNA isolated from throughout leaf development during the plant blooming stage. After clustering and assembly of these ESTs, 5,191 unique sequences, representative 1,652 contigs and 3,539 singletons, were obtained. The average unique sequence length was 682 bp. Annotation of these unique sequences revealed that 84.4% showed significant homology to sequences in the NCBI non-redundant protein database, and 57.3% had significant hits to known proteins in the Swiss-Prot database. Comparative analysis indicated that our library added 2,400 ESTs and 991 unique sequences to those known for cotton. The unigenes were functionally characterized by gene ontology annotation. We identified 1,339 and 200 unigenes as potential leaf senescence-related genes and transcription factors, respectively. Moreover, nine genes related to leaf senescence and eleven MYB transcription factors were randomly selected for quantitative real-time PCR (qRT-PCR, which revealed that these genes were regulated differentially during senescence. The qRT-PCR for three GhYLSs revealed that these genes express express preferentially in senescent leaves. CONCLUSIONS/SIGNIFICANCE: These EST resources will provide valuable sequence information for gene expression profiling analyses and functional genomics studies to elucidate their roles, as well as for studying the mechanisms of leaf development and senescence in cotton and discovering candidate genes related to important agronomic traits of cotton. These data will also facilitate future whole-genome sequence

  14. Selectivity and stability of vegetation-applied herbicides in cotton (Gossypium hirsutum L.

    Directory of Open Access Journals (Sweden)

    T. Barakova

    2016-06-01

    Full Text Available Abstract. An experiment was carried out during 2013 – 2015 in the experimental field of the Field Crops Institute, Chirpan, with two cotton cultivars − Helius and Darmi (Gossypium hirsutum L.. Herbicides: Goal 2 E, oxyfluorfen (80 ml/da; Linuron 45 SC, linuron (200 ml/da; Wing-P, pendimethalin + dimethenamid (400 ml/da; Merlin 750 WG, isoxaflutol (5 g/da; Bazagran 480 SL, bentazone (150 ml/da were investigated. They were treated separately or combined with growth regulator Amalgerol (500 ml/da or foliar fertilizer Lactofol O (500 ml/da in the budding stage of the cotton. It was established that selectivity is the lowest in the two cotton cultivars with herbicides Linuron 45 CK and Merlin 750 WG. The purpose of this investigation was to establish the selectivity and stability of some herbicides and their tank mixtures on the cotton by influence of different meteorological conditions. It has been found that the highest phytotoxicity on cotton is given the vegetation-applied herbicides Merlin and Linuron. Foliar fertilizer Laktofol O reduces phytotoxicity of herbicides Goal, Wing, Merlin and Bazagran in two cotton cultivars. Herbicides Wing and Bazagran have excellent selectivity for the two cotton cultivars – Helius and Darmi. The highest yield was obtained by vegetation treatment with herbicide Bazagran, followed by herbicides Wing and Goal. Tank mixtures of Goal, Bazagran and Wing with Laktofol, followed by those with Amalgerol are technologically the most valuable. They combine high yield with high stability over the years. Аlone application of herbicides Linuron and Merlin and their tank mixtures with Amalgerol and Laktofol have low estimate.

  15. Genome wide identification of cotton (Gossypium hirsutum)-encoded microRNA targets against Cotton leaf curl Burewala virus.

    Science.gov (United States)

    Shweta; Akhter, Yusuf; Khan, Jawaid Ahmad

    2018-01-05

    Cotton leaf curl Burewala virus (CLCuBV, genus Begomovirus) causes devastating cotton leaf curl disease. Among various known virus controlling strategies, RNAi-mediated one has shown potential to protect host crop plants. Micro(mi) RNAs, are the endogenous small RNAs and play a key role in plant development and stress resistance. In the present study we have identified cotton (Gossypium hirsutum)-encoded miRNAs targeting the CLCuBV. Based on threshold free energy and maximum complementarity scores of host miRNA-viral mRNA target pairs, a number of potential miRNAs were annotated. Among them, ghr-miR168 was selected as the most potent candidate, capable of targeting several vital genes namely C1, C3, C4, V1 and V2 of CLCuBV genome. In addition, ghr-miR395a and ghr-miR395d were observed to target the overlapping transcripts of C1 and C4 genes. We have verified the efficacy of these miRNA targets against CLCuBV following suppression of RNAi-mediated virus control through translational inhibition or cleavage of viral mRNA. Copyright © 2017 Elsevier B.V. All rights reserved.

  16. Propriedades físicas e sensoriais da carne de cordeiros Santa Inês terminados em dietas com diferentes níveis de caroço de algodão integral (Gossypium hirsutum Physical and sensorial properties of Santa Ines lamb meat terminated in diets with increasing levels of whole cotton seed (Gossypium hirsutum

    Directory of Open Access Journals (Sweden)

    Thereza Raquel de Lucena Vieira

    2010-06-01

    Full Text Available Esta pesquisa teve como objetivo avaliar o efeito de dietas de terminação contendo diferentes níveis (0, 20, 30 e 40% de caroço de algodão integral (Gossypium hirsutum sobre os parâmetros físicos e sensoriais da carne de vinte e quatro cordeiros da raça Santa Inês. Foram avaliados os parâmetros de pH, capacidade de retenção de água (CRA, perda de peso por cocção (PPC, textura e cor, além dos parâmetros sensoriais de sabor, aroma, cor e textura. Apenas o parâmetro cor da carne ovina sofreu influência significativa da adição do caroço de algodão integral, observando-se variações para as coordenadas b* e L* (antes da cocção. Verificou-se também que os tratamentos apresentaram influência (p The objective of this research was to evaluate the effect of termination diets containing increasing levels (0, 20, 30, and 40% of whole cotton seed (Gossypium hirsutum on the physical (pH, water holding capacity, cooking losses, texture, colour and sensory parameters (flavour, odour, colour, texture of the lamb meat of twenty four Santa Ines sheep. Only the b* and L* colour parameters of the lamb meat were significantly affected by the addition of different levels of whole cotton seed to the diet. The inclusion of the whole cotton seed in the diet of the Santa Ines sheep also influenced sensory attributes such as natural colour, odour, and characteristic flavour. Based on these observations, considering the physical and sensory attributes of the lamb meat, the use of whole cotton seed at a 40% level for sheep in termination for short periods, i.e., up to 90 days, is recommended.

  17. Construction of microsatellite-based linkage map and mapping of nectarilessness and hairiness genes in Gossypium tomentosum.

    Science.gov (United States)

    Hou, Meiying; Cai, Caiping; Zhang, Shuwen; Guo, Wangzhen; Zhang, Tianzhen; Zhou, Baoliang

    2013-12-01

    Gossypium tomentosum, a wild tetraploid cotton species with AD genomes, possesses genes conferring strong fibers and high heat tolerance. To effectively transfer these genes into Gossypium hirsutum, an entire microsatellite (simple sequence repeat, SSR)-based genetic map was constructed using the interspecific cross of G. hirsutum x G. tomentosum (HT). We detected 1800 loci from 1347 pairs of polymorphic primers. Of these, 1204 loci were grouped into 35 linkage groups at LOD ≥ 4. The map covers 3320.8 cM, with a mean density of 2.76 cM per locus. We detected 420 common loci (186 in the At subgenome and 234 in Dt) between the HT map and the map of TM-1 (G. hirsutum) and Hai 7124 (G. barbadense; HB map). The linkage groups were assigned chromosome numbers based on location of common loci and the HB map as reference. A comparison of common markers revealed that no significant chromosomal rearrangement exist between G. tomentosum and G. barbadense. Interestingly, however, we detected numerous (33.7%) segregation loci deviating from 3:1 ratio (P constructed in this study will be useful for further genetic studies on cotton breeding, including mapping loci controlling quantitative traits associated with fiber quality, stress tolerance and developing chromosome segment specific introgression lines from G. tomentosum into G. hirsutum using marker-assisted selection.

  18. Usability of Particle Film Technology and Water Holding Materials to Improve Drought Tolerance in Gossypium hirsutum L. Plants

    Science.gov (United States)

    Roy, K.; Zwieniecki, M.

    2017-12-01

    Cotton (Gossypium hirsutum L.) is relatively drought resistant and thus is planted widely in many semi-arid and arid parts of the world, many of which are usually deprived of modern water management technologies. Since the productivity of cotton plants depends on water availability, we carried out the present research aiming at testing two different low cost and arid-environment friendly water efficient techniques: application of particle film technology on leaves to reduce the transpiration rate (kaolin dust), and use of organic material to improve the soil water holding capacity (cotton wool). In details, kaolin (3% and 5%; weight:volume) mixed in water was sprayed on the upper surface of the leaves of young plants, and small amounts of cotton wool (0.1%, 0.3% and 0.5%; weight:weight) were mixed into the soils. The study showed that kaolin spray was useful as a transpiration reducing agent only if plants have adequate water in the soil (well irrigated) but not under water stress conditions. In addition, mixing a small amount of cotton wool into the soil can significantly increase the amount of water available to the plants, and extend the benefit of kaolin application on plants.

  19. Gene expression in response to Cotton Leaf Curl Virus infection in Gossypium hirsutum under variable environmental conditions

    Directory of Open Access Journals (Sweden)

    Rehman Iqra

    2017-01-01

    Full Text Available Cotton Leaf Curl Disease (CLCuD is one of the threatening constrains of cotton production in Pakistan for which no adequate remedy is available until now. Local variety of Gossypium hirsutum (FH-142 was grown in field and infected naturally by CLCuV under variable range of temperature and humidity. Plants showed thickening of veins in lower leaf surface at 34°C and 60% relative humidity at 15days post infection (dpi and curling of leaf margins at 33°C with 58% relative humidity at 30dpi. Remarkable leaf darkening was observed with reduced boll formation at 45dpi at 26°C and 41% relative humidity. Enation developed, severe thickening and curling of leaves intensified and plants showed dwarf growth at 60dpi at 24°C with 52% relative humidity. PCR amplification of Rep associated gene confirmed the presence of CLCuD-associated begomovirus in the infected samples. Quantitative RT-PCR confirmed the amplification and differential expression of a number of pathogen stress responsive genes at different levels of temperature and humidity. This observation predicts that Cotton Leaf Curl Virus (CLCuV interacts with several host genes that are upregulated to make plants susceptible or suppress other genes to overcome host defense responses.

  20. Genotypic variations in photosynthetic and physiological adjustment to potassium deficiency in cotton (Gossypium hirsutum).

    Science.gov (United States)

    Wang, Ning; Hua, Hanbai; Eneji, A Egrinya; Li, Zhaohu; Duan, Liusheng; Tian, Xiaoli

    2012-05-02

    A hydroponic culture experiment was conducted to determine genotypic variation in photosynthetic rate and the associated physiological changes in response to potassium (K) deficiency in cotton (Gossypium hirsutum L.) seedlings with contrasting two cotton cultivars in K efficiency. The K-efficient Liaomian18 produced 66.7% more biomass than the K-inefficient NuCOTN99(B) under K deficiency, despite their similar biomass under K sufficiency. Compared with NuCOTN99(B), Liaomian18 showed 19.4% higher net photosynthetic rate (P(n), per unit leaf area) under K deficient solutions and this was associated with higher photochemical efficiency and faster export of soluble sugars from the phloem. The lower net P(n) of NuCOTN99(B) was attributed to higher capacity for nitrate assimilation and lower export of soluble sugars. Furthermore, NuCOTN99(B) showed 38.4% greater ETR/P(n) than Liaomian18 under K deficiency, indicating that more electrons were driven to other sinks. Higher superoxide dismutase (SOD) and lower catalase (CAT) and ascorbate peroxidase (APX) activities resulted in higher levels of reactive oxygen species (ROS; e.g. O(2)(-)and H(2)O(2)) in NuCOTN99(B) relative to Liaomian18. Thus, the K inefficiency of NuCOTN99(B), indicated by lower biomass and net P(n) under K deficiency, was associated with excessively high nitrogen assimilation, lower export of carbon assimilates, and greater ROS accumulation in the leaf. Crown Copyright © 2012. Published by Elsevier B.V. All rights reserved.

  1. ADAPTABILIDADE E ESTABILIDADE FENOTÍPICA DE CULTIVARES DE ALGODOEIRO NO ESTADO DO MATO GROSSO, BRASIL PHENOTYPIC ADAPTABILITY AND STABILITY OF COTTON CULTIVARS IN THE MATO GROSSO STATE, BRAZIL

    Directory of Open Access Journals (Sweden)

    Cristina Schetino Bastos

    2007-09-01

    Full Text Available

    O objetivo deste trabalho foi o de avaliar a adaptabilidade e a estabilidade de cultivares de algodão (Gossypium hirsutum L., utilizando a metodologia proposta por Eberhart & Russell (1966. Para tanto, onze variedades de algodão foram avaliadas em sete locais do Estado do Mato Grosso, Brasil, em dois anos agrícolas (2002/2003 e 2003/2004. O delineamento experimental empregado foi o de blocos casualizados com quatro repetições e as características avaliadas foram a produtividade de algodão em caroço e a porcentagem de fibra. Com relação à produção de algodão em caroço, as cultivares BRS Aroeira, BRS Ipê, BRS Cedro, BRS Jatobá e Delta Opal demonstraram ampla adaptabilidade e estabilidade para as regiões produtoras do Estado. Entretanto, considerando a porcentagem de fibra, não foram encontradas cultivares de algodão com ampla adaptabilidade e estabilidade nos ambientes estudados.

    PALAVRAS-CHAVE: Gossypium hirsutum; fibra; estabilidade.

    The objective of this work was to evaluate the stability and adaptability of cotton (Gossypium hirsutum L. cultivars using the method of Eberhart & Russell (1966. Eleven varieties of cotton were tested at seven locations in Mato Grosso State, Brazil, in two growing seasons (2002/2003 and 2003/2004. The experimental design was the randomized complete blocks with four replications and the evaluated traits were lint percentage and seed cotton yield. For seed cotton yield, BRS Aroeira, BRS Ipê, BRS Cedro, BRS Jatobá and Delta Opal showed broad adaptability and stability in Mato Grosso State. However, for lint percentage there were not found cotton cultivars with both broad adaptability and stability for the studied environments.

  2. Competição de plantas daninhas com a cultura do algodoeiro Effect of weed competition on cotton

    Directory of Open Access Journals (Sweden)

    Edivaldo Cia

    1978-01-01

    comprimento e índice Pressley.The effect of weed competition on cotton (Gossypium hirsutum L. was evaluated in the Centro Experimental de Campinas and the Estação Experimental de Tietê during the 1970/71, 1971/72 and 1972/73 agricultural seasons. In the first season, competition periods of 10, 20, 30, 40, 60, 90 or 120 days, after emergence were studied, compared to checks always either with or without weeds. In the next seasons, competition was studied during the first 10, 20, 30 or 40 days after emergence, or after these periods, until harvest, maintained previously weed free for these different periods and afterwards competition was allowed until harvest. The experimental plots had four rows of five meters, distributed in randomized blocks with five or six replications. For evaluation of the competition effects the following parameters were considered: number, fresh and dry weights of weeds, after each competition period; fiber percentage, boll and seed weight, cotton yield, fiber length uniformity, Micronaire, Pressley and maturity, at harvest. The results showed a lower yield of cotton when the competition period was longer than 20 days after emergence. When the crop was maintained weed free for the first 30 to 40 days yield was similar to the completely weed free treatment. Competition periods of 90 days or longer determined negative effect on yield. In some cases a negative effect of weed competition was observed on fiber percentage, boll and seed weight, Micronaire, fiber uniformity and Pressley.

  3. Genome-Wide Identification and Expression Analysis of the Biotin Carboxyl Carrier Subunits of Heteromeric Acetyl-CoA Carboxylase in Gossypium

    Directory of Open Access Journals (Sweden)

    Jinping Hua

    2017-05-01

    Full Text Available Acetyl-CoA carboxylase is an important enzyme, which catalyzes acetyl-CoA’s carboxylation to produce malonyl-CoA and to serve as a committed step for de novo fatty acid biosynthesis in plastids. In this study, 24 putative cotton BCCP genes were identified based on the lately published genome data in Gossypium. Among them, 4, 4, 8, and 8 BCCP homologs were identified in Gossypium raimondii, G. arboreum, G. hirsutum, and G. barbadense, respectively. These genes were divided into two classes based on a phylogenetic analysis. In each class, these homologs were relatively conserved in gene structure and motifs. The chromosomal distribution pattern revealed that all the BCCP genes were distributed equally on corresponding chromosomes or scaffold in the four cotton species. Segmental duplication was a predominant duplication event in both of G. hirsutum and G. barbadense. The analysis of the expression profile showed that 8 GhBCCP genes expressed in all the tested tissues with changed expression levels, and GhBCCP genes belonging to class II were predominantly expressed in developing ovules. Meanwhile, the expression analysis for the 16 cotton BCCP genes from G. raimondii, G. arboreum and G. hirsutum showed that they were induced or suppressed by cold or salt stress, and their expression patterns varied among different tissues. These findings will help to determine the functional and evolutionary characteristics of the BCCP genes in Gossypium species.

  4. Comparative genomic study of ALDH gene superfamily in Gossypium: A focus on Gossypium hirsutum under salt stress.

    Directory of Open Access Journals (Sweden)

    Yating Dong

    Full Text Available Aldehyde dehydrogenases (ALDHs are a superfamily of enzymes which play important role in the scavenging of active aldehydes molecules. In present work, a comprehensive whole-genomic study of ALDH gene superfamily was carried out for an allotetraploid cultivated cotton species, G. hirsutum, as well as in parallel relative to their diploid progenitors, G. arboreum and G. raimondii. Totally, 30 and 58 ALDH gene sequences belong to 10 families were identified from diploid and allotetraploid cotton species, respectively. The gene structures among the members from same families were highly conserved. Whole-genome duplication and segmental duplication might be the major driver for the expansion of ALDH gene superfamily in G. hirsutum. In addition, the expression patterns of GhALDH genes were diverse across tissues. Most GhALDH genes were induced or repressed by salt stress in upland cotton. Our observation shed lights on the molecular evolutionary properties of ALDH genes in diploid cottons and their alloallotetraploid derivatives. It may be useful to mine key genes for improvement of cotton response to salt stress.

  5. Determinação do poder germinativo de sementes de variedades paulistas de algodoeiro (Gossypium hirsutum L. Studies on germination of cotton seeds

    Directory of Open Access Journals (Sweden)

    Eduardo Zink

    1969-01-01

    Full Text Available São relatados os resultados das determinações do poder germinativo de sementes de sete variedades paulistas de algodoeiro, provenientes de ensaios de competição de variedades instalados nos Estados de São Paulo e Paraná, no ano agrícola de 1966/67. Os testes de germinação foram efetuados simultaneamente no Laboratório de Sementes, do Instituto Agronômico do Estado de São Paulo, e no Laboratório Central, da Divisão de Sementes e Mudas, da Secretaria da Agricultura do Estado de São Paulo. Com referência a plântulas normais e plântulas anormais B (infetadas verificaram-se, conforme o caso, diferenças significativas entre localidades, entre variedades, entre laboratórios e entre substratos, bem como diversas interações envolvendo as variáveis mencionadas.Seeds of seven varieties of cotton produced at different regions of the States of São Paulo and Paraná (Brazil were submitted to germination tests at two laboratories: Instituto Agronômico de Campinas (IAC at 20 - 30°C and Divisão de Sementes e Mudas (DSM at 30°C. The substrata used for the tests were cotton towels desinfected differently at each laboratory. The statistical analysis for numbers of normal and abnormal plants (infected showed significant differences between regions, varieties, laboratories and substrata. Several significant interactions including these variables were also detected.

  6. Silicon (Si) alleviates cotton (Gossypium hirsutum L.) from zinc (Zn) toxicity stress by limiting Zn uptake and oxidative damage.

    Science.gov (United States)

    Anwaar, Shad Ali; Ali, Shafaqat; Ali, Skhawat; Ishaque, Wajid; Farid, Mujahid; Farooq, Muhammad Ahsan; Najeeb, Ullah; Abbas, Farhat; Sharif, Muhammad

    2015-03-01

    Silicon (Si) is as an important fertilizer element, which has been found effective in enhancing plant tolerance to variety of biotic and a-biotic stresses. This study investigates the Si potential to alleviate zinc (Zn) toxicity stress in cotton (Gossypium hirsutum L.). Cotton plants were grown in hydroponics and exposed to different Zn concentration, 0, 25, and 50 μM, alone and/or in combination with 1 mM Si. Incremental Zn concentration in growth media instigated the cellular oxidative damage that was evident from elevated levels of hydrogen peroxide (H2O2), electrolyte leakage, and malondialdehyde (MDA) and consequently inhibited cotton growth, biomass, chlorophyll pigments, and photosynthetic process. Application of Si significantly suppressed Zn accumulation in various plant parts, i.e., roots, stems, and leaves and thus promoted biomass, photosynthetic, growth parameters, and antioxidant enzymes activity of Zn-stressed as well unstressed plants. In addition, Si reduced the MDA and H2O2 production and electrolyte leakage suggesting its role in protecting cotton plants from Zn toxicity-induced oxidative damage. Thus, the study indicated that exogenous Si application could improve growth and development of cotton crop experiencing Zn toxicity stress by limiting Zn bioavailability and oxidative damage.

  7. Spatial and temporal variation in fungal endophyte communities isolated from cultivated cotton (Gossypium hirsutum.

    Directory of Open Access Journals (Sweden)

    María J Ek-Ramos

    Full Text Available Studies of fungi in upland cotton (Gossypium hirsutum cultivated in the United States have largely focused on monitoring and controlling plant pathogens. Given increasing interest in asymptomatic fungal endophytes as potential biological control agents, surveys are needed to better characterize their diversity, distribution patterns and possible applications in integrated pest management. We sampled multiple varieties of cotton in Texas, USA and tested for temporal and spatial variation in fungal endophyte diversity and community composition, as well as for differences associated with organic and conventional farming practices. Fungal isolates were identified by morphological and DNA identification methods. We found members of the genera Alternaria, Colletotrichum and Phomopsis, previously isolated as endophytes from other plant species. Other recovered species such as Drechslerella dactyloides (formerly Arthrobotrys dactyloides and Exserohilum rostratum have not, to our knowledge, been previously reported as endophytes in cotton. We also isolated many latent pathogens, but some species such as Alternaria tennuissima, Epicoccum nigrum, Acremonium alternatum, Cladosporium cladosporioides, Chaetomium globosum and Paecilomyces sp., are known to be antagonists against plant pathogens, insects and nematode pests. We found no differences in endophyte species richness or diversity among different cotton varieties, but did detect differences over time and in different plant tissues. No consistent patterns of community similarity associated with variety, region, farming practice, time of the season or tissue type were observed regardless of the ecological community similarity measurements used. Results indicated that local fungal endophyte communities may be affected by both time of the year and plant tissue, but the specific community composition varies across sites. In addition to providing insights into fungal endophyte community structure, our survey

  8. Gene expression in developing fibres of Upland cotton (Gossypium hirsutum L.) was massively altered by domestication.

    Science.gov (United States)

    Rapp, Ryan A; Haigler, Candace H; Flagel, Lex; Hovav, Ran H; Udall, Joshua A; Wendel, Jonathan F

    2010-11-15

    Understanding the evolutionary genetics of modern crop phenotypes has a dual relevance to evolutionary biology and crop improvement. Modern upland cotton (Gossypium hirsutum L.) was developed following thousands of years of artificial selection from a wild form, G. hirsutum var. yucatanense, which bears a shorter, sparser, layer of single-celled, ovular trichomes ('fibre'). In order to gain an insight into the nature of the developmental genetic transformations that accompanied domestication and crop improvement, we studied the transcriptomes of cotton fibres from wild and domesticated accessions over a developmental time course. Fibre cells were harvested between 2 and 25 days post-anthesis and encompassed the primary and secondary wall synthesis stages. Using amplified messenger RNA and a custom microarray platform designed to interrogate expression for 40,430 genes, we determined global patterns of expression during fibre development. The fibre transcriptome of domesticated cotton is far more dynamic than that of wild cotton, with over twice as many genes being differentially expressed during development (12,626 versus 5273). Remarkably, a total of 9465 genes were diagnosed as differentially expressed between wild and domesticated fibres when summed across five key developmental time points. Human selection during the initial domestication and subsequent crop improvement has resulted in a biased upregulation of components of the transcriptional network that are important for agronomically advanced fibre, especially in the early stages of development. About 15% of the differentially expressed genes in wild versus domesticated cotton fibre have no homology to the genes in databases. We show that artificial selection during crop domestication can radically alter the transcriptional developmental network of even a single-celled structure, affecting nearly a quarter of the genes in the genome. Gene expression during fibre development within accessions and expression

  9. Salt-induced effects on some key morpho-physiological attributes of cotton (Gossypium hirsutum L. at various growth stages

    Directory of Open Access Journals (Sweden)

    Huma Lubna Shaheen and Muhammad Shahbaz

    2012-11-01

    Full Text Available Salinity is a multidimensional stress affecting crop yield and productivity at various levels of plant organization. To assess salt induced adverse effects on cotton (Gossypium hirsutum L., ten cultivars were grown in sand culture supplemented with full strength Hoagland’s nutrients solutions and different salt concentrations (0, 50, 100 and 200 mM NaCl. Salt stress markedly reduced growth attributes, relative water contents, efficiency of photosystem II, net CO2 assimilation rate (A, transpiration rate (E and stomatal conductance in all cultivars. Reduction was maximum at the highest level of salt stress i.e. 200 mM. However, response of cotton cultivars was variable to various levels of salinity and even at various developmental stages. Cultivars RH-510, BH-118 and MNH-770 were ranked as relatively salt tolerant on the basis of their better growth performance and net CO2 assimilation rate whereas cvs. CIM-496, CIM-473 and FH-901 were relatively salt sensitive. Cultivars RH-510, BH-118 and MNH-770 exhibited high shoot fresh and dry weights, photosynthetic rate (A, and Photosystem II (Fv/Fm efficiency at both seedling and maturity growth stages. Results suggest that selection of plants having high photosynthetic rate and biomass at seedling stage may be a good source of high yield at mature stage of growth.

  10. Critical osmotic, ionic and physiological indicators of salinity tolerance in cotton (gossypium hirsutum l.) for cultivar selection

    International Nuclear Information System (INIS)

    Munis, M.F.H.; Tu, L.; Ziaf, K; Tan, J.; Deng, F.; Zhang, X.

    2010-01-01

    Salinity affects the germination, growth and ultimately the yield of cotton (Gossypium hirsutum L.) which demands reliable traits for the evaluation and selection of salt tolerant cultivars. Here, ten major osmotic, ionic and physiological parameters have been studied to distinguish the effect of salinity in two different cultivars of cotton. Plants were grown in hydroponic system and exposed to different salinity levels of NaCl followed by its recovery under non saline conditions. Data was recorded at three different stages i.e., before stress, after stress and after recovery for comparative study. Recovery assay proved to be very helpful in extracting reliable results. Both cultivars showed significantly different response to Na+ and K+ accumulation and phenotypically salt tolerant cultivar (Coker 312) accumulated less Na+ and more K+ in comparison with susceptible (Simian 3). Decrease in leaf area, seed germination and seedling growth were also conclusive to differentiate these cultivars. We also found other physiological parameters like relative leaf water content (RLWC), plant fresh-weight (PFW), plant dry-weight (PDW), relative growth rate (RGR) and stomatal behavior as good indicators of salinity but could not find their significant role to differentiate two closely relevant cultivars regarding salinity tolerance. Our studies revealed that proline accumulation and chlorophyll concentration are not significant to be used as accurate indicators to characterize the sensitivity of cotton cultivars to salinity. We found post-recovery analysis to be very useful in understanding the role and behavior of different indicators of salinity. (author)

  11. Analyses of Fusarium wilt race 3 resistance in Upland cotton (Gossypium hirsutum L.).

    Science.gov (United States)

    Abdullaev, Alisher A; Salakhutdinov, Ilkhom B; Egamberdiev, Sharof Sh; Kuryazov, Zarif; Glukhova, Ludmila A; Adilova, Azoda T; Rizaeva, Sofiya M; Ulloa, Mauricio; Abdurakhmonov, Ibrokhim Y

    2015-06-01

    Fusarium wilt [Fusarium oxysporum f.sp. vasinfectum (FOV) Atk. Sny & Hans] represents a serious threat to cotton (Gossypium spp.) production. For the last few decades, the FOV pathogen has become a significant problem in Uzbekistan causing severe wilt disease and yield losses of G. hirsutum L. cultivars. We present the first genetic analyses of FOV race 3 resistance on Uzbek Cotton Germplasm with a series of field and greenhouse artificial inoculation-evaluations and inheritance studies. The field experiments were conducted in two different sites: the experimental station in Zangiota region-Environment (Env) 1 and the Institute of Cotton Breeding (Env-2, Tashkent province). The Env-1 was known to be free of FOV while the Env-2 was known to be a heavily FOV infested soil. In both (Env-1 and Env-2) of these sites, field soil was inoculated with FOV race 3. F2 and an F3 Upland populations ("Mebane B1" × "11970") were observed with a large phenotypic variance for plant survival and FOV disease severity within populations and among control or check Upland accessions. Wilt symptoms among studied F2 individuals and F3 families significantly differed depending on test type and evaluation site. Distribution of Mendelian rations of susceptible (S) and resistant (R) phenotypes were 1S:1R field Env-1 and 3S:1R field Env-2 in the F2 population, and 1S:3R greenhouse site in the F3 population. The different segregation distribution of the Uzbek populations may be explained by differences in FOV inoculum level and environmental conditions during assays. However, genetic analysis indicated a recessive single gene action under high inoculum levels or disease pressure for FOV race 3 resistance. Uzbek germplasm may be more susceptible than expected to FOV race 3, and sources of resistance to FOV may be limited under the FOV inoculum levels present in highly-infested fields making the breeding process more complex.

  12. iTRAQ-facilitated proteomic profiling of anthers from a photosensitive male sterile mutant and wild-type cotton (Gossypium hirsutum L.).

    Science.gov (United States)

    Liu, Ji; Pang, Chaoyou; Wei, Hengling; Song, Meizhen; Meng, Yanyan; Ma, Jianhui; Fan, Shuli; Yu, Shuxun

    2015-08-03

    Male sterility is a common phenomenon in flowering plants, and it has been successfully developed in several crops by taking advantage of heterosis. Cotton (Gossypium hirsutum L.) is an important economic crop, used mainly for the production of textile fiber. Using a space mutation breeding technique, a novel photosensitive genetic male sterile mutant CCRI9106 was isolated from the wild-type upland cotton cultivar CCRI040029. To use CCRI9106 in cotton hybrid breeding, it is of great importance to study the molecular mechanisms of its male sterility. Here, histological and iTRAQ-facilitated proteomic analyses of anthers were performed to explore male sterility mechanisms of the mutant. Scanning and transmission electron microscopy of the anthers showed that the development of pollen wall in CCRI9106 was severely defective with a lack of exine formation. At the protein level, 6121 high-confidence proteins were identified and 325 of them showed differential expression patterns between mutant and wild-type anthers. The proteins up- or down-regulated in MT anthers were mainly involved in exine formation, protein degradation, calcium ion binding,etc. These findings provide valuable information on the proteins involved in anther and pollen development, and contribute to elucidate the mechanism of male sterility in upland cotton. Copyright © 2015. Published by Elsevier B.V.

  13. SENSIBILIDADE DE Rhizoctonia solani Kuhn, A FUNGICIDAS “IN VITRO” E EM PLÂNTULAS DE ALGODOEIRO (Gossypium hirsutum L., EM CONDIÇÕES DE CASA DE VEGETAÇÃO SENSIBILITY OF Rhizoctonia solani Kuhn TO FUNGICIDES “IN VITRO” AND IN COTTON PLANTULES (Gossypium hirsutum L AT GREENHOUSE CONDITIONS

    Directory of Open Access Journals (Sweden)

    Wilson Ferreira de Oliveira

    2007-09-01

    Full Text Available

    Foram instalados nas dependências do Departamento Fitossanitário da Escola de Agronomia - UFG, ensaio “in vitro”, em BDA2 e a nível de Casa de Vegetação, objetivando testar a eficiência de diferentes dosagens de Iprodione + Thiran (Rovrin em comparação com PCNB (Brassicol 75 BR, TMTD (Rhodiauran 70 e Captan + Pencycuron (Monceren para o controle de Rhizoctonia solani Kuhn, na cultura do algodoeiro, através do tratamento de sementes. Os resultados obtidos, nas condições de realização dos ensaios, permitem concluir que os fungicidas Rovrin - 320 g.i.a., Monceren - 210 g.i.a., Rovrin - 240 g.i.a., Rovrin - 200 g.i.a., PCNB - 450 g.i.a./100 litros de água ou 100 kg de sementes mostraram-se eficientes e não diferiram estatisticamente entre si no controle de R. solani, enquanto que o produto TMTD (Rhodiauran 70 na dosagem de 280 g.i.a./100 litros de água ou 100 kg de sementes de algodoeiro não se mostrou eficiente no controle deste agente causal.

    Aiming to test the efficiency of different dosages of Iprodione + Thiram (Rovrin in comparison with PCNB (Brassicol 75 BR, TMTD (Rhodiauran 70 and Captan + Pencycuron (Monceren for controlling Rhizoctonia solani Kuhn, in cotton plantation, through seeds treatment, was mounted essays “in vitro” at greenhouse level and BDA, in the Phytosanitary Department annexes of School of Agronomy-UFG. The results obtained, at essays conditions, permit to conclude that fungicides Rovrin - 320 g.i.a., Monceren - 210 g.i.a., Rovrin - 240 g.i.a., Rovrin - 200 g.i.a., PCNB - 450 g.i.a./l00 liters of water or 100kg of seeds, were efficient and statistically had no variation among them, in controlling R. solani, while chemical product TMTD (Rhodiauran 70, at dosage of 280 g.i.a./100 liters of water or 100 kg of cotton seeds, was not efficient in controlling this causal

  14. Potassium improves photosynthetic tolerance to and recovery from episodic drought stress in functional leaves of cotton (Gossypium hirsutum L.).

    Science.gov (United States)

    Zahoor, Rizwan; Zhao, Wenqing; Dong, Haoran; Snider, John L; Abid, Muhammad; Iqbal, Babar; Zhou, Zhiguo

    2017-10-01

    To investigate whether potassium (K) application enhances the potential of cotton (Gossypium hirsutum L.) plants to maintain physiological functions during drought and recovery, low K-sensitive (Siza 3) and -tolerant (Simian 3) cotton cultivars were exposed to three K rates (0, 150, and 300 K 2 O kg ha -1 ) and either well-watered conditions or severe drought stress followed by a recovery period. Under drought stress, cotton plants showed a substantial decline in leaf water potential, stomatal conductance, photosynthetic rate, and the maximum and actual quantum yield of PSII, resulting in greater non-photochemical quenching and lipid peroxidation as compared to well-watered plants. However, plants under K application not only showed less of a decline in these traits but also displayed greater potential to recover after rewatering as compared to the plants without K application. Plants receiving K application showed lower lipid peroxidation, higher antioxidant enzyme activities, and increased proline accumulation as compared to plants without K application. Significant relationships between rates of photosynthetic recovery and K application were observed. The cultivar Siza 3 exhibited a more positive response to K application than Simian 3. The results suggest that K application enhances the cotton plant's potential to maintain functionality under drought and facilitates recovery after rewatering. Copyright © 2017 Elsevier Masson SAS. All rights reserved.

  15. Mutantes morfológicos de algodoeiro herbáceo como fonte de resistência ao bicudo Morphological mutants of upland cotton as source of boll weevil resistance

    Directory of Open Access Journals (Sweden)

    Francisco das Chagas Vidal Neto

    2005-02-01

    Full Text Available Este trabalho teve como objetivo avaliar os efeitos de três características morfológicas mutantes de linhagens de algodoeiro herbáceo (Gossypium hirsutum L. r. latifolium Hutch., isoladas ou combinadas no mesmo genótipo, como fonte de resistência ao bicudo, Anthonomus grandis Boheman, 1843 (Coleoptera, Curculionidae. O experimento foi conduzido em campo, sob infestação natural, com delineamento de blocos ao acaso e arranjo fatorial 2´3 com um tratamento adicional, com quatro repetições. Em teste com chance de escolha, a característica bráctea frego foi a que apresentou maior redução no dano de oviposição pelo bicudo (34,71%, em relação ao equivalente normal. A folha "okra" reduziu o dano apenas quando associada à bráctea frego (40%. A combinação das três características mutantes na mesma planta proporcionou a menor porcentagem de botões com dano de oviposição (23,13%.This work aimed to evaluate the effects of three morphological mutants of upland cotton lines (Gossypium hirsutm L. r. latifolium Hutch., isolated or in combination in the same cotton genotype, as a source of resistance to boll weevil, Anthonomus grandis Boheman, 1843 (Coleoptera, Curculionidae. The experiment was carried out in the field, under natural infestation, with a completely randomized block design arranged in a factorial 2´3 plus an additional treatment, with four replications. In a multiple choice test, the character mutant frego bract presented the higher reduction on boll weevil oviposition damage (34.71%, in relation to the normal equivalent. The okra leaf reduced the boll weevil damage only when associated with frego bract (40%. The combination of the three mutant characters in the same plant presented the least square percent with oviposition damage (23.13%.

  16. Genetic variation and heritability for cotton seed, fiber and oil traits in gossypium hirsutum

    International Nuclear Information System (INIS)

    Khan, N.U.; Farhatullah; Batool, S.; Makhdoom, K.; Marwat, K.B.; Hassan, G.; Ahmad, W.; Khan, H.U.

    2010-01-01

    The research work pertaining to the study of genetic variability, heritability, genetic gain and correlation for cottonseed, fiber and cottonseed oil % in Gossypium hirsutum cultivars was conducted during 2005 at NWFP Agricultural University Peshawar, Pakistan. Analysis of variance manifested highly significant differences among the genotypes for all the traits except seeds per locule. Genetic potential range of eight cotton cultivars for different parameters was recorded i.e. seeds locule-1 (6.33 to 6.60), seeds boll-1 (26.10 to 28.47), seed index (8.61 to 9.69 g), lint index (5.35 to 6.05 g), lint % (35.17 to 38.13 %), seed cotton yield (1200 to 2450 kg ha/sup -1/) and cottonseed oil % (27.52 to 30.15%). Genetic variances were found almost greater than the environmental variances for all the traits except seeds locule-1 and seed index. High broad sense heritability and selection response were also formulated for seeds boll-1 (0.67, 0.84), seed index (0.77, 0.47 g), lint index (0.96, 0.33 g), lint % (0.96, 1.66 %), seed cotton yield (0.98, 643.16 kg) and cottonseed oil % (0.87, 1.28 %), respectively. Correlation of yield with other traits was found positive for majority of traits except seeds locule-1 and cotton seed oil %. Seed cotton yield is our ultimate goal in growing cotton besides lint %. Highest seed cotton yield was recorded in CIM-499 followed by CIM-473, CIM-496 and CIM-506 and were also found as the second and third top scoring genotypes for seeds per boll, seed index, lint % and cottonseed oil %. Cultivar SLH-279 performed better for lint index, lint % and oil %. This type of correlation is rarely found and ultra desirable by the cotton breeders and a little genetic gain in seed and lint traits, and oil content is a great accomplishment. (author)

  17. Simulate rain about action insecticide flonicamid in the control of the cotton aphid=Chuva simulada sobre ação inseticida flonicamid no controle do pulgão-do-algodoeiro.

    Directory of Open Access Journals (Sweden)

    Paulo Eduardo Degrande

    2011-10-01

    Full Text Available The cotton production system in Brazil concentrates on the area of the cerrado, characterized by frequent rains that interfere in the effectiveness of the necessary sprays during its cycle. The objective of the work was to evaluate simulate rain of 15 mm in 4 hours after spraying in the control of Aphis gossypii with insecticide flonicamid. Plants of Gossypium hirsutum were cultivated in pots containing soil as substrate in greenhouse conditions. The pots were arranged in randomized complete design with seven treatments and five replicates, consisting of: test without insecticide spraying, without insecticide spraying with rain, flonicamid spraying with simulate rain of 15 mm after 30 minutes, 1, 2 and 4 hours after spraying. Equivalent insecticide was sprayed 75 g of flonicamid by hectare. The efficiency evaluation was accomplished through the individuals of A. gossypii count which started from an artificial infestation 6 days before the application of the treatments. The results were: a 15-mm precipitation during the first four hours after flonicamid spraying interfered negatively in the control of A. gossypii.O cultivo do algodoeiro no Brasil concentra-se na Região do Cerrado, caracterizada por chuvas freqüentes que interferem na eficácia das pulverizações necessárias durante seu ciclo. O objetivo do trabalho foi avaliar chuva simulada de 15 mm nas 4h iniciais após pulverização no controle de A. gossypii com inseticida flonicamid. Plantas de Gossypium hirsutum foram cultivadas em vasos contendo solo como substrato em condições de casa-de-vegetação. Cada parcela foi constituída de um vaso com duas plantas. Utilizou-se delineamento experimental inteiramente casualizado com sete tratamentos e cinco repetições, consistindo de: testemunha sem pulverização de inseticida, testemunha sem pulverização de inseticida com presença de chuva e pulverização de flonicamid com chuva simulada de 15 mm aos 30 min., 1, 2 e 4h após aplica

  18. Germination of cotton cultivar seeds under water stress induced by polyethyleneglycol-6000 Germinação de sementes de cultivares de algodoeiro sob estresse hídrico induzido por polietilenoglicol-6000

    Directory of Open Access Journals (Sweden)

    Carlos Henrique Salvino Gadelha Meneses

    2011-04-01

    Full Text Available The physiological quality of cotton cultivar seeds (Gossypium hirsutum var. latifolium L. was evaluated in laboratory by the simulation of water potentials with polyethyleneglycol-6000 (0.0; -0.2; -0.4; -0.6; -0.8 and -1.0 MPa, at 25ºC using germitest paper as substrate. A completely randomized design in a 4 × 6 factorial scheme with four replications of 50 seeds each was used. The studied variables were: germination percentage, first count of germination, germination velocity index, accelerated aging in water, electrical conductivity, humidity, vigor classification, radicle length and radicle/shoot length ratio. The effect of water stress on seed viability and on plantlet vigor was severe at potentials below -0.4 MPa. The 'CNPA 187 8H' cultivar was the least sensitive to the tested osmotic potentials, both in terms of germination and of vigor. The 'BRS-201' cultivar was mostly affected by the viability and vigor tests under water deficit conditions. Differential viability and vigor between cultivars were observed under the water stress levels.A qualidade fisiológica de sementes de cultivares de algodoeiro (Gossypium hirsutum var. latifolium L. foi avaliada em laboratório pela simulação de potenciais hídricos com polietilenoglicol-6000 (0,0; -0,2; -0,4; -0,6; -0,8 e -1,0 MPa, na temperatura de 25ºC, em substrato papel germitest. O delineamento utilizado foi o inteiramente casualizado, em esquema fatorial 4 × 6, com quatro repetições de 50 sementes. As variáveis estudadas foram: porcentagem de germinação, primeira contagem da germinação e índice de velocidade de germinação, envelhecimento acelerado em água, condutividade elétrica, umidade, classificação de vigor (plântulas normais, fortes ou fracas, comprimento de radícula e relação radícula/parte aérea. O efeito do estresse hídrico na viabilidade das sementes e no vigor das plântulas foi severo a partir de -0.4 MPa. O cultivar CNPA 187 8H foi o menos sensível aos

  19. Genome wide SSR high density genetic map construction from an interspecific cross of Gossypium hirsutum × Gossypium tomentosum

    Directory of Open Access Journals (Sweden)

    Muhammad Kashif Riaz eKhan

    2016-04-01

    Full Text Available A high density genetic map was constructed using F2 population derived from an interspecific cross of G. hirsutum x G. tomentosum. The map consisted of 3,093 marker loci distributed across all the 26 chromosomes and covered 4,365.3 cM of cotton genome with an average inter-marker distance of 1.48 cM. The maximum length of chromosome was 218.38 cM and the minimum was 122.09 cM with an average length of 167.90 cM. A sub-genome covers more genetic distance (2,189.01 cM with an average inter loci distance of 1.53 cM than D sub-genome which covers a length of 2,176.29 cM with an average distance of 1.43 cM. There were 716 distorted loci in the map accounting for 23.14% and most distorted loci were distributed on D sub-genome (25.06%, which were more than on A sub-genome (21.23%. In our map 49 segregation hotspots (SDR were distributed across the genome with more on D sub-genome as compared to A genome. Two post-polyploidization reciprocal translocations of A2/A3 and A4/A5 were suggested by 7 pairs of duplicate loci. The map constructed through these studies is one of the three densest genetic maps in cotton however; this is the first dense genome wide SSR interspecific genetic map between G. hirsutum and G. tomentosum.

  20. Suppression of cotton leaf curl disease symptoms in Gossypium hirsutum through over expression of host-encoded miRNAs.

    Science.gov (United States)

    Akmal, Mohd; Baig, Mirza S; Khan, Jawaid A

    2017-12-10

    Cotton leaf curl disease (CLCuD), a major factor resulting in the enormous yield losses in cotton crop, is caused by a distinct monopartite begomovirus in association with Cotton leaf curl Multan betasatellite (CLCuMB). Micro(mi)RNAs are known to regulate gene expression in eukaryotes, including antiviral defense in plants. In a previous study, we had computationally identified a set of cotton miRNAs, which were shown to have potential targets in the genomes of Cotton leaf curl Multan virus (CLCuMuV) and CLCuMB at multiple loci. In the current study, effect of Gossypium arboreum-encoded miRNAs on the genome of CLCuMuV and CLCuMB was investigated in planta. Two computationally predicted cotton-encoded miRNAs (miR398 and miR2950) that showed potential to bind multiple Open Reading Frames (ORFs; C1, C4, V1, and non- coding intergenic region) of CLCuMuV, and (βC1) of CLCuMB were selected. Functional validation of miR398 and miR2950 was done by overexpression approach in G. hirsutum var. HS6. A total of ten in vitro cotton plants were generated from independent events and subjected to biological and molecular analyses. Presence of the respective Precursor (pre)-miRNA was confirmed through PCR and Southern blotting, and their expression level was assessed by semi quantitative RT-PCR, Real Time quantitative PCR and northern hybridization in the PCR-positive lines. Southern hybridization revealed 2-4 copy integration of T-DNA in the genome of the transformed lines. Remarkably, expression of pre-miRNAs was shown up to 5.8-fold higher in the transgenic (T 0 ) lines as revealed by Real Time PCR. The virus resistance was monitored following inoculation of the transgenic cotton lines with viruliferous whitefly (Bemisia tabaci) insect vector. After inoculation, four of the transgenic lines remained apparently symptom free. While a very low titre of viral DNA could be detected by Rolling circle amplification, betasatellite responsible for symptom induction could not be detected

  1. Cloreto de mepiquat, thidiazuron e ethephon aplicados no algodoeiro em Ponta Porã, MS Mepiquat chloride, thidiazuron and ethephon applied on cotton in Ponta Porã, MS, Brazil

    Directory of Open Access Journals (Sweden)

    Fernando Mendes Lamas

    1999-10-01

    Full Text Available O objetivo do presente estudo foi avaliar os efeitos de diferentes dosagens de cloreto de mepiquat, thidiazuron e ethephon, aplicadas parceladamente no algodoeiro (Gossypium hirsutum L. na Fazenda Itamarati, Ponta Porã, MS. As dosagens de cloreto de mepiquat foram: (0; 12,5 + 12,5 + 25,0 = 50; 25 + 25 + 25 = 75; 0 + 50 + 50 = 100; 12,5 + 62,5 + 50 = 125 g ha-1, com aplicações efetuadas aos 34, 47 e 62 dias após a emergência (DAE em 1993/94, e aos 42, 60 e 73 DAE, em 1994/95, enquanto o thidiazuron foi aplicado quando 70% dos capulhos estavam abertos, nas dosagens de 0, 45, 60 e 75 g ha-1; já o ethephon foi aplicado sete dias após o thidiazuron, quando já se observava desfolha de 85%, nas dosagens de 0, 960 e 1.440 g ha-1. O delineamento experimental utilizado foi o de blocos casualizados em faixa, com subparcelas subdivididas e quatro repetições. O cloreto de mepiquat proporcionou redução do número de frutos verdes, aumento do peso de 100 sementes e do peso médio de um capulho; a percentagem de desfolha aumentou com as dosagens de thidiazuron e ethephon; constatou-se que a interação cloreto de mepiquat x thidiazuron x ethephon foi significativa para percentagem de abertura de capulhos e produção de algodão em caroço.The objective of this study was to evaluate the effect of doses of mepiquat chloride, thidiazuron and ethephon on cotton (Gossypium hirsutum L., applied in parcels, and were surveyed in Itamarati Farm at Ponta Porã county. The mepiquat chloride doses were: (0.0; 12.5 + 12.5 + 25.0 = 50.0; 25.0 + 25.0 + 25.0 = 75.0; 0.0 + 50.0 + 50.0 = 100.0; 12.5 + 62.5 + 50.0 = 125.0 g ha-1. The applications were made at 34, 47 and 63 days after emergence(DAE in 1993/94 and at 42, 60 and 73 DAE in 1994/95. Thidiazuron was applied when 70% of bolls were opened at the doses 0.0, 45.0, 60.0 and 75.0 g ha-1. Ethephon was applied seven days after thidiazuron, when 85% defoliation was observed, in the doses of 0.0, 960.0 and 1,440.0 g

  2. Effects of Different Densities of Cotton (Gossypium Hirsutum and Common Lambsquarter (Chenopodium Album on Some Cotton Growth Characteristics in Birjand Condition

    Directory of Open Access Journals (Sweden)

    M. Velayati

    2011-01-01

    Full Text Available Abstract Weeds are problematic plants in agroecosystems as a competitor for crops. In order to evaluate effects of cotton (Gossypium hirsutum and common lambsquarter (Chenopodium album densities on some crop growth indices, a study was conducted during 2006 in Experimental Station of Faculty of Agriculture, The University of Birjand as factorial experiment based on complete randomized block design with four replications. Three densities of cotton (6, 9 and 12 Pl.m-2 and four weed densities (0, 6, 9 and 12 Pl.m-2 were used to provide different weed interference levels. Indeed, three plots in each replication were intended to cultivation of lambsquarter alone at 6, 9 or 12 Pl.m-2. Results showed that crop growth rate (CGR of cotton was influenced by weed density, and its relative growth rate (RGR and net assimilation rate (NAR indicated a declining trend as weed density increased. Dry matter accumulation of cotton also was affected negatively by weed densities, as interference of lambsquarter at 6, 9 and 12 Pl.m-2 resulted to 35, 42 and 48 percent dry matter reduction, respectively, than weed-free treatment. Increasing of cotton density could partly compensate for negative impact of weed attendance on cotton growth. Thus, it seems higher plant densities can be used as a managing tool against weeds in cotton fields to avoid reduction of yield. Keywords: Cotton, Density, Weed, competition, Growth analysis

  3. Estimation of best parents parents and superior cross combinations for yield and fiber quality related traits in upland cotton (gossypium hirsutum L.)

    International Nuclear Information System (INIS)

    Shaukat, S.; Khan, T.M.; Ijaz, S.

    2013-01-01

    Combining ability was studied for identification of potential cultivars and hybrids in upland cotton (Gossypium hirsutum L.) in a 6x6 set of diallel crosses among six genotypes of cotton, i.e., VH-232, CRS-2007, SB-149, GR-156, FH-207, and MARVI carried out on fiber length, fiber fineness, fiber elongation, fiber strength, ginning out tern (GOT) and seed cotton yield. Analysis of variance revealed highly significant (p < 0.01) differences among the genotypes for all traits. Combining ability studies showed that the mean squares, due to general combining ability (GCA), specific combining ability (SCA) and reciprocal effects were highly significant in F1 generation. Genetic components, due to GCA and SCA, revealed that traits, such as, fiber length, strength and fineness, showed high proportion of additive type of gene action in F1 generation because of greater GCA variances were greater than SCA variance. GR-156 was the best combiner for lint percentage and fiber length. FH-207 was the best combiner for fiber fineness. FH-207, MARVI and SB-149 were the best general combiners for fiber character and were suggested to be used in future breeding programme to improve fiber quality traits. CRS-2007 x GR-156, CRS-2007 x MARVI, SB-149 x MARVI and VH-232 x SB-149 had higher specific combining ability and reciprocal effects and they can be used for future breeding programme to improve fiber quality. (author)

  4. High Resolution Consensus Mapping of Quantitative Trait Loci for Fiber Strength, Length and Micronaire on Chromosome 25 of the Upland Cotton (Gossypium hirsutum L.).

    Science.gov (United States)

    Zhang, Zhen; Li, Junwen; Muhammad, Jamshed; Cai, Juan; Jia, Fei; Shi, Yuzhen; Gong, Juwu; Shang, Haihong; Liu, Aiying; Chen, Tingting; Ge, Qun; Palanga, Koffi Kibalou; Lu, Quanwei; Deng, Xiaoying; Tan, Yunna; Li, Wei; Sun, Linyang; Gong, Wankui; Yuan, Youlu

    2015-01-01

    Cotton (Gossypium hirsutum L.) is an important agricultural crop that provides renewable natural fiber resources for the global textile industry. Technological developments in the textile industry and improvements in human living standards have increased the requirement for supplies and better quality cotton. Upland cotton 0-153 is an elite cultivar harboring strong fiber strength genes. To conduct quantitative trait locus (QTL) mapping for fiber quality in 0-153, we developed a population of 196 recombinant inbred lines (RILs) from a cross between 0-153 and sGK9708. The fiber quality traits in 11 environments were measured and a genetic linkage map of chromosome 25 comprising 210 loci was constructed using this RIL population, mainly using simple sequence repeat markers and single nucleotide polymorphism markers. QTLs were identified across diverse environments using the composite interval mapping method. A total of 37 QTLs for fiber quality traits were identified on chromosome 25, of which 17 were stably expressed in at least in two environments. A stable fiber strength QTL, qFS-chr25-4, which was detected in seven environments and was located in the marker interval between CRI-SNP120491 and BNL2572, could explain 6.53%-11.83% of the observed phenotypic variations. Meta-analysis also confirmed the above QTLs with previous reports. Application of these QTLs could contribute to improving fiber quality and provide information for marker-assisted selection.

  5. Engineering cotton (Gossypium hirsutum L.) for resistance to cotton leaf curl disease using viral truncated AC1 DNA sequences.

    Science.gov (United States)

    Hashmi, Jamil A; Zafar, Yusuf; Arshad, Muhammad; Mansoor, Shahid; Asad, Shaheen

    2011-04-01

    Several important biological processes are performed by distinct functional domains found on replication-associated protein (Rep) encoded by AC1 of geminiviruses. Two truncated forms of replicase (tAC1) gene, capable of expressing only the N-terminal 669 bp (5'AC1) and C-terminal 783 bp (3'AC1) nucleotides cloned under transcriptional control of the CaMV35S were introduced into cotton (Gossypium hirsutum L.) using LBA4404 strain of Agrobacterium tumefaciens to make use of an interference strategy for impairing cotton leaf curl virus (CLCuV) infection in transgenic cotton. Compared with nontransformed control, we observed that transgenic cotton plants overexpressing either N-terminal (5'AC1) or C-terminal (3'AC1) sequences confer resistance to CLCuV by inhibiting replication of viral genomic and β satellite DNA components. Molecular analysis by Northern blot hybridization revealed high transgene expression in early and late growth stages associated with inhibition of CLCuV replication. Of the eight T(1) transgenic lines tested, six had delayed and minor symptoms as compared to nontransformed control lines which developed disease symptoms after 2-3 weeks of whitefly-mediated viral delivery. Virus biological assay and growth of T(2) plants proved that transgenic cotton plants overexpressing 5'- and 3'AC1 displayed high resistance level up to 72, 81%, respectively, as compared to non-transformed control plants following inoculation with viruliferous whiteflies giving significantly high cotton seed yield. Progeny analysis of these plants by polymerase chain reaction (PCR), Southern blotting and virus biological assay showed stable transgene, integration, inheritance and cotton leaf curl disease (CLCuD) resistance in two of the eight transgenic lines having single or two transgene insertions. Transgenic cotton expressing partial AC1 gene of CLCuV can be used as virus resistance source in cotton breeding programs aiming to improve virus resistance in cotton crop.

  6. A Gossypium hirsutum GDSL lipase/hydrolase gene (GhGLIP) appears to be involved in promoting seed growth in Arabidopsis.

    Science.gov (United States)

    Ma, Rendi; Yuan, Hali; An, Jing; Hao, Xiaoyun; Li, Hongbin

    2018-01-01

    GDSL lipase (GLIP) plays a pivotal role in plant cell growth as a multifunctional hydrolytic enzyme. Herein, a cotton (Gossypium hirsutum L. cv Xuzhou 142) GDSL lipase gene (GhGLIP) was obtained from developing ovules and fibers. The GhGLIP cDNA contained an open reading frame (ORF) of 1,143 base pairs (bp) and encodes a putative polypeptide of 380 amino acid residues. Sequence alignment indicated that GhGLIP includes four enzyme catalytic amino acid residue sites of Ser (S), Gly (G), Asn (N) and His (H), located in four conserved blocks. Phylogenetic tree analysis showed that GhGLIP belongs to the typical class IV lipase family with potential functions in plant secondary metabolism. Subcellular distribution analysis demonstrated that GhGLIP localized to the nucleus, cytoplasm and plasma membrane. GhGLIP was expressed predominantly at 5-15 day post anthesis (dpa) in developing ovules and elongating fibers, measured as mRNA levels and enzyme activity. Ectopic overexpression of GhGLIP in Arabidopsis plants resulted in enhanced seed development, including length and fresh weight. Meanwhile, there was increased soluble sugar and protein storage in transgenic Arabidopsis plants, coupled with the promotion of lipase activity. Moreover, the expression of cotton GhGLIP is induced by ethylene (ETH) treatment in vitro. A 1,954-bp GhGLIP promoter was isolated and expressed high activity in driving green fluorescence protein (GFP) expression in tobacco leaves. Cis-acting element analysis of the GhGLIP promoter (pGhGLIP) indicated the presence of an ethylene-responsive element (ERE), and transgenic tobacco leaves with ectopic expression of pGhGLIP::GFP-GUS showed increased GUS activity after ETH treatment. In summary, these results suggest that GhGLIP is a functional enzyme involved in ovule and fiber development and performs significant roles in seed development.

  7. Evaluation of haemoglobin (erythrogen): for improved somatic embryogenesis and plant regeneration in cotton (Gossypium hirsutum L. cv. SVPR 2).

    Science.gov (United States)

    Ganesan, M; Jayabalan, N

    2004-10-01

    Somatic embryogenesis in cotton (Gossypium hirsutum L.) is accelerated when the plant regeneration medium is supplemented with haemoglobin (erythrogen). In cotton SVPR 2 lines, a higher frequency of embryoid formation was observed when the medium contained 400 mg/l haemoglobin. Fresh weight of the callus, rate of embryoid induction, number of embryoids formed and the percentage of plant regeneration from somatic embryos were increased. Among the two different cultivars tested, MCU 11 showed no response to the presence of haemoglobin when compared to SVPR 2, and embryogenic callus formation was completely absent in the former. Medium containing MS salts, 100 mg/l myo-inositol , 0.3 mg/l thiamine-HCL, 0.3 mg/l Picloram (PIC), 0.1 mg/l kinetin and 400 mg/l haemoglobin effected a better response with respect to embryogenic callus induction. After 8 weeks of culture, a high frequency of embryoid induction was observed on medium containing MS basal salts, 100 mg/l myo-inositol, 0.3 mg/l PIC , 0.1 mg/l isopentenyl adenine, 1.0 g/l NH4NO3 and 400 mg/l haemoglobin. Plant regeneration was observed in 75.8% of the mature somatic embryos, and whole plant regeneration was achieved within 6-7 months of culture. The regenerated plantlets were fertile and similar to in vivo-grown, seed-derived plants except that they were phenotypically smaller. A positive influence of haemoglobin was observed at concentrations up to 400 mg/l at all stages of somatic embryogenesis. The increase in the levels of antioxidant enzyme activities, for example superoxide dismutase and peroxidase, indicated the presence of excess oxygen uptake and the stressed condition of the plant tissues that arose from haemoglobin supplementation. This increased oxygen uptake and haemoglobin-mediated stress appeared to accelerate somatic embryogenesis in cotton.

  8. Confamiliar transferability of simple sequence repeat (SSR) markers from cotton (Gossypium hirsutum L.) and jute (Corchorus olitorius L.) to twenty two Malvaceous species.

    Science.gov (United States)

    Satya, Pratik; Paswan, Pramod Kumar; Ghosh, Swagata; Majumdar, Snehalata; Ali, Nasim

    2016-06-01

    Cross-species transferability is a quick and economic method to enrich SSR database, particularly for minor crops where little genomic information is available. However, transferability of SSR markers varies greatly between species, genera and families of plant species. We assessed confamiliar transferability of SSR markers from cotton (Gossypium hirsutum) and jute (Corchorus olitorius) to 22 species distributed in different taxonomic groups of Malvaceae. All the species selected were potential industrial crop species having little or no genomic resources or SSR database. Of the 14 cotton SSR loci tested, 13 (92.86 %) amplified in G. arboreum and 71.43 % exhibited cross-genera transferability. Nine out of 11 jute SSRs (81.81 %) showed cross-transferability across genera. SSRs from both the species exhibited high polymorphism and resolving power in other species. The correlation between transferability of cotton and jute SSRs were highly significant (r = 0.813). The difference in transferability among species was also significant for both the marker groups. High transferability was observed at genus, tribe and subfamily level. At tribe level, transferability of jute SSRs (41.04 %) was higher than that of cotton SSRs (33.74 %). The tribe Byttnerieae exhibited highest SSR transferability (48.7 %). The high level of cross-genera transferability (>50 %) in ten species of Malvaceae, where no SSR resource is available, calls for large scale transferability testing from the enriched SSR databases of cotton and jute.

  9. Intensidade da ramulose sob semeadura convencional e direta do algodoeiro Ramulosis intensity under conventional and no-tillage cotton crop systems

    Directory of Open Access Journals (Sweden)

    Daniela Kubiak de Salvatierra

    2009-01-01

    Full Text Available Foram realizados em Piracicaba (SP, em 2004/05 e 2005/06, experimentos com o algodoeiro (Gossypium hirsutum L. var. latifolium Hutch, sob preparo do solo e semeadura convencional; e ausência de preparo do solo com semeadura sobre palhada de milheto, com o objetivo de avaliar as modificações microclimáticas (temperatura e duração do período de molhamento-DPM, decorrentes da utilização da palhada de milheto, no desenvolvimento da ramulose (Colletotrichum gossypii South. var. cephalosporioides Costa do algodoeiro. Foi utilizado também um índice de favorabilidade temperatura-molhamento (IF-tm para a ramulose do algodoeiro, para avaliar o desenvolvimento da doença nos dois sistemas de semeadura. Os dados climáticos foram medidos por uma plataforma de aquisição de dados sob o dossel das plantas e na região central da área experimental. A ramulose foi avaliada por escala de notas (1 a 5 e as médias das notas analisadas estatisticamente. Alterações no progresso da doença foram observadas, com ocorrência mais severa no sistema convencional de semeadura, porém não podendo ser atribuídas às variações na temperatura e DPM, consideradas isoladamente, mas decorrente de interações entre estas e a precipitação pluvial. O IF-tm teve boa relação com o aumento da severidade da doença, e a diferença, observada em maior proporção no sistema convencional de semeadura, ocorreu em períodos cujos valores de IF-tm foram altos, associados a períodos com chuvas e fase de maior suscetibilidade das plantas ao patógeno. Com IF-tm menores que 0,500 não se observa aumento efetivo da severidade da ramulose em quaisquer sistema de semeadura.During the years of 2004/05 and 2005/06, in Piracicaba, State of São Paulo, experiments were carried out with cotton crop under conventional tillage seeding and no-tillage. The seeding was performed over the mulching of millet, with the objective to evaluate if such mulching could interfere on

  10. Identification of exotic genetic components and DNA methylation pattern analysis of three cotton introgression lines from Gossypium bickii.

    Science.gov (United States)

    He, Shou-Pu; Sun, Jun-Ling; Zhang, Chao; Du, Xiong-Ming

    2011-01-01

    The impact of alien DNA fragments on plant genome has been studied in many species. However, little is known about the introgression lines of Gossypium. To study the consequences of introgression in Gossypium, we investigated 2000 genomic and 800 epigenetic sites in three typical cotton introgression lines, as well as their cultivar (Gossypium hirsutum) and wild parents (Gossypium bickii), by amplified fragment length polymorphism (AFLP) and methylation-sensitive amplified polymorphism (MSAP). The results demonstrate that an average of 0.5% of exotic DNA segments from wild cotton is transmitted into the genome of each introgression line, with the addition of other forms of genetic variation. In total, an average of 0.7% of genetic variation sites is identified in introgression lines. Simultaneously, the overall cytosine methylation level in each introgression line is very close to that of the upland cotton parent (an average of 22.6%). Further dividing patterns reveal that both hypomethylation and hypermethylation occurred in introgression lines in comparison with the upland cotton parent. Sequencing of nine methylation polymorphism fragments showed that most (7 of 9) of the methylation alternations occurred in the noncoding sequences. The molecular evidence of introgression from wild cotton into introgression lines in our study is identified by AFLP. Moreover, the causes of petal variation in introgression lines are discussed.

  11. Genome-Wide Transcriptome Analysis of Cotton (Gossypium hirsutum L. Identifies Candidate Gene Signatures in Response to Aflatoxin Producing Fungus Aspergillus flavus.

    Directory of Open Access Journals (Sweden)

    Renesh Bedre

    Full Text Available Aflatoxins are toxic and potent carcinogenic metabolites produced from the fungi Aspergillus flavus and A. parasiticus. Aflatoxins can contaminate cottonseed under conducive preharvest and postharvest conditions. United States federal regulations restrict the use of aflatoxin contaminated cottonseed at >20 ppb for animal feed. Several strategies have been proposed for controlling aflatoxin contamination, and much success has been achieved by the application of an atoxigenic strain of A. flavus in cotton, peanut and maize fields. Development of cultivars resistant to aflatoxin through overexpression of resistance associated genes and/or knocking down aflatoxin biosynthesis of A. flavus will be an effective strategy for controlling aflatoxin contamination in cotton. In this study, genome-wide transcriptome profiling was performed to identify differentially expressed genes in response to infection with both toxigenic and atoxigenic strains of A. flavus on cotton (Gossypium hirsutum L. pericarp and seed. The genes involved in antifungal response, oxidative burst, transcription factors, defense signaling pathways and stress response were highly differentially expressed in pericarp and seed tissues in response to A. flavus infection. The cell-wall modifying genes and genes involved in the production of antimicrobial substances were more active in pericarp as compared to seed. The genes involved in auxin and cytokinin signaling were also induced. Most of the genes involved in defense response in cotton were highly induced in pericarp than in seed. The global gene expression analysis in response to fungal invasion in cotton will serve as a source for identifying biomarkers for breeding, potential candidate genes for transgenic manipulation, and will help in understanding complex plant-fungal interaction for future downstream research.

  12. High Resolution Consensus Mapping of Quantitative Trait Loci for Fiber Strength, Length and Micronaire on Chromosome 25 of the Upland Cotton (Gossypium hirsutum L..

    Directory of Open Access Journals (Sweden)

    Zhen Zhang

    Full Text Available Cotton (Gossypium hirsutum L. is an important agricultural crop that provides renewable natural fiber resources for the global textile industry. Technological developments in the textile industry and improvements in human living standards have increased the requirement for supplies and better quality cotton. Upland cotton 0-153 is an elite cultivar harboring strong fiber strength genes. To conduct quantitative trait locus (QTL mapping for fiber quality in 0-153, we developed a population of 196 recombinant inbred lines (RILs from a cross between 0-153 and sGK9708. The fiber quality traits in 11 environments were measured and a genetic linkage map of chromosome 25 comprising 210 loci was constructed using this RIL population, mainly using simple sequence repeat markers and single nucleotide polymorphism markers. QTLs were identified across diverse environments using the composite interval mapping method. A total of 37 QTLs for fiber quality traits were identified on chromosome 25, of which 17 were stably expressed in at least in two environments. A stable fiber strength QTL, qFS-chr25-4, which was detected in seven environments and was located in the marker interval between CRI-SNP120491 and BNL2572, could explain 6.53%-11.83% of the observed phenotypic variations. Meta-analysis also confirmed the above QTLs with previous reports. Application of these QTLs could contribute to improving fiber quality and provide information for marker-assisted selection.

  13. Meta-analysis of cotton fiber quality QTLs across diverse environments in a Gossypium hirsutum x G. barbadense RIL population.

    Science.gov (United States)

    Lacape, Jean-Marc; Llewellyn, Danny; Jacobs, John; Arioli, Tony; Becker, David; Calhoun, Steve; Al-Ghazi, Yves; Liu, Shiming; Palaï, Oumarou; Georges, Sophie; Giband, Marc; de Assunção, Henrique; Barroso, Paulo Augusto Vianna; Claverie, Michel; Gawryziak, Gérard; Jean, Janine; Vialle, Michèle; Viot, Christopher

    2010-06-28

    Cotton fibers (produced by Gossypium species) are the premier natural fibers for textile production. The two tetraploid species, G. barbadense (Gb) and G. hirsutum (Gh), differ significantly in their fiber properties, the former having much longer, finer and stronger fibers that are highly prized. A better understanding of the genetics and underlying biological causes of these differences will aid further improvement of cotton quality through breeding and biotechnology. We evaluated an inter-specific Gh x Gb recombinant inbred line (RIL) population for fiber characteristics in 11 independent experiments under field and glasshouse conditions. Sites were located on 4 continents and 5 countries and some locations were analyzed over multiple years. The RIL population displayed a large variability for all major fiber traits. QTL analyses were performed on a per-site basis by composite interval mapping. Among the 651 putative QTLs (LOD > 2), 167 had a LOD exceeding permutation based thresholds. Coincidence in QTL location across data sets was assessed for the fiber trait categories strength, elongation, length, length uniformity, fineness/maturity, and color. A meta-analysis of more than a thousand putative QTLs was conducted with MetaQTL software to integrate QTL data from the RIL and 3 backcross populations (from the same parents) and to compare them with the literature. Although the global level of congruence across experiments and populations was generally moderate, the QTL clustering was possible for 30 trait x chromosome combinations (5 traits in 19 different chromosomes) where an effective co-localization of unidirectional (similar sign of additivity) QTLs from at least 5 different data sets was observed. Most consistent meta-clusters were identified for fiber color on chromosomes c6, c8 and c25, fineness on c15, and fiber length on c3. Meta-analysis provided a reliable means of integrating phenotypic and genetic mapping data across multiple populations and

  14. The Immature Fiber Mutant Phenotype of Cotton (Gossypium hirsutum Is Linked to a 22-bp Frame-Shift Deletion in a Mitochondria Targeted Pentatricopeptide Repeat Gene

    Directory of Open Access Journals (Sweden)

    Gregory N. Thyssen

    2016-06-01

    Full Text Available Cotton seed trichomes are the most important source of natural fibers globally. The major fiber thickness properties influence the price of the raw material, and the quality of the finished product. The recessive immature fiber (im gene reduces the degree of fiber cell wall thickening by a process that was previously shown to involve mitochondrial function in allotetraploid Gossypium hirsutum. Here, we present the fine genetic mapping of the im locus, gene expression analysis of annotated proteins near the locus, and association analysis of the linked markers. Mapping-by-sequencing identified a 22-bp deletion in a pentatricopeptide repeat (PPR gene that is completely linked to the immature fiber phenotype in 2837 F2 plants, and is absent from all 163 cultivated varieties tested, although other closely linked marker polymorphisms are prevalent in the diversity panel. This frame-shift mutation results in a transcript with two long open reading frames: one containing the N-terminal transit peptide that targets mitochondria, the other containing only the RNA-binding PPR domains, suggesting that a functional PPR protein cannot be targeted to mitochondria in the im mutant. Taken together, these results suggest that PPR gene Gh_A03G0489 is involved in the cotton fiber wall thickening process, and is a promising candidate gene at the im locus. Our findings expand our understanding of the molecular mechanisms that modulate cotton fiber fineness and maturity, and may facilitate the development of cotton varieties with superior fiber attributes.

  15. Effects of ionizing radiation on the hypocotyl-root axis of three species of gossypium

    International Nuclear Information System (INIS)

    Reed, J.P.

    1977-01-01

    The hypocotyl-root axis of cotton seedlings grown from irradiated and non-irradiated seeds was investigated using light microscopy and histological techniques. Special emphasis was placed on the pattern of vascular transition. Two patterns of vascular transition in non-irradiated seedlings were found. In Gossypium hirsutum and G. barbadense there are prominent metaxylem bands between the vascular bundles in the hypocotyl. In G. gossypioides there are no bands. The presence or absence of the bands was easily detected using polarized light. The most outstanding effects of radiation were inhibition of lateral root development and alteration of the pattern of vascular transition in seedlings grown from irradiated seeds. The findings suggest that the root apical meristem determines the vascular pattern

  16. A R2R3-MYB transcription factor that is specifically expressed in cotton (Gossypium hirsutum) fibers affects secondary cell wall biosynthesis and deposition in transgenic Arabidopsis.

    Science.gov (United States)

    Sun, Xiang; Gong, Si-Ying; Nie, Xiao-Ying; Li, Yang; Li, Wen; Huang, Geng-Qing; Li, Xue-Bao

    2015-07-01

    Secondary cell wall (SCW) is an important industrial raw material for pulping, papermaking, construction, lumbering, textiles and potentially for biofuel production. The process of SCW thickening of cotton fibers lays down the cellulose that will constitute the bulk (up to 96%) of the fiber at maturity. In this study, a gene encoding a MYB-domain protein was identified in cotton (Gossypium hirsutum) and designated as GhMYBL1. Quantitative real-time polymerase chain reaction (RT-PCR) analysis revealed that GhMYBL1 was specifically expressed in cotton fibers at the stage of secondary wall deposition. Further analysis indicated that this protein is a R2R3-MYB transcription factor, and is targeted to the cell nucleus. Overexpression of GhMYBL1 in Arabidopsis affected the formation of SCW in the stem xylem of the transgenic plants. The enhanced SCW thickening also occurred in the interfascicular fibers, xylary fibers and vessels of the GhMYBL1-overexpression transgenic plants. The expression of secondary wall-associated genes, such as CesA4, CesA7, CesA8, PAL1, F5H and 4CL1, were upregulated, and consequently, cellulose and lignin biosynthesis were enhanced in the GhMYBL1 transgenic plants. These data suggested that GhMYBL1 may participate in modulating the process of secondary wall biosynthesis and deposition of cotton fibers. © 2014 Scandinavian Plant Physiology Society.

  17. Promoter isolation and characterization of GhAO-like1, a Gossypium hirsutum gene similar to multicopper oxidases that is highly expressed in reproductive organs.

    Science.gov (United States)

    Lambret-Frotté, Julia; Artico, Sinara; Muniz Nardeli, Sarah; Fonseca, Fernando; Brilhante Oliveira-Neto, Osmundo; Grossi-de-Sá, Maria Fatima; Alves-Ferreira, Marcio

    2016-01-01

    Cotton is one of the most economically important cultivated crops. It is the major source of natural fiber for the textile industry and an important target for genetic modification for both biotic stress and herbicide tolerance. Therefore, the characterization of genes and regulatory regions that might be useful for genetic transformation is indispensable. The isolation and characterization of new regulatory regions is of great importance to drive transgene expression in genetically modified crops. One of the major drawbacks in cotton production is pest damage; therefore, the most promising, cost-effective, and sustainable method for pest control is the development of genetically resistant cotton lines. Considering this scenario, our group isolated and characterized the promoter region of a MCO (multicopper oxidase) from Gossypium hirsutum, named GhAO-like1 (ascorbate oxidase-like1). The quantitative expression, together with the in vivo characterization of the promoter region reveals that GhAO-like1 has a flower- and fruit-specific expression pattern. The GUS activity is mainly observed in stamens, as expected considering that the GhAO-like1 regulatory sequence is enriched in cis elements, which have been characterized as a target of reproductive tissue specific transcription factors. Both histological and quantitative analyses in Arabidopsis thaliana have confirmed flower (mainly in stamens) and fruit expression of GhAO-like1. In the present paper, we isolated and characterized both in silico and in vivo the promoter region of the GhAO-like1 gene. The regulatory region of GhAO-like1 might be useful to confer tissue-specific expression in genetically modified plants.

  18. Steam explosion distinctively enhances biomass enzymatic saccharification of cotton stalks by largely reducing cellulose polymerization degree in G. barbadense and G. hirsutum.

    Science.gov (United States)

    Huang, Yu; Wei, Xiaoyang; Zhou, Shiguang; Liu, Mingyong; Tu, Yuanyuan; Li, Ao; Chen, Peng; Wang, Yanting; Zhang, Xuewen; Tai, Hongzhong; Peng, Liangcai; Xia, Tao

    2015-04-01

    In this study, steam explosion pretreatment was performed in cotton stalks, leading to 5-6 folds enhancements on biomass enzymatic saccharification distinctive in Gossypium barbadense and Gossypium hirsutum species. Sequential 1% H2SO4 pretreatment could further increase biomass digestibility of the steam-exploded stalks, and also cause the highest sugar-ethanol conversion rates probably by releasing less inhibitor to yeast fermentation. By comparison, extremely high concentration alkali (16% NaOH) pretreatment with raw stalks resulted in the highest hexoses yields, but it had the lowest sugar-ethanol conversion rates. Characterization of wall polymer features indicated that biomass saccharification was enhanced with steam explosion by largely reducing cellulose DP and extracting hemicelluloses. It also showed that cellulose crystallinity and arabinose substitution degree of xylans were the major factors on biomass digestibility in cotton stalks. Hence, this study has provided the insights into cell wall modification and biomass process technology in cotton stalks and beyond. Copyright © 2015 Elsevier Ltd. All rights reserved.

  19. EPIDEMIOLOGICAL ASPECTS OF COTTON RAMULOSIS (Colletotrichum gossypii SOUTH. Var. cephalosporioides COSTA ASPECTOS EPIDEMIOLÓGICOS DA RAMULOSE (Colletotrichum gossypii South. var. cephalosporioides Costa DO ALGODOEIRO (Gossypium hirsutum L.

    Directory of Open Access Journals (Sweden)

    Fuad Calil

    2007-09-01

    Full Text Available

    These experiments deal with the effects of outbreak of early, medium and late developing ramulosis on the IAC-13.l variety of cotton, which was seeded at three different intervals in Itauçu (Goiás—Brazil. The effects of the ramulosis on the height and weight of the plants, on the number of bolls, and on the weight of the cotton seeds and lints, were studied. The experiments were installed in a flat area of red latosoil. The experimental design was one of random blocks with six repetitions and the plants were classified, at the end of their vegetative growth, into the following categories: healthy, early ramulosis, medium ramulosis and late developing ramulosis. The early and medium ramulosis affected more significantly the studied parameters, and it was observed that varieties of cotton which were moderately resistant in relation to ramulosis, can be severely affected during growing seasons of heavy rains such as the 1975/76 season.

    Estudaram-se os efeitos da incidência precoce, mediana e tardia de ramulose sobre o peso e altura das plantas, número de capulhos, peso das sementes e da pluma de algodoeiro do cultivar IAC-l3.l em três épocas de semeadura (21/10/75, 21/11/75 e 23/12/75 no município de Itauçu (GO. O experimento foi instalado em região plana com latossolo vermelho. Foram utilizados blocos casualizados com seis repetições e plantas no final do ciclo vegetativo foram classificadas em quatro tipos: sadias, com ramulose precoce, com ramulose mediana ou com ramulose tardia. Concluiu-se que a forma precoce e também a mediana foram as que afetaram mais significativamente os parâmetros aferidos, e que cultivares tidos como de razoável comportamento em relação à ramulose, podem ser severamente afetados em anos agrícolas muito chuvosos como foi o de 1975/76.

  20. Changes in activities of both photosystems and the regulatory effect of cyclic electron flow in field-grown cotton (Gossypium hirsutum L) under water deficit.

    Science.gov (United States)

    Yi, Xiao-Ping; Zhang, Ya-Li; Yao, He-Sheng; Han, Ji-Mei; Chow, Wah Soon; Fan, Da-Yong; Zhang, Wang-Feng

    2018-01-01

    To clarify the influence of water deficit on the functionality of the photosynthetic apparatus of cotton plants, leaf gas exchange, chlorophyll a fluorescence, and P700 redox state were examined in field-grown cotton Gossypium hirsutum L. cv. Xinluzao 45. In addition, we measured changes in the P515 signal and analyzed the activity of ATP synthase and the trans-thylakoid proton gradient (ΔpH). With increasing water deficit, the net CO 2 assimilation rate (A N ) and stomatal conductance (g s ) significantly decreased, but the maximum quantum efficiency of PSII photochemistry (F v /F m ) did not change. The photochemical activity of photosystem II (PSII) was reflected by the photochemical quenching coefficient (qP), quantum efficiency of photosystem II [Y(II)], and electron transport rate through PSII [ETR(II)], while the activity of photosystem I (PSI) was reflected by the quantum efficiency of photosystem I [Y(I)] and the electron transport rate through PSI [ETR(I)]. Both activities were maintained under mild water deficit, but were slightly decreased under moderate water deficit. Under moderate water deficit, cyclic electron flow (CEF), the fraction of absorbed light dissipated thermally via the ΔpH- and xanthophyll-regulated process [Y(NPQ)], and the fraction of P700 oxidized under a given set of conditions [Y(ND)] increased. Our results suggest that the activities of both photosystems are stable under mild water deficit and decrease only slightly under moderate water deficit. Moderate water deficit stimulates CEF, and the stimulation of CEF is essential for protecting PSI and PSII against photoinhibition. Copyright © 2017 Elsevier GmbH. All rights reserved.

  1. Meta-analysis of cotton fiber quality QTLs across diverse environments in a Gossypium hirsutum x G. barbadense RIL population

    Directory of Open Access Journals (Sweden)

    Giband Marc

    2010-06-01

    Full Text Available Abstract Background Cotton fibers (produced by Gossypium species are the premier natural fibers for textile production. The two tetraploid species, G. barbadense (Gb and G. hirsutum (Gh, differ significantly in their fiber properties, the former having much longer, finer and stronger fibers that are highly prized. A better understanding of the genetics and underlying biological causes of these differences will aid further improvement of cotton quality through breeding and biotechnology. We evaluated an inter-specific Gh × Gb recombinant inbred line (RIL population for fiber characteristics in 11 independent experiments under field and glasshouse conditions. Sites were located on 4 continents and 5 countries and some locations were analyzed over multiple years. Results The RIL population displayed a large variability for all major fiber traits. QTL analyses were performed on a per-site basis by composite interval mapping. Among the 651 putative QTLs (LOD > 2, 167 had a LOD exceeding permutation based thresholds. Coincidence in QTL location across data sets was assessed for the fiber trait categories strength, elongation, length, length uniformity, fineness/maturity, and color. A meta-analysis of more than a thousand putative QTLs was conducted with MetaQTL software to integrate QTL data from the RIL and 3 backcross populations (from the same parents and to compare them with the literature. Although the global level of congruence across experiments and populations was generally moderate, the QTL clustering was possible for 30 trait x chromosome combinations (5 traits in 19 different chromosomes where an effective co-localization of unidirectional (similar sign of additivity QTLs from at least 5 different data sets was observed. Most consistent meta-clusters were identified for fiber color on chromosomes c6, c8 and c25, fineness on c15, and fiber length on c3. Conclusions Meta-analysis provided a reliable means of integrating phenotypic and

  2. Construction of a plant-transformation-competent BIBAC library and genome sequence analysis of polyploid Upland cotton (Gossypium hirsutum L.).

    Science.gov (United States)

    Lee, Mi-Kyung; Zhang, Yang; Zhang, Meiping; Goebel, Mark; Kim, Hee Jin; Triplett, Barbara A; Stelly, David M; Zhang, Hong-Bin

    2013-03-28

    Cotton, one of the world's leading crops, is important to the world's textile and energy industries, and is a model species for studies of plant polyploidization, cellulose biosynthesis and cell wall biogenesis. Here, we report the construction of a plant-transformation-competent binary bacterial artificial chromosome (BIBAC) library and comparative genome sequence analysis of polyploid Upland cotton (Gossypium hirsutum L.) with one of its diploid putative progenitor species, G. raimondii Ulbr. We constructed the cotton BIBAC library in a vector competent for high-molecular-weight DNA transformation in different plant species through either Agrobacterium or particle bombardment. The library contains 76,800 clones with an average insert size of 135 kb, providing an approximate 99% probability of obtaining at least one positive clone from the library using a single-copy probe. The quality and utility of the library were verified by identifying BIBACs containing genes important for fiber development, fiber cellulose biosynthesis, seed fatty acid metabolism, cotton-nematode interaction, and bacterial blight resistance. In order to gain an insight into the Upland cotton genome and its relationship with G. raimondii, we sequenced nearly 10,000 BIBAC ends (BESs) randomly selected from the library, generating approximately one BES for every 250 kb along the Upland cotton genome. The retroelement Gypsy/DIRS1 family predominates in the Upland cotton genome, accounting for over 77% of all transposable elements. From the BESs, we identified 1,269 simple sequence repeats (SSRs), of which 1,006 were new, thus providing additional markers for cotton genome research. Surprisingly, comparative sequence analysis showed that Upland cotton is much more diverged from G. raimondii at the genomic sequence level than expected. There seems to be no significant difference between the relationships of the Upland cotton D- and A-subgenomes with the G. raimondii genome, even though G

  3. Gossypium hirsutum

    Indian Academy of Sciences (India)

    2015-03-12

    Mar 12, 2015 ... measurement used to compare diversity between two or more ... Each individual genotype is represented by a line partitioned in five coloured segments that .... protein, the addition of more markers to catalogue multi-.

  4. Desempenho de genótipos de algodoeiro sob pressão de bicudo

    Directory of Open Access Journals (Sweden)

    Samuel Campos Abreu

    2013-02-01

    Full Text Available http://dx.doi.org/10.5007/2175-7925.2013v26n2p77   O objetivo deste estudo foi avaliar o comportamento de cinco genótipos de algodoeiro em condições de infestação de bicudo-do-algodoeiro. O experimento foi realizado em Janaúba-MG, no ano agrícola de 2004/2005. O delineamento experimental adotado foi de blocos casualizados, com quatro repetições. Foram utilizados cinco tratamentos (constituídos pelos seguintes genótipos de algodoeiro: Redenção, Precoce 1, Linhagem experimental, Liça e Alva. A densidade de plantas foi de 88.000 a 100.000 plantas/ha. Na condução da cultura não foram adotados quaisquer métodos de controle de pragas. Foram avaliados o número de capulhos, o rendimento de algodão em caroço, a altura de planta, a massa do capulho, a massa de 100 sementes, a porcentagem de pluma, a época de floração e o número médio de bicudo-do-algodoeiro nos botões florais. As cultivares Alva e Linhagem experimental obtiveram os maiores rendimentos de algodão em caroço, 1.092,5 kg.ha-1 e 922,5 kg.ha-1, respectivamente, comparadas à ‘Redenção’, que apresentou a menor produtividade, 453,6 kg.ha-1. A Linhagem experimental foi a mais infestada, apresentando a maior média de indivíduos, de 1,7 bicudo-do-algodoeiro por planta.

  5. Observações sôbre o bronzeado do algodoeiro Mocó Observations on bronzing of the Mocó cotton

    Directory of Open Access Journals (Sweden)

    A. S. Costa

    1955-01-01

    Full Text Available Uma anomalia do algodoeiro Mocó, denominada bronzeado, vem sendo observada na região do Seridó, Rio Grande do Norte, durante os últimos três anos. Pensou-se, a princípio, que esta anomalia fôsse causada por um vírus, mas as observações relatadas neste trabalho indicam que é causada por um ácaro. As fôlhas das plantas afetadas, especialmente aquelas da metade superior dos galhos, mostram uma coloração bronzeada no lado de baixo. Essa face da fôlha tem também uma superfície rugosa, com brilho vidrado (est. 1, B, as vezes com pequenas áreas de tecido cicatricial. Vistas pelo lado de cima são mais rugosas do que as normais e têm os bordos curvados para baixo. Nos casos graves, as fôlhas do topo dos galhos morrem e caem (est. 2, A e B. A espécie de ácaro causadora do bronzeado do algodoeiro Mocó foi identificada por H. H. Keifer, Sacramento, Calif., como pertencente a um gênero ainda não descrito da família Eriophyidae. Esta espécie está sendo presentemente denominada Anthocoptes sp. até que a sua descrição seja publicada. Populações de 500 a 1.000 indivíduos por centímetro quadrado de fôlha já foram encontradas. Esse ácaro parece ser muito sensível às condições do ambiente, visto que as populações da praga variam entre grandes limites.For the last three years a bronzing anomaly of cotton plants of the Mocó variety (Gossypium hirsutum L. var. maria galante Hutch. has been recorded in the Seridó region (a semi-arid region in the north-eastern part of Brazil, state of Rio Grande do Norte. This anomaly was first thought to be of virus origin, but the observations reported in this paper indicated that it is due to the attack by a species of mite. Leaves from affected plants, especially those on the upper half of the branches, show a bronzing discoloration on the dorsal side, frequently accompanied by a rough and ventral side of these leaves shows some rugosity not present in normal leaves, and in most cases

  6. Characterization of expressed sequence tags from developing fibers of Gossypium barbadense and evaluation of insertion-deletion variation in tetraploid cultivated cotton species.

    Science.gov (United States)

    Lv, Yuanda; Zhao, Liang; Xu, Xiaoyang; Wang, Lei; Wang, Cheng; Zhang, Tianzhen; Guo, Wangzhen

    2013-03-13

    Cotton is the leading fiber crop worldwide. Gossypium barbadense is an important species of cotton because of its extra-long staple fibers with superior luster and silkiness. However, a systematic analysis and utilization of cDNA sequences from G. barbadense fiber development remains understudied. A total of 21,079 high quality sequences were generated from two non-normalized cDNA libraries prepared by using a mixture of G. barbadense Hai7124 fibers and ovules. After assembly processing, a set of 8,653 unigenes were obtained. Of those, 7,786 were matched to known proteins and 7,316 were assigned to functional categories. The molecular functions of these unigenes were mostly related to binding and catalytic activity, and carbohydrate, amino acid, and energy metabolisms were major contributors among the subsets of metabolism. Sequences comparison between G. barbadense and G. hirsutum revealed that 8,245 unigenes from G. barbadense were detected the similarity with those released publicly in G. hirsutum, however, the remaining 408 sequences had no hits against G. hirsutum unigenes database. Furthermore, 13,275 putative ESTs InDels loci involved in the orthologous and/or homoeologous differences between/within G. barbadense and G. hirsutum were discovered by in silico analyses, and 2,160 InDel markers were developed by ESTs with more than five insertions or deletions. By gel electrophoresis combined with sequencing verification, 71.11% candidate InDel loci were reconfirmed orthologous and/or homoeologous loci polymorphisms using G. hirsutum acc TM-1 and G. barbadense cv Hai7124. Blastx result showed among 2,160 InDel loci, 81 with significant function similarity with known genes associated with secondary wall synthesis process, indicating the important roles in fiber quality in tetraploid cultivated cotton species. Sequence comparisons and InDel markers development will lay the groundwork for promoting the identification of genes related to superior agronomic traits

  7. O cultivo do algodão herbáceo no sistema de sequeiro no Nordeste do Brasil, no cenário de mudanças climática Cultivation of upland cotton in the rainfed system in Northeastern Brazil in the climate change scenario

    Directory of Open Access Journals (Sweden)

    Madson T. Silva

    2012-01-01

    Full Text Available O principal objetivo do estudo foi avaliar o impacto das mudanças climáticas no algodoeiro herbáceo (Gossypium hirsutum L. latifolium Hutch cultivado no Nordeste do Brasil a partir de estimativas da disponibilidade de terras aptas para a atividade agrícola de sequeiro. Essas informações, baseadas em cenários de aumento de temperatura e variabilidade da precipitação pluvial do Painel Intergovernamental de Mudanças Climáticas (IPCC, alimentam um modelo inter-regional de balanço hídrico. Os dados utilizados no estudo foram séries climatológicas diárias de precipitação pluvial, maior que 30 anos, coeficientes da cultura, evapotranspiração potencial e a duração do ciclo. Os cenários denominados A, B e C correspondem, respectivamente, aos aumentos de temperatura média do ar em 1,5; 3,0 e 5,0 ºC associados com as oscilações percentuais de precipitação de ±10; ±25 e ±40%. O Índice de Satisfação das Necessidades de Água para a cultura (ISNA, definido como a relação entre a evapotranspiração real e a evapotranspiração máxima (ETr/ETm foi utilizado como critério na definição das áreas favoráveis ao cultivo do algodoeiro. Os resultados obtidos sugerem que os cenários de mudanças climáticas podem provocar reduções de áreas favoráveis ao algodoeiro herbáceo em toda a região Nordeste do Brasil.The main objective of the study was to analyse the impact of climate change on upland cotton (Gossypium hirsutum L. latifolium Hutch grown in Northeastern Brazil from estimates of the availability of land suitable for rainfed agriculture. This information, based on scenarios of increased temperature and rainfall variability of the Intergovernmental Panel on Climate Change (IPCC, was used in a model of inter-regional water balance. The data series used in the study were climatological daily rainfall of more than 30 years, crop coefficients, evapotranspiration potential and cycle length. The scenarios named A, B and

  8. SELECTIVITY OF PESTICIDES OVER PREDATORS OF COTTON PLANT PESTS SELETIVIDADE DE INSETICIDAS SOBRE O COMPLEXO DE PREDADORES DAS PRAGAS DO ALGODOEIRO

    Directory of Open Access Journals (Sweden)

    Izidro dos Santos de Lima Júnior

    2010-08-01

    similar to the control, until 8 days after spraying. Among the pesticides evaluated, only Flonicamid 500 WG was considered selective, according to the IOBC classification, because it showed the lowest mortality percentage for the complex of predators identified.

    KEY-WORDS: Gossypium hirsutum L.; insecta; pesticides; cotton plant; predators.

    O algodoeiro é hospedeiro de um complexo de pragas, que podem ocasionar danos às estruturas das plantas. Para o desenvolvimento sustentado, neste agroecossistema, há necessidade da implementação do Manejo Integrado das Pragas (MIP. O objetivo deste trabalho foi estudar a seletividade de inseticidas aos predadores das pragas do algodoeiro. O delineamento experimental utilizado foi o de blocos ao acaso, com nove tratamentos e quatro repetições. Os tratamentos foram aplicados aos 84 dias após a emergência. As amostragens foram feitas através do método de batida de pano, com cinco batidas ao acaso, por parcela, nas quais foram identificados e contados os predadores vivos. Os inseticidas Clotianidin 500 WP (200 g ha-1, Carbosulfan 400 SC (400 mL ha-1, Benfuracarb 400 EC (450 mL ha-1, Cartap hydrochloride 500 SP (1.000 g ha-1, Thiamethoxam 250 WG (200 g ha-1 e Acetamiprid 200 SP (150 g ha-1 não foram seletivos ao complexo de predadores ocorrentes, com percentagens de mortalidades que oscilaram entre moderadamente tóxicos e tóxicos. Etofenprox 300 EC (450 mL ha-1 apresentou a maior percentagem de mortalidade, em rela

  9. Chromosomal Locations of 5S and 45S rDNA in Gossypium Genus and Its Phylogenetic Implications Revealed by FISH.

    Science.gov (United States)

    Gan, Yimei; Liu, Fang; Chen, Dan; Wu, Qiong; Qin, Qin; Wang, Chunying; Li, Shaohui; Zhang, Xiangdi; Wang, Yuhong; Wang, Kunbo

    2013-01-01

    We investigated the locations of 5S and 45S rDNA in Gossypium diploid A, B, D, E, F, G genomes and tetraploid genome (AD) using multi-probe fluorescent in situ hybridization (FISH) for evolution analysis in Gossypium genus. The rDNA numbers and sizes, and synteny relationships between 5S and 45S were revealed using 5S and 45S as double-probe for all species, and the rDNA-bearing chromosomes were identified for A, D and AD genomes with one more probe that is single-chromosome-specific BAC clone from G. hirsutum (A1D1). Two to four 45S and one 5S loci were found in diploid-species except two 5S loci in G. incanum (E4), the same as that in tetraploid species. The 45S on the 7th and 9th chromosomes and the 5S on the 9th chromosomes seemed to be conserved in A, D and AD genomes. In the species of B, E, F and G genomes, the rDNA numbers, sizes, and synteny relationships were first reported in this paper. The rDNA pattern agrees with previously reported phylogenetic history with some disagreements. Combined with the whole-genome sequencing data from G. raimondii (D5) and the conserved cotton karyotype, it is suggested that the expansion, decrease and transposition of rDNA other than chromosome rearrangements might occur during the Gossypium evolution.

  10. Gossypium barbadense genome sequence provides insight into the evolution of extra-long staple fiber and specialized metabolites.

    Science.gov (United States)

    Liu, Xia; Zhao, Bo; Zheng, Hua-Jun; Hu, Yan; Lu, Gang; Yang, Chang-Qing; Chen, Jie-Dan; Chen, Jun-Jian; Chen, Dian-Yang; Zhang, Liang; Zhou, Yan; Wang, Ling-Jian; Guo, Wang-Zhen; Bai, Yu-Lin; Ruan, Ju-Xin; Shangguan, Xiao-Xia; Mao, Ying-Bo; Shan, Chun-Min; Jiang, Jian-Ping; Zhu, Yong-Qiang; Jin, Lei; Kang, Hui; Chen, Shu-Ting; He, Xu-Lin; Wang, Rui; Wang, Yue-Zhu; Chen, Jie; Wang, Li-Jun; Yu, Shu-Ting; Wang, Bi-Yun; Wei, Jia; Song, Si-Chao; Lu, Xin-Yan; Gao, Zheng-Chao; Gu, Wen-Yi; Deng, Xiao; Ma, Dan; Wang, Sen; Liang, Wen-Hua; Fang, Lei; Cai, Cai-Ping; Zhu, Xie-Fei; Zhou, Bao-Liang; Jeffrey Chen, Z; Xu, Shu-Hua; Zhang, Yu-Gao; Wang, Sheng-Yue; Zhang, Tian-Zhen; Zhao, Guo-Ping; Chen, Xiao-Ya

    2015-09-30

    Of the two cultivated species of allopolyploid cotton, Gossypium barbadense produces extra-long fibers for the production of superior textiles. We sequenced its genome (AD)2 and performed a comparative analysis. We identified three bursts of retrotransposons from 20 million years ago (Mya) and a genome-wide uneven pseudogenization peak at 11-20 Mya, which likely contributed to genomic divergences. Among the 2,483 genes preferentially expressed in fiber, a cell elongation regulator, PRE1, is strikingly At biased and fiber specific, echoing the A-genome origin of spinnable fiber. The expansion of the PRE members implies a genetic factor that underlies fiber elongation. Mature cotton fiber consists of nearly pure cellulose. G. barbadense and G. hirsutum contain 29 and 30 cellulose synthase (CesA) genes, respectively; whereas most of these genes (>25) are expressed in fiber, genes for secondary cell wall biosynthesis exhibited a delayed and higher degree of up-regulation in G. barbadense compared with G. hirsutum, conferring an extended elongation stage and highly active secondary wall deposition during extra-long fiber development. The rapid diversification of sesquiterpene synthase genes in the gossypol pathway exemplifies the chemical diversity of lineage-specific secondary metabolites. The G. barbadense genome advances our understanding of allopolyploidy, which will help improve cotton fiber quality.

  11. Gamma irradiation of the interspecific hybrids Gossypium hirsutum L. x G. barbadense L. Part 1

    International Nuclear Information System (INIS)

    Stoilova, A.

    1990-01-01

    The study was aimed at combining the methods of hybridization and experimental mutagenesis and widening the possibilities of interspecific hybridization for successful breeding work. The reaction of interspecific cotton hybrids (G. hirsutum x G. barbadense) to gamma rays in the year of treatment was investigated. Four hybrid combinations resulting from reciprocal crosses between the two species were studied. Seeds of long fibre F 1 plants from each combination were divided in four equal parts (irradiated with 15, 20 and 25 krad and a control). The changes in the main biometrical indices between the control and maximum dose (25 krad) treatment showed that the F 2 hybrids were either resistant or slightly sensitive to irradiation depending on the direction of crossing in respect to growth processes, field germination and survival to the end of vegetation. 3 tabs., 2 figs., 14 refs

  12. Development of Agrobacterium-mediated virus-induced gene silencing and performance evaluation of four marker genes in Gossypium barbadense.

    Directory of Open Access Journals (Sweden)

    Jinhuan Pang

    Full Text Available Gossypiumbarbadense is a cultivated cotton species and possesses many desirable traits, including high fiber quality and resistance to pathogens, especially Verticilliumdahliae (a devastating pathogen of Gossypium hirsutum, the main cultivated species. These elite traits are difficult to be introduced into G. hirsutum through classical breeding methods. In addition, genetic transformation of G. barbadense has not been successfully performed. It is therefore important to develop methods for evaluating the function and molecular mechanism of genes in G. barbadense. In this study, we had successfully introduced a virus-induced gene silencing (VIGS system into three cultivars of G. barbadense by inserting marker genes into the tobacco rattle virus (TRV vector. After we optimized the VIGS conditions, including light intensity, photoperiod, seedling age and Agrobacterium strain, 100% of plants agroinfiltrated with the GaPDS silencing vector showed white colored leaves. Three other marker genes, GaCLA1, GaANS and GaANR, were employed to further test this VIGS system in G. barbadense. The transcript levels of the endogenous genes in the silenced plants were reduced by more than 99% compared to control plants; these plants presented phenotypic symptoms 2 weeks after inoculation. We introduced a fusing sequence fragment of GaPDS and GaANR gene silencing vectors into a single plant, which resulted in both photobleaching and brownish coloration. The extent of silencing in plants agroinfiltrated with fusing two-gene-silencing vector was consistent with plants harboring a single gene silencing vector. The development of this VIGS system should promote analysis of gene function in G. barbadense, and help to contribute desirable traits for breeding of G. barbadense and G. hirsutum.

  13. Comprehensive Analysis of the COBRA-Like (COBL) Gene Family in Gossypium Identifies Two COBLs Potentially Associated with Fiber Quality

    Science.gov (United States)

    Niu, Erli; Shang, Xiaoguang; Cheng, Chaoze; Bao, Jianghao; Zeng, Yanda; Cai, Caiping; Du, Xiongming; Guo, Wangzhen

    2015-01-01

    COBRA-Like (COBL) genes, which encode a plant-specific glycosylphosphatidylinositol (GPI) anchored protein, have been proven to be key regulators in the orientation of cell expansion and cellulose crystallinity status. Genome-wide analysis has been performed in A. thaliana, O. sativa, Z. mays and S. lycopersicum, but little in Gossypium. Here we identified 19, 18 and 33 candidate COBL genes from three sequenced cotton species, diploid cotton G. raimondii, G. arboreum and tetraploid cotton G. hirsutum acc. TM-1, respectively. These COBL members were anchored onto 10 chromosomes in G. raimondii and could be divided into two subgroups. Expression patterns of COBL genes showed highly developmental and spatial regulation in G. hirsutum acc. TM-1. Of them, GhCOBL9 and GhCOBL13 were preferentially expressed at the secondary cell wall stage of fiber development and had significantly co-upregulated expression with cellulose synthase genes GhCESA4, GhCESA7 and GhCESA8. Besides, GhCOBL9 Dt and GhCOBL13 Dt were co-localized with previously reported cotton fiber quality quantitative trait loci (QTLs) and the favorable allele types of GhCOBL9 Dt had significantly positive correlations with fiber quality traits, indicating that these two genes might play an important role in fiber development. PMID:26710066

  14. Clustering, haplotype diversity and locations of MIC-3: a unique root-specific defense-related gene family in upland cotton (Gossypium hirsutum L.)

    Science.gov (United States)

    MIC-3-related genes of cotton (Gossypium spp.) were identified and shown to have root-specific expression, associated with pathogen defense-related function and specifically increased expression in root-knot nematode (RKN) resistant plants after nematode infection. Here we cloned and sequenced MIC-...

  15. Gossypium hirsutum L.

    Indian Academy of Sciences (India)

    dell

    Improvement of cotton fiber yield and quality is challenging due to the narrow ... The polymorphic information content (PIC) values ranged from 0.371 to ... Several DNA marker systems have been developed and applied to assess the genetic.

  16. Potassium sources in covering fertilization on cotton I – Yield, fiber quality and economic analisys. / Fontes de potássio na adubação de cobertura do algodoeiro I – Produtividade, qualidade de fibras e análise econômica

    Directory of Open Access Journals (Sweden)

    José Eduardo Creste

    2009-03-01

    Full Text Available A field experiment was conducted in Sapezal, Mato Grosso state, Brazil, in 2007/2008, with the purpose of determining the effect of potassium sources on yield components, yield, fiber quality and economical aspects of cotton (Gossypium hirsutum L.. A randomized complete block experimental design was used, with five replications. The treatments consisted of application in covering, via soil, at rate of 100 kg ha-1 of K2O, in two split applications, of the sources KCl, K2SO4, KNO3 and K2SO4.2MgSO4. The number of nodes, height, number of bolls in the superior third and the weight of boll in the medium third was higher with K2SO4.2MgSO4 than with KNO3 source. The potassium fertilizers did not influence the fiber revenue, but the fertilizing with K2SO4.2MgSO4 source had higher cotton seed yield and lint yield, although the uniformity ratio of fibber and profitability were smaller in relation to K2SO4. The fibber agio index was higher with KNO3 source. The production cost was higher with K2SO4.2MgSO4 source and in function of the smallest production cost, KCl source presented superior liquid revenue than other treatments. Conduziu-se um experimento de campo, em Sapezal – MT, no ano agrícola de 2007/2008, com o objetivo de avaliar o efeito das fontes de potássio sobre os componentes de produção, a produtividade, a qualidade da fibra e os aspectos econômicos do algodoeiro (Gossypium hirsutum L. cultivar FMT 701. O delineamento utilizado foi o de blocos casualizados, com cinco repetições. Os tratamentos constaram da aplicação em cobertura via solo na dose de 100 kg ha-1 de K2O, parcelada em duas aplicações, nas fontes KCl, K2SO4, KNO3 e K2SO4.2MgSO4. O número de nós, a altura da planta, o número de capulhos no terço superior e o peso do capulho no terço médio foram maiores no tratamento com K2SO4.2MgSO4, em relação ao KNO3. Os adubos potássicos não influenciaram o rendimento de fibra, mas a adubação potássica de cobertura na

  17. Genome-wide investigation and transcriptome analysis of the WRKY gene family in Gossypium.

    Science.gov (United States)

    Ding, Mingquan; Chen, Jiadong; Jiang, Yurong; Lin, Lifeng; Cao, YueFen; Wang, Minhua; Zhang, Yuting; Rong, Junkang; Ye, Wuwei

    2015-02-01

    WRKY transcription factors play important roles in various stress responses in diverse plant species. In cotton, this family has not been well studied, especially in relation to fiber development. Here, the genomes and transcriptomes of Gossypium raimondii and Gossypium arboreum were investigated to identify fiber development related WRKY genes. This represents the first comprehensive comparative study of WRKY transcription factors in both diploid A and D cotton species. In total, 112 G. raimondii and 109 G. arboreum WRKY genes were identified. No significant gene structure or domain alterations were detected between the two species, but many SNPs distributed unequally in exon and intron regions. Physical mapping revealed that the WRKY genes in G. arboreum were not located in the corresponding chromosomes of G. raimondii, suggesting great chromosome rearrangement in the diploid cotton genomes. The cotton WRKY genes, especially subgroups I and II, have expanded through multiple whole genome duplications and tandem duplications compared with other plant species. Sequence comparison showed many functionally divergent sites between WRKY subgroups, while the genes within each group are under strong purifying selection. Transcriptome analysis suggested that many WRKY genes participate in specific fiber development processes such as fiber initiation, elongation and maturation with different expression patterns between species. Complex WRKY gene expression such as differential Dt and At allelic gene expression in G. hirsutum and alternative splicing events were also observed in both diploid and tetraploid cottons during fiber development process. In conclusion, this study provides important information on the evolution and function of WRKY gene family in cotton species.

  18. Eliminação do desbaste na cultura do algodoeiro Elimination of thinning practices on cotton crop

    Directory of Open Access Journals (Sweden)

    Edivaldo Cia

    2001-10-01

    Full Text Available Este trabalho foi desenvolvido nos anos agrícolas de 1979/80 a 1982/83 em diferentes localidades no Estado de São Paulo, com o objetivo de avaliar o efeito da eliminação do desbaste na cultura do algodoeiro Gossypium hirsutum L. O delineamento experimental empregado foi o de blocos ao acaso, em esquema fatorial, com seis tratamentos e seis repetições. Os tratamentos foram constituídos de 12 e 24 sementes/m, submetidas ao deslintamento mecânico, deslintamento mecânico + tratamento com fungicidas e deslintamento químico + tratamento com fungicidas. Para a avaliação dos resultados foram feitas duas análises conjuntas, com base na emergência das plantas: emergência normal e emergência tardia, estudando-se as características: emergência, produção, estande final, peso de capulho e semente, porcentagem e índice de fibra. Os resultados mostraram que em condições edafoclimáticas adversas à germinação ocorreu baixa emergência, causando, com isso, menor população de plantas, e, conseqüentemente, prejuízos à produção de algodão. Com maior estande ocorreram menores pesos de capulho e de sementes, e menor porcentagem e índice de fibra. Constatou-se que existe a viabilidade de eliminação da prática do desbaste por meio do tratamento das sementes com fungicidas aliado ao deslintamento químico, desde que o plantio seja efetuado em boas condições de ambiente à germinação.This work was developed during the agricultural years of 1979/80 to 1982/83 in different localities in the State of São Paulo, Brazil, to evaluate the effect of plant thinning in the cotton plantation. The trial was carried out in a randomized block design and in a factorial scheme with six treatments and six replicates. The treatments consisted of 12 and 24 seeds/m submitted to mechanical delinting + fungicide, and chemical delinting + fungicides. For evaluation of the results, two conjunct analyses were done based on the plant emergence: normal

  19. REPRODUÇÃO DE Edessa meditabunda (HEMIPTERA: PENTATOMIDAE EM ALGODOEIRO

    Directory of Open Access Journals (Sweden)

    Rosalia Azambuja

    2015-05-01

    Full Text Available O percevejo-asa-preta-da-soja Edessa meditabunda (Fabricius (Hemiptera: Pentatomidae no final do ciclo da soja dispersa para algodoeiro e utiliza essa planta como hospedeiro alternativo. Visando conhecer o potencial desta espécie como praga em algodoais e auxiliar na tomada decisão quanto ao manejo deste inseto, hipotetizou-se nesse trabalho que o algodoeiro é nutricionalmente adequado para a reprodução e desenvolvimento de E. meditabunda. Os tratamentos testados foram: 1 folhas e maçã de algodoeiro e 2 dieta padrão, recomendada para criação de pentatomídeos fitófagos em laboratório, utilizada como testemunha. As características biológicas avaliadas foram: período de desenvolvimento ninfal, duração de cada ínstar, porcentagem de sobrevivência, peso dos adultos na emergência, longevidade de machos e de fêmeas, período de pré-oviposição e de oviposição, número total de ovos por fêmea e fecundidade das fêmeas. Observou-se que, apesar do prolongamento do período de desenvolvimento ninfal, as ninfas alimentadas com algodoeiro sobreviveram, atingiram a fase adulta e os adultos se reproduziram, o que nos permite sugerir que o algodoeiro seja uma planta nutricionalmente adequada para o desenvolvimento e reprodução de E. meditabunda, permitindo a manutenção do inseto em campo após a colheita da soja.  RESUMO El chinche Edessa meditabunda (Fabricius (Hemiptera: Pentatomidae al final del ciclo de la soja emigra al cultivo de algodón y utiliza esta planta como un huésped alternativo. Con el objetivo de conocer el potencial de esta especie como una plaga en los algodonales y ayudar en la toma de decisiones con respecto al manejo de este insecto, se planteó la hipótesis en este estudio que el algodón y nutritiva, adecuada para la reproducción y el desarrollo de E. meditabunda. Los tratamientos fueron:1 las hojas y el fruto del algodón 2 dieta estándar recomendada para la cría de pentatomidos fitófagos en el

  20. Evolution of insect pest and disease resistant, high-yielding and improved quality varieties of cotton by use of ionizing radiation. Part of a coordinated programme on the use of induced mutations for disease resistance in crop plants

    International Nuclear Information System (INIS)

    Vasti, S.M.

    1981-06-01

    Disease resistant, high yielding and higher quality cotton varieties were developed. 42 interspecific hybrid progenies of earlier crosses between Gossypium barbadense and Gossypium tomentosum or Gossypium barbadense and Gossypium hirsutum were included. Out of these, 22 progenies in F 3 generation were irradiated by gamma radiation doses of 20 and 25 kR. A list is given of interspecific hybrid progenies, as are the lists of boll rot susceptible and resistant plants in the irradiated and non-irradiated populations and/or successful crosses made between 1977 and 1978

  1. Linkage and association mapping reveals the genetic basis of brown fibre (Gossypium hirsutum).

    Science.gov (United States)

    Wen, Tianwang; Wu, Mi; Shen, Chao; Gao, Bin; Zhu, De; Zhang, Xianlong; You, Chunyuan; Lin, Zhongxu

    2018-02-24

    Brown fibre cotton is an environmental-friendly resource that plays a key role in the textile industry. However, the fibre quality and yield of natural brown cotton are poor, and fundamental research on brown cotton is relatively scarce. To understand the genetic basis of brown fibre cotton, we constructed linkage and association populations to systematically examine brown fibre accessions. We fine-mapped the brown fibre region, Lc 1 , and dissected it into 2 loci, qBF-A07-1 and qBF-A07-2. The qBF-A07-1 locus mediates the initiation of brown fibre production, whereas the shade of the brown fibre is affected by the interaction between qBF-A07-1 and qBF-A07-2. Gh_A07G2341 and Gh_A07G0100 were identified as candidate genes for qBF-A07-1 and qBF-A07-2, respectively. Haploid analysis of the signals significantly associated with these two loci showed that most tetraploid modern brown cotton accessions exhibit the introgression signature of Gossypium barbadense. We identified 10 quantitative trait loci (QTLs) for fibre yield and 19 QTLs for fibre quality through a genome-wide association study (GWAS) and found that qBF-A07-2 negatively affects fibre yield and quality through an epistatic interaction with qBF-A07-1. This study sheds light on the genetics of fibre colour and lint-related traits in brown fibre cotton, which will guide the elite cultivars breeding of brown fibre cotton. © 2018 The Authors. Plant Biotechnology Journal published by Society for Experimental Biology and The Association of Applied Biologists and John Wiley & Sons Ltd.

  2. Cotton (Gossypium hirsutum L.).

    Science.gov (United States)

    Rathore, Keerti S; Campbell, LeAnne M; Sherwood, Shanna; Nunes, Eugenia

    2015-01-01

    Cotton continues to be a crop of great economic importance in many developing and some developed countries. Cotton plants expressing the Bt gene to deter some of the major pests have been enthusiastically and widely accepted by the farmers in three of the major producing countries, i.e., China, India, and the USA. Considering the constraints related to its production and the wide variety of products derived from the cotton plant, it offers several target traits that can be improved through genetic engineering. Thus, there is a great need to accelerate the application of biotechnological tools for cotton improvement. This requires a simple, yet robust gene delivery/transformant recovery system. Recently, a protocol, involving large-scale, mechanical isolation of embryonic axes from germinating cottonseeds followed by direct transformation of the meristematic cells has been developed by an industrial laboratory. However, complexity of the mechanical device and the patent restrictions are likely to keep this method out of reach of most academic laboratories. In this chapter, we describe the method developed in our laboratory that has undergone further refinements and involves Agrobacterium-mediated transformation of cotton cells, selection of stable transgenic callus lines, and recovery of plants via somatic embryogenesis.

  3. Genome-wide identification of CBL family and expression analysis of CBLs in response to potassium deficiency in cotton

    Directory of Open Access Journals (Sweden)

    Tingting Lu

    2017-08-01

    Full Text Available Calcineurin B-like (CBL proteins, as calcium sensors, play pivotal roles in plant responses to diverse abiotic stresses and in growth and development through interaction with CBL-interacting protein kinases (CIPKs. However, knowledge about functions and evolution of CBLs in Gossypium plants is scarce. Here, we conducted a genome-wide survey and identified 13, 13 and 22 CBL genes in the progenitor diploid Gossypium arboreum and Gossypium raimondii, and the cultivated allotetraploid Gossypium hirsutum, respectively. Analysis of physical properties, chromosomal locations, conserved domains and phylogeny indicated rather conserved nature of CBLs among the three Gossypium species. Moreover, these CBLs have closer genetic evolutionary relationship with the CBLs from cocoa than with those from other plants. Most CBL genes underwent evolution under purifying selection in the three Gossypium plants. Additionally, nearly all G. hirsutum CBL (GhCBL genes were expressed in the root, stem, leaf, flower and fiber. Many GhCBLs were preferentially expressed in the flower while several GhCBLs were mainly expressed in roots. Expression patterns of GhCBL genes in response to potassium deficiency were also studied. The expression of most GhCBLs were moderately induced in roots after treatments with low-potassium stress. Yeast two-hybrid experiments indicated that GhCBL1-2, GhCBL1-3, GhCBL4-4, GhCBL8, GhCBL9 and GhCBL10-3 interacted with GhCIPK23, respectively. Our results provided a comprehensive view of the CBLs and valuable information for researchers to further investigate the roles and functional mechanisms of the CBLs in Gossypium.

  4. Comportamento de progênies oriundas de raças primitivas de algodão herbáceo frente ao ataque do bicudo Behavior of lines from cotton primitive race stocks to attack of the boll weevil

    Directory of Open Access Journals (Sweden)

    Francisco José Correia Farias

    1999-12-01

    Full Text Available Com o objetivo de obter linhagens resistentes ao bicudo-do-algodoeiro (Anthonomus grandis Boheman, a Embrapa-Centro Nacional de Pesquisa de Algodão vem testando progênies oriundas de raças primitivas de algodoeiro herbáceo (Gossypium hirsutum L. originárias do México e da América Central, que apresentam níveis aceitáveis de resistência ao bicudo. Em 1991 e 1992, as progênies em BC1F5 e BC1F6 oriundas das linhagens Texas 277, Texas 326 e Texas 1180, Texas 297, Texas 339, Texas 766 e Texas 1134, foram avaliadas com relação à resistência ao bicudo. O delineamento experimental utilizado foi o de blocos ao acaso, com seis repetições. A unidade experimental foi constituída por duas fileiras de 5 m, sob um espaçamento de 0,75 m x 0,20 m. As parcelas foram infestadas com adultos do bicudo recém-emergidos, a uma taxa de 10.000 adultos/ha. Aos seis dias após a liberação dos adultos, as parcelas foram pulverizadas com Cipermethrim, sendo realizadas em intervalos semanais. Foram procedidas cinco avaliações através da coleta de 33 botões florais ao acaso, por parcela. Os maiores níveis de resistência ao bicudo foram obtidos pelas progênies Texas 326-95-1, Texas 277-87-5, Texas 1180-99-2, Texas 297 e Texas 339, com redução de ataque de 44,0, 41,2, 32,0, 40,4 e 36,4%, respectivamente, em relação à testemunha CNPA 6H.The goal of the boll weevil (Anthonomus grandis Boheman resistance program of Embrapa-Centro Nacional de Pesquisa de Algodão is to obtain cultivars that give 80% suppression when compared to commercial cultivars. The primitive cottons (Gossypium hirsutum L. from Mexico and Central America have been known to show measurable levels of resistance to the boll weevil. In 1991 and 1992, the lines in BC1F5 and BC1F6 from Texas 277, Texas 326, Texas 1180, Texas 297, Texas 339, Texas 766 and Texas 1134 were evaluated to boll weevil resistance. The experiment was carried out at Campina Grande, PB, Brazil. The trial

  5. Irradiation effect on F2 segregation for earliness, productiveness and fibre length in Gossypium hirsutum x G. barbadense hybridization

    International Nuclear Information System (INIS)

    Stoilova, A.

    1984-01-01

    Two hybrid combinations between cv. Chirpan-433 (of the species G. hirsutum) and C-6030 and 5904-I (of the species G. barbadense) were studied. F 0 seeds were irradiated by 30 krad. Non-irradiated seeds were used as control. It was found that hybrid irradiation affected segregation of the characters in a different way. It retarded ripening, the negative effect being higher in the combination Chirpan-433x5904-N. In respect to productiveness and fibre lenght hybrid irradiation led to positive changes in the form-producing process. Hibrids of the combination Chirpan-433X5904-I responded more favourably to irradiation in respect to these two characters. Hybrid irradiation altered the type of segregation and created suplementary pool of forms with desired characters, increasing the possibilities of interspecific hybridization to combine the valuable economic characters of both species

  6. Cottonseed oil and yield assessment via economic heterosis and ...

    African Journals Online (AJOL)

    user

    2010-11-01

    Nov 1, 2010 ... ISSN 1684–5315 ©2010 Academic Journals. Full Length ... Key words: Hybrid vigor, inbreeding depression, cottonseed traits, cottonseed oil, Gossypium hirsutum. ... in yield and superior performance than well-adapted.

  7. AcEST: DK949197 [AcEST

    Lifescience Database Archive (English)

    Full Text Available GOSHI Catalase isozyme 2 OS=Gossypium hirsutum G... 432 e-121 sp|O24339|CATA_SOLAP Catalase OS=Soldanella al...t: 181 ESLHMFTFLFDDIGVPQDYRHMDGSGVHTYTLINKAGKSHYVKFH 225 >sp|O24339|CATA_SOLAP Catalase OS=Soldanella alpina

  8. Controle de plantas daninhas com cyanazine aplicado em mistura com outros herbicidas, na cultura do algodão (Gossypium hirsutum L. Weed control in cotton (Gossypium hirsutum L. with cyanazine and other herbicides

    Directory of Open Access Journals (Sweden)

    Julio Pedro Laca-Buendia

    1985-12-01

    Full Text Available Com a finalidade de estudar a mistura de tanque mais eficiente com cyanazine em aplicação de pré-emergência na cultura algodoeira (Gossypium hirsutum L. , foram estudados os seguintes tratamentos: cyanazine + diuron nas doses de 0,8 + 0,8 kg i.a/ha e 1,0 + 1,0 kg i.a/ha; cyanazine+ oryzalin , nas do sés de 1,2 + 0,8 kg i.a/ha e 1,6 + 1,2 kg i.a/h a; cyanazyne + metol a chlor, nas doses de 1,4 + 2,0 kg i.a/ha e 1,75 + 2,52 kg i.a/ ha;cianazine na dose de 1,75 kg i.a /ha; oryzalin na dose de 1,12 kg i.a/ha; metol achlor na dose de 2,52 kg i.a /ha e diuron na dose de 1,6 kg i.a /ha. Para efeito de comparação, utilizou-se uma testemunha sem capina e outra com capina manual. Nenhum tratamento apresentou injúria para as plantas de algodão e não houve diferenças significativas para o "stand" inicial. Já no "stand" final, a testemunha sem capina apresentou o menor número de plantas, sendo que não houve diferenças significativas dos outros tratamentos com a testemunha capinada. Para o rendimento, a mistura cyanazine + metolachior em ambas as doses estudadas, não apresentaram diferenças significativas da testemunha capinada. Quanto à altura da planta, peso de 100 sementes, porcentagem e índice de fibras não houve diferenças significativas entre os tratamentos estudados, somente o peso do capulho foi afetado pelo oryzalin. Pela avaliação visual (EWRC 1 a 9*, os herbicidas apres entaram um controle satisfatório somente até os 30 dias após aplicação, sendo que a mistura cyanazine + metolachlor foi efici ente quanto a testemunha capinada. No controle da Portulaca oleracea , a mistura cyanazine + oryzalin na maior dose e oryzalin apresentaram 71,4% de controle ate os 30 dias e 79,4% e 82,4%, respectivamente, até 45 dias da aplicação. Para Amaranthus sp., à exceção da cyanazine e cyanazine + diuron nas doses menores, não apresentaram nenhum controle, sendo que os outros herbicidas controlaram com eficiência superior a 70

  9. Exp2 polymorphisms associated with variation for fiber quality properties in cotton (Gossypium spp.

    Directory of Open Access Journals (Sweden)

    Daohua He

    2014-10-01

    Full Text Available Plant expansins are a group of extracellular proteins thought to affect the quality of cotton fibers. Previous expression profile analysis revealed that six Expansin A genes are present in cotton, of which two (GhExp1 and GhExp2 produce transcripts that are specific to the developing cotton fiber. To identify the phenotypic function of Exp2, and to determine whether nucleotide variation among alleles of Exp2 affects fiber quality, candidate gene association mapping was conducted. Gene-specific primers were designed to amplify the Exp2 gene. By amplicon sequencing, the nucleotide diversity of Exp2 was investigated across 92 accessions (including 7 Gossypium arboreum, 74 Gossypium hirsutum, and 11 Gossypium barbadense accessions with different fiber qualities. Twenty-six SNPs and seven InDels including 14 from the coding region of Exp2 were detected, forming twelve distinct haplotypes in the cotton collection. Among the 14 SNPs in the coding region, five were missense mutations and nine were synonymous nucleotide changes. The average SNP/InDel per nucleotide ratio was 2.61% (one SNP per 39 bp, with 1.81 and 3.87% occurring in coding and non-coding regions, respectively. Nucleotide and haplotype diversity across the entire Exp2 region was 0.00603 (π and 0.844, respectively, and diversity in non-coding regions was higher than that in coding regions. For linkage disequilibrium (LD, the mean r2 value for all polymorphism loci pairs was 0.48, and LD did not decay over 748 bp. Based on 132 simple sequence repeat (SSR loci evenly covering 26 chromosomes, the population structure was estimated, and the accessions were divided into seven groups that agreed well with their genomic origin and evolutionary history. A general linear model was used to calculate the Exp2-wide diversity–trait associations of 5 fiber quality traits, considering population structure (Q. Four SNPs in Exp2 were associated with at least one of the fiber quality traits, but not with

  10. Vermelhão do algodoeiro Cotton "vermelhão" or anthocyanosis

    Directory of Open Access Journals (Sweden)

    A. S. Costa

    1954-01-01

    Full Text Available Uma moléstia do algodoeiro associada à infestação pelo pulgão Aphis gossypii, é descrita. É proposto que o nome vermelhão fique restrito a essa moléstia e que quando esta designação for usada em associação com outras moléstias, seja qualificada em seu emprêgo. São apontadas algumas diferenças que permitem distinguir o vermelhão do afídio de outras condições em que a coloração das fôlhas do algodoeiro é mais ou menos semelhante. Foi verificado que, quando afídios coletados de plantas com vermelhão eram alimentados em algodoeiros novos por 48 horas apenas, os sintomas da moléstia se manifestavam dentro de 12 a 30 dias. Infestações com um afídio por planta foram suficientes para reproduzir a moléstia em alguns casos ; com cinco afídios por planta conseguiu-se reproduzir a moléstia com maior freqüência ; com 25 afídios, em praticamente todos os casos. Insetos da mesma espécie, coletados de plantas de pepino, não produziram o vermelhão quando colocados sobre algodoeiros. Reprodução de vermelhão foi obtida por enxertia, passando os sintomas a se manifestar nos cavalos ; houve também perpetuação dos sintomas por enxertia em terceira reprodução vegetativa. A evidência obtida nos ensaios de reprodução da moléstia é discutida, sendo apontado que tudo indica ser um vírus a causa primária da moléstia e não toxina do inseto ou deficiência de elementos. Outras hipóteses alternativas são mencionadas.A disease associated with the infestation of cotton plants by the cotton or melon aphid, Aphis gossypii Glov. is described under the name of "vermelhão" or anthocyanosis. Symptoms of the disease resemble those resulting from magnesium deficiency. Aphids collected from diseased plants reproduced the disease when fed on cotton seedlings for 48 hours. Symptoms usually appeared from 12 to 30 days after inoculation, as chlorotic areas or spots that later turned reddish or purplish under strong light conditions

  11. Spectral discrimination of two pigweeds from cotton with different leaf colors

    Science.gov (United States)

    To implement strategies to control Palmer amaranth (Amaranthus palmeri S. Wats.) and redroot pigweed (Amaranthus retroflexus L.) infestations in cotton (Gossypium hirsutum L.) production systems, managers need effective techniques to identify the weeds. Leaf light reflectance measurements have shown...

  12. Responses of reniform nematode and browntop millet to tillage, cover crop, and herbicides in cotton

    Science.gov (United States)

    Cropping practices that reduce competition from reniform nematode (Rotylenchulus reniformis) and browntop millet (Urochlora ramosum) may help minimize losses in cotton (Gossypium hirsutum). The impacts of tillage, rye cover crop, and preemergence and postemergence herbicides on cotton yields, renifo...

  13. Efeito de inseticidas em insetos predadores em culturas de algodão Effect of insecticides on predator insects associated with cotton

    Directory of Open Access Journals (Sweden)

    JOSÉ JANDUI SOARES

    2000-09-01

    Full Text Available Com o objetivo de verificar o efeito de inseticidas em insetos predadores em cultura de algodão (Gossypium hirsutum L., instalaram-se, em 1993-1994, dois experimentos, um no campo, e outro, em laboratório. No experimento realizado no campo, os tratamentos foram: Fipronil 200 SC (75 g/ha de i.a.; Fipronil 800 WDG (64, 80 e 100 g/ha de i.a.; Endosulfan 350 CE (700 g/ha de i.a.; e testemunha. Em laboratório, além das formulações à base de Fipronil foi utilizado o Paration metílico 600 CE (480 g/ha de i.a.. Fipronil foi seletivo para os artrópodes predadores (Scymnus sp., Geocoris ventralis, Cycloneda sanguinea e Doru lineare no campo, e a Cycloneda sanguinea (L., em laboratório, e pode ser recomendado em programas de manejo integrado de pragas na cultura do algodoeiro para o controle de Alabama argillacea (Rueb., e Anthonomus grandis Boh. Endosulfan foi seletivo em relação a Scymnus sp., Geocoris ventralis Thomazini e Doru lineare (Eschs no campo, com uma redução dos insetos inferior a 30%, e o Paration metílico não foi seletivo para C. sanguinea em laboratório.To assess the selectivity of insecticides to predator insects in cotton (Gossypium hirsutum L. crops two, trials, 1993-1994, under field and laboratory conditions were conducted. Under field conditions, the following treatments were compared: Fipronil 200 CS (75 g/ha of a.i.; Fipronil 800 WDG (64, 80 and 100 g/ha of a.i.; Endosulfan 350 EC (700 g/ha of a.i.; and control. Under laboratory conditions, in addition to Friponil, Methyl parathion 600 EC 480 g/ha of a.i. was also tested. Fipronil was selective to predators (Scymnus sp., Geocoris ventralis, Cycloneda sanguinea and Doru lineare under field condition and to Cycloneda sanguinea (L. under laboratory conditions. This product can be used in integrated pest management programs in cotton crops to control Alabama argillacea (Rueb., and Anthonomus grandis Boh. Endosulfan was selective to Scymnus sp., Geocoris ventralis

  14. Impacto do algodoeiro Bt na dinâmica populacional do pulgão-do-algodoeiro em casa de vegetação Impact of Bt cotton on the population dynamics of the cotton aphid in greenhouse

    Directory of Open Access Journals (Sweden)

    Edison Ryoiti Sujii

    2008-10-01

    Full Text Available O objetivo deste trabalho foi desenvolver um protocolo experimental para avaliar o impacto do algodoeiro Bt na bionomia e na escolha de plantas para colonização pelo pulgão-do-algodoeiro (Aphis gossypii. A bionomia do pulgão foi avaliada em casa de vegetação com insetos criados em gaiolas individuais com plantas de algodão Bt, da variedade DP 404 BG (Bollgard, ou sua isolinha não transformada DP 4049. Gaiolas contendo vasos com plantas de algodoeiro Bt e não-Bt foram usadas como arena de escolha, para a avaliação de preferência de adultos alados. O período pré-reprodutivo e reprodutivo, a longevidade, a curva de sobrevivência, a produção de prole total e diária por fêmea e a curva acumulada de produção de prole da população não apresentaram diferenças significativas. Não foi observada diferença na escolha de plantas para colonização por indivíduos alados, o que indica taxas equivalentes de colonização nas populações iniciais. O algodoeiro Bt não afeta a dinâmica populacional de A. gossypii e não aumenta seu potencial de risco como praga.The objective of this work was to develop an experimental protocol to assess the impact of Bt cotton on bionomics and on plant choice for Aphis gossypii colonization. The bionomics of the cotton aphid was assessed in greenhouse with insects reared in individual cages containing Bt cotton plants of the variety DP 404 BG (Bollgard or its nontransformed isoline DP 4049. Cages with Bt cotton and non-Bt cotton were used as choosing arena for evaluation of winged adults preference. There was no significant difference for pre-reproduction period (immature phase, reproduction period, longevity, survivorship curve total and daily production of offspring by female, and curve of accumulated production of offspring by the population. There was no preference of colonization for any plant by winged adults, which indicates equivalent rates of colonization of the initial populations. Bt

  15. (Gossypium barbadense) germplasm resources

    Indian Academy of Sciences (India)

    Navya

    2017-03-28

    Mar 28, 2017 ... Running title: Marker-trait associations in sea-island cotton ... In this study, Gossypium barbadense germplasm accessions with ... origins (n = 123) were used to perform association analysis of fiber traits with 120 polymorphic simple ... Because fiber yield and quality traits are complex quantitative traits, ...

  16. Regulation of auxin on secondary cell wall cellulose biosynthesis in developing cotton fibers

    Science.gov (United States)

    Cotton (Gossypium hirsutum L.) fibers are unicellular trichomes that differentiate from epidermal cells of developing cotton ovules. Mature fibers exhibit thickened secondary walls composed of nearly pure cellulose. Cotton fiber development is divided into four overlapping phases, 1) initiation sta...

  17. Reproduction and pathogenicity of endemic populations of Rotylenchulus reniformis on cotton

    Science.gov (United States)

    The reniform nematode (Rotylenchulus reniformis) is the predominant parasitic nematode of upland cotton (Gossypium hirsutum) in the southern United States. Little is known about variability in geographic isolates of reniform nematode. In order to evaluate the comparative reproduction and pathogenici...

  18. Arabidopsis CDS blastp result: AK242601 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK242601 J090014G03 At4g24000.1 68417.m03449 cellulose synthase family protein similar to cellulose... synthase from Gossypium hirsutum [gi:1706956], cellulose synthase-5 from Zea mays [gi:9622882] 2e-27 ...

  19. Arabidopsis CDS blastp result: AK242601 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK242601 J090014G03 At4g24000.1 68417.m03449 cellulose synthase family protein similar to cellulose... synthase from Gossypium hirsutum [gi:1706956], cellulose synthase-5 from Zea mays [gi:9622882] 5e-27 ...

  20. Arabidopsis CDS blastp result: AK242585 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK242585 J090010M20 At4g24000.1 68417.m03449 cellulose synthase family protein similar to cellulose... synthase from Gossypium hirsutum [gi:1706956], cellulose synthase-5 from Zea mays [gi:9622882] 1e-123 ...

  1. Arabidopsis CDS blastp result: AK242890 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK242890 J090079L19 At4g24000.1 68417.m03449 cellulose synthase family protein similar to cellulose... synthase from Gossypium hirsutum [gi:1706956], cellulose synthase-5 from Zea mays [gi:9622882] 4e-48 ...

  2. Arabidopsis CDS blastp result: AK242601 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK242601 J090014G03 At4g24000.1 68417.m03449 cellulose synthase family protein similar to cellulose... synthase from Gossypium hirsutum [gi:1706956], cellulose synthase-5 from Zea mays [gi:9622882] 4e-25 ...

  3. AcEST: DK949890 [AcEST

    Lifescience Database Archive (English)

    Full Text Available _GOSHI Catalase isozyme 1 OS=Gossypium hirsutum G... 401 e-111 sp|O24339|CATA_SOLAP Catalase OS=Soldanella a...8 EGFMNFMHRDEEINYFPSRYDPVRHAEMFPIPPAVCT 414 >sp|O24339|CATA_SOLAP Catalase OS=Soldanella alpina PE=2 SV=1 Le

  4. Earthworm populations are affected from Long-Term Crop Sequences and Bio-Covers under No-Tillage

    Science.gov (United States)

    Earthworms are crucial for improving soil biophysical properties in cropping systems. Consequently, effects of cropping rotation and bio-covers were assessed on earthworm populations under no-tillage sites. Main effects of 6 different cropping sequences [corn (Zea mays), cotton (Gossypium hirsutum),...

  5. Espécies vegetais para cobertura do solo: influência sobre plantas daninhas e a produtividade do algodoeiro em sistema plantio direto

    Directory of Open Access Journals (Sweden)

    Alexandre Cunha de Barcellos Ferreira

    2010-12-01

    Full Text Available Este trabalho objetivou avaliar a produção, a persistência e os efeitos de coberturas vegetais sobre as plantas daninhas e a produtividade do algodoeiro em sistema plantio direto. Os tratamentos consistiram das espécies de cobertura: milheto (Pennisetum glaucum (L. R. Brown, Brachiaria ruziziensis Germain & Evrard, sorgo forrageiro (Sorghum bicolor L. Moench, capim-pé-de-galinha (Eleusine coracana L. Gaerth, Crotalaria juncea L., Crotalaria spectabilis Roth, aveia-preta (Avena strigosa Schreb., nabo forrageiro (Raphanus sativus L., P. glaucum + C. juncea, P. glaucum + C. spectabilis, B. ruziziensis + C. juncea, B. ruziziensis + C. spectabilis, S. bicolor + C. juncea, S. bicolor + C. spectabilis, E. coracana + C. juncea, E. coracana + C. spectabilis, A. strigosa + R. sativus, P. glaucum + R. sativus e pousio. As espécies foram semeadas no final do verão, após a colheita de soja, e o algodoeiro BRS 269-Buriti, nove meses após. O delineamento experimental foi em blocos ao acaso, com quatro repetições. As espécies B. ruziziensis, B. ruziziensis + C. juncea, B. ruziziensis + C. spectabilis e P. glaucum + R. sativus produziram mais de 6,8 t ha-1 de biomassa seca. A palhada produzida pela B. ruziziensis garantiu boa cobertura do solo durante o ciclo do algodoeiro. A biomassa seca de B. ruziziensis, B. ruziziensis + C. juncea e B. ruziziensis + C. spectabilis reduziu a infestação de plantas daninhas até a época de semeadura do algodão e durante os estádios iniciais de seu desenvolvimento. Palhas de R. sativus e A. strigosa, solteiras e consorciadas, interferiram negativamente na produtividade do algodoeiro.

  6. Coupling of MIC-3 overexpression with the chromosomes 11 and 14 root-knot nematode (RKN) (Meloidogyne incognita) resistance QTLs provides insights into the regulation of the RKN resistance response in Upland cotton (Gossypium hirsutum).

    Science.gov (United States)

    Wubben, Martin J; Callahan, Franklin E; Jenkins, Johnie N; Deng, Dewayne D

    2016-09-01

    Genetic analysis of MIC-3 transgene with RKN resistance QTLs provides insight into the resistance regulatory mechanism and provides a framework for testing additional hypotheses. Resistance to root-knot nematode (RKN) (Meloidogyne incognita) in Upland cotton (Gossypium hirsutum) is mediated by two major quantitative trait loci (QTL) located on chromosomes 11 and 14. The MIC-3 (Meloidogyne Induced Cotton3) protein accumulates specifically within the immature galls of RKN-resistant plants that possess these QTLs. Recently, we showed that MIC-3 overexpression in an RKN-susceptible cotton genotype suppressed RKN egg production but not RKN-induced root galling. In this study, the MIC-3 overexpression construct T-DNA in the single-copy transgenic line '14-7-1' was converted into a codominant molecular marker that allowed the marker assisted selection of F2:3 cotton lines, derived from a cross between 14-7-1 and M-240 RNR, having all possible combinations of the chromosomes 11 and 14 QTLs with and without the MIC-3 overexpression construct. Root-knot nematode reproduction (eggs g(-1) root) and severity of RKN-induced root galling were assessed in these lines. We discovered that the addition of MIC-3 overexpression suppressed RKN reproduction in lines lacking both resistance QTLs and in lines having only the chromosome 14 QTL, suggesting an additive effect of the MIC-3 construct with this QTL. In contrast, MIC-3 overexpression did not improve resistance in lines having the single chromosome 11 QTL or in lines having both resistance QTLs, suggesting an epistatic interaction between the chromosome 11 QTL and the MIC-3 construct. Overexpression of MIC-3 did not affect the severity of RKN-induced root galling regardless of QTL genotype. These data provide new insights into the relative order of action of the chromosomes 11 and 14 QTLs and their potential roles in regulating MIC-3 expression as part of the RKN resistance response.

  7. Methylation sensitive amplified polymorphism (MSAP) reveals that ...

    African Journals Online (AJOL)

    ajl yemi

    2011-12-19

    Dec 19, 2011 ... Key words: Salt stress, alkali stress, Gossypium hirsutum L., DNA methylation, methylation sensitive amplified polymorphism (MSAP). INTRODUCTION. DNA methylation is one of the key epigenetic mecha- nisms among eukaryotes that can modulate gene expression without the changes of DNA sequence.

  8. Crop response to biochar under differing irrigation levels in the southeastern USA

    Science.gov (United States)

    Application of biochar to soils is hypothesized to increase crop yield. Crop productivity impacts of biochar application in Southeastern cropping systems consisting of peanut (Arachis hypogaea L.), corn (Zea mays L.), and cotton (Gossypium hirsutum L.) produced under varying rates of irrigation have...

  9. Detecting cotton boll rot with an electronic nose

    Science.gov (United States)

    South Carolina Boll Rot is an emerging disease of cotton, Gossypium hirsutum L., caused by the opportunistic bacteria, Pantoea agglomerans (Ewing and Fife). Unlike typical fungal diseases, bolls infected with P. agglomerans continue to appear normal externally, complicating early and rapid detectio...

  10. Airborne multispectral detection of regrowth cotton fields

    Science.gov (United States)

    Regrowth of cotton, Gossypium hirsutum L., can provide boll weevils, Anthonomus grandis Boheman, with an extended opportunity to feed and reproduce beyond the production season. Effective methods for timely areawide detection of these potential host plants are critically needed to achieve eradicati...

  11. Morphometrics of the Southern Green Stink Bug [Nezara viridula (L.) (Hemiptera: Pentatomidae)] Stylet Bundle

    Science.gov (United States)

    The southern green stink bug, Nezara viridula (L.) (Hemiptera: Pentatomidae), is a cosmopolitan pest of high-value cash crops, including cotton (Gossypium hirsutum L.; Malvales: Malvaceae). The pest can ingest and transmit disease-causing bacterial and fungal pathogens of cotton. We hypothesized t...

  12. Cotton Flowers: Pollen and Petal Humidity Sensitivities Determine Reproductive Competitiveness in Diverse Environments

    Science.gov (United States)

    Genetic diversity in reproductive abiotic stress tolerance has been reported for cotton [Gossypium hirsutum (L.)] based upon the percentage of anther dehiscence of mature pollen in adverse environments. This study investigated the abiotic stress tolerance of mature pollen and identified genetic vari...

  13. Relationship between NDVI at early bloom and yield in germplasm evaluation trials

    Science.gov (United States)

    The use of high-throughput phenotyping (HTP) equipment is expanding as it offers the potential to increase the efficiency of making selections in cotton (Gossypium hirsutum L.) improvement programs. Measurements often being collected on HTP field equipment include normalized difference vegetative in...

  14. Assessing the Economic Impact of inversion tillage, cover crops, and herbicide regimes in palmer amaranth (Amaranthus palmeri) infested cotton

    Science.gov (United States)

    Cotton (Gossypium hirsutum L.) producers in Alabama and across the Cotton Belt are faced with a rapidly expanding problem that decreases yields and increases production costs: herbicide-resistant weeds. Producers are increasingly relying on production methods that raise production costs, such as add...

  15. Submission to GenBank of the Plasma membrane intrinsic protein (PIP) Subfamily in Cotton – GenBank Accession No. GU998827-GU998830 and GenBank Accession TPA;inferential No. BK007045-BK007052

    Science.gov (United States)

    The plasma membrane intrinsic proteins (PIP) are one of the five aquaporin protein subfamilies. Aquaporin proteins are known to facilitate water transport through biological membranes. In order to identify NIP aquaporin gene candidates in cotton (Gossypium hirsutum L.), in silico and molecular clon...

  16. AcEST: DK952437 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 04 sp|P30567|CATA2_GOSHI Catalase isozyme 2 OS=Gossypium hirsutum G... 376 e-104 sp|O24339|CATA_SOLAP Catala...ALKPNPKSHIQENWRILDFFSHHP 180 Query: 619 ESMHMFSW 642 ES+HMF++ Sbjct: 181 ESLHMFTF 188 >sp|O24339|CATA_SOLAP

  17. Concentração eficiente e econômica de caulim para a proteção de algodoeiro contra o bicudo

    Directory of Open Access Journals (Sweden)

    Ana Lígia Aureliano de Lima e Silva

    2015-09-01

    Full Text Available Resumo:O objetivo deste trabalho foi determinar a concentração de caulim mais eficiente e econômica para a proteção de algodoeiro contra os danos causados pelo bicudo-do-algodoeiro (Anthonomus grandis. Utilizou-se o delineamento experimental de blocos ao acaso, com cinco tratamentos de pulverizações com caulim nas concentrações: 20, 40, 60, 80 e 100 g L-1. Determinaram-se os seguintes parâmetros: percentagem de botões florais com orifícios de oviposição por fêmeas do bicudo; resíduos de caulim depositados sobre as folhas e as brácteas do algodoeiro; média da produção; e receita líquida do algodão, por hectare, a partir da pesagem da pluma de algodão com caroço. As percentagens de botões florais com orifício de oviposição variaram de 13,6 a 30,8%; o resíduo médio de caulim depositado nas folhas, de 0,0010 a 0,0034 mg mm-2, e nas brácteas, de 0,0010 a 0,0034 mg mm-2; a produção variou de 348,1 a 717,8 kg ha-1; e a receita líquida de algodão de R$ 1.033,88 a R$ 2.098,86 por hectare. As concentrações de caulim mais eficientes para a proteção de algodoeiro contra o bicudo são as de 60, 80 e 100 g L-1; no entanto, a de 60 g L-1foi a mais econômica.

  18. Insecticide use and practices among cotton farmers in northern ...

    African Journals Online (AJOL)

    Cotton (Gossypium hirsutum L.) is an important cash crop in Uganda. Insecticide application practices among cotton growers in northern Uganda were examined to determine the pests targeted and the compliance of control measures with the standards recommended by the Uganda's Cotton Development Organization ...

  19. Linkage disequilibrium and association mapping of drought ...

    African Journals Online (AJOL)

    Drought stress is a major abiotic stress that limits crop production. Molecular association mapping techniques through linkage disequilibrium (LD) can be effectively used to tag genomic regions involved in drought stress tolerance. With the association mapping approach, 90 genotypes of cotton Gossypium hirsutum, from ...

  20. Genotypic and environmental effects on cottonseed oil, nitrogen, and gossypol contents in eighteen years Regional High Quality tests

    Science.gov (United States)

    Determination of environmental influence on seed traits is critical for genetic improvement of seed quality in Upland cotton (Gossypium hirsutum L.). The objective of this study was to analyze the relative contribution of environment and genotype (G) for seed oil, nitrogen (N), and gossypol content...

  1. Biological control of cotton aphid (Aphis gossypii Glover) in cotton (inter)cropping systems in China : a simulation study

    NARCIS (Netherlands)

    Xia, J.

    1997-01-01

    Cotton aphid ( Aphis gossypii Glover) is the key insect pest of seedling cotton ( Gossypium hirsutum L. ) in China, particularly in the North China cotton region. The resulting annual losses amount to 10-15% of the attainable yield. Sole reliance on

  2. Evaluation of various substrates and supplements for biological ...

    African Journals Online (AJOL)

    An experiment was conducted to determine the effects of different substrates namely wheat straw (Triticum aestivum), maize stover (Zea mays L), thatch grass (Hyparrhenia filipendula) and oil/protein rich supplements (maize bran, cottonseed hull [Gossypium hirsutum]) on biological efficiency of two oyster mushroom ...

  3. Engineered disease resistance in cotton using RNA-interference to knock down cotton leaf curl kokhran virus-Burewala and cotton leaf curl Multan betasatellite

    Science.gov (United States)

    Cotton Leaf Curl virus Disease (CLCuD) has caused enormous losses in cotton (Gossypium hirsutum) production in Pakistan. RNA interference (RNAi) is an emerging technique that could knock out CLCuD by targeting different regions of the pathogen genome that are important for replication, transcription...

  4. Irrigation strategies that use cutout for optimum boll maturation and yield where growing season duration is limited

    Science.gov (United States)

    Irrigation water availability is decreasing due to declining water sources and greater competition. Many producers must now comply with annual pumping restrictions that may limit overall productivity of crops like corn (Zea mays L.). Cotton [Gossypium hirsutum (L.)] water demand is less than corn, b...

  5. Dicty_cDB: Contig-U09533-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 33308 |pid:none) Anabas testudineus cyclin-dependen... 253 1e-65 BC061617_1( BC06..... 253 1e-65 EU006765_1( EU006765 |pid:none) Gossypium hirsutum cultivar des119... 253 1e-65 AY533308_1( AY5

  6. Application of mixed models for the assessment genotype and ...

    African Journals Online (AJOL)

    Application of mixed models for the assessment genotype and environment interactions in cotton ( Gossypium hirsutum ) cultivars in Mozambique. ... The cultivars ISA 205, STAM 42 and REMU 40 showed superior productivity when they were selected by the Harmonic Mean of Genotypic Values (HMGV) criterion in relation ...

  7. Yield response and economics of shallow subsurface drip irrigation systems

    Science.gov (United States)

    Field tests were conducted using shallow subsurface drip irrigation (S3DI) on cotton (Gossypium hirsutum, L.), corn (Zea mays, L.), and peanut (Arachis hypogeae, L.) in rotation to investigate yield potential and economic sustainability of this irrigation system technique over a six year period. Dri...

  8. Coupling of MIC-3 overexpression with the chromosome 11 and 14 root-knot nematode (RKN) (Meloidogyne incognita) resistance QTLs provides insights into the regulation of the RKN resistance response in Upland cotton...

    Science.gov (United States)

    High levels of resistance to root-knot nematode (RKN) (Meloidogyne incognita) in Upland cotton (Gossypium hirsutum) is mediated by two major quantitative trait loci (QTL) located on chromosomes 11 and 14. We had previously determined that MIC-3 expression played a direct role in suppressing RKN egg...

  9. Development of DNA barcodes of genus Lygus Hahn (Hemiptera: Miridae)

    Science.gov (United States)

    The genus Lygus (Hemiptera: Miridae) is an important group of insects that contains 43 known species worldwide. Some species within this genus are important agricultural pests in North America. Annual economic impacts in cotton, Gossypium hirsutum L., from Lygus spp. due to yield losses and control ...

  10. Effect of pyramiding Bt and CpTI genes on resistance of cotton to Helicoverpa armigera (Lepidoptera: Noctuidae) under laboratory and field conditions

    NARCIS (Netherlands)

    Cui, J.J.; Luo, J.Y.; Werf, van der W.; Ma, Y.; Xia, J.Y.

    2011-01-01

    Transgenic cotton (Gossypium hirsutum L.) varieties, adapted to China, have been bred that express two genes for resistance to insects. the Cry1Ac gene from Bacillus thuringiensis (Berliner) (Bt), and a trypsin inhibitor gene from cowpea (CpTI). Effectiveness of the double gene modification in

  11. African Journal of Biotechnology - Vol 10, No 38 (2011)

    African Journals Online (AJOL)

    Lowering virus attack with improved yield and fiber quality in different cotton genotypes by early sown cotton (Gossypium hirsutum L.) EMAIL FREE FULL TEXT ... typhimurium in rainbow trout stored under aerobic, modified atmosphere and vacuum packed conditions · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT

  12. Long-term effects of conservation systems on productivity for the old rotation

    Science.gov (United States)

    Winter legumes in cotton (Gossypium hirsutum L.) production is not new to the Southeast. In 1896, the Old Rotation experiment at Auburn University was established to study the feasibility of producing cotton in crop rotations with winter legumes managed as a green manure crop. Throughout the experim...

  13. Effects of 1,1-Dimethylpiperidinium Chloride on the Pests and Allelochemicals of Cotton and Pecan.

    Science.gov (United States)

    P. A. Hedin; J. N. Jenkins; J. C. McCarty; J. E. Mulrooney; W. L. Parrott; A. Borazjani; C. H. Graves; T. H. Filer

    1984-01-01

    The growth regulator, PIX (mepiquat chloride - 1,1-dimethyl-piperdinium chloride), when applied to cotton (Gossypium hirsutum L.) and pecan (Carya illinoensis Koch), caused internode shortening. PIX did not elicit an increase in resistance in cotton to the tobacco budworm (Heliothis virescens (Fab.)], or in pecan...

  14. Sugar alcohols-induced oxidative metabolism in cotton callus culture

    African Journals Online (AJOL)

    Sugar alcohols (mannitol and sorbitol) may cause oxidative damage in plants if used in higher concentration. Our present experiment was undertaken to study physiological and metabolic responses in cotton (Gossypium hirsutum L.) callus against mannitol and sorbitol higher doses. Both markedly declined mean values of ...

  15. Inheritance of resistance to cotton blue disease Herança da resistência do algodoeiro à doença-azul

    Directory of Open Access Journals (Sweden)

    Osmério Pupim Junior

    2008-05-01

    Full Text Available The objective of this work was to determine the inheritance of cotton blue disease resistance by cotton plants. Populations derived from the CD 401 and Delta Opal resistant varieties were evaluated, through a greenhouse test with artificial inoculation by viruliferous aphids. Cotton blue disease resistance is conditioned by one dominant gene, both in CD 401 and Delta Opal varieties.O objetivo deste trabalho foi determinar a herança da resistência do algodoeiro à doença-azul. Populações derivadas das variedades resistentes CD 401 e Delta Opal foram avaliadas em casa de vegetação, por meio da inoculação de pulgões virulíferos. A resistência à doença-azul do algodoeiro é condicionada por um gene dominante, tanto em 'DC 401' quanto em 'Delta Opal'.

  16. Tobacco rattle virus (TRV) based silencing of cotton enoyl-CoA reductase (ECR) gene and the role of very long chain fatty acids in normal leaf development and resistance to wilt disease

    Science.gov (United States)

    A Tobacco rattle virus (TRV) based virus-induced gene silencing (VIGS) assay was employed as a reverse genetic approach to study gene function in cotton (Gossypium hirsutum). This approach was used to investigate the function of Enoyl-CoA reductase (GhECR) in pathogen defense. Amino acid sequence al...

  17. Molecular cloning, structural analysis and expression of a zinc ...

    African Journals Online (AJOL)

    The results of prokaryotic expression of ZnBP and overexpression of the ZnBP gene in A. thaliana improve our understanding of the function of this gene. Future studies should investigate the molecular mechanisms involved in gland morphogenesis in cotton. Key words: Gossypium hirsutum, pigment gland, zinc binding ...

  18. Crop yield response to increasing biochar rates

    Science.gov (United States)

    The benefit or detriment to crop yield from biochar application varies with biochar type/rate, soil, crop, or climate. The objective of this research was to identify yield response of cotton (Gossypium hirsutum L.), corn (Zea mayes L.), and peanut (Arachis hypogaea L.) to hardwood biochar applied at...

  19. African Journal of Biotechnology - Vol 12, No 33 (2013)

    African Journals Online (AJOL)

    An evaluation of some mutant cotton (Gossypium hirsutum L.) varieties from Azerbaijan in Southeast Anatolian region of Turkey · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. EFE Lale, Fatih Killi, Sefer Mustafayev. http://dx.doi.org/10.5897/AJB11.1785 ...

  20. Water quality of surface runoff and lint yield in cotton under furrow irrigation in Northeast Arkansas

    Science.gov (United States)

    Use of furrow irrigation in row crop production is a common practice through much of the Midsouth US and yet, nutrients can be transported off-site through surface runoff. A field study with cotton (Gossypium hirsutum, L.) was conducted to understand the impact of furrow tillage practices and nitrog...

  1. Profitability of cover crops for single and twin row cotton

    Science.gov (United States)

    With the increased interest in cover crops, the impact of adoption on profitability of cash crops is a common question from producers. The objective of this study was to evaluate the profitability of cover crops for single and twin row cotton (Gossypium hirsutum L.) in Alabama. This experiment inclu...

  2. Genetic diversity, population structure and marker trait associations ...

    Indian Academy of Sciences (India)

    Supplementary data: Genetic diversity, population structure and marker trait associations for seed quality traits in cotton (Gossypium hirsutum). Ashok Badigannavar and Gerald O. Myers. J. Genet. 94, 87–94. Table 1. List of cotton germplasm lines used in this study. Germplasm no. Cultivar. Region. Germplasm no. Cultivar.

  3. AcEST: DK947415 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 7|CATA2_GOSHI Catalase isozyme 2 OS=Gossypium hirsutum G... 74 3e-13 sp|O24339|CATA_SOLAP Catalase OS=Soldan...RLNVRPSI 492 >sp|O24339|CATA_SOLAP Catalase OS=Soldanella alpina PE=2 SV=1 Length = 492 Score = 73.2 bits (1

  4. Efficacy of vegetable oils against dry bean beetles Acanthoscelides ...

    African Journals Online (AJOL)

    Acanthoscelides obtectus (Say) is a major pest of stored dry beans (Phaseolus vulgaris L.) and other legumes world wide. The objective of this study was to assess the efficacy of castor (Ricinus communis L.) and cottonseed (Gossypium hirsutum) oils against A. obtectus on stored dry beans under laboratory conditions.

  5. Diversidade de formigas (Hymenoptera: Formicidae) em sistemas de cultivo de algodoeiro no Distrito Federal

    OpenAIRE

    Monteiro, André Fábio Medeiros

    2009-01-01

    Diversos estudos mostram que as formigas exercem papéis importantes para o funcionamento dos agroecossistemas. Néctar extrafloral, exsudados de pulgões e alta densidade de herbívoros atraem formigas predadoras para o algodoeiro, que poderiam protegê-lo de danos por pragas. Isso dependeria de circunstâncias regionais, da intensidade de manejo de sistemas de cultivo específicos e da densidade e agressividade de formigas dominantes. Os objetivos gerais desse estudo foram avaliar o...

  6. EFEITO DE TRICOMAS, ALELOQUÍMICOS E NUTRIENTES NA RESISTÊNCIA DE LYCOPERSICON HIRSUTUM À TRAÇA-DO-TOMATEIRO EFFECT OF TRICHOMES, ALELLOCHEMICALS AND MINERALS ON THE RESISTANCE OF LYCOPERSICON HIRSUTUM TO TOMATO LEAF MINER

    Directory of Open Access Journals (Sweden)

    GERMANO LEÃO DEMOLIN LEITE

    1999-11-01

    Full Text Available Estudos foram conduzidos com o objetivo de verificar o efeito de tricomas, aleloquímicos e nutrientes nas folhas de partes do dossel das plantas na resistência de Lycopersicon hirsutum à traça- do-tomateiro, Tuta absoluta (Lepidoptera: Gelechiidae. Foram quantificados os teores de 2-tridecanona (2-TD, 2-undecanona (2-UD, N, P, K, Ca e Mg, densidade e tipos de tricomas e tamanho das folhas nos terços apical, mediano e basal do dossel de plantas de L. hirsutum e de L. esculentum e estudaram- se os efeitos destes fatores sobre características biológicas de T. absoluta. Observou-se elevação no teor de 2-TD da base para o ápice do dossel. Não se detectou diferença significativa quanto ao número de ovos de T. absoluta ao longo do dossel de L. hirsutum, constatando-se em L. esculentum maior oviposição nos terços apical e mediano do que no basal. As folhas do terço apical de L. hirsutum apresentaram maior efeito deletério sobre as larvas de traça.The objective of this work was to study the effect of trichomes, alellochemicals and minerals in the leaves of different canopy heights on the resistance of Lycopersicon hirsutum to tomato leaf miner, Tuta absoluta (Lepidoptera: Gelechiidae. Effects of 2-tridecanone (2-TD, 2-undecanone (2-UD, N, P, K, Ca and Mg levels, density and types of trichomes and leaf area on apical, medium and basal parts of plant dossel of L. hirsutum and L. esculentum on the oviposition and mines number of T. absoluta was studied. Production of 2-TD increased from the bottom to the top of the canopy. The apical part of plants of L. hirsutum showed more antibiotic effect on the caterpillar. T. absoluta oviposited more on leaves of the apical and medium portion of the plants than in the basal parts of L. esculentum.

  7. Levantamento entomofaunístico de artrópodes em algodoeiro de fibra naturalmente colorida em Ipanguaçu-RN

    Directory of Open Access Journals (Sweden)

    Bárbara Karine de Albuquerque Silva

    2016-08-01

    Full Text Available Objetivou-se com esta pesquisa identificar a diversidade de artrópodes associados à cultura do algodão Gossypium hirsutum L. com pluma colorida, sendo realizados levantamentos entomofaunístico em Ipanguaçu-RN em áreas de produção. A área experimental foi composta por 15 variedades de algodão com pluma colorida: CNPA 2009-6; CNPA 2009-11; CNPA 2009-13; CNPA 2009-16; CNPA 2009-27; CNPA 2009-42; CNPA 2009-47; CNPA 2009-48; CNPA 2009-50; CNPA 2009-59; CNPA 2009-60; CNPA 2009-62; BRS RUBI; BRS AROEIRA; BRS TOPÁZIO. O levantamento foi realizado tendo como base três métodos de coleta ativa em pontos aleatórios da área experimental. As coletas consistiram da retirada manual de folhas e maçãs diretamente da planta, além da captura de insetos em pleno voo, com auxílio de rede entomológica. Foram encontrados um total 1884 insetos adultos e 66 larvas, dispostos em 8 ordens e 22 famílias. A família Aphididae: Hemiptera foi a mais numerosa entre o material coletado, com 1720 adultos dispersos nos três métodos de coleta aplicados. Além desta, outras famílias de pragas da cultura foram encontradas, como Curculionidae: Coleoptera. Também foram coletados organismos benéficos como os polinizadores Aphidae e Megachilidae, pertencentes a ordem Hymenoptera, predadores (Coccinellidae: Coleoptera; Vespidae: Hymenoptera; Reduviidae: Hemiptera; Chrysopidae: Neuroptera e Labiidae: Dermaptera e parasitoides, como os microhimenópteros. Foram encontrados três tipos de larvas, sendo classificadas como curculioniforme as mais numerosas, apresentando um total de 57 espécimes coletados.Entomofaunistic survey of artropods in naturally colored cotton fiber in Ipanguaçu-RNAbstract: The objective of this research was to identify the diversity of arthropods associated with cotton crop Gossypium hirsutum L. with colorful plume, it was conducted entomofaunístico survey in Ipanguaçu-RN in production areas. The experimental area was composed of 15 cotton

  8. Alleles conferring improved fiber quality from EMS mutagenesis of elite cotton genotypes

    Science.gov (United States)

    The elite gene pool of cotton (Gossypium spp.) has less diversity than those of most other major crops, making identification of novel alleles important to ongoing crop improvement. A total of 3,164 M5 lines resulting from ethyl methanesulfonate mutagenesis of two G. hirsutum breeding lines, TAM 94L...

  9. Evaluating cotton seed gland initiation by microscopy

    Science.gov (United States)

    Gossypol is a terpenoid aldehyde found in cotton (Gossypium hirsutum L.) glands and helps protect the seed from pests and pathogens. However, gossypol is toxic to many animals, so the seed is used mainly in cattle feed, as ruminants are tolerant to the effects of gossypol. In order to develop strat...

  10. First record of Sesbania punicea (Fabales: Fabaceae) as a host plant for Chinavia hilaris (Hemiptera: Pentatomidae)

    Science.gov (United States)

    The green stink bug, Chinavia hilaris (Say) (Hemiptera: Pentatomidae), is an economic pest of cotton, Gossypium hirsutum L. Numerous known non-crop hosts of C. hilaris that exist in field edges bordering cotton are sources of this stink bug in this crop. Sesbania punicea plants in a field border su...

  11. Area-wide management approach for tarnished plant bug in the Mississippi Delta

    Science.gov (United States)

    The tarnished plant bug, Lygus lineolaris (Palisot de Beauvois), is the major insect pest of cotton, Gossypium hirsutum (L.), within the Mid-South region. From 2001 to 2012, the tarnished plant bug has been the number one insect pest of cotton in Louisiana and Mississippi in eleven and nine of those...

  12. Effect of nitrates on embryo induction efficiency in cotton ...

    African Journals Online (AJOL)

    Cotton (Gossypium hirsutum L.) cv Coker-312 callus culture was assessed in terms of its usefulness as a system for investigating the effect of nitrates from different chemical compounds of nitrogen on embryo induction percentage in calli as the plant growth and cell differentiation mainly based on nitrogen. Both sources and ...

  13. Mapping of genes for flower-related traits and QTLs for flowering ...

    Indian Academy of Sciences (India)

    Mapping of genes for flower-related traits and QTLs for flowering time in an interspecific population of Gossypium hirsutum × G. darwinii. Shuwen Zhang, Qianqian Lan, Xiang Gao, Biao Yang, Caiping Cai, Tianzhen Zhang and Baoliang Zhou. J. Genet. 95, 197–201. Table 1. Loci composition and recombination distances of ...

  14. Case Study: Transgenic Crop Controversy in Costa Rica

    Science.gov (United States)

    Hague, Steve S.

    2009-01-01

    Costa Rica has rich ecological resources and has been a steady political force in turbulent Central America. Most recently, it has become a battleground between pro- and anti-genetically modified organism (GMO) political forces. This case study examines the roles of U.S.-based cotton ("Gossypium hirsutum" L.) seed companies, anti-GMO…

  15. The genome sequence of Sea-Island cotton (Gossypium barbadense) provides insights into the allopolyploidization and development of superior spinnable fibres

    Science.gov (United States)

    Yuan, Daojun; Tang, Zhonghui; Wang, Maojun; Gao, Wenhui; Tu, Lili; Jin, Xin; Chen, Lingling; He, Yonghui; Zhang, Lin; Zhu, Longfu; Li, Yang; Liang, Qiqi; Lin, Zhongxu; Yang, Xiyan; Liu, Nian; Jin, Shuangxia; Lei, Yang; Ding, Yuanhao; Li, Guoliang; Ruan, Xiaoan; Ruan, Yijun; Zhang, Xianlong

    2015-01-01

    Gossypium hirsutum contributes the most production of cotton fibre, but G. barbadense is valued for its better comprehensive resistance and superior fibre properties. However, the allotetraploid genome of G. barbadense has not been comprehensively analysed. Here we present a high-quality assembly of the 2.57 gigabase genome of G. barbadense, including 80,876 protein-coding genes. The double-sized genome of the A (or At) (1.50 Gb) against D (or Dt) (853 Mb) primarily resulted from the expansion of Gypsy elements, including Peabody and Retrosat2 subclades in the Del clade, and the Athila subclade in the Athila/Tat clade. Substantial gene expansion and contraction were observed and rich homoeologous gene pairs with biased expression patterns were identified, suggesting abundant gene sub-functionalization occurred by allopolyploidization. More specifically, the CesA gene family has adapted differentially temporal expression patterns, suggesting an integrated regulatory mechanism of CesA genes from At and Dt subgenomes for the primary and secondary cellulose biosynthesis of cotton fibre in a “relay race”-like fashion. We anticipate that the G. barbadense genome sequence will advance our understanding the mechanism of genome polyploidization and underpin genome-wide comparison research in this genus. PMID:26634818

  16. Induction of lycopene and lycopene precursors in germinating cottonseedwith the substituted triethylamine compound MPTA

    Science.gov (United States)

    Treatment of dark germinating cottonseed (Gossypium hirsutum Acala cultivar) with 0.72 mM 2(4-methylphenoxy) triethylamine (MPTA) resulted in a 18-fold increase in carotenoid biosynthesis. In comparison to H2O treated control seed germinating in the dark that formed 8.4 ug/g fr wt of lutein and 1.6 ...

  17. Arabidopsis CDS blastp result: AK108458 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK108458 002-143-D05 At4g35000.1 L-ascorbate peroxidase 3 (APX3) identical to ascorbat...e peroxidase 3 [Arabidopsis thaliana] GI:2444019, L-ascorbate peroxidase [Arabidopsis thaliana] gi|152379...1|emb|CAA66926; similar to ascorbate peroxidase [Gossypium hirsutum] gi|1019946|gb|AAB52954 2e-35 ...

  18. Arabidopsis CDS blastp result: AK070842 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK070842 J023074O14 At4g35000.1 L-ascorbate peroxidase 3 (APX3) identical to ascorbat...e peroxidase 3 [Arabidopsis thaliana] GI:2444019, L-ascorbate peroxidase [Arabidopsis thaliana] gi|1523791...|emb|CAA66926; similar to ascorbate peroxidase [Gossypium hirsutum] gi|1019946|gb|AAB52954 1e-112 ...

  19. Journal of Genetics | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Logo of the Indian Academy of Sciences .... Association of AFLP and SSR markers with agronomic and fibre quality traits in Gossypium hirsutum L. ... cDNA cloning and expression analysis of two distinct Sox8 genes in Paramisgurnus ... Allelic variations in Glu-1 and Glu-3 loci of historical and modern Iranian bread wheat ...

  20. Genome-wide analysis of the HD-ZIP IV transcription factor family in Gossypium arboreum and GaHDG11 involved in osmotic tolerance in transgenic Arabidopsis.

    Science.gov (United States)

    Chen, Eryong; Zhang, Xueyan; Yang, Zhaoen; Wang, Xiaoqian; Yang, Zuoren; Zhang, Chaojun; Wu, Zhixia; Kong, Depei; Liu, Zhao; Zhao, Ge; Butt, Hamama Islam; Zhang, Xianlong; Li, Fuguang

    2017-06-01

    HD-ZIP IV proteins belong to the homeodomain-leucine zipper (HD-ZIP) transcription factor family and are involved in trichome development and drought stress in plants. Although some functions of the HD-ZIP IV group are well understood in Arabidopsis, little is known about their function in cotton. In this study, HD-ZIP genes were identified from three Gossypium species (G. arboreum, G. raimondii and G. hirsutum) and clustered into four families (HD-ZIP I, II, III and IV) to separate HD-ZIP IV from the other three families. Systematic analyses of phylogeny, gene structure, conserved domains, and expression profiles in different plant tissues and the expression patterns under osmotic stress in leaves were further conducted in G. arboreum. More importantly, ectopic overexpression of GaHDG11, a representative of the HD-ZIP IV family, confers enhanced osmotic tolerance in transgenic Arabidopsis plants, possibly due to elongated primary root length, lower water loss rates, high osmoprotectant proline levels, significant levels of antioxidants CAT, and/or SOD enzyme activity with reduced levels of MDA. Taken together, these observations may lay the foundation for future functional analysis of cotton HD-ZIP IV genes to unravel their biological roles in cotton.

  1. Chemical characterization and chemotaxonomy of Hypericum hirsutum L. 1753 from Vojvodina (Serbia

    Directory of Open Access Journals (Sweden)

    Kladar Nebojša V.

    2016-01-01

    Full Text Available The genus Hypericum includes over 500 widely distributed species. The main representative is St. John’s wort (Hypericum perforatum L. (1753, Hypericaceae, the only approved biological source of Hyperici herba by WHO and EMEA monographs. It is frequently used in the form of oil macerate for treatment of burns, scars, eczema and gas­trointestinal disorders, as well as in the form of water and alcoholic extracts as clinically proved antidepressant. Available data suggest that the amounts of secondary metabolites in the plant vary depending on ecological factors of the habitat, and consequently affect the quality of herbal drug. The reports show that other species of the genus have similar chemical profile as H. perforatum. But, there are also Hypericum species in which some of the secondary metabolites of interest occur in higher quantities than in H. perforatum. As previous data suggest, Hypericum hirsutum L. 1753, could be such example. Therefore, the aim of this study was to chemically characterize water-alcoholic extracts of H. hirsutum samples, collected at four localities in Vojvodina (Republic of Serbia by liquid chromatography (HPLC-DAD. The obtained results suggest a good match (in a term of a presence of investigated compounds of previously published results describing chemical profile of H. perforatum water-alcoholic extracts with examined H. hirsutum extracts. Also, chemotaxonomic analysis showed variations in quantity of secondary metabolites in the examined extracts. This opens the door to further investigation of H. hirsutum as a new source of bioactive secondary metabolites and additional markers in Hypericum chemotaxonomy.

  2. A comparison of soda and soda-AQ pulps from cotton stalks | Akgül ...

    African Journals Online (AJOL)

    In this study, cotton stalks (Gossypium hirsutum L.) were cooked using soda and soda-anthraquinone (AQ) process. Nine soda cooks were conducted by changing cooking conditions including active alkali charge and pulping time. Soda-AQ cooks were obtained by adding 0.075, 0.10, 0.15, 0.2% AQ (based on o.d stalks) to ...

  3. The induction of lycopene in germinating cottonseed with 2-(4-Methylphenoxy)Triethylamine (MPTA)

    Science.gov (United States)

    Cottonseed (Gossypium hirsutum Acala cultivar) were imbibed in H2O for 6 hr and seed coats removed. The seeds were imbibed for an additional 3 hr in H2O or 7.2x10**-4M 2-(4-methylphenoxy) triethylamine (MPTA) and germinated in the dark for 72 hr. The carotenoids were extracted and analyzed by HPLC...

  4. Ethyl ester purpurine-18 from Gossypium mustelinum (Malvaceae);Feoforbideo (etoxi-purpurina-18) isolado de Gossypium mustelinum (Malvaceae)

    Energy Technology Data Exchange (ETDEWEB)

    Silva, Tania Maria Sarmento; Camara, Celso Amorim, E-mail: taniasarmento@dq.ufrpe.b [Universidade Federal de Pernambuco (UFPE), Recife, PE (Brazil). Dept. de Quimica; Barbosa-Filho, Jose Maria [Universidade Federal da Paraiba (UFPB), Joao Pessoa, PB (Brazil). Lab. de Tecnologia Farmaceutica; Giulietti, Ana Maria [Universidade Estadual de Feira de Santana, BA (Brazil). Dept. de Ciencias Biologicas

    2010-07-01

    The phaeophorbide ethyl ester named Purpurine-18 and the flavonoids quercetin and kaempferol were obtained by chromatographic procedures from the chloroform fraction of aerial parts of Gossypium mustelinum. The structure of these compound was determined by NMR, IR and mass spectra data analysis. This is the first occurrence of this compound in Angiosperm. (author)

  5. Competição de misturas de herbicidas nas principais regiões algodoeiras (Gossypium hirsutum L. no E. de Minas Gerais

    Directory of Open Access Journals (Sweden)

    J.P. del C. Laca-Buendia

    1978-09-01

    região foi encontrado efeito negativo da aplicação dos herbicidas.Several herbicide mixtures were tested on cotton, (Gossypium hirsutum L. in the main production areas of the State of Minas Gerais, Brasil. The cultivar "Minas Dona Beta", was used in the Metalúrgica region, whilst in Triângulo and Norte the cultivar employed was ."IAC-13-1", . In Triângulo litle regrowth occurred up to 30 days after application when the following mixtures were used: dinitramine + diuron, dinitroanilin + prometryne and pendimethalin + diuron. These treatments controlled 96.2%, 92.5% and 96.5% of the total weeds, respectively. When yields were compared, 1,962 Kg/ha were obtained in the best treatment (pendimethalin + diuron, against the control plots average of 1,130 Kg/ha. Tank mixtures of 2,00 Kg/ha of alachlor and 0.35 Kg/ha of metribuzin, or 3,00 Kg/ha of alachlor and 0,50 Kg/ha of metribuzin, and 1,00 Kg/ha of trifluralin and 0,50 Kg/ha of metribuzin were the most efficient in controlling grasses and dicotyledons. Effective weed control was recorded in Nor th of Minas Gerais when pendimethalin + diuron were applied expressed as: 86.4%, 83.6% and 70.3% of the total weeds after 30,50 and 80 days, respectively. The mixtures dinitramine + fluome - turon and dinitroanilin + fluometuron showed the best results regard to a cotton yield of 1,532 Kg/ha, produced in the treated plots against only 229 kg/ha in the control (unhoed. The best combination for total weed control in the Metalúrgica region was dinitramine + diuron with an efficiency of 67% after 30 days. When differences in fiber production were considered, however, the best mixture was dinitramine + fluometuron, the treated plots yielding 831 kg/ha and the control 145 kg/ha.

  6. Selección y caracterización de rizobacterias promotoras de crecimiento vegetal (RPCV asociadas al cultivo de algodón (Gossypium hirsutum

    Directory of Open Access Journals (Sweden)

    Andrés Guzmán

    2012-01-01

    Full Text Available Título en ingles: Selection and characterization of plant growth promoting rhizobacteria (PGPR’s associated with cotton crop (Gossypium hirsutum Resumen: Como parte de las estrategias de una agricultura sostenible, se hace necesario disminuir el uso de fertilizantes nitrogenados de síntesis, mediante la utilización de los biofertilizantes. En particular, los géneros Azotobacter y Azospirillum son utilizados como agentes promotores de crecimiento vegetal debido a su capacidad para fijar nitrógeno atmosférico y producir hormonas de tipo indólico. Por tal razón, en este estudio se aislaron bacterias diazotróficas de los géneros Azotobacter y Azospirillum a partir de la rizósfera de cultivos de algodón en el Espinal (Tolima. Las poblaciones microbianas se caracterizaron fenotípicamente en los medios de cultivo semiespecíficos: Ashby y LG (Azotobacter sp. y NFb, LGI y Batata (Azospirillum sp.. La promoción de crecimiento vegetal se determinó mediante la actividad de la enzima nitrogenasa por medio de la técnica de reducción de acetileno y producción de índoles por el método colorimétrico de Salkowsky. Se obtuvieron 9 aislamientos tentativos de Azotobacter sp. y 4 de Azospirillum sp. Se presentaron diferencias significativas en la prueba de reducción de acetileno con las cepas presuntivas de Azotobacter sp.: NAT 9 (206.43 nmol C2H2 mL-1.h-1, NAT 4, (292.77 nmol C2H2 mL-1.h-1, y NAT 6 (460.60 nmol C2H2 mL-1.h-1 y en la producción de índoles de las cepas NAT 19 (19.87 μg.mL-1 y NAT 13 (20.08 μg.mL-1. Por su eficiencia in vitro en la promoción de crecimiento vegetal se seleccionaron las cepas NAT9, NAT4, NAT6, NAT19 y NAT13 para ser evaluadas como principio activo en futuros inoculantes para el algodón en esta zona del departamento del Tolima. Palabras clave: fijación biológica de nitrógeno; producción de índoles; promoción del crecimiento vegetal;  biofertilizantes. Abstract: As part of strategies for sustainable

  7. Untitled

    African Journals Online (AJOL)

    Département de Biologie et Physiologie Végétales, Faculté des Sciences, Université de Yaoundé Yaoundé I, B.P.. 812 Yaoundé — Cameroun. RÉSUMÉ. Les travaux de recherche sont réalisés au Cameroun de Juillet 2001 à Septembre 2003 sur les plantules d'une glycophyte tolérante ; Gossypium hirsutum (Malvaceae).

  8. Rainwater deficit and irrigation demand for row crops in Mississippi Blackland Prairie

    Science.gov (United States)

    Gary Feng; Ying Ouyang; Ardeshir Adeli; John Read; Johnie Jenkins

    2018-01-01

    Irrigation research in the mid-south United States has not kept pace with a steady increase in irrigated area in recent years. This study used rainfall records from 1895 to 2016 to determine rainwater deficit and irrigation demand for soybean [Glycine max (L.) Merr.], corn (Zea mays L.), and cotton (Gossypium hirsutum L.) in the Blackland Prairie region of Mississippi...

  9. Association of AFLP and SSR markers with agronomic and fibre ...

    Indian Academy of Sciences (India)

    We have attempted to tag yield and fibre quality traits with AFLP and SSR markers using F2 and F3 populations of a cross between two Gossypium hirsutum varieties, PS56-4 and RS2013. Out of 50 AFLP primer combinations and 177 SSR primer pairs tested, 32 AFLP and four SSR primers were chosen for genotyping F2 ...

  10. Gossipium hirsutum L. extract as green corrosion inhibitor for ...

    African Journals Online (AJOL)

    Inhibitive effect of Gossipium hirsutum L. leaves extract on the acid corrosion of aluminum in 1 M HCl solution was studied by weight loss technique. The extract at optimum concentration inhibited the corrosion of aluminum, with about 92% inhibition efficiency and the inhibition efficiency increased with increasing ...

  11. Comportamento do algodoeiro herbáceo (Gossypium hirsutum latifolium Hutch. e controle de plantas daninhas com o uso dos herbicidas diuron e sethoxydim The behavior of upland-type cotton (G. hirsutum latifolium Hutch. and the control of weeds after the use of diuron and sethoxydim herbicides

    Directory of Open Access Journals (Sweden)

    N.E. de M. Beltrão

    1983-06-01

    Full Text Available Com a finalidade de verificar o comportamento do algodoeiro herbáceo, cultivar IAC-17, bem como o controle de plantas daninhas e aspectos competitivos do complexo floristico infestante sobre a cultura, na presença dos herbicidas diuron e sethoxydim, foi realizado um ensaio no município de Viçosa, Minas Gerais. O solo do local experimental, Podzólico Vermelho-Amarelo, apresenta textura argilosa, com 1,38% de carbono orgânico e de baixa fertilidade natural. O diuron foi aplicado em pré-emergência nas doses de 0,0; 0,8; 1,6 e 2,4 kg/ha e o sethoxydim, em pós-emergência, nas doses de 0, 150, 300, 450 e 600 g/ha. O ensaio foi instalado em blocos ao acaso, com 21 tratamentos em esquema fatorial (4 x 5 + 1, sendo 20 deles envolvendo o controle químico, resultantes de todas as combinações das doses desses herbicidas e uma testemunha relativa onde o controle foi realizado com o uso da enxada. Avaliaram-se várias características do crescimento e desen vol vimento da cul tura, tai s como área fol iar, índice de área folia r, ren dimento de algodão em rama, altura da plant a, diâmetro do caule etc.; e, por meio de mét odos sin ecológico s, a densidade populac ional e peso da fitomassa hidratada epí gea das esp éci es daninhas dominant es, e o total de todas as espécies. O diuron exerceu um elevado contro le de lat ifo liadas, como botão-de -ouro (Galin soga parvif lora Cav. e picão-preto (Biden spilosa L., nas doses de 1,6 e 2,4 kg/ ha. O sethoxydim mesmo na menor dose testada (150 g/h a controlou totalmente o capim-marmelada (Brachiaria planta ginea (Link. Hitch . Nenhum dos herbicidas controlou a falsa -serralha (Emilia sonc hi folia DC., porém referida planta daninha não reduziu o crescimento da cultura, mostrando- se de baixa força de competição. As plantas daninhas que apresentaram maiores forças de competição foram o botão-de-ouro, por apresentar maior densidade populacional, e o capim-marmelada, por ser de maior

  12. Feoforbídeo (etoxi-purpurina-18 isolado de Gossypium mustelinum (Malvaceae Ethyl ester putpurin-18 from Gossypium mustelinum (Malvaceae

    Directory of Open Access Journals (Sweden)

    Tania Maria Sarmento Silva

    2010-01-01

    Full Text Available The phaeophorbide ethyl ester named Purpurin-18 and the flavonoids quercetin and kaempferol were obtained by chromatographic procedures from the chloroform fraction of aerial parts of Gossypium mustelinum. The structure of these compound was determined by NMR, IR and mass spectra data analysis. This is the first occurrence of this compound in Angiosperm.

  13. Genome-wide analysis of the WRKY gene family in cotton.

    Science.gov (United States)

    Dou, Lingling; Zhang, Xiaohong; Pang, Chaoyou; Song, Meizhen; Wei, Hengling; Fan, Shuli; Yu, Shuxun

    2014-12-01

    WRKY proteins are major transcription factors involved in regulating plant growth and development. Although many studies have focused on the functional identification of WRKY genes, our knowledge concerning many areas of WRKY gene biology is limited. For example, in cotton, the phylogenetic characteristics, global expression patterns, molecular mechanisms regulating expression, and target genes/pathways of WRKY genes are poorly characterized. Therefore, in this study, we present a genome-wide analysis of the WRKY gene family in cotton (Gossypium raimondii and Gossypium hirsutum). We identified 116 WRKY genes in G. raimondii from the completed genome sequence, and we cloned 102 WRKY genes in G. hirsutum. Chromosomal location analysis indicated that WRKY genes in G. raimondii evolved mainly from segmental duplication followed by tandem amplifications. Phylogenetic analysis of alga, bryophyte, lycophyta, monocot and eudicot WRKY domains revealed family member expansion with increasing complexity of the plant body. Microarray, expression profiling and qRT-PCR data revealed that WRKY genes in G. hirsutum may regulate the development of fibers, anthers, tissues (roots, stems, leaves and embryos), and are involved in the response to stresses. Expression analysis showed that most group II and III GhWRKY genes are highly expressed under diverse stresses. Group I members, representing the ancestral form, seem to be insensitive to abiotic stress, with low expression divergence. Our results indicate that cotton WRKY genes might have evolved by adaptive duplication, leading to sensitivity to diverse stresses. This study provides fundamental information to inform further analysis and understanding of WRKY gene functions in cotton species.

  14. Analise de crescimento do algodoeiro herbáceo BRS-201 com aplicações de zinco e boro sobre condições de campo

    Directory of Open Access Journals (Sweden)

    João H. de Albuquerque

    2014-04-01

    Full Text Available Objetivou-se com este trabalho, avaliar o efeito no crescimento de plantas de algodoeiro herbáceo cv. BRS 201 em quatro idades diferentes (dias após emergência – dae sob condições de campo, em resposta a adubação com boro e zinco. Utilizou-se o delineamento experimental em blocos ao acaso, com os tratamentos distribuídos em esquema fatorial 4 x 4, sendo quatro doses de boro (0,0; 2,0; 4,0 e 6,0 kg.ha-1, na forma de Ácido Bórico com 17% de B, quatro doses de zinco (0,0; 0,4; 0,8 e 1,2 kg.ha-1, na forma de Sulfato de Zinco com 20% de Zn, e mais uma testemunha relativa (adubação de NPK, com quatro repetições, perfazendo o total de 68 parcelas, cultivar BRS-201. As variáveis estudadas foram: altura de planta (AP; diâmetro do caule (DC e a área foliar por planta (AFP, medidos aos 30, 60, 90 e 120 dias após a semeadura, DAS. Foram realizadas leituras medidos aos 30, 60, 90 e 120 dias após a emergência, dae.  O crescimento do algodoeiro, cultivar BRS 201, medido via altura de planta, foi alterado pelos micronutrientes zinco e boro, com incremento significativo, da ordem de 15,71%, em relação ao tratamento que não recebeu tais elementos químicos. A altura da planta (AP, o diâmetro do caule (DC e a área foliar do algodoeiro (AFP aumentaram com as doses de zinco e boro.  Normal 0 21 false false false PT-BR X-NONE X-NONE

  15. Ethyl ester purpurine-18 from Gossypium mustelinum (Malvaceae)

    International Nuclear Information System (INIS)

    Silva, Tania Maria Sarmento; Camara, Celso Amorim; Barbosa-Filho, Jose Maria; Giulietti, Ana Maria

    2010-01-01

    The phaeophorbide ethyl ester named Purpurine-18 and the flavonoids quercetin and kaempferol were obtained by chromatographic procedures from the chloroform fraction of aerial parts of Gossypium mustelinum. The structure of these compound was determined by NMR, IR and mass spectra data analysis. This is the first occurrence of this compound in Angiosperm. (author)

  16. SELETIVIDADE DE INSETICIDAS SOBRE O COMPLEXO DE PREDADORES DAS PRAGAS DO ALGODOEIRO SELECTIVITY OF PESTICIDES OVER PREDATORS OF COTTON PLANT PESTS

    OpenAIRE

    Elmo Pontes de Melo; Thiago Ferreira Bertoncello; Rodrigo Fernandes Nogueira; Izidro dos Santos de Lima Júnior; Renato Suekane; Paulo Eduardo Degrande

    2010-01-01

    O algodoeiro é hospedeiro de um complexo de pragas, que podem ocasionar danos às estruturas das plantas. Para o desenvolvimento sustentado, neste agroecossistema, há necessidade da implementação do Manejo In...

  17. Characterization of the damage of Spodoptera eridania (Cramer) and Spodoptera cosmioides (Walker) (Lepidoptera: Noctuidae) to structures of cotton plants

    OpenAIRE

    Santos, Karen B dos; Meneguim, Ana M; Santos, Walter J dos; Neves, Pedro M O J; Santos, Rachel B dos

    2010-01-01

    The cotton plant, Gossypium hirsutum, hosts various pests that damage different structures. Among these pests, Spodoptera cosmioides (Walker) and Spodoptera eridania (Cramer) (Lepidoptera: Noctuidae) are considered important. The objectives of this study were to characterize and to quantify the potential damage of S. eridania and S. cosmioides feeding on different structures of cotton plants. For this purpose, newly-hatched larvae were reared on the following plant parts: leaf and flower bud;...

  18. Phylogenetic analysis of Gossypium L. using restriction fragment length polymorphism of repeated sequences.

    Science.gov (United States)

    Zhang, Meiping; Rong, Ying; Lee, Mi-Kyung; Zhang, Yang; Stelly, David M; Zhang, Hong-Bin

    2015-10-01

    Cotton is the world's leading textile fiber crop and is also grown as a bioenergy and food crop. Knowledge of the phylogeny of closely related species and the genome origin and evolution of polyploid species is significant for advanced genomics research and breeding. We have reconstructed the phylogeny of the cotton genus, Gossypium L., and deciphered the genome origin and evolution of its five polyploid species by restriction fragment analysis of repeated sequences. Nuclear DNA of 84 accessions representing 35 species and all eight genomes of the genus were analyzed. The phylogenetic tree of the genus was reconstructed using the parsimony method on 1033 polymorphic repeated sequence restriction fragments. The genome origin of its polyploids was determined by calculating the diploid-polyploid restriction fragment correspondence (RFC). The tree is consistent with the morphological classification, genome designation and geographic distribution of the species at subgenus, section and subsection levels. Gossypium lobatum (D7) was unambiguously shown to have the highest RFC with the D-subgenomes of all five polyploids of the genus, while the common ancestor of Gossypium herbaceum (A1) and Gossypium arboreum (A2) likely contributed to the A-subgenomes of the polyploids. These results provide a comprehensive phylogenetic tree of the cotton genus and new insights into the genome origin and evolution of its polyploid species. The results also further demonstrate a simple, rapid and inexpensive method suitable for phylogenetic analysis of closely related species, especially congeneric species, and the inference of genome origin of polyploids that constitute over 70 % of flowering plants.

  19. Resistência do algodoeiro à ferrugem tropical potencializada pelo silício

    Directory of Open Access Journals (Sweden)

    Antonia Mirian Nogueira de Moura Guerra

    2013-01-01

    Full Text Available Este trabalho teve como objetivo estudar o efeito do silício (Si sobre componentes de resistência do algodoeiro à ferrugem tropical causada por Phakopsora gossypii. Plantas das cultivares BRS Buriti e FM 993 cresceram em solução nutritiva contendo zero (-Si ou 2 mmol Si L- 1 (+Si. A maior concentração foliar de Si aumentou o período de incubação e o período latente em 9% e 14,3%, respectivamente, reduziu a área pustular, a área abaixo da curva de progresso da ferrugem e a área abaixo da curva de progresso da área da pústula em 27,5%, 36% e 22%, respectivamente. Nas plantas das cultivares BRS Buriti e FM 993 supridas com Si houve redução no número de pústulas em 70% e 30% e no número de urédias em 40,3% e 19,5%, respectivamente. A concentração de compostos fenólicos nas plantas da cultivar BRS Buriti supridas com Si aumentou até os 10 dai e, para a cultivar FM993, até os 30 dai. A concentração de derivados da lignina-ácido tioglicólico aumentou depois dos 20 dai para as duas cultivares supridas com Si. Atividade da peroxidas e aumentou até os 25 dai e os 10 dai para as plantas das cultivares BRS Buriti e FM 993 supridas com Si, respectivamente. A atividade da quitinase aumentou até 10 dai para as plantas da cultivar BRS Buriti e aos 10 e 20 dai para as plantas da cultivar supridas com Si. A atividade da glucanase aumentou até os 10 dai para as plantas da cultivar BRS Buriti supridas com Si e até os 20 dai para as plantas da cultivar FM 993 supridas com Si. Em conclusão, o suprimento de Si contribuiu para aumentar a resistência do algodoeiro à ferrugem devido à maior atividade das enzimas de defesa.

  20. PARASITISM OF BOLL WEEVIL (Anthonomus grandis IN FLOWER BUDS OF COTTON PLANT, IN THE MUNICIPAL DISTRICT OF GOIÂNIA-GO PARASITISMO DO BICUDO DO ALGODOEIRO (Anthonomus grandis EM BOTÕES FLORAIS DO ALGODOEIRO, NO MUNICÍPIO DE GOIÂNIA-GO

    Directory of Open Access Journals (Sweden)

    Paulo Marçal Fernandes

    2007-09-01

    Full Text Available

    This work studied the indexes of parasitism of A. grandis in floral buttons of the cotton plants, collected in the soil and in the plants, in an area not treat with insecticides, located in the School of Agronomy of the Universidade Federal de Goiás, municipal district of Goiânia-GO. Floral buttons were collected with and without sign of oviparousness of the beaked ones. They presented larger parasitism occurrence in those collected in the soil. The parasites were identified as: Chelonus sp. (Microchelonus, Bracon sp. and Pteromalidae.

    KEY-WORDS: Insecta; parasitism; cotton plant; Anthonomus grandis.

    Estudou-se o índice de parasitismo de A. grandis em botões florais de algodoeiro coletados no solo e nas plantas, em uma área não tratada com inseticidas, localizada na Escola de Agronomia da Universidade Federal de Goiás, no município de Goiânia (GO. Foram coletados botões florais com e sem puncturas de oviposição dos bicudos. Verificou-se um maior parasitismo nos botões florais coletados no solo. Os parasitóides foram identificados como Chelonus sp. (Microchelonus, Bracon sp. e Pteromalidae.

    PALAVRAS-CHAVE: Insecta; parasitismo; algodoeiro; Anthonomus grandis.

  1. Pretreatment of radiata pine using two white rot fungal strains Stereum hirsutum and Trametes versicolor

    International Nuclear Information System (INIS)

    Shirkavand, Ehsan; Baroutian, Saeid; Gapes, Daniel J.; Young, Brent R.

    2017-01-01

    Highlights: • Fungal pretreatment by two New Zealand native white rot fungi was proposed. • Trametes versicolor was more efficient in selective degradation of pine wood chips. • Both fungal strains significantly decreased crystallinity index of biomass only after week 7 of degradation. • Structural analysis showed that Trametes versicolor and Stereum hirsutum increased porous surface area of woody biomass. - Abstract: Stereum hirsutum and Trametes versicolor, were studied over a period of 3–7 weeks for pretreatment of radiata pine wood chips. Chemical analysis of pretreated biomass showed that the two studied strains were able to selectively degrade lignin. Selective lignin degradation was greater in week 3 of the pretreatment by Trametes versicolor compared to the other strain. Lengthening pretreatment time increased both lignin and cellulose losses which caused a reduction in selective lignin degradation for both strains. X-ray diffractometry showed that after seven weeks of pretreatment, the crystallinity of the woody biomass was decreased significantly. It decreased from 46% for untreated wood chips to 37% and 44% for Stereum hirsutum and Trametes versicolor treated biomass, respectively. The pretreatment with these two white rot fungi showed that 3-week pretreatment provided a cellulose rich biomass with the minimum cellulose loss compared to the other time of pretreatment.

  2. Dicty_cDB: Contig-U01957-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Synthetic construct DNA, clone: pF... 41 0.074 AB241241_1( AB241241 |pid:none) Symbiotic...me: Full=Rac-like GTP-binding protein 3; AltName: ... 38 0.82 AB241244_1( AB241244 |pid:none) Symbiotic prot... DQ667981 |pid:none) Gossypium hirsutum small GTPase (R... 40 0.13 AB241245_1( AB241245 |pid:none) Symbiot...ic protist of Reticuliterme... 40 0.17 BX538352_67( BX538352 |pid:none) Cryptospori

  3. Using Winter Annual Cover Crops in a Virginia No-till Cotton Production System

    OpenAIRE

    Daniel, James B. II

    1997-01-01

    Cotton (Gossypium hirsutum L.) is a low residue crop, that may not provide sufficient surface residue to reduce erosion and protect the soil. A winter annual cover crop could alleviate erosion between cotton crops. Field experiments were conducted to evaluate selected winter annual cover crops for biomass production, ground cover, and N assimilation. The cover crop treatments were monitored under no-till and conventional tillage systems for the effects on soil moisture, cotton yield and qu...

  4. Effect of ionization radiation (γ-rays 60Co) on germination of cotton

    International Nuclear Information System (INIS)

    Lall, S.B.; Bhute, M.G.

    1974-01-01

    Effect of ionization radiation (γ-rays 60 Co) on germination of cotton varieties viz. AK 235 and 197/3, also B 147 and B 296-7 belonging to Gossypium arboreum and Gossypium hirsutum respectively under field and laboratory conditions were studied. Materials under study were tried in two radiation doses i.e. 10,000 r and 20,000 r in two (R1 and R2) generations. In laboratory and field condition, both doses (10,000r and 20,000r) depressed the germination percentage in R1 generation of radiation to greater degree in almost all the varieties of cotton. Maximum depression was noted under field condition in both the varieties belonging to Gossypium arboreum species in R1 generation under 20,000 r. In R2 generation, depressing effect on germination capacity of seed is reduced to much extent in field condition in almost of all the varieties. The germination percentage has increased over control in R2 generation in both doses in laboratory conditions in all the varieties used in this experiment. (author)

  5. Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres

    Science.gov (United States)

    Emergent phenotypes are common in polyploids relative to their diploid progenitors, a phenomenon exemplified by spinnable cotton fibers. Following 15-18 fold paleopolyploidy, allopolyploidy 1-2 million years ago reunited divergent Gossypium genomes, imparting new combinatorial complexity that might ...

  6. Enriching an intraspecific genetic map and identifying QTL for fiber quality and yield component traits across multiple environments in Upland cotton (Gossypium hirsutum L.).

    Science.gov (United States)

    Liu, Xueying; Teng, Zhonghua; Wang, Jinxia; Wu, Tiantian; Zhang, Zhiqin; Deng, Xianping; Fang, Xiaomei; Tan, Zhaoyun; Ali, Iftikhar; Liu, Dexin; Zhang, Jian; Liu, Dajun; Liu, Fang; Zhang, Zhengsheng

    2017-12-01

    Cotton is a significant commercial crop that plays an indispensable role in many domains. Constructing high-density genetic maps and identifying stable quantitative trait locus (QTL) controlling agronomic traits are necessary prerequisites for marker-assisted selection (MAS). A total of 14,899 SSR primer pairs designed from the genome sequence of G. raimondii were screened for polymorphic markers between mapping parents CCRI 35 and Yumian 1, and 712 SSR markers showing polymorphism were used to genotype 180 lines from a (CCRI 35 × Yumian 1) recombinant inbred line (RIL) population. Genetic linkage analysis was conducted on 726 loci obtained from the 712 polymorphic SSR markers, along with 1379 SSR loci obtained in our previous study, and a high-density genetic map with 2051 loci was constructed, which spanned 3508.29 cM with an average distance of 1.71 cM between adjacent markers. Marker orders on the linkage map are highly consistent with the corresponding physical orders on a G. hirsutum genome sequence. Based on fiber quality and yield component trait data collected from six environments, 113 QTLs were identified through two analytical methods. Among these 113 QTLs, 50 were considered stable (detected in multiple environments or for which phenotypic variance explained by additive effect was greater than environment effect), and 18 of these 50 were identified with stability by both methods. These 18 QTLs, including eleven for fiber quality and seven for yield component traits, could be priorities for MAS.

  7. Carcass merit and meat quality in Suffolk lambs, Katahdin lambs, and meat-goat kids finished on a grass-legume pasture with and without supplementation.

    Science.gov (United States)

    Turner, K E; Belesky, D P; Cassida, K A; Zerby, H N

    2014-10-01

    The experiment evaluated traditional U.S. sheep (Suffolk), hair sheep (Katahdin), and meat goat (Boer crossbred; Goat) carcass and meat quality parameters when finished on pasture with and without supplemental whole cottonseed (Gossypium hirsutum L.). Supplemented animals had greater ribeye area (PGoat. Goat LM had less (Pgoats would be acceptable for most ethnic markets in the USA. Omega6:Omega3 ratios in chevon and lamb were within the guidelines for meats that can improve human diets and health. Published by Elsevier Ltd.

  8. Aspectos bioquímicos da resistência do algodoeiro à ramulose potencializada pelo silício

    Directory of Open Access Journals (Sweden)

    Antonia Mirian Nogueira de Moura Guerra

    2013-01-01

    Full Text Available Objetivou-se avaliar o efeito do silício (Si sobre a ramulose e aspectos bioquímicos da resistência do algodoeiro a essa doença. Os cultivares BRS Araçá e FM 993 foram desenvolvidos em solução nutritiva contendo (+Si ou não (-Si silício. Avaliou-se o período de incubação (PI, incidência (I, área abaixo da curva do índice da ramulose (AACIR e concentração foliar de Si (CFSi. A CFSi e o PI aumentaram em 76% e 19,5%, respectivamente, nas plantas +Si em relação às -Si, e a I e a AACIR diminuíram em 64% e 18%, respectivamente. A concentração dos compostos fenólicos solúveis totais (CFST e dos derivados da lignina-ácido tioglicólico (DLATG dos dois cultivares supridos com Si aumentou durante o progresso da ramulose, porém essa concentração foi inferior à daquelas que não receberam Si. No cultivar BRS Araçá +Si a atividade das enzimas quitinase (QUI e glicanase (GLI aumentou até os 10 dai em relação às plantas -Si. A atividade das enzimas peroxidase (POX e polifenoloxidase (PPO no cultivar BRS Araçá +Si aumentou entre 20 e 30 dai em relação às plantas -Si, enquanto na FM 993 +Si o aumento foi de até 10 dai. No cultivar FM 993 +Si, a atividade da fenilalanina amônia-liase (FAL aumentou. O fornecimento de Si às plantas de algodoeiro aumentou a resistência à ramulose mediante incremento na concentração CFST e de DLATG nos dois cultivares e na atividade das POX, PPO, QUI e GLI na BRS Araçá, e de POX e FAL na FM 993.

  9. The Complexity of Posttranscriptional Small RNA Regulatory Networks Revealed by In Silico Analysis of Gossypium arboreum L. Leaf, Flower and Boll Small Regulatory RNAs.

    Directory of Open Access Journals (Sweden)

    Hongtao Hu

    Full Text Available MicroRNAs (miRNAs and secondary small interfering RNAs (principally phased siRNAs or trans-acting siRNAs are two distinct subfamilies of small RNAs (sRNAs that are emerging as key regulators of posttranscriptional gene expression in plants. Both miRNAs and secondary-siRNAs (sec-siRNAs are processed from longer RNA precursors by DICER-LIKE proteins (DCLs. Gossypium arboreum L., also known as tree cotton or Asian cotton, is a diploid, possibly ancestral relative of tetraploid Gossypium hirsutum L., the predominant type of commercially grown cotton worldwide known as upland cotton. To understand the biological significance of these gene regulators in G. arboreum, a bioinformatics analysis was performed on G. arboreum small RNAs produced from G. arboreum leaf, flower, and boll tissues. Consequently, 263 miRNAs derived from 353 precursors, including 155 conserved miRNAs (cs-miRNAs and 108 novel lineage-specific miRNAs (ls-miRNAs. Along with miRNAs, 2,033 miRNA variants (isomiRNAs were identified as well. Those isomiRNAs with variation at the 3'-miRNA end were expressed at the highest levels, compared to other types of variants. In addition, 755 pha-siRNAs derived 319 pha-siRNA gene transcripts (PGTs were identified, and the potential pha-siRNA initiators were predicted. Also, 2,251 non-phased siRNAs were found as well, of which 1,088 appeared to be produced by so-called cis- or trans-cleavage of the PGTs observed at positions differing from pha-siRNAs. Of those sRNAs, 148 miRNAs/isomiRNAs and 274 phased/non-phased siRNAs were differentially expressed in one or more pairs of tissues examined. Target analysis revealed that target genes for both miRNAs and pha-siRNAs are involved a broad range of metabolic and enzymatic activities. We demonstrate that secondary siRNA production could result from initial cleavage of precursors by both miRNAs or isomiRNAs, and that subsequently produced phased and unphased siRNAs could result that also serve as triggers

  10. The Complexity of Posttranscriptional Small RNA Regulatory Networks Revealed by In Silico Analysis of Gossypium arboreum L. Leaf, Flower and Boll Small Regulatory RNAs.

    Science.gov (United States)

    Hu, Hongtao; Rashotte, Aaron M; Singh, Narendra K; Weaver, David B; Goertzen, Leslie R; Singh, Shree R; Locy, Robert D

    2015-01-01

    MicroRNAs (miRNAs) and secondary small interfering RNAs (principally phased siRNAs or trans-acting siRNAs) are two distinct subfamilies of small RNAs (sRNAs) that are emerging as key regulators of posttranscriptional gene expression in plants. Both miRNAs and secondary-siRNAs (sec-siRNAs) are processed from longer RNA precursors by DICER-LIKE proteins (DCLs). Gossypium arboreum L., also known as tree cotton or Asian cotton, is a diploid, possibly ancestral relative of tetraploid Gossypium hirsutum L., the predominant type of commercially grown cotton worldwide known as upland cotton. To understand the biological significance of these gene regulators in G. arboreum, a bioinformatics analysis was performed on G. arboreum small RNAs produced from G. arboreum leaf, flower, and boll tissues. Consequently, 263 miRNAs derived from 353 precursors, including 155 conserved miRNAs (cs-miRNAs) and 108 novel lineage-specific miRNAs (ls-miRNAs). Along with miRNAs, 2,033 miRNA variants (isomiRNAs) were identified as well. Those isomiRNAs with variation at the 3'-miRNA end were expressed at the highest levels, compared to other types of variants. In addition, 755 pha-siRNAs derived 319 pha-siRNA gene transcripts (PGTs) were identified, and the potential pha-siRNA initiators were predicted. Also, 2,251 non-phased siRNAs were found as well, of which 1,088 appeared to be produced by so-called cis- or trans-cleavage of the PGTs observed at positions differing from pha-siRNAs. Of those sRNAs, 148 miRNAs/isomiRNAs and 274 phased/non-phased siRNAs were differentially expressed in one or more pairs of tissues examined. Target analysis revealed that target genes for both miRNAs and pha-siRNAs are involved a broad range of metabolic and enzymatic activities. We demonstrate that secondary siRNA production could result from initial cleavage of precursors by both miRNAs or isomiRNAs, and that subsequently produced phased and unphased siRNAs could result that also serve as triggers of a second

  11. Variation in water-use efficiency and its relation to carbon isotope ratio in cotton

    International Nuclear Information System (INIS)

    Saranga, Y.; Flash, I.; Yakir, D.

    1998-01-01

    Cotton (Gossypium spp.) is often exposed to drought, which adversely affects both yield and quality. Improved water-use efficiency (WUE = total dry matter produced or yield harvested / water used) is expected to reduce these adverse effects. Genetic variability in WUE and its association with photosynthetic rate and carbon isotope ratio (13C/12C) in cotton are reported in this paper. WUE of six cotton cultivars--G. hirsutum L., G. barbadense L., and an interspecific F1 hybrid (G. hirsutum x G. barbadense, ISH), was examined under two irrigation regimes in two field trials. The greatest WUE was obtained by two G. hirsutum cultivars (2.55 g dry matter or 1.12 g seed-cotton L-1 H2O) the ISH obtained similar or somewhat lower values, and that G. barbadense cultivars and one G. hirsutum cultivar exhibited the lowest values (2.1 g dry matter or 0.8 to 0.85 g seed-cotton L-1 H2O). These results indicate that different cotton cultivars may have evolved different environmental adaptations that affect their WUE. Photosynthetic rate was correlated with WUE in only a few cases emphasizing the limitation of this parameter as a basis for estimating crop WUE. Under both trials WUE was positively correlated with carbon isotope ratio, indicating the potential of this technique as a selection criterion for improving cotton WUE

  12. Oviposição do curuquerê e alimentação de suas lagartas neonatas em algodoeiros tratados com caulim

    Directory of Open Access Journals (Sweden)

    Suziane Gomes Gonçalves

    2015-07-01

    Full Text Available Resumo: O objetivo deste trabalho foi avaliar a capacidade do caulim de afetar a oviposição e a alimentação de Alabama argillacea (Lepidoptera: Noctuidae em algodoeiro. Determinou-se a preferência de oviposição, a viabilidade de ovos e o consumo das lagartas de primeiro instar de A. argillacea, em folhas de algodão tratadas ou não com caulim. A preferência de oviposição foi determinada por teste de escolha e confinamento, em delineamento experimental de blocos ao acaso, em arranjo fatorial 2x7, representado pelos tratamentos com caulim em água destilada (60 g L-1 ou somente água destilada (testemunha, e pela avaliação de sete estruturas vegetais da planta. O consumo pelas lagartas de primeiro instar foi determinado em delineamento experimental inteiramente casualizado, em arranjo fatorial 2x4, representado pelo tratamento com caulim em água destilada, pela testemunha e pelos quatro períodos de observação (6, 12, 24 e 48 horas. A oviposição das mariposas do curuquerê-do-algodoeiro foi reduzida nas plantas de algodão tratadas com caulim; no entanto, a viabilidade dos ovos não foi afetada. A folha da haste foi a estrutura preferida para oviposição. A sobrevivência e o consumo de lagartas de primeiro instar do curuquerê são menores nas plantas de algodão tratadas com caulim.

  13. An evaluation of some mutant cotton (Gossypium hirsutum L ...

    African Journals Online (AJOL)

    user1

    2013-08-14

    Aug 14, 2013 ... to the high percentage of the seed oil and protein. ... Yield, yield components and fiber technological traits in .... L.) genotypes during the main growing season, from ... interaction was highly significant, indicating differential .... Combined analysis of variance of the varieties tested for yield,yield components, ...

  14. Genetics of the ovule fuzzless trait in Gossypium arboreum germplasm line PI 615737

    Science.gov (United States)

    The diploid cotton species Gossypium arboreum possesses many favorable agronomic traits such as drought tolerance and disease resistance, which can be utilized in the development of improved upland cotton cultivars. The USDA National Plant Germplasm System maintains more than 1,600 G. arboreum acces...

  15. Biomembrane stabilization and antiulcerogenic properties of aqueous leaf extract of Gossypium barbadense L. (Malvaceae

    Directory of Open Access Journals (Sweden)

    S. Sabiu

    2017-12-01

    Full Text Available Gossypium spp. belong to a class of botanicals with global therapeutic applications against a number of disorders including ulcers. This study evaluated the membrane stabilization and detoxification potential of aqueous leaf extract of Gossypium barbadense L. (Malvaceae in indomethacin-induced oxidative gastric ulceration in Wistar rats. The ulcerated rats were orally pretreated with the extract and esomeprazole for 4 weeks. Gastric function and antioxidative parameters were thereafter evaluated. The indomethacin-mediated significant elevations in the ulcer index, gastric volume, pepsin activity and mucosal level of malondialdehyde were dosedependently attenuated in the extract-treated animals. The extract also significantly modulated and improved the pH, mucin content, glutathione (reduced as well as gastric activities of superoxide dismutase and catalase in the ulcerated rats. These improvements may be ascribed to the antioxidant and membrane stabilization activities of the extract which are attributable to its active metabolites as revealed by the analytical chromatogram. The observed effects compared favorably with that of esomeprazole and are suggestive of the capability of the extract to prevent mucosal damage and preserve gastric functions as evidently supported by the macroscopical appearance of the stomachs and the % ulcer inhibitory values. Conclusively, the overall data from the present findings suggest that the aqueous leaf extract of G. barbadense could prevent indomethacin-mediated oxidative gastric ulceration via fortification of antioxidant defense mechanisms. Keywords: Esomeprazole, Gossypium barbadense, Indomethacin, Mucosal damage, Oxidative stress

  16. Density and Seasonal Dynamics of Bemisia tabaci (Gennadius) Mediterranean on Common Crops and Weeds around Cotton Fields in Northern China

    DEFF Research Database (Denmark)

    Zhang, Xiao-ming; Yang, Nian-wan; Wan, Fang-hao

    2014-01-01

    theophrasti Medicus), sunflower (Helianthus annuus L.), sweet potato (Ipomoea batatas L.), soybean (Glycine max L.), and maize (Zea mays L.). The whitefly species identity was repeatedly tested and confirmed; seasonal dynamics on the various host plants was standardized by the quartile method. B. tabaci MED......The density seasonal dynamics of Bemisia tabaci MED were evaluated over two-years in a cotton-growing area in Langfang, Hebei Province, northern China on cotton (Gossypium hirsutum L.) and six other, co-occurring common plants: common ragweed (Ambrosia artemisiifolia L.), piemarker (Abutilon...

  17. Development of a core set of SSR markers for the characterization of Gossypium germplasm

    Science.gov (United States)

    Molecular markers such as simple sequence repeats (SSR) are a useful tool for characterizing genetic diversity of Gossypium germplasm collections. Genetic profiles by DNA fingerprinting of cotton accessions can only be compared among different collections if a common set of molecular markers are us...

  18. Amélioration de la méthode d'extraction d'ADN au CTAB appliquée aux feuilles de cotonnier

    Directory of Open Access Journals (Sweden)

    Mergeai G.

    2006-01-01

    Full Text Available Improvement of the genomic DNA extraction method with CTAB for cotton leaves. Molecular genetic analysis in cotton (Gossypium hirsutum L. is often limited by the availability of fresh tissue and the time necessary to extract DNA from it. To overcome these problems, the original CTAB method was improved. The major modifi cations concern DNA precipitation at -20°C, incubation of the resuspended DNA at 60°C and centrifugation at 4°C for all extraction steps. The improved method was relatively fast, cheap and yielded high quality DNA (80-200 μg . g-1. The optimized protocol gives satisfactory results on dried and frozen leaves at -80°C. The DNA was suitable for restriction-enzyme digestion with EcoRI and as a template for polymerase chain reaction (PCR using more than two hundred microsatellite cotton primers on different cotton species, the G. hirsutum × G. raimondii × G. sturtianum trispecifi c hybrid and its progenies.

  19. Efeitos de relações CaSO4/CaCO3 na mobilidade de nutrientes no solo e no crescimento do algodoeiro

    Directory of Open Access Journals (Sweden)

    A. A. Silva

    1998-09-01

    Full Text Available O experimento, realizado em casa de vegetação no Departamento de Ciência do Solo da Universidade Federal de Lavras, teve por objetivo estudar o efeito de diferentes relações de CaSO4/CaCO3, que simulam o uso de gesso e calcário, na movimentação de nutrientes no solo e no crescimento do algodoeiro, cultivar IAC-20. As proporções de CaSO4/CaCO3 utilizadas foram: 0/100, 25/75, 50/50, 75/25 e 100/0, com base em peso equivalente, além de um tratamento-testemunha, sem aplicação de CaSO4 e CaCO3. Observou-se acentuada movimentação de cálcio e de sulfato em profundidade, como íons acompanhantes, com o aumento da relação CaSO4/CaCO3. Para o N-NO3- e Mg2+, ao contrário do N-NH4+ e K+, observou-se um acúmulo em profundidade, com a elevação da relação CaSO4/CaCO3. Neste estudo, o gesso teve pouco ou nenhum efeito sobre a acidez e Al trocável presentes nas camadas subsuperficiais. A produção de matéria seca do algodoeiro foi reduzida com o aumento da relação CaSO4/CaCO3, porém, quando comparada à do tratamento-testemunha, a aplicação de gesso aumentou-a significativamente, atestando o potencial de uso do gesso agrícola.

  20. Mecanismos bioquímicos da defesa do algodoeiro à mancha de ramulária mediados pelo silício

    Directory of Open Access Journals (Sweden)

    Carmen Rosa da Silva Curvêlo

    2013-03-01

    Full Text Available Esse estudo investigou o efeito do silício (Si na resistência do algodoeiro à mancha de ramulária (Ramularia areola. Plantas de algodoeiro (cvs. NuOpal e BRS Buriti foram cultivadas em solução nutritiva nas concentrações de 0 (-Si e 2 mM Si L-1 (+Si e aos 30 dias após emergência foram submetidas à inoculação com uma suspensão de conídios de R. areola. Avaliou-se o período de incubação (PI, o período latente (PL60, a severidade, o número de lesões (NL por cm² de folha, o tamanho de lesão (TL, a concentração foliar de Si e as atividades das enzimas de defesa peroxidases (POX, polifenoloxidases (PFO, quitinases (QUI, β-1,3-glucanases (GLU e fenilalanina amônia-liases (FAL. Os dados de severidade foram usados para calcular a área abaixo da curva do progresso da mancha de ramulária (AACPMR. A concentração foliar de Si aumentou em 64% nas plantas supridas com Si em relação às não supridas com esse elemento. Houve aumentos de 10% e 14,7%, respectivamente, para o PI e o PL60 nas plantas supridas com Si. Reduções de 38,6% e 62,4% para o NL e de 17,2% e 26,6% para o TL ocorrem, respectivamente, nas plantas das cvs. NuOpal e BRS Buriti supridas com Si. Houve redução de 35% na AACPMR para as plantas supridas com Si em relação às não supridas. A concentração de compostos fenólicos solúveis totais nas plantas das duas cultivares supridas com Si foi maior aos 21 dias após inoculação (dai em relação às não supridas com esse elemento. A concentração dos derivados da lignina foi maior dos 15 aos 21 dai apenas para as plantas da cv. BRS Buriti supridas com Si. A atividade da POX foi maior nas plantas das duas cultivares supridas com Si em relação às não supridas com esse elemento dos 15 aos 21 dai. Paras as plantas da cv. NuOpal supridas com Si, as atividades da PFO, QUI, GLU e FAL aumentaram aos 18 dai. As atividades da PFO e da FAL nas plantas da cv. BRS Buriti não foram potencializadas pelo Si. Nas

  1. Screening of cotton (gossypium hirsutum l.) genotypes for heat tolerance

    International Nuclear Information System (INIS)

    Abro, S.; Khan, M.A.; Sial, M.A.

    2015-01-01

    Cotton yield is highly affected due to biotic (diseases and pests) and abiotic (heat, dought and salinity) Stresses. Among them, high temperature is the main environmental constraint which adversely reduces cotton yield and quality. High temperature above 36 degree C affects plant growth and development especially during reproductive phase. Present studies were carried out to assess the tolerance of fifty-eight newly evolved cotton genotypes to heat stresses, based on agronomic and physiological characteristics. The genotypes were screened in field conditions under two temperature regimes. The studies were conducted at experimental farm of Nuclear Institute of Agriculture, Tando Jam, Pakistan. The results showed that March sown crop experienced high temperature (i.e. > 44 degree C in May and June), which significantly affected crop growth and productivity. The genotypes were identified as heat-tolerant on the basis of relative cell injury percentage (RCI %), heat susceptibility index (HSI) values, boll retention and seed cotton yield (kg/ha). RCI level in cotton genotypes ranged from 39.0 to 86.0%. Out of 58, seventeen genotypes (viz.NIA-80, NIA-81, NIA-83, NIA-84, NIA-M-30, NIA-M31, NIA-HM-48, NIA-HM-327, NIA-H-32, NIA-HM-2-1, NIA-Bt1, NIA-Bt2, NIA-Perkh, CRIS-342, CRIS-134, NIAB-111 and check variety Sadori indicated high level of heat tolerance at both (heat-stressed and non-stressed) temperature regimes; as shown the lowest relative injury level and relatively heat resistant index (HSI<1) values. Such genotypes could be used as heattolerant genotypes under heat-stressed environments. (author)

  2. Yield and fiber quality properties of cotton (Gossypium hirsutum L ...

    African Journals Online (AJOL)

    Jane

    2011-10-03

    Oct 3, 2011 ... The experiment was laid out as a randomized split block design (RSBD) with four replications. ... classified as a drought tolerant crop as some other plants species such ..... character for textile industry and spinning technology,.

  3. Asymmetric evolution and domestication in allotetraploid cotton (Gossypium hirsutum L.

    Directory of Open Access Journals (Sweden)

    Lei Fang

    2017-04-01

    Full Text Available Polyploidy plays a major role in genome evolution, which corresponds to environmental changes over millions of years. The mechanisms of genome evolution, particularly during the process of domestication, are of broad interest in the fields of plant science and crop breeding. Upland cotton is derived from the hybridization and polyploidization of its ancient A and D diploid ancestors. As a result, cotton is a model for polyploid genome evolution and crop domestication. To explore the genomic mysteries of allopolyploid cotton, we investigated asymmetric evolution and domestication in the A and D subgenomes. Interestingly, more structural rearrangements have been characterized in the A subgenome than in the D subgenome. Correspondingly, more transposable elements, a greater number of lost and disrupted genes, and faster evolution have been identified in the A subgenome. In contrast, the centromeric retroelement (RT-domain related sequence of tetraploid cotton derived from the D subgenome progenitor was found to have invaded the A subgenome centromeres after allotetrapolyploid formation. Although there is no genome-wide expression bias between the subgenomes, as with expression-level alterations, gene expression bias of homoeologous gene pairs is widespread and varies from tissue to tissue. Further, there are more positively selected genes for fiber yield and quality in the A subgenome and more for stress tolerance in the D subgenome, indicating asymmetric domestication. This review highlights the asymmetric subgenomic evolution and domestication of allotetraploid cotton, providing valuable genomic resources for cotton research and enhancing our understanding of the basis of many other allopolyploids.

  4. Problems and achievements of cotton (Gossypium Hirsutum L. weeds control

    Directory of Open Access Journals (Sweden)

    T. Barakova

    2017-09-01

    Full Text Available Abstract. Weed control in the cultivation of cotton is critical to the yield and quality of production. The influence of economically important weeds was studied. Chemical control is the most effective method of weed control in cotton but much of the information on it relates to primary weed infestation. Problems with primary weed infestation in cotton have been solved to a significant extent. The question of secondary weed infestation with annual and perennial graminaceous weeds during the period of cotton vegetation is also determined largely by the use of antigraminaceous herbicides. The data related to herbicides to effectively control secondary germinated broadleaf weeds in conventional technology for cotton growing are quite scarce, even globally. We are still seeking effective herbicides for control of these weeds in cotton crops. Studies on their influence on the sowing characteristics of cotton seed and the quality of cotton fiber are still insufficient. In the scientific literature there is not enough information on these questions. The combinations of herbicides, as well as their tank mixtures with fertilizers or plant growth regulators are more efficient than autonomous application. Often during their combined application higher synergistic effect on yield is produced. There is information about cotton cultivars resistant to glyphosate. These cultivars are GMO and they are banned within the European Union, including Bulgaria.

  5. Correlations and Correlated Responses in Upland Cotton (Gossypium hirsutum L.

    Directory of Open Access Journals (Sweden)

    Echekwu, CA.

    2001-01-01

    Full Text Available Plant breeders must be concerned with the total array of economic characters in their efforts to develop a crop variety acceptable to farmers. Their selection endeavours must therefore take into consideration how changes in one trait affect, simultaneously changes in other economic attributes. The importance of correlations and correlated responses is therefore self evident in plant breeding endeavours. In this study F3 progenies from a cross between two cotton lines SAMCOT-9 x Y422 were evaluated for two years and performance data were used to obtain correlations between nine agronomic and fibre quality traits in upland cotton. The results indicated that plant helght was significantly and positively correlated with seed cotton yield, number of sympodial and monopodial branches, seed index, fibre length and micronaire index. Positive and significant correlations were also obtained between : seed cotton yield, tint percent and fibre strength and fibre length. Significant negative correlations were obtained between : plant height and lint percent ; number of monopodial branches, sympodial branches and lint percent ; fibre length, fibre strength and micronaire index. The correlated responses in the other eight traits when selection was practiced for seed cotton yield in the present study shows that it might be more profitable to practice direct selection for seed cotton yield compared to selecting for seed cotton yield through any of the other traits.

  6. Transcriptome Sequencing and Differential Gene Expression Analysis of Delayed Gland Morphogenesis in Gossypium australe during Seed Germination

    Science.gov (United States)

    Tao, Tao; Zhao, Liang; Lv, Yuanda; Chen, Jiedan; Hu, Yan; Zhang, Tianzhen; Zhou, Baoliang

    2013-01-01

    The genus Gossypium is a globally important crop that is used to produce textiles, oil and protein. However, gossypol, which is found in cultivated cottonseed, is toxic to humans and non-ruminant animals. Efforts have been made to breed improved cultivated cotton with lower gossypol content. The delayed gland morphogenesis trait possessed by some Australian wild cotton species may enable the widespread, direct usage of cottonseed. However, the mechanisms about the delayed gland morphogenesis are still unknown. Here, we sequenced the first Australian wild cotton species ( Gossypium australe ) and a diploid cotton species ( Gossypium arboreum ) using the Illumina Hiseq 2000 RNA-seq platform to help elucidate the mechanisms underlying gossypol synthesis and gland development. Paired-end Illumina short reads were de novo assembled into 226,184, 213,257 and 275,434 transcripts, clustering into 61,048, 47,908 and 72,985 individual clusters with N50 lengths of 1,710 bp, 1544 BP and 1,743 bp, respectively. The clustered Unigenes were searched against three public protein databases (TrEMBL, SwissProt and RefSeq) and the nucleotide and protein sequences of Gossypium raimondii using BLASTx and BLASTn. A total of 21,987, 17,209 and 25,325 Unigenes were annotated. Of these, 18,766 (85.4%), 14,552 (84.6%) and 21,374 (84.4%) Unigenes could be assigned to GO-term classifications. We identified and analyzed 13,884 differentially expressed Unigenes by clustering and functional enrichment. Terpenoid-related biosynthesis pathways showed differentially regulated expression patterns between the two cotton species. Phylogenetic analysis of the terpene synthases family was also carried out to clarify the classifications of TPSs. RNA-seq data from two distinct cotton species provide comprehensive transcriptome annotation resources and global gene expression profiles during seed germination and gland and gossypol formation. These data may be used to further elucidate various mechanisms and

  7. Seletividade de clomazone isolado ou em mistura para a cultura do algodoeiro Selectivity of clomazone applied alone or in tank mixtures to cotton

    Directory of Open Access Journals (Sweden)

    H.A Dan

    2011-09-01

    Full Text Available O clomazone destaca-se como um dos principais herbicidas utilizados em pré-emergência na cultura do algodoeiro, mesmo levando-se em conta o fato de que muito pouco se sabe em relação à sua seletividade para a cultura. Objetivou-se com este trabalho avaliar a seletividade do clomazone isolado ou em mistura com outros herbicidas utilizados em pré-emergência na cultura do algodoeiro. O delineamento experimental foi o de blocos ao acaso, com quatro repetições, com a utilização de testemunhas duplas. Foram avaliados 13 tratamentos, os quais foram constituídos de clomazone isolado ou combinado com os herbicidas S-metolachlor, diuron, prometryne, alachlor, oxyfluorfen e trifluralin. Foram avaliados porcentagem de fitointoxicação, estande final, altura de plantas, número de maçãs e rendimento final de algodão em caroço. O clomazone, isolado nas doses de 1,00 e 1,25 kg ha-1 ou em associação com S-metolachlor (0,76 kg ha-1, diuron (1,50 kg ha-1, prometryne (1,50 kg ha-1, alachlor (1,44 kg ha-1 e trifluralin (1,80 kg ha-1, foi seletivo à cultura do algodão cv. Nu Opal. Em contrapartida, sua associação com oxyfluorfen (1,25 + 0,19 kg ha-1, trifluralin + diuron (1,25 + 1,80 + 1,50 kg ha-1 e trifluralin + prometryne (1,25 + 1,80 + 1,50 kg ha-1 proporcionou redução na produtividade do algodoeiro.Clomazone is one of the most important herbicides applied in pre-emergence in cotton, even though not much is known about its selectivity to this crop. This work was carried out to evaluate the selectivity of clomazone applied alone or in tank mixtures with other herbicides applied in pre-emergence in cotton. The experiment was designed as a randomized block, with four replicates, using two-fold checks. Thirteen treatments were evaluated, constituted by different combinations of clomazone with S-metolachlor, diuron, prometryne, alachlor, oxyfluorfen, and trifluralin. After herbicide application, visual crop injury was evaluated, as well as

  8. Genome-wide identification of mitogen-activated protein kinase gene family in Gossypium raimondii and the function of their corresponding orthologs in tetraploid cultivated cotton.

    Science.gov (United States)

    Zhang, Xueying; Wang, Liman; Xu, Xiaoyang; Cai, Caiping; Guo, Wangzhen

    2014-12-10

    Mitogen-activated protein kinase (MAPK) cascades play a crucial role in plant growth and development as well as biotic and abiotic stress responses. Knowledge about the MAPK gene family in cotton is limited, and systematic investigation of MAPK family proteins has not been reported. By performing a bioinformatics homology search, we identified 28 putative MAPK genes in the Gossypium raimondii genome. These MAPK members were anchored onto 11 chromosomes in G. raimondii, with uneven distribution. Phylogenetic analysis showed that the MAPK candidates could be classified into the four known A, B, C and D groups, with more MAPKs containing the TEY phosphorylation site (18 members) than the TDY motif (10 members). Furthermore, 21 cDNA sequences of MAPKs with complete open reading frames (ORFs) were identified in G. hirsutum via PCR-based approaches, including 13 novel MAPKs and eight with homologs reported previously in tetraploid cotton. The expression patterns of 23 MAPK genes reveal their important roles in diverse functions in cotton, in both various developmental stages of vegetative and reproductive growth and in the stress response. Using a reverse genetics approach based on tobacco rattle virus-induced gene silencing (TRV-VIGS), we further verified that MPK9, MPK13 and MPK25 confer resistance to defoliating isolates of Verticillium dahliae in cotton. Silencing of MPK9, MPK13 and MPK25 can significantly enhance cotton susceptibility to this pathogen. This study presents a comprehensive identification of 28 mitogen-activated protein kinase genes in G. raimondii. Their phylogenetic relationships, transcript expression patterns and responses to various stressors were verified. This study provides the first systematic analysis of MAPKs in cotton, improving our understanding of defense responses in general and laying the foundation for future crop improvement using MAPKs.

  9. Functional characterization of AGAMOUS-subfamily members from cotton during reproductive development and in response to plant hormones.

    Science.gov (United States)

    de Moura, Stéfanie Menezes; Artico, Sinara; Lima, Cássio; Nardeli, Sarah Muniz; Berbel, Ana; Oliveira-Neto, Osmundo Brilhante; Grossi-de-Sá, Maria Fátima; Ferrándiz, Cristina; Madueño, Francisco; Alves-Ferreira, Márcio

    2017-03-01

    Expression analysis of the AG -subfamily members from G. hirsutum during flower and fruit development. Reproductive development in cotton, including the fruit and fiber formation, is a complex process; it involves the coordinated action of gene expression regulators, and it is highly influenced by plant hormones. Several studies have reported the identification and expression of the transcription factor family MADS-box members in cotton ovules and fibers; however, their roles are still elusive during the reproductive development in cotton. In this study, we evaluated the expression profiles of five MADS-box genes (GhMADS3, GhMADS4, GhMADS5, GhMADS6 and GhMADS7) belonging to the AGAMOUS-subfamily in Gossypium hirsutum. Phylogenetic and protein sequence analyses were performed using diploid (G. arboreum, G. raimondii) and tetraploid (G. barbadense, G. hirsutum) cotton genomes, as well as the AG-subfamily members from Arabidopsis thaliana, Petunia hybrida and Antirrhinum majus. qPCR analysis showed that the AG-subfamily genes had high expression during flower and fruit development in G. hirsutum. In situ hybridization analysis also substantiates the involvement of AG-subfamily members on reproductive tissues of G. hirsutum, including ovule and ovary. The effect of plant hormones on AG-subfamily genes expression was verified in cotton fruits treated with gibberellin, auxin and brassinosteroid. All the genes were significantly regulated in response to auxin, whereas only GhMADS3, GhMADS4 and GhMADS7 genes were also regulated by brassinosteroid treatment. In addition, we have investigated the GhMADS3 and GhMADS4 overexpression effects in Arabidopsis plants. Interestingly, the transgenic plants from both cotton AG-like genes in Arabidopsis significantly altered the fruit size compared to the control plants. This alteration suggests that cotton AG-like genes might act regulating fruit formation. Our results demonstrate that members of the AG-subfamily in G. hirsutum

  10. Selection of optimal doses for mutation induction in two species of cotton G.hirsutum and G. barbadense

    International Nuclear Information System (INIS)

    Jawdat, D.; Karajoli, I.

    2007-05-01

    Seeds from six varieties of Gossypium hirusutum and from one variety of Gossypium barbadense were cultured in plastic containers (20 x 60 x 30 cm) with compost (Terfgroup, Netherlands). Germination readings were taken 14 days after culture, where plants with first true leaf was chosen for readings. The highest percentages of germinations were 83.3 (C6040) and 80 % (Rakka 5). Seeds of Rakka 5 were subjected to gamma radiation (60 C o) with radiation activity of 4 kci using the Gamma cell (Isolvated, made in Russia) at the Radiation Technology department at the AECS. The following doses were used in a rate of 1.8548 KGry/h: 100,150, 200, 250, 300, 350,400 and 500 Gry. On the other hand, seeds of C6040 were subjected to 100,150,200, 250 and 300 Gry. The results indicated the effects of gamma radiation doses on germination rate, plant height, distance between cotyledons leaves and first true leaf and flowering time.(author)

  11. Simple Sequence Repeat (SSR Genetic Linkage Map of D Genome Diploid Cotton Derived from an Interspecific Cross between Gossypium davidsonii and Gossypium klotzschianum

    Directory of Open Access Journals (Sweden)

    Joy Nyangasi Kirungu

    2018-01-01

    Full Text Available The challenge in tetraploid cotton cultivars is the narrow genetic base and therefore, the bottleneck is how to obtain interspecific hybrids and introduce the germplasm directly from wild cotton to elite cultivars. Construction of genetic maps has provided insight into understanding the genome structure, interrelationships between organisms in relation to evolution, and discovery of genes that carry important agronomic traits in plants. In this study, we generated an interspecific hybrid between two wild diploid cottons, Gossypium davidsonii and Gossypium klotzschianum, and genotyped 188 F2:3 populations in order to develop a genetic map. We screened 12,560 SWU Simple Sequence Repeat (SSR primers and obtained 1000 polymorphic markers which accounted for only 8%. A total of 928 polymorphic primers were successfully scored and only 728 were effectively linked across the 13 chromosomes, but with an asymmetrical distribution. The map length was 1480.23 cM, with an average length of 2.182 cM between adjacent markers. A high percentage of the markers on the map developed, and for the physical map of G. raimondii, exhibited highly significant collinearity, with two types of duplication. High level of segregation distortion was observed. A total of 27 key genes were identified with diverse roles in plant hormone signaling, development, and defense reactions. The achievement of developing the F2:3 population and its genetic map constructions may be a landmark in establishing a new tool for the genetic improvement of cultivars from wild plants in cotton. Our map had an increased recombination length compared to other maps developed from other D genome cotton species.

  12. Seleção de isolados de Beauveria bassiana patogênicos ao bicudo-do-algodoeiro Selection of isolates of Beauveria bassiana pathogenic to cotton boll weevil

    Directory of Open Access Journals (Sweden)

    Carlos Alberto Domingues da Silva

    2001-02-01

    Full Text Available Objetivou-se selecionar isolados de Beauveria bassiana (Balsamo Vüillemin provenientes de diferentes hospedeiros e regiões geográficas, patogênicos ao Anthonomus grandis, o bicudo-do-algodoeiro. Foram analisados 12 isolados em condições de laboratório. Os isolados obtidos originalmente de A. grandis foram pouco virulentos a essa praga. A mortalidade do bicudo teve início no segundo dia após a inoculação das suspensões fúngicas, variando de 15% a 83%, com TL50 entre 5,30 a 11,06 dias. Os isolados apresentaram variabilidade quanto à germinação dos conídios em meio de cultura artificial, e esta não se correlacionou com a patogenicidade. O isolado CG138 de B. bassiana destacou-se como um dos mais virulentos ao bicudo-do-algodoeiro.The objective of this work was to screen pathogenic isolates of Beauveria bassiana (Balsamo Vüillemin from different hosts and geographic regions, pathogenic to the cotton boll weevil. Twelve isolates were evaluated. Isolates originally obtained from boll weevil showed low pathogenicity against this host. Insect mortality began on the second day after inoculation by fungal suspension, ranging from 15% to 83%, with a TL50 of 5.30 to 11.06 days. Variability among isolates concerning conidial germination in artificial culture medium was verified, and TG50 did not correlate with pathogenicity. One of the most virulent isolates of B. bassiana against cotton boll weevil is CG138.

  13. Residualidad del ácido sulfúrico aplicado como enmienda, y calculado de acuerdo con la CIC y con la suma de bases, sobre la estabilidad de los agregados en dos suelos salino-sódicos de la zona de Palmaseca, Valle del Cauca Residualidad del acido sulfúrico aplicado como enmienda, y calculado de acuerdo con la c 1c y con la suma de bases, sobre la estabilidad de los agregados en dos suelos salino-sódicos de la zona de palma seca, Valle del Cauca

    Directory of Open Access Journals (Sweden)

    Charry Calle Jairo

    1988-12-01

    Full Text Available Los dos suelos salino-sódicos se cultivaron sucesivamente con algodón (Gossypium hirsutum var. Gossica P-21, soya (Glycine max var. ICA- Tunía y fríjol (Phaseolus vulgaris var. ICA- Gualí. La estabilidad de los agregados para los suelos, tratamientos y cultivos, se comparó calculando el área localizada debajo de cada una de las curvas aditivas porcentuales de los agregados, entre los parámetros menor de 025 mm y 0.42-0.84 mm.Residuality of sulfuric acid applied as amendment and calculated according to CEC and Sum of Exchangeable Bases (Ca, Mg, Na and K on the aggregate stability of two saline-sodic soils from Palmaseca zone , Cauca Valley, successively cultivated in cotton (Gossypium hirsutum var. Gossica P- 211. soybean (Glycine max var. ICA Tunía and bean (Phaseolus vulgaris var. ICA-Gualí was studied. The aggregate stability for two soils, treatments and crops, was compared by calculating the area located below each one of the accumulative percentage curves of aggregates, between less than 025 mm and 0.42-084 mm parameters. The results showed: A percent increase up to 56% in the aggregate stability of both soils, in treatments calculated according to CEC cultivated in soybean, and Sum of Exchangeable Bases cultivated in bean. The characteristic roots do not have a pronounced effect on aggregation. The initial and final chemical analysis of soils cultivated in cotton, bean and soybean showed in general, a 90 to 98% reductions of levels of sulphate, exchangeable sodium and exchangeable sodium percentage.

  14. Genetic diversity and relationship analysis of Gossypium arboreum accessions.

    Science.gov (United States)

    Liu, F; Zhou, Z L; Wang, C Y; Wang, Y H; Cai, X Y; Wang, X X; Zhang, Z S; Wang, K B

    2015-11-19

    Simple sequence repeat techniques were used to identify the genetic diversity of 101 Gossypium arboreum accessions collected from India, Vietnam, and the southwest of China (Guizhou, Guangxi, and Yunnan provinces). Twenty-six pairs of SSR primers produced a total of 103 polymorphic loci with an average of 3.96 polymorphic loci per primer. The average of the effective number of alleles, Nei's gene diversity, and Shannon's information index were 0.59, 0.2835, and 0.4361, respectively. The diversity varied among different geographic regions. The result of principal component analysis was consistent with that of unweighted pair group method with arithmetic mean clustering analysis. The 101 G. arboreum accessions were clustered into 2 groups.

  15. Época apropriada para a poda apical do algodoeiro para o controle de pragas

    Directory of Open Access Journals (Sweden)

    Robério Carlos dos Santos Neves

    2010-12-01

    Full Text Available O objetivo deste trabalho foi determinar a época apropriada para a realização da poda apical em algodoeiro. O trabalho foi realizado durante as safras de 2008 e 2009 (maio a novembro em delineamento de blocos ao acaso, em dois ambientes, com as variedades: BRS 201, de fibra branca, e BRS Rubi, BRS Safira e BRS Verde, de fibra colorida, em Paudalho, PE; e BRS 201 e BRS Rubi, em Surubim, PE. A poda apical consistiu na retirada dos ápices das plantas com estruturas vegetativas e reprodutivas, em duas idades fenológicas: com 50% das maçãs maduras (poda I e no surgimento dos primeiros capulhos (poda II. A poda I resultou em maior retirada de botões florais do que a poda II. Em ambas as podas, houve a retirada de cinco nós dos ponteiros. A produção e a qualidade de fibra não diferiram entre plantas podadas ou não. Um número significativo de estruturas atacadas foi eliminado pela poda. A poda apical é recomendada para reduzir o número de estruturas não produtivas, ao final da safra, que são utilizadas como hospedeiras de pragas

  16. Influência do período de armazenamento do caupi [Vigna unguiculata (L. Walp.], tratado com óleos essenciais e fixos, no controle de Callosobruchus maculatus (Fabricius, 1775 (Coleoptera, Chrysomelidae, Bruchinae Influence of the storage period of cowpea [Vigna unguiculata (L. Walp.] treated with essential and fixed oils, for the control of Callosobruchus maculatus (Fabricius, 1775 (Coleoptera, Chrysomelidae, Bruchinae

    Directory of Open Access Journals (Sweden)

    Adriana Carla Ribeiro Lopes Pereira

    2009-02-01

    Full Text Available Compostos secundários obtidos de plantas podem ser utilizados no controle de Callosobruchus maculatus, como uma tática alternativa potencial aos inseticidas sintéticos. Foram testados óleos essenciais (Cymbopogon martini Roxb., Piper aduncum L., Piper hispidinervum C.DC., Melaleuca sp., Lippia gracillis Shau e fixos (Helianthus annus L., Sesamum indicum L., Gossypium hirsutum L., Glycine max L. e Caryocar brasiliense Camb., na concentração de 50µl/20g, de acordo com estudos anteriores. Grãos de caupi, cv. Sempre Verde, foram impregnados com os óleos, em recipientes de vidro e submetidos à agitação manual por dois minutos. Cada parcela de 20g foi infestada com oito fêmeas de C. maculatus com 0 a 48h de idade, durante quatro dias. Os óleos foram avaliados logo após a impregnação e aos 30, 60, 90 e 120 dias de armazenamento. Na primeira avaliação, todos os óleos essenciais provocaram 100% de mortalidade e para os óleos fixos, a mortalidade variou entre 35% (G. hirsutum e 67,5% (G. max. Com o prolongamento do período de armazenamento, houve um aumento do número de ovos viáveis e de insetos emergidos, exceto para P. aduncum. Em relação aos óleos fixos, S. indicum, G. max, G. hirsutum e C. brasiliense foram os mais eficientes até os 30 dias de armazenamento. Os resultados indicam que os óleos testados na concentração de 50µl/20g apresentam baixo efeito residual, com exceção de P. aduncum, que foi efetivo durante todo o período de armazenamento.The secondary compounds extracted from plants are considered potential alternative to synthetic insecticides in the control of agricultural pests. Essential oils (Cymbopogon martini Roxb., Piper aduncum L., P. hispidinervum C.DC., Melaleuca sp. and Lippia gracillis Shau and fixed oils (Helianthus annus L., Sesamum indicum L., Gossypium hirsutum L., Glycine max L. and Caryocar brasiliense Camb. at the concentration of 50µl/20g were tested according to previous studies. Samples

  17. Seletividade de amonio-glufosinate isolado e em mistura com pyrithiobac-sodium em algodoeiro transgênico LL® Selectivity of ammonium-glufosinate applied alone or in mixture with pyrithiobac sodium in transgenic LL® cotton

    Directory of Open Access Journals (Sweden)

    G.B.P. Braz

    2012-12-01

    Full Text Available Com a recente introdução no Brasil de variedades transgênicas de algodoeiro que apresentam resistência ao amonio-glufosinate (LL®, há escassez de informações tanto a respeito da seletividade de reaplicações desse herbicida, quanto no que se refere a misturas com outros herbicidas. Objetivou-se no presente trabalho avaliar a seletividade de aplicações sequenciais de amonio-glufosinate isolado e em associação com pyrithiobac-sodium em algodão transgênico LL®. Dessa forma, foi instalado um experimento em delineamento de blocos casualizados em arranjo fatorial (3x3+1, empregando-se oito repetições. O primeiro fator correspondeu à aplicação dos tratamentos amonio-glufosinate (500 g ha-1 e amonio-glufosinate + pyrithiobac-sodium (500 + 42 g ha-1 e 500 + 56 g ha-1. O segundo fator foi o número de aplicações sequenciais em pós-emergência do algodoeiro (uma, duas ou três. O tratamento adicional foi composto por testemunha sem aplicação de herbicida. A associação do pyrithiobac-sodium ao amonio-glufosinate causou maiores níveis de fitointoxicação inicial, embora não tenham havido mais sintomas duas semanas após as aplicações. A qualidade de fibra do algodoeiro não foi influenciada por nenhum dos tratamentos herbicidas. O amonio-glufosinate isolado foi seletivo para o algodão LL® em até três aplicações em pós-emergência. O algodoeiro apresentou ainda tolerância a uma aplicação da mistura de amonio-glufosinate + pyrithiobac-sodium, e não se observou qualquer efeito negativo sobre a produtividade de algodão em caroço.Due to the recent introduction of transgenic cotton varities with resistance to ammonium-glufosinate (LL® in Brazil, there is a lack of information related both to the selectivity of sequential reapplications of ammonium-glufosinate and to tank mixture with other herbicides. This work aimed to evaluate the selectivity of sequential applications of ammonium-glufosinate isolated or in

  18. Genetic study of various agronomic traits in cotton (Gossypium hirsutum L.)

    International Nuclear Information System (INIS)

    Ashraf, F.; Khan, I.A.; Ahmed, S.

    2009-01-01

    The use of already existing genetic variability in the breeding material, as well as, the creation of new variability along with the genetic understanding of various agronomic traits is of crucial importance, in order to develop potential sources of cotton. For this purpose, 5 X 6 complete diallel cross experiment was conducted during 2003-04, involving 5 strains i.e. VH-55, MNH-516, ACALA-SJ-4, A-8100 and CRIS-420, to evaluate gene-action, general and specific combining ability for number of sympodial branches, number of monopodial branches, plant height, number of bolls per plant, boll weight and yield of seed cotton. Additive type of gene action, with partial dominance for all the traits studied, was observed. Most dominant genes for boll weight, yield of seed-cotton, and number of sympodial branches were observed in CRIS-420, while maximum dominant genes for number of monopodial branches, plant height were observed in ACALA-SJ-4. Variety VH-55 carried maximum dominant genes for number of bolls per plant. Recessive genes for the number of sympodial branches, number of monopodial branches, plant height, number of bolls per plant and yield of seed-cotton, were exhibited by MNH-516. The variety ACAU-SJ-4 showed harmonius combination for bolls per plant and yield of seed-cotton, whereas CRIS- 420 was found a good general combiner for plant height and number of sympodial branches. (author)

  19. Induced variants in cotton (Gossypium Hirsutum L.) by in vitro mutagenesis

    International Nuclear Information System (INIS)

    Muthusamy, A.; Jayabalan, N.

    2000-01-01

    The shoot tips (3-5mm) of cotton were isolated from five day old in vitro grown seedlings and it contained two small unexpanded leaves approximately 1.0 mm along with cotyledons and the cotyledons were removed before the treatment with mutagens. The shoot tip alone was treated with 1-5 kR doses of gamma rays from 60C o source at Sugarcane Breeding Institute (ICAR), Coimbatore, Tamil Nadu and 1-5 mM of ethyl methane sulphonate (EMS) and sodium azide (SA) for 30 min. at pH 6 and 3 respectively. The treated shoot tips were inoculated on MS medium supplemented with 0.1 mg/l KIN, l-inositol 100 mg/l, thiamine HCI 1.0 mg/l, sucrose 30 g/l and agar 8 g/l. During the development of shoots, a number of leaf mutants with narrow, tubular, bilobed and multilobed leaves was observed. The plants also showed the best performance in number of branches, leaf area and yield characters than control. The morphological variants obtained due to mutagenic treatment in the present investigation showed high frequency with increasing doses of mutagens. Compared with somatic cell culture of cotton, shoot and meristem culture is an easier method to obtain regenerative plants. The in vitro induction of mutations has also potential application in the development of disease-resistant plants through tissue culture. (author)

  20. Monitoring cotton (Gossypium hirsutum L.) germination using ultrahigh-resolution UAS images

    Science.gov (United States)

    Examination of seed germination rate is of great importance for growers early in the season to determine the necessity for replanting their fields. The objective of this study was to explore the potential of using unmanned aircraft system (UAS)-based visible-band images to monitor and quantify the c...

  1. Gamma ray induced diversity in restorer line of cotton (Gossypium Hirsutum)

    International Nuclear Information System (INIS)

    Mehetre, S.S.; Patil, V.R.; Surana, P.P.

    2000-01-01

    Looking to the limitation of very few restorers available in cotton a diversification of available restorer line was undertaken by gamma irradiation. The four hundred individual plants selected from individual M 2 families were crossed with CMS lines. Out of which 12 plants restored fertility in CMS lines and their F 1 's with CMS produced more heterotic hybrids than their checks (control). The results indicated that sufficient variability can be induced with the help of gamma rays and the diversification of restorers is possible within a short period with simultaneous improvement in either one or two characters. (author)

  2. Genome-wide identification and functional analysis of the TIFY gene family in response to drought in cotton.

    Science.gov (United States)

    Zhao, Ge; Song, Yun; Wang, Caixiang; Butt, Hamama Islam; Wang, Qianhua; Zhang, Chaojun; Yang, Zuoren; Liu, Zhao; Chen, Eryong; Zhang, Xueyan; Li, Fuguang

    2016-12-01

    Jasmonates control many aspects of plant biological processes. They are important for regulating plant responses to various biotic and abiotic stresses, including drought, which is one of the most serious threats to sustainable agricultural production. However, little is known regarding how jasmonate ZIM-domain (JAZ) proteins mediate jasmonic acid signals to improve stress tolerance in cotton. This represents the first comprehensive comparative study of TIFY transcription factors in both diploid A, D and tetraploid AD cotton species. In this study, we identified 21 TIFY family members in the genome of Gossypium arboretum, 28 members from Gossypium raimondii and 50 TIFY genes in Gossypium hirsutum. The phylogenetic analyses indicated the TIFY gene family could be divided into the following four subfamilies: TIFY, PPD, ZML, and JAZ subfamilies. The cotton TIFY genes have expanded through tandem duplications and segmental duplications compared with other plant species. Gene expression profile revealed temporal and tissue specificities for TIFY genes under simulated drought conditions in Gossypium arboretum. The JAZ subfamily members were the most highly expressed genes, suggesting that they have a vital role in responses to drought stress. Over-expression of GaJAZ5 gene decreased water loss, stomatal openings, and the accumulation of H 2 O 2 in Arabidopsis thaliana. Additionally, the results of drought tolerance assays suggested that this subfamily might be involved in increasing drought tolerance. Our study provides new data regarding the genome-wide analysis of TIFY gene families and their important roles in drought tolerance in cotton species. These data may form the basis of future studies regarding the relationship between drought and jasmonic acid.

  3. Effect of diameter of the cotton squares in the development of boll weevil Efeito do diâmetro do botão floral no desenvolvimento do bicudo-do-algodoeiro

    Directory of Open Access Journals (Sweden)

    Marcos Doniseti Michelotto

    2007-01-01

    Full Text Available The objective of this work was to study the effect of diameter of the cotton squares in the corporal mass of adults of boll weevil, Anthonomus grandis Boheman (Coleoptera: Curculionidae. The assay was carried out under field and laboratory conditions, in Jaboticabal, São Paulo State, Brazil. Six samplings obtained from a random harvesting of ten plants of each cultivar (Coodetec 405 and Fibermax 986. The number and diameter of squares were recorded for each plant. Squares with oviposition orifices were kept individually in a recipient and observed daily until adult emergence. The larger the diameter of the squares, the more corporal mass of boll weevil newly emerged adults in both cultivars.O objetivo deste trabalho foi estudar o efeito do diâmetro dos botões florais de algodoeiro na massa corporal de adultos do bicudo-do-algodoeiro, Anthonomus grandis Boheman (Coleoptera: Curculionidae. O experimento foi realizado em condições de campo e laboratório, em Jaboticabal (SP, Brasil. Foram realizadas seis amostragens, coletando-se ao acaso dez plantas nas cultivares Coodetec 405 e Fibermax 986, avaliando-se o número e o diâmetro de botões florais. Os botões florais com orifícios de oviposição foram individualizados em frascos e observados diariamente para a visualização da emergência dos adultos. Botões florais com maiores diâmetros proporcionam maior massa corporal de adultos de A. grandis recém-emergidos nas duas cultivares.

  4. Fitomassa e produção de algodoeiro cv. BRS Jady cultivado com águas salinas e doses de esterco bovino

    Directory of Open Access Journals (Sweden)

    Leandro de Pádua Souza

    2016-11-01

    Full Text Available A produção de algodoeiro de fibra naturalmente colorido, na região semiárida do nordeste brasileiro, onde as águas nem sempre são de boa qualidade, está na dependência do uso de técnicas que viabilizem o manejo do solo e da água com teor elevado de sais. Diante do exposto, objetivou-se avaliar fitomassa e produção do algodoeiro cv. BRS Jady submetido a níveis crescentes de salinidade da água de irrigação e doses de esterco bovino. O experimento foi conduzido em ambiente protegido em um Neossolo Regolítico Eutrófico de textura franco-arenosa no município de Campina Grande, Paraíba. Usou-se o delineamento experimental de blocos ao acaso, em esquema fatorial 4 x 4, com três repetições, sendo os tratamentos compostos de quatro níveis de condutividade elétrica da água (CEa (1,7; 3,4; 5,1 e 6,8 dS m-1 e quatro doses de esterco bovino (0; 2,5; 3,5 e 4,5% em base do volume do solo. Níveis crescentes de salinidade da água de irrigação com CEa superior a 1,7 dS m-1 reduziu a formação de fitomassa seca de folha, entretanto o aumento nas doses de esterco bovino promoveu acréscimos nesta variável. A adubação com esterco bovino promove incremento na produção de número de sementes totais e massa de cem sementes. Houve interação entre os fatores níveis de condutividade elétrica da água de irrigação e doses de esterco bovino para fitomassa seca e caule e raiz do algodoeiro cv. ‘BRS Jady’.Fitomassa and cotton production cv. BRS Jady cultivated with salt waters and esterco bovine dosesAbstract: The production of naturally colored fiber cotton in the semi-arid region of northeastern Brazil, where water is not always of good quality, is dependent on the use of techniques that make it possible to manage soil and water with high salt content. In view of the above, the objective was to evaluate phytomass and cotton production cv. BRS Jady subjected to increasing levels of salinity of irrigation water and doses of bovine

  5. Rapid diversification of the cotton genus (Gossypium: Malvaceae) revealed by analysis of sixteen nuclear and chloroplast genes.

    Science.gov (United States)

    Richard C. Cronn; Randall L. Small; Tamara Hanselkorn; Jonathan F. Wendel

    2002-01-01

    Previous molecular phylogenetic studies have failed to resolve the branching order among the major cotton (Gossypium) lineages, and it has been unclear whether this reflects actual history (rapid radiation) or sampling properties of the genes evaluated. In this paper, we reconsider the phylogenetic relationships of diploid cotton genome groups using DNA sequences from...

  6. Population structure and genetic diversity of the boll weevil, Anthonomus grandis (Coleoptera: Curculionidae), on Gossypium in North America

    Science.gov (United States)

    While the boll weevil, Anthonomus grandis, has been identified as one of the most devastating pests in U.S. history, its origin and activity in Mexico, both on wild and cultivated cotton hosts (genus Gossypium), is poorly understood. Three forms (geographical or host-associated races) of A. grandis ...

  7. Biosorption studies on waste cotton seed for cationic dyes sequestration: equilibrium and thermodynamics

    Science.gov (United States)

    Sivarajasekar, N.; Baskar, R.; Ragu, T.; Sarika, K.; Preethi, N.; Radhika, T.

    2017-07-01

    The immature Gossypium hirsutum seeds—an agricultural waste was converted into a novel adsorbent and its effectiveness for cationic dyes removal was discussed in this study. Characterization revealed that sulfuric acid activated waste Gossypium hirsutum seed (WGSAB) contains surface area 496 m2 g-1. The ability of WGSAB to adsorb basic red 2 (BR2) and basic violet 3 (BV3) from aqueous solutions has been studied. Batch adsorption studies were carried out at different initial dye concentrations (100-300 mg l-1), contact time (1-5 h), pH (2-12) and temperature (293-323 K) to understand the adsorption mechanism. Adsorption data were modeled using Langmuir, Freundlich and Toth adsorption isotherms. Equilibrium data of the adsorption process fitted very well to the Toth model for both dyes. The Langmuir maximum adsorption capacity was 66.69 mg g-1 for BV3 and 50.11 mg g-1 for BR2 at optimum conditions. The near unity value of Toth isotherm constant (BR2: 0.999 and BV3: 1.0) indicates that WGSAB surface is heterogeneous in nature. The maximum adsorption capacity predicted by Toth isotherm of BV3 (66.699 mg g-1) is higher than BR2 (50.310 mg g-1). The kinetic investigation revealed that the BR2 and BV3 were chemisorbed on WGSAB surface following Avrami fractional order kinetics. Further, the fractional order and rate constant values are almost similar for every concentration in both the dyes. The thermodynamic parameters such as Δ H 0, Δ S 0 and Δ G 0 were evaluated. The dye adsorption process was found to be spontaneous and endothermic for the two dyes. Regeneration of WGSAB exhausted by the two dyes could be possible via acetic acid as elutant.

  8. In Silico study for diversing the molecular pathway of pigment formation: An alternative to manual coloring in cotton fibers.

    Directory of Open Access Journals (Sweden)

    Ammara eAhad

    2015-09-01

    Full Text Available Diversity of colors in flowers and fruits is largely due to anthocyanin pigments. The flavonoid/anthocyanin pathway has been most extensively studied. Dihydroflavonol 4-reductase (DFR is a vibrant enzyme of the flavonoid pathway which displays major impact on the formation of anthocyanins, flavan 3-ols and flavonols. The substrate specificity of the DFR was found to play a crucial role in determination of type of anthocyanidins. Altering the flavonoid/ anthocyanin pathway through genetic engineering to develop color of our own choice is an exciting subject of future research. In the present study, comparison among four DFR genes (Gossypium hirsutum, Iris × hollandica, Ang. DFRI and DFRII, sequence alignment for homology as well as protein modeling and docking is demonstrated. Estimation of catalytic sites, prediction of substrate preference and protein docking were the key features of this article. For specific substrate uptake, a proline rich region and positions 12 plus 26 along with other positions emphasizing the 26-amino acid residue region (132-157 was tested. Results showed that proline rich region position 12, 26 and 132-157 plays an important role in selective attachment of DFRs with respective substrates. Further, ‘Expasy ProtParam tool’ results showed that Iris × hollandica DFR amino acids (Asn 9: Asp 23 favorable for reducing DHQ and DHM thus accumulating delphinidin, while Gossypium hirsutum DFR has (Asn 13: Asp 21 hypothesized to consume DHK. Protein docking data showed that amino acid residues in above mentioned positions were just involved in attachment of DFR with substrate and had no role in specific substrate uptake.Advanced bioinformatics analysis has revealed that all above mentioned positions have role in substrate attachment. For substrate specificity, other residues region is involved. It will help in color manipulations in different plant species.

  9. Phylogeny of the New World diploid cottons (Gossypium L., Malvaceae) based on sequences of three low-copy nuclear genes.

    Science.gov (United States)

    I. Alvarez; R. Cronn; J.F. Wendel

    2005-01-01

    American diploid cottons (Gossypium L., subgenus Houzingenia Fryxell) form a monophyletic group of 13 species distributed mainly in western Mexico, extending into Arizona, Baja California, and with one disjunct species each in the Galapagos Islands and Peru. Prior phylogenetic analyses based on an alcohol dehydrogenase gene (...

  10. Natural products to agro-ecological pest management and their natural enemies of cotton plant intercropped with maize, cowpea and sesame = Produtos naturais no manejo agroecológico de pragas e seus inimigos naturais do algodoeiro consorciado com milho, feijão-caupi e gergelim

    Directory of Open Access Journals (Sweden)

    Gildo Pereira de Araujo

    2015-06-01

    . Objetivou-se com este trabalho avaliar os inseticidas naturais: extrato aquoso da pimenta malagueta, caulim, Azamax®, Rotenat® e Pironat® no manejo agroecológico das principais pragas e seus inimigos naturais do algodoeiro consorciado com as culturas do milho, feijão-caupi e gergelim. Os estudos foram desenvolvidos no campo experimental da Embrapa Algodão em Barbalha, Ceará, onde instalou-se o experimento para avaliação dos produtos naturais, com o delineamento experimental em blocos ao acaso e com quatro repetições, representado por seis tratamentos: T1-Testemunha (sem aplicação, T2-Pimenta malagueta, T3-Caulim, T4-Azamax®, T5-Rotenat® e T6-Pironat®. Os produtos foram aplicados a cada sete dias, seguidos de avaliações também semanais, considerando-se o efeito dos tratamentos sobre a ocorrência dos insetos pragas do algodoeiro e seus inimigos naturais. O Caulim é o produto natural mais eficiente no controle do bicudo do algodoeiro, Anthonomus grandis . A pimenta malagueta não é eficiente no controle das principais pragas do algodoeiro. Os produtos naturais aplicados a cada 7 dias em pulverizações nas folhas do algodoeiro não interferem na presença de inimigos naturais.

  11. Estudo das características de tamanho de gotas de bicos de pulverização de energia centrífuga e hidráulica na cultura do algodoeiro

    OpenAIRE

    Alandia Roman, Rodrigo Alberto [UNESP

    2010-01-01

    Objetivou-se avaliar a características do tamanho de gota, a distribuição volumétrica, cobertura e deposição por bicos de energia centrífuga e hidráulica, assim como o controle do bicudo-do-algodoeiro e produtividade da cultura do algodão. No Laboratório de Análises do Tamanho de Partículas, com utilização de um medidor de gotas por difração a luz laser, foram realizadas todas as avaliações referentes ao tamanho de gota de todos os experimentos. Na primeira avaliação referente ao tamanho de g...

  12. Desenvolvimento larval de Chrysoperla externa alimentada com Aphis gossypii provenientes de três cultivares de algodoeiro

    Directory of Open Access Journals (Sweden)

    Eunice Cláudia Schlick-Souza

    2011-10-01

    Full Text Available O objetivo deste trabalho foi avaliar os aspectos biológicos de Chrysoperla externa alimentadas com Aphis gossypii provenientes de três cultivares de algodoeiro (FMT 701, Acala 90 e Delta Opal. O experimento foi conduzido no Laboratório de Fitossanidade da Universidade Estadual de Mato Grosso do Sul (UEMS, Unidade de Cassilândia (MS. Os adultos de C. externa foram mantidos em gaiolas de PVC, em sala climatizada. As larvas do predador foram individualizadas em placas de Petri e alimentadas diariamente com pulgões advindos das diferentes cultivares. Larvas que se alimentaram de indíviduos da cultivar FMT 701 apresentaram a viabilidade menor do que as que alimentaram dos afídeos criados nas cultivares Delta Opal e Acala 90. Observou-se redução do consumo diário nas larvas de terceiro ínstar que se alimentaram dos pulgões advindos da cultivar Acala 90. Consequentemente, larvas supridas com pulgões criados nas cultivares Delta Opal e Acala 90, tiveram menor peso, 3,60 e 3,90 mg respectivamente, diferindo significativamente da FMT 701. De modo geral, é possível a utilização de C. externa no controle de A. gossypii nas cultivares estudadas.

  13. Adubação orgânica e águas de diferentes níveis salinos no cultivo do algodoeiro de fibra colorida

    Directory of Open Access Journals (Sweden)

    Leandro de Pádua Souza

    2017-02-01

    Full Text Available No semiárido a ocorrência de longos períodos de estiagem vem tornado a irrigação uma pratica indispensável para exploração agrícola. Desta forma objetivou-se, com esta pesquisa, avaliar o crescimento e a produção de do algodoeiro cv. BRS Jady irrigado com águas de distintos níveis de salinidades e doses de matéria orgânica. O experimento foi conduzido utilizando-se um Neossolo Regolítico Eutrófico de textura franco arenosa no município de Campina Grande-PB. Adotou-se o delineamento experimental de blocos ao acaso, em esquema fatorial 4 x 4, com três repetições, cujos os tratamentos resultaram da combinação de quatro níveis de condutividade elétrica da água (CEa (1,7; 3,4; 5,1 e 6,8 dS m-1 e quatro doses de matéria orgânica (0; 2,5; 3,5 e 4,5% em base do volume do solo. A irrigação com água salina de CE a partir 1,7 dS m-1 afetou negativamente o crescimento e a produção do algodoeiro cv. BRS Jady, provocando reduções no diâmetro de caule, altura de planta, área foliar, fitomassa seca total, massa de algodão em pluma, massa total de sementes e rendimento de fibra. A adubação orgânica com doses crescentes promoveu aumento na altura de plantas, área foliar e massa total de sementes do algodoeiro cv. BRS Jady. Houve interação entre os fatores aguas salinas e doses de matéria orgânica para diâmetro caulinar, fitomassa seca total e massa de algodão em pluma, sendo os maiores valores obtidos na das doses de 3,5 e 4,5% de matéria orgânica.Organic fertilization and waters of different salin levels in the cultivation of colored fiber cottonAbstract: In the semiarid the occurrence of long periods of drought has made irrigation an indispensable practice for agricultural exploration. The objective of this research was to evaluate the growth and yield of cotton cv. BRS Jady irrigated with waters of different levels of salinities and doses of organic matter. The experiment was conducted using a sandy loam

  14. Polyploidization altered gene functions in cotton (Gossypium spp.).

    Science.gov (United States)

    Xu, Zhanyou; Yu, John Z; Cho, Jaemin; Yu, Jing; Kohel, Russell J; Percy, Richard G

    2010-12-16

    Cotton (Gossypium spp.) is an important crop plant that is widely grown to produce both natural textile fibers and cottonseed oil. Cotton fibers, the economically more important product of the cotton plant, are seed trichomes derived from individual cells of the epidermal layer of the seed coat. It has been known for a long time that large numbers of genes determine the development of cotton fiber, and more recently it has been determined that these genes are distributed across At and Dt subgenomes of tetraploid AD cottons. In the present study, the organization and evolution of the fiber development genes were investigated through the construction of an integrated genetic and physical map of fiber development genes whose functions have been verified and confirmed. A total of 535 cotton fiber development genes, including 103 fiber transcription factors, 259 fiber development genes, and 173 SSR-contained fiber ESTs, were analyzed at the subgenome level. A total of 499 fiber related contigs were selected and assembled. Together these contigs covered about 151 Mb in physical length, or about 6.7% of the tetraploid cotton genome. Among the 499 contigs, 397 were anchored onto individual chromosomes. Results from our studies on the distribution patterns of the fiber development genes and transcription factors between the At and Dt subgenomes showed that more transcription factors were from Dt subgenome than At, whereas more fiber development genes were from At subgenome than Dt. Combining our mapping results with previous reports that more fiber QTLs were mapped in Dt subgenome than At subgenome, the results suggested a new functional hypothesis for tetraploid cotton. After the merging of the two diploid Gossypium genomes, the At subgenome has provided most of the genes for fiber development, because it continues to function similar to its fiber producing diploid A genome ancestor. On the other hand, the Dt subgenome, with its non-fiber producing D genome ancestor

  15. Evapotranspiração e coeficiente de cultura do algodoeiro irrigado a partir de imagens de sensores orbitais Cotton evapotranspiration and crop coefficient obtained by satellite images

    Directory of Open Access Journals (Sweden)

    Marcus Vinícius Cândido Bezerra

    2012-03-01

    Full Text Available O presente estudo teve como objetivos estimar a evapotranspiração - ETc e determinar a curva do coeficiente de cultura - Kc do algodoeiro irrigado através do Surface Energy Balance Algorithm for Land - SEBAL com imagens orbitais TM - Landsat 5. Foram utilizadas oito imagens distribuídas ao longo do ciclo fenológico do algodoeiro cultivado na Fazenda Busato localiza no município de Bom Jesus da Lapa, região do Médio São Francisco, Estado da Bahia (13°15'18''S, 43°25'05''W, 436 m. A classificação climática da região segundo Köppen é BSwh'. O saldo de radiação foi calculado a partir de imagens da temperatura, emissividade da superfície, índices de vegetação, albedo e calculados os fluxos de calor no solo e sensível para obter-se o fluxo de calor latente e a ETc. Verificou-se que o índice de vegetação NDVI apresentou evolução concomitante com o ciclo da cultura, com valores máximos (0,80 aos 70 dias após semeadura - DAS. A ETc e o Kc obtidos foram, respectivamente: 1,0 a 5,0 mm dia-1 e 0,65 no período de desenvolvimento (7 e 70 DAS; > 6 mm dia-1 e 1,18 durante a floração e formação dos capulhos e 2 mm dia-1 e 0,66 no fim do ciclo. Os resultados mostram que o NDVI é um bom indicador do desenvolvimento do algodoeiro e os dados de ETc e Kc estão coerentes com relatos na literatura.This research aimed determine cotton evapotranspiration - ETc and crop coefficient - Kc slope using the Surface Energy balance Algorithm for Land - SEBAL with TM-Landsat 5 images. We used eight images distributed throughout the cotton growth season on the Busato Farm located in Bom Jesus da Lapa, Médio São Francisco region, Bahia state (13°15'18" S, 43°25'05" W, 436 m. The Climate classification of region by Köppen is BSwh'. The net radiation was calculated from surface temperature, surface emissivity, vegetation index and albedo imagesn and calculated soil and sensible heats fluxes to obtain the latent heat flux and ETc. The NDVI

  16. Genome-wide identification and comparative analysis of squamosa-promoter binding proteins (sbp) transcription factor family in gossypium raimondii and arabidopsis thaliana

    International Nuclear Information System (INIS)

    Ali, M.A.; Alia, K.B.; Atif, R.M.; Rasulj, I.; Nadeem, H.U.; Shahid, A.; Azeem, F

    2017-01-01

    SQUAMOSA-Promoter Binding Proteins (SBP) are class of transcription factors that play vital role in regulation of plant tissue growth and development. The genes encoding these proteins have not yet been identified in diploid cotton. Thus here, a comprehensive genome wide analysis of SBP genes/proteins was carried out to identify the genes encoding SBP proteins in Gossypium raimondii and Arabidopsis thaliana. We identified 17 SBP genes from Arabidopsis thaliana genome and 30 SBP genes from Gossypium raimondii. Chromosome localization studies revealed the uneven distribution of SBP encoding genes both in the genomes of A. thaliana and G. raimondii. In cotton, five SBP genes were located on chromosome no. 2, while no gene was found on chromosome 9. In A. thaliana, maximum seven SBP genes were identified on chromosome 9, while chromosome 4 did not have any SBP gene. Thus, the SBP gene family might have expanded as a result of segmental as well as tandem duplications in these species. The comparative phylogenetic analysis of Arabidopsis and cotton SBPs revealed the presence of eight groups. The gene structure analysis of SBP encoding genes revealed the presence of one to eleven inrons in both Arabidopsis and G. raimondii. The proteins sharing the same phyletic group mostly demonstrated the similar intron-exon occurrence pattern; and share the common conserved domains. The SBP DNA-binding domain shared 24 absolutely conserved residues in Arabidopsis. The present study can serve as a base for the functional characterization of SBP gene family in Gossypium raimondii. (author)

  17. [Analysis of cis-regulatory element distribution in gene promoters of Gossypium raimondii and Arabidopsis thaliana].

    Science.gov (United States)

    Sun, Gao-Fei; He, Shou-Pu; Du, Xiong-Ming

    2013-10-01

    Cotton genomic studies have boomed since the release of Gossypium raimondii draft genome. In this study, cis-regulatory element (CRE) in 1 kb length sequence upstream 5' UTR of annotated genes were selected and scanned in the Arabidopsis thaliana (At) and Gossypium raimondii (Gr) genomes, based on the database of PLACE (Plant cis-acting Regulatory DNA Elements). According to the definition of this study, 44 (12.3%) and 57 (15.5%) CREs presented "peak-like" distribution in the 1 kb selected sequences of both genomes, respectively. Thirty-four of them were peak-like distributed in both genomes, which could be further categorized into 4 types based on their core sequences. The coincidence of TATABOX peak position and their actual position ((-) -30 bp) indicated that the position of a common CRE was conservative in different genes, which suggested that the peak position of these CREs was their possible actual position of transcription factors. The position of a common CRE was also different between the two genomes due to stronger length variation of 5' UTR in Gr than At. Furthermore, most of the peak-like CREs were located in the region of -110 bp-0 bp, which suggested that concentrated distribution might be conductive to the interaction of transcription factors, and then regulate the gene expression in downstream.

  18. Physiological traits for drought phenotyping in cotton = Traços fisiológicos para fenotipagem de algodoeiro sob seca

    Directory of Open Access Journals (Sweden)

    Giovani Greigh de Brito

    2011-01-01

    Full Text Available The objective of this study was to identify physiological traits that could distinguish between cotton genotypes that were tolerant or sensitive to water deficits. The experiment was conducted in a completely randomized design through a factorial combination to analyze four genotypes (BRS 187 8H and ACALA SJ-4 - water deficittolerant; CNPA 7H and SU-0450/8909 - water deficit sensitive and two water regimes (watered/always irrigated and stressed/with a water deficit imposed at flowering. Irrigation was suspended for the plants in the water deficit treatment groups when their first flowersappeared. Leaf water potential (ƒÕpd was monitored until the plants reached -3.0 MPa predawn, at which point leaf samples were collected for analysis. The plants were reirrigated and monitored for a recovery to 50% of leaf water potential. The maximum photochemical efficiency (Fv/Fm, chlorophyll content (SPAD index, relative watercontent (RWC, disruption of the cell membrane via membrane leakage, carbon isotope composition (ƒÂ13C, seed cotton yield and fiber quality were evaluated. The trends in membrane leakage and carbon isotope composition were different between the tolerant and sensitive genotypes under a water deficit, which makes these physiological traits suitable for screening for tolerance to water deficits in cotton.Objetivou-se identificar variaveis fisiologicas para distinguir genotipos de algodoeiro tolerantes e sensiveis ao deficit hidrico. O experimento foi conduzido no delineamento inteiramente casualizado emarranjo fatorial, sendo testados quatro genotipos (BRS 187 8H e ACALA SJ-4 . tolerante ao deficit hidrico; CNPA 7H e SU-0450/8909 - sensiveis ao deficit hidrico e dois regimes hidricos (controle . sempre irrigado e com deficit hidrico imposto na emissao da primeira flor. Na emissao da primeira flor, a irrigacao foi suspensa para o grupo a ser submetido ao deficit hidrico. O potencial hidrico foliar foi monitorado na antemanha ate que as

  19. CRISPR/Cas9-mediated targeted mutagenesis in upland cotton (Gossypium hirsutum L.).

    Science.gov (United States)

    Janga, Madhusudhana R; Campbell, LeAnne M; Rathore, Keerti S

    2017-07-01

    The clustered, regularly interspaced, short palindromic repeats (CRISPR)/CRISPR associated (Cas)9 protein system has emerged as a simple and efficient tool for genome editing in eukaryotic cells. It has been shown to be functional in several crop species, yet there are no reports on the application of this or any other genome editing technologies in the cotton plant. Cotton is an important crop that is grown mainly for its fiber, but its seed also serves as a useful source of edible oil and feed protein. Most of the commercially-grown cotton is tetraploid, thus making it much more difficult to target both sets of homeologous alleles. Therefore, in order to understand the efficacy of the CRISPR/Cas9 system to target a gene within the genome of cotton, we made use of a transgenic cotton line previously generated in our laboratory that had a single copy of the green fluorescent protein (GFP) gene integrated into its genome. We demonstrate, for the first time, the use of this powerful new tool in targeted knockout of a gene residing in the cotton genome. By following the loss of GFP fluorescence, we were able to observe the cells that had undergone targeted mutations as a result of CRISPR/Cas9 activity. In addition, we provide examples of the different types of indels obtained by Cas9-mediated cleavage of the GFP gene, guided by three independent sgRNAs. The results provide useful information that will help us target important native genes in the cotton plant in future.

  20. Current status of genetic engineering in cotton (Gossypium hirsutum L): an assessment.

    Science.gov (United States)

    Chakravarthy, Vajhala S K; Reddy, Tummala Papi; Reddy, Vudem Dashavantha; Rao, Khareedu Venkateswara

    2014-06-01

    Cotton is considered as the foremost commercially important fiber crop and is deemed as the backbone of the textile industry. The productivity of cotton crop, worldwide, is severely hampered by the occurrence of pests, weeds, pathogens apart from various environmental factors. Several beneficial agronomic traits, viz., early maturity, improved fiber quality, heat tolerance, etc. have been successfully incorporated into cotton varieties employing conventional hybridization and mutation breeding. Crop losses, due to biotic factors, are substantial and may be reduced through certain crop protection strategies. In recent years, pioneering success has been achieved through the adoption of modern biotechnological approaches. Genetically engineered cotton varieties, expressing Bacillus thuringiensis cry genes, proved to be highly successful in controlling the bollworm complex. Various other candidate genes responsible for resistance to insect pests and pathogens, tolerance to major abiotic stress factors such as temperature, drought and salinity, have been introduced into cotton via genetic engineering methods to enhance the agronomic performance of cotton cultivars. Furthermore, genes for improving the seed oil quality and fiber characteristics have been identified and introduced into cotton cultivars. This review provides a brief overview of the various advancements made in cotton through genetic engineering approaches.

  1. Genome-wide functional analysis of cotton (Gossypium hirsutum in response to drought.

    Directory of Open Access Journals (Sweden)

    Yun Chen

    Full Text Available Cotton is one of the most important crops for its natural textile fibers in the world. However, it often suffered from drought stress during its growth and development, resulting in a drastic reduction in cotton productivity. Therefore, study on molecular mechanism of cotton drought-tolerance is very important for increasing cotton production. To investigate molecular mechanism of cotton drought-resistance, we employed RNA-Seq technology to identify differentially expressed genes in the leaves of two different cultivars (drought-resistant cultivar J-13 and drought-sensitive cultivar Lu-6 of cotton. The results indicated that there are about 13.38% to 18.75% of all the unigenes differentially expressed in drought-resistant sample and drought-sensitive control, and the number of differentially expressed genes was increased along with prolonged drought treatment. DEG (differentially expression gene analysis showed that the normal biophysical profiles of cotton (cultivar J-13 were affected by drought stress, and some cellular metabolic processes (including photosynthesis were inhibited in cotton under drought conditions. Furthermore, the experimental data revealed that there were significant differences in expression levels of the genes related to abscisic acid signaling, ethylene signaling and jasmonic acid signaling pathways between drought-resistant cultivar J-13 and drought-sensitive cultivar Lu-6, implying that these signaling pathways may participate in cotton response and tolerance to drought stress.

  2. Responses of physiological and biochemical components in Gossypium hirsutum L. to mutagens

    International Nuclear Information System (INIS)

    Muthusamy, A.; Vasanth, K.; Jayabalan, N.

    2003-01-01

    The two tetraploid varieties of cotton were exposed to gamma rays, EMS and SA. Chlorophyll, carotenoids, sugar, starch, free amino acids, protein, lipids, DNA and RNA were estimated quantitatively. All the physiological and biochemical components were increased in lower dose/concentration of the mutagenic treatments and they were decreased in higher dose/concentrations. The stimulation of the biochemical contents was a dose/concentration dependent response. Among the two varieties, MCU 11 was found to be responsive to mutagens than MCU 5. Based on the study the lower dose/concentration of the mutagenic treatments could enhance the biochemical components which is used for improved economic characters of cotton. (author)

  3. Global gene expression in cotton (Gossypium hirsutum L. leaves to waterlogging stress.

    Directory of Open Access Journals (Sweden)

    Yanjun Zhang

    Full Text Available Cotton is sensitive to waterlogging stress, which usually results in stunted growth and yield loss. To date, the molecular mechanisms underlying the responses to waterlogging in cotton remain elusive. Cotton was grown in a rain-shelter and subjected to 0 (control-, 10-, 15- and 20-d waterlogging at flowering stage. The fourth-leaves on the main-stem from the top were sampled and immediately frozen in liquid nitrogen for physiological measurement. Global gene transcription in the leaves of 15-d waterlogged plants was analyzed by RNA-Seq. Seven hundred and ninety four genes were up-regulated and 1018 genes were down-regulated in waterlogged cotton leaves compared with non-waterlogged control. The differentially expressed genes were mainly related to photosynthesis, nitrogen metabolism, starch and sucrose metabolism, glycolysis and plant hormone signal transduction. KEGG (Kyoto Encyclopedia of Genes and Genomes analysis indicated that most genes related to flavonoid biosynthesis, oxidative phosphorylation, amino acid metabolism and biosynthesis as well as circadian rhythm pathways were differently expressed. Waterlogging increased the expression of anaerobic fermentation related genes, such as alcohol dehydrogenase (ADH, but decreased the leaf chlorophyll concentration and photosynthesis by down-regulating the expression of photosynthesis related genes. Many genes related to plant hormones and transcription factors were differently expressed under waterlogging stress. Most of the ethylene related genes and ethylene-responsive factor-type transcription factors were up-regulated under water-logging stress, suggesting that ethylene may play key roles in the survival of cotton under waterlogging stress.

  4. GhNAC18, a novel cotton (Gossypium hirsutum L.) NAC gene, is ...

    African Journals Online (AJOL)

    EVANS

    especially inhibition of leaf senescence and plant stress responses in cotton. This study provides .... For exogenous application of hormone treatments, leaves of uniformly ...... with incompatible interactions between chili pepper and pathogens.

  5. SSR-based association mapping of salt tolerance in cotton (Gossypium hirsutum L.).

    Science.gov (United States)

    Zhao, Y L; Wang, H M; Shao, B X; Chen, W; Guo, Z J; Gong, H Y; Sang, X H; Wang, J J; Ye, W W

    2016-05-25

    The identification of simple sequence repeat (SSR) markers associated with salt tolerance in cotton contributes to molecular assisted selection (MAS), which can improve the efficiency of traditional breeding. In this study, 134 samples of upland cotton cultivars were selected. The seedling emergence rates were tested under 0.3% NaCl stress. A total of 74 SSR markers were used to scan the genomes of these samples. To identify SSR markers associated with salt tolerance, an association analysis was performed between salt tolerance and SSR markers using TASSEL 2.1, based on the analysis of genetic structure using Structure 2.3.4. The results showed that the seedling emergence rates of 134 cultivars were significantly different, and 27 salt-sensitive and 10 salt-tolerant cultivars were identified. A total of 148 loci were found in 74 SSR markers involving 246 allelic variations, which ranged from 2 to 7 with an average of 3.32 per SSR marker. The gene diversity ranged from 0.0295 to 0.4959, with the average being 0.2897. The polymorphic information content ranged from0.0290 to 0.3729, with the average being 0.2381. This natural population was classified into two subgroups by Structure 2.3.4, containing 89 and 45 samples, respectively. Finally, eight SSR sites associated with salt tolerance ware found through an association analysis, with the rate of explanation ranging from 2.91 to 7.82% and an average of 4.32%. These results provide reference data for the use MAS for salt tolerance in cotton.

  6. Analysis of root-knot nematode and fusarium wilt disease resistance in cotton (Gossypium spp.) using chromosome substitution lines from two alien species.

    Science.gov (United States)

    Ulloa, M; Wang, C; Saha, S; Hutmacher, R B; Stelly, D M; Jenkins, J N; Burke, J; Roberts, P A

    2016-04-01

    Chromosome substitution (CS) lines in plants are a powerful genetic resource for analyzing the contribution of chromosome segments to phenotypic variance. In this study, a series of interspecific cotton (Gossypium spp.) CS lines were used to identify a new germplasm resource, and to validate chromosomal regions and favorable alleles associated with nematode or fungal disease resistance traits. The CS lines were developed in the G. hirsutum L. TM-1 background with chromosome or chromosome segment substitutions from G. barbadense L. Pima 3-79 or G. tomentosum. Root-knot nematode (Meloidogyne incognita) and fusarium wilt (Fusarium oxysporum f. sp. vasinfectum) (races 1 and 4) resistance alleles and quantitative trait loci (QTL) previously placed on cotton chromosomes using SSR markers in two interspecific recombinant inbred line populations were chosen for testing. Phenotypic responses of increased resistance or susceptibility in controlled inoculation and infested field assays confirmed the resistance QTLs, based on substitution with the positive or negative allele for resistance. Lines CS-B22Lo, CS-B04, and CS-B18 showed high resistance to nematode root-galling, confirming QTLs on chromosomes 4 and 22 (long arm) with resistance alleles from Pima 3-79. Line CS-B16 had less fusarium race 1-induced vascular root staining and higher percent survival than the TM-1 parent, confirming a major resistance QTL on chromosome 16. Lines CS-B(17-11) and CS-B17 had high fusarium race 4 vascular symptoms and low survival due to susceptible alleles introgressed from Pima 3-79, confirming the localization on chromosome 17 of an identified QTL with resistance alleles from TM1 and other resistant lines. Analyses validated regions on chromosomes 11, 16, and 17 harboring nematode and fusarium wilt resistance genes and demonstrated the value of CS lines as both a germplasm resource for breeding programs and as a powerful genetic analysis tool for determining QTL effects for disease

  7. CORRELACIONES Y ANÁLISIS DE SENDERO EN ALGODÓN (Gossypium hirsutum L. EN EL CARIBE COLOMBIANO CORRELATIONS AND PATH ANALYSIS IN COTTON (Gossypium hirsutum L. IN THE COLOMBIAN CARIBBEAN

    Directory of Open Access Journals (Sweden)

    Miguel Mariano Espitia Camacho

    2008-06-01

    Full Text Available El cultivo del algodón es la principal actividad agrícola en la economía del Caribe colombiano en el segundo semestre del año y el principal abastecedor de fibra a la industria nacional desde hace aproximadamente 60 años. El objetivo de este trabajo fue estimar las correlaciones fenotípicas, genéticas y ambientales, entre 11 caracteres agronómicos y realizar un análisis de sendero para rendimiento de fibra. Se utilizaron los datos de la evaluación agronómica de 10 genotipos de algodón en ocho ambientes del Caribe colombiano. En cada ambiente se utilizó un diseño experimental de bloques completos al azar con cuatro repeticiones. Los resultados indicaron que las correlaciones genéticas fueron superiores a las fenotípicas y ambientales. El rendimiento de fibra (REF presentó las mayores correlaciones fenotípicas, genéticas y fenotipicas parciales con el porcentaje de fibra (PFI, el rendimiento de algodón - semilla (RAS y el peso de mota (PMO, con valores de r > 0,43 (PThe cotton crop is the main agricultural activity in the economy of the colombian Caribbean in the second semester of the year and the main supplier of fibre to national industry for about 60 years. The objective of this work was to estimate the phenotypic, genetic and environmental correlations, between 11 agronomic characters and to make a path analysis for fibre yield. Data of agronomic evaluation of 10 genotypes of cotton in eight environments of the colombian Caribbean were used. In each environment experimental design at random complete blocks with four repetitions were used. The results indicated that genetic correlations were superior to phenotypic and environmental correlations. Fibre yield (FIY presented the highest phenotypic, genetic and partial phenotypic correlations with ginning percentage (GP, seed-cotton yield (SCY and boll weight (BOW with values of r > 0,43 (P<0,01. The FIP (0,810 was the cause variable that showed the greatest direct effect on the REF. The YFI can be used as selection criteria to increase the YFI in cotton.

  8. Dicty_cDB: Contig-U05261-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available DN828913 ) KUCD01_04_F02_T3 WSWR cDNA library Triticum aesti... 48 0.49 1 ( DB872994 ) Lipochromis sp. 'matu...berosum cDNA, ... 50 0.13 1 ( CK261371 ) EST707449 potato abiotic stress cDNA library Sola... 50 0.13 1 ( BQ...pergillus niger mRNA for hypothetical protein, ... 44 7.7 1 ( AL111181 ) Botrytis cinerea strain T4 cDNA library...) Batrachochytrium dendrobatidis strain JAM059 vari... 48 0.49 1 ( AL112706 ) Botrytis cinerea strain T4 cDNA library...3 ) GH_MBb0070I15f GH_MBb Gossypium hirsutum genomic ... 48 0.49 1 ( AL424547 ) T3 end of clone XAZ0AA001A10 of library

  9. Dicty_cDB: Contig-U01201-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available DT573931 ) EST1084571 GH_TMO Gossypium hirsutum cDNA, mRNA s... 46 2.3 1 ( DR026249 ) Osmo00116 F. cylindrus osmotic stress library...67 ) Glycine max cDNA clone: GMFL01-28-N10, 3'end. 44 9.0 1 ( BU869818 ) Q004H08 Populus flower cDNA library Populus tric...Lib... 46 2.3 1 ( DU120744 ) KBrH113B12F Brassica rapa BAC library KBrH Brassi......... 46 2.3 1 ( CB285041 ) DF1898 Dermatophagoides farinae cDNA library Derm... 46 2.3 1 ( C25513 ) Dic...rary Ictalurus... 44 9.0 1 ( CF230535 ) PtaC0009E5E0509 Poplar cDNA library from ca

  10. Upland cotton gene GhFPF1 confers promotion of flowering time and shade-avoidance responses in Arabidopsis thaliana.

    Directory of Open Access Journals (Sweden)

    Xiaoyan Wang

    Full Text Available Extensive studies on floral transition in model species have revealed a network of regulatory interactions between proteins that transduce and integrate developmental and environmental signals to promote or inhibit the transition to flowering. Previous studies indicated FLOWERING PROMOTING FACTOR 1 (FPF1 gene was involved in the promotion of flowering, but the molecular mechanism was still unclear. Here, FPF1 homologous sequences were screened from diploid Gossypium raimondii L. (D-genome, n = 13 and Gossypium arboreum L. genome (A-genome, n = 13 databases. Orthologous genes from the two species were compared, suggesting that distinctions at nucleic acid and amino acid levels were not equivalent because of codon degeneracy. Six FPF1 homologous genes were identified from the cultivated allotetraploid Gossypium hirsutum L. (AD-genome, n = 26. Analysis of relative transcripts of the six genes in different tissues revealed that this gene family displayed strong tissue-specific expression. GhFPF1, encoding a 12.0-kDa protein (Accession No: KC832319 exerted more transcripts in floral apices of short-season cotton, hinting that it could be involved in floral regulation. Significantly activated APETALA 1 and suppressed FLOWERING LOCUS C expression were induced by over-expression of GhFPF1 in the Arabidopsis Columbia-0 ecotype. In addition, transgenic Arabidopsis displayed a constitutive shade-avoiding phenotype that is characterized by long hypocotyls and petioles, reduced chlorophyll content, and early flowering. We propose that GhFPF1 may be involved in flowering time control and shade-avoidance responses.

  11. Analysis of root-knot nematode and fusarium wilt disease resistance in cotton (Gossypium spp.) using chromosome substitution lines from two alien species

    Science.gov (United States)

    To Identify a new germplasm resource, and to validate chromosomal regions and favorable alleles associated with nematode and fungal disease resistance traits, a series of interspecific cotton (Gossypium spp.) chromosome substitution (CS) lines were used in this study. The CS lines were developed in ...

  12. Avaliação da eficiência de controle de plantas daninhas gramíneas do herbicida clethodim em algodoeiro herbáceo (Gossypium hirsutum var. latifolium Hutch. Evaluation of the efficiency on the control of gramineous weeds by the herbicide clethodim in a herbaceous cotton crop (Gossypium hirsutum var. latifolium Hutch.

    Directory of Open Access Journals (Sweden)

    J.P. Laca-Buendia

    1992-01-01

    Full Text Available Com o objetivo de conhecer a eficiência do herbicida clethodim no controle de plantas daninhas gramíneas e seu comportamento seletivo na cultura do algodão, cv. IAC-20, foi instalado um experimento em solo aluvial de textura arenosa. Foram estudados os seguintes tratamentos: clethodim + óleo mineral nas doses de 0,84 0,96 e 0,108 kg/ha + 0,5 % v/v, sethoxydim + óleo mineral a 0,23 kg/ha + 0,5% v/v em pós-emergência, alachlor a 2,4 kg/ha em pós-emergência, trifluralin a 0,89 kg/ha em pós-plantio incorporado, uma testemunha capinada e outra sem capina. As espécies de plantas daninhas mais freqüentes foram: Cenchrus echinatus L. (capim-carrapicho, Eleusine indica (L. Gaertn. (capim-pé-de-galinha e Brachiaria plantaginea (Link. Hitch. (capim-marmelada. Nenhum dos herbicidas testados apresento injúria à cultura. Quanto à produção, esses herbicidas apresentaram diferenças significativas em relação à testemunha capinada (828 kg/ha, sendo que o tratamento com clethodim + óleo mineral a 0,108 kg/ha + 0,5% v/v (528 kg/ha foi o único que apresentou diferenças significativas com a testemunha sem capina (330 kg/ha. Na altura da planta, a testemunha capinada somente apresentou diferenças significativas em relação ao tratamento com trifluralin e a testemunha sem capina. O carrapicho-de-burro e o capim-pé-de-galinha foram eficientemente controlados pelo clethodim + óleo mineral, em todas as doses estudadas, e sethoxydim + óleo mineral, com controle acima de 80% aos 45 dias da aplicação. O capim-marmelada foi eficientemente controlado pelo clethodim + óleo mineral a 0,096 e 0,108 kg/ha + 0,5% v/v, com 86% e 94%, respectivamente, seguido de sethoxydim + óleo mineral com 83%, e trifluralin com 71% de controle, até 45 dias após aplicação. O total de gramíneas foi eficientemente controlado pelo clethodim + óleo mineral 0,108 kg/ha + 0,5% v/v com 94,2% seguido de clethodim + óleo mineral 0,096 kg/ha + 0,5% v/v, com 85% e sethoxydim + óleo mineral, com 83% de controle, até 45 dias após a aplicação.An experiment in the Porteirinha region, north of Minas Gerais state, Brazil, was performed with the cotton cultivar IAC-20 to find out the efficiency of clethodim 0.84, 0,96 and 0,108 kg/ha plus 0.5% mineral oil v/v, in comparison to sethoxidim 0.23 kg/ha plus 0.5% mineral oil v/v, all those treatments in post emergence; other treatments were in preplanting time and incorporated to the soil alachlor 2,4 kg/ha and trifluralin 0.89 kg/ha; as check were used no weeded plots and hoed plots. The weeds involved were Cenchrus echinatus L., Eleusine indica (L. Gaertn. And Brachiaria plantaginea (Link. Hitch. None of the tested herbicides were noxious to the cotton plants. The highest production in cotton was obtained from the check hoed plots (828 kg/ha; in the second place the clethodim 0.108 kh/ha gave 528 kg/ha, the only treatments statistically different from the no weeded plots wich gave 330 kg/ha. Clethodim gave good control of Cenchrus echinatus and Eleusine indica, with all doses. Brachiaria plantaginea was efficiently controlled (86% and more by clethodim. Clethodim followed by sethoxydim gave in general 83% and 85% control of all the grasses.

  13. Competição de adubos fosfatados no algodoeiro, em ensaio de longa duração Phosphate fertilizers competition in a long term experiment with cotton, on a dusky red latosol

    Directory of Open Access Journals (Sweden)

    Nelson Machado da Silva

    1987-01-01

    Full Text Available Após quatro anos de aplicações sucessivas de misturas de adubos contendo P ou P mais S, em ensaio permanente com o algodoeiro, fez-se rotação com cultivo de mucuna-preta na entressafra do quarto para o quinto ano, seguida de calagem visando à adequada correção da acidez do solo. No qüinqüênio 1978-1983, cultivou-se a variedade IAC 18 de algodoeiro, mantendo-se a mesma adubação da primeira fase, que, através de combinações de produtos comerciais, como sulfato de amônio, Nitrocálcio, superfosfato triplo, superfosfato simples e cloreto de potássio, forneceu anualmente às plantas N e K em doses constantes e P e S em doses variáveis. Sintomas de deficiência de enxofre, representados especialmente pelo "verde-limão" das folhas de ponteiro, tornaram-se evidentes a partir do quinto ano agrícola (primeiro da segunda fase, coincidindo com tendência para aumento de produtividade do algodoeiro. Entretanto, só após a correção da acidez do solo (pH em H2O ao redor de 6,2, é que a produtividade das plantas se estabilizou em nível alto, e as diferenças a favor das misturas contendo superfosfato simples tornaram-se estatisticamente significativas. Na segunda fase, as doses de 50 e 100 kg/ha de P2O5 proporcionaram acréscimos no volume de produção, respectivamente de 37 e 40%, quando se usou superfosfato triplo na adubação, e de 55 a 67% no caso do superfosfato simples. Em termos de lucro, o superfosfato simples proporcionou acréscimos sobre o triplo da ordem de 55 a 82%, em função da dose de P2O5 usada. Peso de capulho e comprimento de fibra também foram significativamente beneficiados pelo superfosfato simples, enquanto o fornecimento suplementar de enxofre, 120 kg/ha de S, não alterou as características gerais do algodoeiro adubado com a dose básica de 60 kg/ha de S. E proposto que se reavalie a necessidade de incorporar enxofre nas formulações comerciais de adubos, diante dos resultados obtidos.After four years of

  14. Decay of oak Wood provoked by fungus Stereum hirsutum (Willd. ex Fr. S. F. Gray. and its' essential physiological requirements

    Directory of Open Access Journals (Sweden)

    Mirić Milenko

    2005-01-01

    Full Text Available White rot fungi usually decompose cell walls of attacked wood destroying tissue elements (i.e. parenchyma cells, wood fibres, tension wood, tracheas etc in different amount, depending to wood-species as well as to its' zones. Different fungi secrete specific enzymes that are responsible for certain damages. As consequence, the wood structure use to be significantly and unfixable decomposed and changed. Microscopical analyses that have been run provided clear and indicative information relating to effects of fungal activity on wood tissue. Physiological requirements of fungi are for shore of the highest importance in understanding of mechanism of decaying process in the wood. The most important factors as like temperature and concentration of H ions, as well as main nutrients as sources of carbon, nitrogen and phosphorus can affect the behaviour of wood decaying fungi. The impacts of these factors on the growth and production on mycelial mass of Stereum hirsutum (Willd. ex Fr. S.F. Gray., have been investigated. This fungus is one of the most frequent appearing on the Sessile- and Pedunculate Oak weakened trees or felled logs, behaving as parasite as well as saprophyte. As a causer of Oak sapwood white rot S. hirsutum causes significant damages of wood at forest- as well as at industrial storages.

  15. POTASSIUM FERTILIZATION OF SOYBEAN, PEARL MILLET, AND COTTON IN A NO-TILL ROTATION SYSTEM IN THE CERRADO REGION DOSES E FORMAS DE APLICAÇÃO DA ADUBAÇÃO POTÁSSICA NA ROTAÇÃO SOJA, MILHETO E ALGODÃO EM SISTEMA PLANTIO DIRETO

    Directory of Open Access Journals (Sweden)

    Maria da Conceição Santana Carvalho

    2009-03-01

    -style: normal; line-height: 120%; text-decoration: none;" lang="pt-BR" align="justify"> 

    KEY-WORDS: Glycine max; Pennisetum; Gossypium hirsutum; fiber quality; agronomic efficiency.

    Este estudo teve como objetivo avaliar a eficiência da adubação potássica, com relação às doses, modos (sulco, a lanço e parcelada e épocas de aplicação (pré-semeadura, semeadura e cobertura, na sucessão de culturas soja-milheto-algodoeiro, cultivadas em sistema plantio direto, em Latossolo Vermelho, no município de Turvelândia, Goiás (17o51’S, 50o18’W. O delineamento experimental adotado foi o de blocos casualizados, com quatro repetições, em esquema fatorial. A fonte de potássio utilizada nas adubações foi o cloreto de potássio. Na soja, os tratamentos utilizados foram doses de K2O (0 kg ha-1, 30 kg ha-1, 60 kg ha-1 e 180 kg ha-1, aplicadas em pré-semeadura (a lanço e na semeadura (no sulco, com e sem cobertura. Na cultura do algodoeiro, os tratamentos foram doses de K2O (0 kg ha-1, 60 kg ha-1, 120 kg ha-1 e 240 kg ha-1, aplicadas em pré-semeadura (a lanço e na semeadura (no sulco, com 0, 1 ou 2 coberturas. A adubação em pré-semeadura foi realizada no milheto. Não houve efeito da adubação potássica sobre a

  16. Aspectos fisiológicos e crescimento do algodoeiro ‘BRS topázio’ cultivado com águas salinas e adubação potássica

    Directory of Open Access Journals (Sweden)

    Jessica Dayanne Capitulino

    2017-06-01

    Full Text Available Objetivou-se avaliar os índices fisiológicos e o crescimento do algodoeiro colorido cv. BRS Topázio submetido à irrigação com águas de diferentes níveis de salinidades e adubação com doses de potássio. O experimento foi conduzido em vasos sob condições de casa de vegetação, utilizando-se um Neossolo Regolítico Eutrófico de textura franco-arenoso não salino. Utilizaram-se o delineamento de blocos casualizados, com 4 repetições, cujos tratamentos foram distribuídos em esquema fatorial 4 x 4, sendo quatro níveis de condutividade elétrica da água de irrigação (CEa (1,5; 3,0; 4,5 e 6,0 dS m-1 e quatro doses de potássio (50; 75; 100 e 125% da recomendação, sendo a dose de 100% correspondente a 150 mg K2O por kg-1 de solo. Avaliaram-se os efeitos dos tratamentos sobre a concentração interna de CO2 (Ci, transpiração (E, condutância estomática (gs, taxa de assimilação de CO2 (A, eficiência no uso da água (EiUA e a eficiência instantânea da carboxilação (EICi, fitomassa seca das folhas (FSF, fitomassa seca do caule (FSC, fitomassa seca da parte aérea (FSA, área foliar especifica (AFE e no período compreendido entre 30 e 130 dias determinaram-se a taxa de assimilação líquida (TAA. As trocas gasosas e a fitomassa seca da folha, a fitomassa seca do caule e a fitomassa seca da parte aérea do algodoeiro colorido cv. BRS Topázio reduz acentuadamente, quando submetida a níveis de CEa maior que 1,5 dS m-1. A área foliar especifica e a taxa de assimilação líquida do algodoeiro BRS Topázio não foram afetados pela água de irrigação com água salina. A adubação potássica não exerceu influência sobre as variáveis de analisadas do algodoeiro colorido. Não houve interação entre os fatores salinidade da água de irrigação versus doses de potássio para as variáveis analisadas.Physiological aspects and growth of 'BRS topázio' cotton cultivated with salt waters and potassic fertilizationThe objective

  17. Diversity in Betasatellites Associated with Cotton Leaf Curl Disease During Source-To-Sink Movement Through a Resistant Host

    Directory of Open Access Journals (Sweden)

    Iftikhar Ali Khan

    2016-02-01

    Full Text Available Cotton leaf curl is devastating disease of cotton characterized by leaf curling, vein darkening and enations. The disease symptoms are induced by DNA satellite known as Cotton leaf curl Multan betasatellite (CLCuMuB, dominant betasatellite in cotton but another betasatellite known as Chili leaf curl betasatellite (ChLCB is also found associated with the disease. Grafting experiment was performed to determine if host plant resistance is determinant of dominant population of betasatellite in cotton (several distinct strains of CLCuMuB are associated with the disease. Infected scion of Gossypium hirsutum collected from field (the source was grafted on G. arboreum, a diploid cotton species, resistant to the disease. A healthy scion of G. hirsutum (sink was grafted at the top of G. arboreum to determine the movement of virus/betasatellite to upper susceptible scion of G. hirsutum. Symptoms of disease appeared in the upper scion and presence of virus/betasatellite in the upper scion was confirmed via molecular techniques, showing that virus/betasatellite was able to move to upper scion through resistant G. arboreum. However, no symptoms appeared on G. arboreum. Betasatelites were cloned and sequenced from lower scion, upper scion and G. arboreum which show that the lower scion contained both CLCuMuB and ChLCB, however only ChLCB was found in G. arboreum. The upper scion contained CLCuMuB with a deletion of 78 nucleotides (nt in the non-coding region between A-rich sequence and βC1 gene and insertion of 27 nt in the middle of βC1 ORF. This study may help in investigating molecular basis of resistance in G. arboreum.

  18. Estimação da área foliar do algodoeiro por meio de dimensões e massa das folhas Cotton leaf area estimates based on leaf dimensions and dry mass methods

    Directory of Open Access Journals (Sweden)

    José Eduardo B. A. Monteiro

    2005-01-01

    Full Text Available O objetivo deste trabalho foi avaliar dois métodos de estimação da área foliar do algodoeiro, por meio de suas dimensões e massa seca das folhas. Foram utilizadas as cultivares IAC 23 e Coodetec 401. No método que utilizou dimensões, as folhas do algodoeiro foram agrupadas em novas, cordiformes e maduras. Para cada tipo de folha, de cada cultivar, foi determinado um fator de forma (FF por meio de análise de regressão entre o produto do comprimento (C pela largura (L e a área das folhas. Avaliou-se a correlação entre a área foliar estimada pelo fator FF e sua medida direta, utilizando-se dados independentes. Testou-se, ainda, um fator único para cada cultivar, independente do estádio da cultura e, também, um fator geral para as duas cultivares. No método que utilizou a massa seca, as folhas foram agrupadas em novas e maduras. Determinou-se o fator de massa seca (FM por meio da análise de regressão entre a massa seca de folhas e respectivas áreas foliares. Em seguida, avaliou-se a correlação entre dados estimados por FM e dados medidos de forma direta, em nova amostra. O método das dimensões é viável para a estimação de área foliar do algodoeiro, por apresentar boa precisão e exatidão, com r² entre 0,71 e 0,98 e com coeficiente angular da regressão entre 0,87 e 0,95. No entanto, pelo método da massa seca, observaram-se precisão e exatidão maiores, com r² entre 0,94 e 0,98, e coeficiente angular da regressão entre 0,97 e 1,00, com a vantagem de ser menos trabalhoso.The objective of this study was to evaluate two different methods to estimate cotton leaf area (LA, based on leaf dimensions (length - L and width - W and leaf dry mass (DM. Two cultivars, IAC 23 and Coodetec 401, were used. For leaf dimensions method, leaves were classified by age: young, heart-shape, and mature. For each age class, a leaf shape factor (LSF was obtained by simple linear regression between L*W and LA. For leaf dry mass method, leaves

  19. Biological fabrication of cellulose fibers with tailored properties

    Science.gov (United States)

    Natalio, Filipe; Fuchs, Regina; Cohen, Sidney R.; Leitus, Gregory; Fritz-Popovski, Gerhard; Paris, Oskar; Kappl, Michael; Butt, Hans-Jürgen

    2017-09-01

    Cotton is a promising basis for wearable smart textiles. Current approaches that rely on fiber coatings suffer from function loss during wear. We present an approach that allows biological incorporation of exogenous molecules into cotton fibers to tailor the material’s functionality. In vitro model cultures of upland cotton (Gossypium hirsutum) are incubated with 6-carboxyfluorescein-glucose and dysprosium-1,4,7,10-tetraazacyclododecane-1,4,7,10-tetraacetic acid-glucose, where the glucose moiety acts as a carrier capable of traveling from the vascular connection to the outermost cell layer of the ovule epidermis, becoming incorporated into the cellulose fibers. This yields fibers with unnatural properties such as fluorescence or magnetism. Combining biological systems with the appropriate molecular design offers numerous possibilities to grow functional composite materials and implements a material-farming concept.

  20. Dicty_cDB: Contig-U05216-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 064701 ) WNEL14b1 Wheat EST endosperm library Triticum aes... 40 0.032 2 ( AC200123 ) Zea mays chromosome 4 ... CF-24-HW fat cDNA... 36 0.055 2 ( EG551033 ) MM04K05_RP Sugar Beet germination cDNA library Be... 36 0.055 2 ( AG332587 ) Mus muscul...7 2 ( AZ506962 ) 1M0348D20F Mouse 10kb plasmid UUGC1M library Mus ... 40 0.057 2 ( BB898919 ) Macaca fascicul...V968176 ) GC06167 Gracilaria changii cDNA library Gracilari... 46 0.014 2 ( AG430324 ) Mus musculus molossin..._IpSto_12_p10 Stomach cDNA library Ictalurus p... 32 0.76 2 ( DX535456 ) GH_MBb0065G22f GH_MBb Gossypium hirsutum genomic

  1. Isolation of a cotton NADP(H oxidase homologue induced by drought stress

    Directory of Open Access Journals (Sweden)

    NEPOMUCENO ALEXANDRE LIMA

    2000-01-01

    Full Text Available The aim of this study was to identify and isolate genes that are differentially expressed in four selected cotton (Gossypium hirsutum L. genotypes contrasting according to their tolerance to water deficit. The genotypes studied were Siokra L-23, Stoneville 506, CS 50 and T-1521. Physiological, morphological and developmental changes that confer drought tolerance in plants must have a molecular genetic basis. To identify and isolate the genes, the mRNA Differential Display (DD technique was used. Messenger RNAs differentially expressed during water deficit were identified, isolated, cloned and sequenced. The cloned transcript A12B15-5, a NADP(H oxidase homologue, was up regulated only during the water deficit stress and only in Siokra L-23, a drought tolerant genotype. Ribonuclease protection assay confirmed that transcription.

  2. Analysis of genetic effects of nuclear-cytoplasmic interaction on quantitative traits: genetic model for diploid plants.

    Science.gov (United States)

    Han, Lide; Yang, Jian; Zhu, Jun

    2007-06-01

    A genetic model was proposed for simultaneously analyzing genetic effects of nuclear, cytoplasm, and nuclear-cytoplasmic interaction (NCI) as well as their genotype by environment (GE) interaction for quantitative traits of diploid plants. In the model, the NCI effects were further partitioned into additive and dominance nuclear-cytoplasmic interaction components. Mixed linear model approaches were used for statistical analysis. On the basis of diallel cross designs, Monte Carlo simulations showed that the genetic model was robust for estimating variance components under several situations without specific effects. Random genetic effects were predicted by an adjusted unbiased prediction (AUP) method. Data on four quantitative traits (boll number, lint percentage, fiber length, and micronaire) in Upland cotton (Gossypium hirsutum L.) were analyzed as a worked example to show the effectiveness of the model.

  3. Efeitos da utilização de misturas de adubos com ou sem enxofre na precocidade e nas características do capulho e da fibra do algodoeiro Effects of mixtures of fertilizers with or without sulfur on cotton earliness and some characteristics of fibers and bolls

    Directory of Open Access Journals (Sweden)

    Nelson Paulieri Sabino

    1984-01-01

    Full Text Available São apresentados resultados referentes à precocidade e características do capulho e da fibra do algodoeiro, obtidos em ensaio de caráter permanente, no município de Guaíra (SP, em gleba de Latossolo Roxo, durante o período 1974/75-1977/78, utilizando-se a variedade 'IAC 16'. Além da reação ao fósforo, foi planejado um estudo conjunto visando observar a resposta do algodoeiro à aplicação de misturas de adubo contendo fósforo e enxofre em quantidades variáveis. A análise e a interpretação dos resultados permitiram as seguintes conclusões: a Adubações com superfosfato triplo ou simples, em solo deficiente em fósforo, resultaram em maior precocidade no ciclo do algodoeiro, enquanto o uso de sulfato de amônio em cobertura tendeu a prolongar esse ciclo; b Ambas as fontes citadas de fósforo proporcionaram aumentos significativos no peso de capulho e no comprimento das fibras, enquanto apenas o superfosfato simples aumentou sensivelmente o peso de cem sementes e o índice Micronaire, que representa o complexo finura + maturidade da fibra; c As características porcentagem de fibras, uniformidade de comprimento, resistência e maturidade das fibras, não foram alteradas significativamente pelos tratamentos estudados.Effects of fertilizers mixtures with or without sulfur on cotton earliness and some characteristics of fiber and bolls, obtained in a field experiment carried out at Guaira County (SP in a oxisoil -"Latossolo Roxo" - during the years of 1974/75 to 1977/78, are related. The following conclusions can be drawn from the results: a - soil fertilizations with concentrated superphosphate or ordinary superphosphate resulted in early picking of cotton crop. Plant cycle, was delayed with split application of ammonium sulphate; b - both concentrated superphosphate and ordinary superphosphate increased significantly boll weight and fiber length, but only ordinary superphosphate gave significant increases on seed weights and

  4. Influence of Soil Temperature on Meloidogyne incognita Resistant and Susceptible Cotton, Gossypium hirsutum

    OpenAIRE

    Carter, William W.

    1982-01-01

    The degree of resistance by a cotton plant to Meloidogyne incognita is affected by soil temperature, particularly in moderately resistant cultivars, The total number of nematodes in the resistant and moderately resistant rools at 35 C was equal to, or greater than, the number in susceptible roots at 20, 25, or 30 C. A shift in numbers to developing and egg-bearing forms of nematodes in the susceptible cultivar as tentperature increased indicates development was affected by temperature rather ...

  5. Herbicide-resistant cotton (Gossypium hirsutum) plants: an alternative way of manual weed removal.

    Science.gov (United States)

    Latif, Ayesha; Rao, Abdul Qayyum; Khan, Muhammad Azmat Ullah; Shahid, Naila; Bajwa, Kamran Shehzad; Ashraf, Muhammad Aleem; Abbas, Malik Adil; Azam, Muhammad; Shahid, Ahmad Ali; Nasir, Idrees Ahmad; Husnain, Tayyab

    2015-09-17

    Cotton yield has been badly affected by different insects and weed competition. In Past Application of multiple chemicals is required to manage insects and weed control was achieved by different conventional means, such as hand weeding, crop rotation and polyculture, because no synthetic chemicals were available. The control methods shifted towards high input and target-oriented methods after the discovery of synthetic herbicide in the 1930s. To utilise the transgenic approach, cotton plants expressing the codon-optimised CEMB GTGene were produced in the present study. Local cotton variety CEMB-02 containing Cry1Ac and Cry2A in single cassette was transformed by synthetic codon-optimised 5-enolpyruvylshikimate-3-phosphate synthase gene cloned into pCAMBIA 1301 vector under 35S promoter with Agrobacterium tumifaciens. Putative transgenic plants were screened in MS medium containing 120 µmol/L glyphosate. Integration and expression of the gene were evaluated by PCR from genomic DNA and ELISA from protein. A 1.4-kb PCR product for Glyphosate and 167-bp product for Cry2A were obtained by amplification through gene specific primers. Expression level of Glyphosate and Bt proteins in two transgenic lines were recorded to be 0.362, 0.325 µg/g leaf and 0.390, 0.300 µg/g leaf respectively. FISH analysis of transgenic lines demonstrates the presence of one and two copy no. of Cp4 EPSPS transgene respectively. Efficacy of the transgene Cp4 EPSPS was further evaluated by Glyphosate spray (41 %) assay at 1900 ml/acre and insect bioassay which shows 100 %mortality of insect feeding on transgenic lines as compared to control. The present study shows that the transgenic lines produced in this study were resistant not only to insects but also equally good against 1900 ml/acre field spray concentration of glyphosate.

  6. Influence of mutagens on enzymes of germinating seeds of cotton (Gossypium hirsutum L.)

    International Nuclear Information System (INIS)

    Muthusamy, A.; Jayabalan, N.; Juliana, B.

    2000-01-01

    The activities of the enzymes amylases, protease and phosphatases were studied in cotton during germination. The seeds were treated with 100-500 Gy of gamma rays, 10-50 mM of EMS, CA and SA in two cultivated varieties viz.. MCU 5 and MCU 11. Activity pattern of amylases, protease and phosphatases in treated seeds were significantly altered from controls. The alteration were positively correlated with increasing dose/concentration of mutagens up to 300 Gy of gamma rays and 30 mM of EMS, CA and SA. The present study pave the ways to discuss the importance of the enzymes and mutagens in germination of cotton seeds. (author)

  7. Extensive and biased intergenomic nonreciprocal DNA exchanges shaped a nascent polyploid genome, Gossypium (cotton).

    Science.gov (United States)

    Guo, Hui; Wang, Xiyin; Gundlach, Heidrun; Mayer, Klaus F X; Peterson, Daniel G; Scheffler, Brian E; Chee, Peng W; Paterson, Andrew H

    2014-08-01

    Genome duplication is thought to be central to the evolution of morphological complexity, and some polyploids enjoy a variety of capabilities that transgress those of their diploid progenitors. Comparison of genomic sequences from several tetraploid (AtDt) Gossypium species and genotypes with putative diploid A- and D-genome progenitor species revealed that unidirectional DNA exchanges between homeologous chromosomes were the predominant mechanism responsible for allelic differences between the Gossypium tetraploids and their diploid progenitors. Homeologous gene conversion events (HeGCEs) gradually subsided, declining to rates similar to random mutation during radiation of the polyploid into multiple clades and species. Despite occurring in a common nucleus, preservation of HeGCE is asymmetric in the two tetraploid subgenomes. At-to-Dt conversion is far more abundant than the reciprocal, is enriched in heterochromatin, is highly correlated with GC content and transposon distribution, and may silence abundant A-genome-derived retrotransposons. Dt-to-At conversion is abundant in euchromatin and genes, frequently reversing losses of gene function. The long-standing observation that the nonspinnable-fibered D-genome contributes to the superior yield and quality of tetraploid cotton fibers may be explained by accelerated Dt to At conversion during cotton domestication and improvement, increasing dosage of alleles from the spinnable-fibered A-genome. HeGCE may provide an alternative to (rare) reciprocal DNA exchanges between chromosomes in heterochromatin, where genes have approximately five times greater abundance of Dt-to-At conversion than does adjacent intergenic DNA. Spanning exon-to-gene-sized regions, HeGCE is a natural noninvasive means of gene transfer with the precision of transformation, potentially important in genetic improvement of many crop plants. Copyright © 2014 by the Genetics Society of America.

  8. Crescimento e componentes de produção do algodoeiro colorido submetido ao estresse salino e adubação potássica

    Directory of Open Access Journals (Sweden)

    Jéssica Dayanne Capitulino

    2016-12-01

    Full Text Available Objetivou-se avaliar o crescimento e os componentes de produção do algodoeiro colorido cv. BRS Topázio, em função da irrigação com águas de diferentes níveis de salinidades e doses de potássio. O experimento foi conduzido em casa de vegetação, utilizando-se um Neossolo Regolítico Eutrófico de textura franco-arenosa não salina no município de Campina Grande, Paraíba. Adotou-se o delineamento de blocos casualizados esquema fatorial 4 x 4 em com três repetições, cujos tratamentos foram constituídos  de quatro níveis de condutividade elétrica da água de irrigação (1,5; 3,0; 4,5 e 6,0 dS m-1 e quatro doses de potássio (50; 75; 100 e 125% da recomendação , sendo a dose de 100% correspondente a 150 mg K2O por kg-1 de solo. A salinidade da água de irrigação afetou negativamente o crescimento do algodoeiro cv. BRS Topázio, sendo a variável área foliar a mais sensível. A produção total de sementes e o número de sementes total foram às variáveis mais sensíveis ao estresse salino.Growth and production components of colored cotton subjected to saline stress and potassium fertilizationAbstract: The objective of this work was to evaluate the growth and production components of the colored cotton cv. BRS Topázio, according to the irrigation with waters of different levels of salinities and doses of potassium. The experiment was conducted in a greenhouse, using a Neolithic Regolithic Eutrophic with a non-saline sandy-loam texture in the city of Campina Grande-PB. A randomized complete block design was used in a 4 x 4 factorial design with three replications. The treatments were composed of four levels of electrical conductivity of the irrigation water (1.5, 3.0, 4.5 and 6.0 dS m-1 and four doses of potassium (50, 75, 100 and 125% of the recommendation, the dose of 100% corresponding to 150 mg K2O per kg-1 of soil. The salinity of the irrigation water negatively affected the growth of the cv. BRS Topazio, the most

  9. Investigating the Antioxidant and Acetylcholinesterase Inhibition Activities of Gossypium herbaceam

    Directory of Open Access Journals (Sweden)

    Haji Akber Aisa

    2013-01-01

    Full Text Available Our previous research showed that standardized extract from the flowers of the Gossypium herbaceam labeled GHE had been used in clinical trials for its beneficial effects on brain functions, particularly in connection with age-related dementia and Alzheimer’s disease (AD. The aim of this work was to determine the components of this herb and the individual constituents of GHE. In order to better understand this herb for AD treatment, we investigated the acetylcholinesterase (AChE inhibition and antioxidant activity of GHE as well as the protective effects to PC12 cells against cytotoxicity induced by tertiary butyl hydroperoxide (tBHP using in vitro assays. The antioxidant activities were assessed by measuring their capabilities for scavenging 1,1-diphenyl-2-picylhydrazyl (DPPH and 2-2'-azinobis-(3-ethylbenzothiazoline-6-sulfonic acid (ABTS free radical as well as in inhibiting lipid peroxidation. Our data showed that GHE exhibited certain activities against AChE and also is an efficient free radical scavenger, which may be helpful in preventing or alleviating patients suffering from AD.

  10. Resistance and Resistant Reaction of Gossypium arboreum to the Reniform, Nematode, Rotylenchulus reniformis

    Science.gov (United States)

    Carter, William W.

    1981-01-01

    Gossypium arboreum 'Nanking CB 1402' possessed a high level of resistance to Rotylenchulus reniformis. Within 16 h, the nematode penetrated roots of resistant and susceptible cottons equally. After 36 h, significantly fewer nematodes were found in resistant roots. Larvae fed in either an endodermal or pericyclic cell and had no specificity for root tissue of a particular age. In roots of resistant G. arboreum '1402,' wall breakdown of pericyclic cells was evident after 3 d, endodermal and cortical cells collapsed, and the hypertrophied pericyclic cells disintegrated within 12 d. Cell walls immediately adjacent to the nematode's head were thickened and more safranin positive in resistant than in susceptible cotton cultivars. Several other cultivars of G. arboreum were also resistant to R. reniformis, based on nematode fecundity and percent egg reduction. PMID:19300777

  11. Asymmetric Evolution and Expansion of the NAC Transcription Factor in Polyploidized Cotton

    Directory of Open Access Journals (Sweden)

    Kai Fan

    2018-01-01

    Full Text Available Polyploidy in Gossypium hirsutum conferred different properties from its diploid ancestors under the regulation of transcription factors. The NAC transcription factor is a plant-specific family that can be related to plant growth and development. So far, little is known about the NAC family in cotton. This study identified 495 NAC genes in three cotton species and investigated the evolution and expansion of different genome-derived NAC genes in cotton. We revealed 15 distinct NAC subfamilies in cotton. Different subfamilies had different gene proportions, expansion rate, gene loss rate, and orthologous exchange rate. Paleohexaploidization (35% and cotton-specific decaploidy (32% might have primarily led to the expansion of the NAC family in cotton. Half of duplication events in G. hirsutum were inherited from its diploid ancestor, and others might have occurred after interspecific hybridization. In addition, NAC genes in the At and Dt subgenomes displayed asymmetric molecular evolution, as evidenced by their different gene loss rates, orthologous exchange, evolutionary rates, and expression levels. The dominant duplication event was different during the cotton evolutionary history. Different genome-derived NACs might have interacted with each other, which ultimately resulted in morphogenetic evolution. This study delineated the expansion and evolutionary history of the NAC family in cotton and illustrated the different fates of NAC genes during polyploidization.

  12. Molecular and Biochemical Characterization of Cotton Epicuticular Wax in Defense Against Cotton Leaf Curl Disease.

    Science.gov (United States)

    Khan, Muhammad Azmat Ullah; Shahid, Ahmad Ali; Rao, Abdul Qayyum; Bajwa, Kamran Shehzad; Samiullah, Tahir Rehman; Muzaffar, Adnan; Nasir, Idrees Ahmad; Husnain, Tayyab

    2015-12-01

    Gossypium arboreumis resistant to Cotton leaf curl Burewala virus and its cognate Cotton leaf curl Multan beta satellite ( CLCuBuV and CLCuMB ). However, the G. arboreum wax deficient mutant (GaWM3) is susceptible to CLCuV . Therefore, epicuticular wax was characterized both quantitatively and qualitatively for its role as physical barrier against whitefly mediated viral transmission and co-related with the titer of each viral component (DNA-A, alphasatellite and betasatellite) in plants. The hypothesis was the CLCuV titer in cotton is dependent on the amount of wax laid down on plant surface and the wax composition. Analysis of the presence of viral genes, namely alphasatellite, betasatellite and DNA-A, via real-time PCR in cotton species indicated that these genes are detectable in G. hirsutum , G. harknessii and GaWM3, whereas no particle was detected in G. arboreum . Quantitative wax analysis revealed that G. arboreum contained 183 μg.cm -2 as compared to GaWM3 with only 95 μg.cm -2 . G. hirsutum and G. harknessii had 130 μg.cm -2 and 146 μg.cm -2 , respectively. The GCMS results depicted that Lanceol, cis was 45% in G. harknessii . Heptadecanoic acid was dominant in G. arboreum with 25.6%. GaWM3 had 18% 1,2,-Benenedicarboxylic acid. G. hirsutum contained 25% diisooctyl ester. The whitefly feeding assay with Nile Blue dye showed no color in whiteflies gut fed on G. arboreum . In contrast, color was observed in the rest of whiteflies. From results, it was concluded that reduced quantity as well as absence of (1) 3-trifluoroacetoxytetradecane, (2) 2-piperidinone,n-|4-bromo-n-butyl|, (3) 4-heptafluorobutyroxypentadecane, (4) Silane, trichlorodocosyl-, (5) 6- Octadecenoic acid, methyl ester, and (6) Heptadecanoicacid,16-methyl-,methyl ester in wax could make plants susceptible to CLCuV , infested by whiteflies.

  13. Remote sensing techniques for monitoring the Rio Grande Valley cotton stalk destruction program

    Energy Technology Data Exchange (ETDEWEB)

    Richardson, A.J.; Gerbermann, A.H.; Summy, K.R.; Anderson, G.L. (Department of Agriculture, Weslaco, TX (United States))

    1993-09-01

    Post harvest cotton (Gossypium hirsutum L.) stalk destruction is a cultural practice used in the Rio Grande Valley to suppress over wintering populations of boll weevils (Anthonomus grandis Boheman) without using chemicals. Consistent application of this practice could substantially reduce insecticide usage, thereby minimizing environmental hazards and increasing cotton production profits. Satellite imagery registered within a geographic information system was used to monitor the cotton stalk destruction program in the Rio Grande Valley. We found that cotton stalk screening procedures based on standard multispectral classification techniques could not reliably distinguish cotton from sorghum. Greenness screening for cotton plant stalks after the stalk destruction deadline was possible only where ground observations locating cotton fields were available. These findings indicate that a successful cotton stalk destruction monitoring program will require satellite images and earth referenced data bases showing cotton field locations.

  14. Feeding habits of Carabidae (Coleoptera associated with herbaceous plants and the phenology of coloured cotton

    Directory of Open Access Journals (Sweden)

    Danilo Henrique da Matta

    2017-04-01

    Full Text Available The carabids (Coleoptera: Carabidae are recognized as polyphagous predators and important natural enemies of insect pests. However, little is known about the feeding habits of these beetles. In this work, we determine the types of food content in the digestive tracts of nine species of Carabidae associated with herbaceous plants and different growth stages of coloured cotton. The food contents were evaluated for beetles associated with the coloured cotton cv. BRS verde, Gossypium hirsutum L. latifolium Hutch., adjacent to weed plants and the flowering herbaceous plants (FHPs Lobularia maritima (L., Tagetes erecta L., and Fagopyrum esculentum Moench. The digestive tract analysis indicated various types of diets and related arthropods for Abaris basistriata, Galerita brasiliensis, Scarites sp., Selenophorus alternans, Selenophorus discopunctatus and Tetracha brasiliensis. The carabids were considered to be polyphagous predators, feeding on different types of prey.

  15. Cellulose synthases: new insights from crystallography and modeling.

    Science.gov (United States)

    Slabaugh, Erin; Davis, Jonathan K; Haigler, Candace H; Yingling, Yaroslava G; Zimmer, Jochen

    2014-02-01

    Detailed information about the structure and biochemical mechanisms of cellulose synthase (CelS) proteins remained elusive until a complex containing the catalytic subunit (BcsA) of CelS from Rhodobacter sphaeroides was crystalized. Additionally, a 3D structure of most of the cytosolic domain of a plant CelS (GhCESA1 from cotton, Gossypium hirsutum) was produced by computational modeling. This predicted structure contributes to our understanding of how plant CelS proteins may be similar and different as compared with BcsA. In this review, we highlight how these structures impact our understanding of the synthesis of cellulose and other extracellular polysaccharides. We show how the structures can be used to generate hypotheses for experiments testing mechanisms of glucan synthesis and translocation in plant CelS. Copyright © 2013 Elsevier Ltd. All rights reserved.

  16. Host plants of leaf worm, Spodoptera litura (Fabricius (Lepidoptera: noctuidae in Pakistan

    Directory of Open Access Journals (Sweden)

    Munir Ahmad

    2013-04-01

    Full Text Available Spodoptera litura is a notorious leaf feeding insect pest of more than one hundred plants around the Asia-Pacific region. Host plant survey for two years from three different locations in cotton belt revealed 27 plant species as host plants of S. litura belonging to 25 genera of 14 families including cultivated crops, vegetables, weeds, fruits and ornamental plants. Major host plants on which it thrived for maximum period were Gossypium hirsutum L., Ricinus communis L., Brassica oleracea var. botrytis L., Colocasia esculenta L., Trianthema portulacastrum L. and Sesbania sesban L.. Eggs were also collected from tree plants but larvae did not complete their development. Reliance of S. litura on major plant species of cultivated crops necessitates their regular monitoring especially during March to April for their population abundance and early warning for their management on commercial crops like cotton.

  17. Flooding tolerance in cotton (gossypium hirsutum l.) at early vegetative and reproductive growth stages

    International Nuclear Information System (INIS)

    Hussain, A.

    2014-01-01

    Periodic flooding at any growth stage greatly affects growth and yield of crops. In order to develop flooding tolerant cotton cultivar and to identify the most sensitive growth stage to periodic flooding, a field experiment was conducted in which 60-cultivars/accessions/lines were subjected to two week flooding at seedling/early vegetative, flower and boll formation growth stages. Pre- and post-flooding soil analysis was also carried out. Nitrate-N was greatly reduced due to flooding applied at all growth stages, whereas NH4-N increased significantly. Similarly, Fe and Mn were also increased to many folds in flooded soils. Under hypoxic conditions, depletion of nitrates and toxic effects of accumulated NH4, Fe and Mn caused severe damages to cotton plants and even death of plants. Of the three growth stages, early vegetative growth stage is most sensitive to two week flooding. Flooding imposed at the flowering and boll formation growth stages caused a substantial amount of yield penalty. On the basis of survival percentage, the 60-cultivars/accessions/lines were categorized into tolerant (61%), moderately tolerant (31=60%) and sensitive (31%) to short term flooding. At the seedling or early vegetative growth stage, genotypes DPL-SR-2 followed by 124-F and MNH-427 were most tolerant to flooding, while AET-5, N-KRISHMA, LRA-5166, CEDIX and H-142 were ranked as sensitive to flooding stress. At the flowering stage, the genotype NIAB-92 followed by S-14 and MNH-427 were highly tolerant to flooding. At the boll formation stage, genotypes DPL-70010-N followed by GH-11-9-75 and B-2918-2 were highly tolerant waterlogging. More than 50% of the genotypes maintained the degree of flooding tolerance at three growth stages. However, on the basis of survival percentage at three growth stages, genotypes MNH-564, FH-114, MNH-786 and CIM-573 were included in the tolerant group and the genotypes N-KRISHMA, LRA-5166, CEDIX and H-142 were included in the sensitive group. These genotypes/cultivars maintaining high degree of stress tolerance at different growth stages are of considerable importance for the development of tolerant cultivar. (author)

  18. Interference between Redroot Pigweed (Amaranthus retroflexus L.) and Cotton (Gossypium hirsutum L.): Growth Analysis.

    Science.gov (United States)

    Ma, Xiaoyan; Wu, Hanwen; Jiang, Weili; Ma, Yajie; Ma, Yan

    2015-01-01

    Redroot pigweed is one of the injurious agricultural weeds on a worldwide basis. Understanding of its interference impact in crop field will provide useful information for weed control programs. The effects of redroot pigweed on cotton at densities of 0, 0.125, 0.25, 0.5, 1, 2, 4, and 8 plants m(-1) of row were evaluated in field experiments conducted in 2013 and 2014 at Institute of Cotton Research, CAAS in China. Redroot pigweed remained taller and thicker than cotton and heavily shaded cotton throughout the growing season. Both cotton height and stem diameter reduced with increasing redroot pigweed density. Moreover, the interference of redroot pigweed resulted in a delay in cotton maturity especially at the densities of 1 to 8 weed plants m(-1) of row, and cotton boll weight and seed numbers per boll were reduced. The relationship between redroot pigweed density and seed cotton yield was described by the hyperbolic decay regression model, which estimated that a density of 0.20-0.33 weed plant m(-1) of row would result in a 50% seed cotton yield loss from the maximum yield. Redroot pigweed seed production per plant or per square meter was indicated by logarithmic response. At a density of 1 plant m(-1) of cotton row, redroot pigweed produced about 626,000 seeds m(-2). Intraspecific competition resulted in density-dependent effects on weed biomass per plant, a range of 430-2,250 g dry weight by harvest. Redroot pigweed biomass ha(-1) tended to increase with increasing weed density as indicated by a logarithmic response. Fiber quality was not significantly influenced by weed density when analyzed over two years; however, the fiber length uniformity and micronaire were adversely affected at density of 1 weed plant m(-1) of row in 2014. The adverse impact of redroot pigweed on cotton growth and development identified in this study has indicated the need of effective redroot pigweed management.

  19. Whole linted cottonseed meal (Gossypium hirsutum L. protein and fiber degradability in the rumen

    Directory of Open Access Journals (Sweden)

    Deborah Clea Ruy

    1996-12-01

    3 x 3 change-over design to evaluate the following treatments: A = 0% WLC; B = 6.6% WLC; and C = 15.0% WLC. Sorghum silage contributed with 70% in all three treatments. DM degradability at 48h incubation time was statistically different (p < 0.05 (A = 54.4%; B = 54.2% and C = 58.7%, as well as PB degradability at 12h (A = 40.3%; B = 47.7% and C = 53.1% and ADF degradability at 48h (A = 40.3%; B = 41.2% and C = 45.6%. Ruminal volume, turn overtime and ruminal pH weren’t affected by the experimental diets. Substitution of WLC for cottonseed meal up to 15% diet increased degradability of DM, CP and ADF of WLC.

  20. Diagnose nutricional com o uso de sensor óptico ativo em algodoeiro Nutritional diagnosis with the use of active optical sensor in cotton

    Directory of Open Access Journals (Sweden)

    Anamari V. de A. Motomiya

    2012-11-01

    Full Text Available Este trabalho objetivou avaliar a resposta espectral do dossel de plantas à variação de doses de nitrogênio (N e sua relação com os teores foliares de N, índice de clorofila e produtividade na cultura do algodoeiro. O experimento foi conduzido em Chapadão do Sul, MS, no delineamento em blocos casualizados, com quatro repetições. Os tratamentos consistiram de cinco doses de N: 0, 30, 70, 110 e 150 kg ha-1, divididas em duas aplicações aos 28 e 41 dias após a emergência utilizando-se, como fonte, o fertilizante ureia. As maiores correlações dos índices de clorofila e do índice de vegetação por diferença normalizada com a produtividade foram observadas na quarta leitura, aos 56 dias após a emergência, indicando que neste período a produtividade já pode estar comprometida caso haja falhas no suprimento de N à cultura. Os resultados obtidos indicaram que o sensor se torna mais sensível à variação do teor foliar de N conforme a planta se desenvolve mas não quando ela atinge um alto índice de área foliar e começa a entrar em senescência. Concluiu-se, então, que o sensoriamento remoto ao nível terrestre permite estimar indiretamente a quantidade de N absorvido, o índice de clorofila e a produtividade do algodoeiro.This research aimed to evaluate the spectral response to variation of nitrogen levels and its relationship with leaf nitrogen, chlorophyll and yield in cotton crop. The experiment was conducted in Chapadão do Céu, MS, in a randomized block design with four replications. The treatments consisted of five N rates of 0, 30, 70, 110 and 150 kg ha-1, divided in two applications at 28 and 41 days after emergence, using urea fertilizer as a source. The highest correlations of the chlorophyll index and normalized difference vegetation index with yield were observed in the fourth observation, at 56 days after emergence, indicating that in this period, yield may already be compromised if there is shortage in the

  1. Desempenho fisiológico de sementes de algodão cultivadas em Luís Eduardo Magalhães, Bahia

    Directory of Open Access Journals (Sweden)

    R. T. C. Nunes

    2015-11-01

    Full Text Available O presente trabalho foi desenvolvido no laboratório de tecnologia de sementes da Universidade Estadual do Sudoeste da Bahia, Campus de Vitória da Conquista UESB, com objetivo de avaliar a qualidade fisiológica de sementes de algodão (Gossypium hirsutum L., utilizando-se cinco cultivares (DP 604, FM 993, BRS 368, TMG 642 e DELTA OPAL. As sementes foram submetidas aos seguintes testes: teor de água, peso de mil sementes, germinação, primeira contagem de germinação, índice de velocidade de emergência, emergência, comprimento da parte aérea, massa seca das plântulas e condutividade elétrica. O delineamento experimental utilizado foi o inteiramente casualizado, em quatro repetições de 50 sementes por tratamento. A cultivar TMG 642 demonstrou baixa qualidade fisiológica das sementes, quando comparados com as cultivares DP 604, FM 993, BRS 368, e DELTA OPAL. Os testes de germinação, condutividade elétrica e índice de velocidade de germinação mostraram eficiência na separação de cultivares de sementes de algodão em níveis de vigor. Physiological performance of cottonseed grown in Luís Eduardo Magalhães, BahiaABSTRACT: This study was conducted at the State University of seed technology laboratory of Southwest Bahia, Campus Victory Conquest, UESB, to evaluate the physiological quality of cotton seeds (Gossypium hirsutum L., using five cultivars (DP 604, FM 993, BRS 368, GMT 642 and DELTA OPAL. Seeds were subjected to the following tests: water content, weight of a thousand seeds, germination, first count, emergence speed index, emergency, shoot length, dry mass of seedlings and electrical conductivity. The experimental design was completely randomized, with four replications of 50 seeds per treatment. The cultivar TMG 642 demonstrated low physiological seed quality when compared with the DP 604 cultivars, FM 993, BRS 368, and DELTA OPAL. Germination tests, electrical conductivity and germination rate index showed efficiency

  2. SELECTIVITY OF INSECTICIDES TO PREDATORS OF PESTS COTTON PLANT SELETIVIDADE DE INSETICIDAS AOS PREDADORES DAS PRAGAS DO ALGODOEIRO

    Directory of Open Access Journals (Sweden)

    Julio Cezar Silveira Nunes

    2007-09-01

    Full Text Available

    The selectivity of insecticides for the complex of predators of the pests of cotton plant was evaluated in field experiment, in Goiânia- Goiás (Brazil, during the crop 1998/99. The experimental design was the randomized blocks with seven treatments and four repetitions (check, clorfluazuron, Bacillus thuringiensis, alanycarb, endosulfan and acephate in two amounts. The samplings were accomplished in beforeapplication, two days, seven and fourteen days after the treatment. For the obtained results (Henderson & Tilton, the products, in the decreasing order of selectivity, were: alanycarb, clorfluazuron, B. thuringiensis, endosulfan e acephate.

    KEY-WORDS: Insecta; insecticides; cotton plant; predators.

    A seletividade de inseticidas para o complexo das pragas do algodoeiro foi avaliada em experimento de campo, em Goiânia (GO, durante a safra 1998/99. O delineamento experimental foi em blocos ao acaso com sete tratamentos testemunha, clorfluazuron, B. thuringiensis, alanycarb, endosulfan e acephate em duas dosagens, em quatro repetições. As amostragens foram realizadas em pré-aplicação; aos dois, sete e quatorze dias após as pulverizações. Pelos resultados obtidos (fórmula de Herderson & Tilton, os produtos, na ordem decrescente de seletividade, foram: alanycarb, clorfluazuron, B. thuringiensis, endosulfan e acephate.

    PALAVRAS-CHAVE: Insecta; inseticidas; algodão; predadores.

  3. Dissecting Genetic Network of Fruit Branch Traits in Upland Cotton by Association Mapping Using SSR Markers.

    Directory of Open Access Journals (Sweden)

    Yongjun Mei

    Full Text Available Genetic architecture of branch traits has large influences on the morphological structure, photosynthetic capacity, planting density, and yield of Upland cotton (Gossypium hirsutum L.. This research aims to reveal the genetic effects of six branch traits, including bottom fruit branch node number (BFBNN, bottom fruit branch length (BFBL, middle fruit branch node number (MFBNN, middle fruit branch length (MFBL, upper fruit branch node number (UFBNN, and upper fruit branch length (UFBL. Association mapping was conducted for these traits of 39 lines and their 178 F1 hybrids in three environments. There were 20 highly significant Quantitative Trait SSRs (QTSs detected by mixed linear model approach analyzing a full genetic model with genetic effects of additive, dominance, epistasis and their environment interaction. The phenotypic variation explained by genetic effects ranged from 32.64 ~ 91.61%, suggesting these branch traits largely influenced by genetic factors.

  4. Capítulo VI: evaluación de la resistencia al pasador del fruto de tomate Neoleucinodes elegantalis (Gueneé en materiales L. hirsutum Humb y Bonpl y L. pimpinellifolium (Just mill y su transferencia a materiales cultivados de tomate L. esculentum Mill

    Directory of Open Access Journals (Sweden)

    Salinas Helbert

    1994-12-01

    Full Text Available

    La investigación tuvo como objetivo estudiar el ciclo de vida del pasador  del fruto del tomate, N. elegantalis y evaluar la resistencia genética en diferentes accesiones de Lycopersicon y en poblaciones derivadas de cruzamientos interespecíficos entre L. esculentum, L. pimpinellifolium y L. hirsutum. La evaluación se realizó en condiciones de campo, utilizando un diseño de bloques completos al azar, con cuatro repeticiones. Se midieron los siguientes caracteres: estados del ciclo de vida, número de posturas, cantidad de frutos dañados, número de perforaciones de entrada, número de larvas por fruto e intensidad del daño. Se determinó el ciclo de vida del insecto plaga. Las especies silvestres fueron calificadas como muy resistentes o resistentes. Las variedades comerciales fueron calificadas como susceptible o medianamente susceptibles. Las poblaciones segregantes provenientes de los cruzamientos interespecíficos fueron calificados como resistentes o ligeramente susceptibles, indicando la posibilidad de introgresión genética de la resistencia. El insecto plaga  tiene mayor preferencia por fenotipos con frutos de mayor peso promedio y pericarpio duro.

    The research was carried out to study the life cicle of N. elegantalis, and the identification of resistence to the insect among Lycopersicon accessions and derivated populations from crossing between L. esculentum, L. pimpinellifolium and L. hirsutum. The life cicle of N. elegantalis was determinated. The wild species L. hirsutum and L. pimpinellifolium were very resistant and resistant, respectively. The Lycopersicon cultivars were susceptibles and derivated populationes from interspecific crossing were resistant or intermedium susceptible. There were associations between the fruit size, fruit firmness, fruit weight and susceptible expression in the plants from crossing between L. hirsutum, L. pimpinellifolium and commercial cultivars.

  5. Comparative transcriptomic analysis of roots of contrasting Gossypium herbaceum genotypes revealing adaptation to drought

    Directory of Open Access Journals (Sweden)

    Ranjan Alok

    2012-11-01

    Full Text Available Abstract Background Root length and its architecture govern the adaptability of plants to various stress conditions, including drought stress. Genetic variations in root growth, length, and architecture are genotypes dependent. In this study, we compared the drought-induced transcriptome of four genotypes of Gossypium herbaceum that differed in their drought tolerance adaptability. Three different methodologies, namely, microarray, pyrosequencing, and qRT–PCR, were used for transcriptome analysis and validation. Results The variations in root length and growth were found among four genotypes of G.herbaceum when exposed to mannitol-induced osmotic stress. Under osmotic stress, the drought tolerant genotypes Vagad and GujCot-21 showed a longer root length than did by drought sensitive RAHS-14 and RAHS-IPS-187. Further, the gene expression patterns in the root tissue of all genotypes were analyzed. We obtained a total of 794 differentially expressed genes by microarray and 104928 high-quality reads representing 53195 unigenes from the root transcriptome. The Vagad and GujCot-21 respond to water stress by inducing various genes and pathways such as response to stresses, response to water deprivation, and flavonoid pathways. Some key regulatory genes involved in abiotic stress such as AP2 EREBP, MYB, WRKY, ERF, ERD9, and LEA were highly expressed in Vagad and GujCot-21. The genes RHD3, NAP1, LBD, and transcription factor WRKY75, known for root development under various stress conditions, were expressed specifically in Vagad and GujCot-21. The genes related to peroxidases, transporters, cell wall-modifying enzymes, and compatible solutes (amino acids, amino sugars, betaine, sugars, or sugar alcohols were also highly expressed in Vagad and Gujcot-21. Conclusion Our analysis highlights changes in the expression pattern of genes and depicts a small but highly specific set of drought responsive genes induced in response to drought stress. Some of these

  6. Uso de misturas de adubos contendo ou não enxofre na adubação do cultivar IAC 16 de algodoeiro The effect of sulfur on 'IAC 16' cotton

    Directory of Open Access Journals (Sweden)

    Nelson M. Silva

    1981-01-01

    Full Text Available Durante quatro anos agrícolas, foi conduzido com o algodoeiro - cultivar IAC 16, ensaio de caráter permanente, de competição de misturas de adubos contendo ou não enxofre, em Latossolo Roxo, ácido, de baixa fertilidade, anteriormente ocupado com pastagem não adubada, no municipio de Guaíra (SP. A combinação de produtos comerciais, como sulfato de amônio, salitre-do-chile, nitrato de amônio, superfosfatos simples e triplo, e cloreto de potássio, permitiu ceder às plantas N e K em doses constantes e P e S em doses variáveis. No primeiro e no último ano agrícola, foram aplicadas pequenas quantidades de calcário dolomítico. A produtividade das plantas no primeiro ano agrícola foi muito baixa, mesmo nos níveis altos de adubação, o que confirma o risco de insucesso que se corre cultivando o algodoeiro em início de correção de solo ácido. O efeito do fósforo sobre a produção das plantas praticamente inexistiu nesse ano e foi de natureza quadrática após sucessivos acúmulos de adubos. A ação do enxofre se fez sentir desde o primeiro ano, aumentando com o tempo e com a efetivação do efeito das calagens. O superfosfato simples comportou-se como adubo misto, tendo proporcionado aumentos no teor de Ca trocável do solo e na concentração de Ca e S na folha do algodoeiro, após aplicações sucessivas. Através dos anos, proporcionou produtividades sistematicamente superiores às devidas ao superfosfato triplo. As maiores produções, entretanto, foram obtidas com a inclusão do sulfato de amônio em cobertura. Não se observou correlação satisfatória entre concentração de nutrientes na planta e níveis de produtividade, uma vez que K, S, N e P se acumularam nas folhas das plantas que não receberam PeSna adubação, devido provavelmente à pouca carga de capulhos formada nesse caso.The influence of the repeated applications of fertilizer mixtures containing P and S and of mixtures without S, was studied by a

  7. Resposta de cultivares de algodoeiro a subdoses de glyphosate Response of cotton cultivars to reduced rates of glyphosate

    Directory of Open Access Journals (Sweden)

    O.M. Yamashita

    2005-12-01

    Full Text Available Avaliou-se a resposta de nove cultivares de algodoeiro, de importância econômica no Estado do Mato Grosso, quanto à intoxicação causada por subdoses de glyphosate. Os cultivares de algodoeiro utilizados foram Fabrika, Makina, ITA-90, FM 986, FM 966, Delta Opal, BRS Facual, Antares e Coodetec 407. As plantas foram cultivadas em tubetes preenchidos com substrato de solo e mantidas em casa telada, tendo recebido a aplicação do glyphosate aos 20 dias após a emergência, época em que apresentavam quatro folhas verdadeiras. As subdoses de glyphosate, simulando deriva, foram de 270 e 540 g ha-1. Também foi utilizada testemunha, sem aplicação do herbicida, para efeito de comparação. Foram realizadas avaliações semanais até 42 dias após a aplicação dos tratamentos (DAA, período em que também foi tomada a altura das plantas. Os sintomas visuais de intoxicação iniciaram-se aos 3 DAA, caracterizados pelo amarelecimento das pontas das folhas mais novas, seguido de murchamento do ápice das plantas. Na dose de 270 g ha-1 esses sintomas foram de baixa intensidade, mas a 540 g ha-1 causaram, na maioria dos casos, toxidez "preocupante" a "muito alta". Os cultivares BRS Facual e FM 986 mostraram-se os mais suscetíveis. A altura das plantas foi mais afetada quando se aplicou a menor dose de glyphosate. Houve recuperação de todos os cultivares tratados com 270 g ha-1 de glyphosate até os 42 DAA. Quando tratados com 540 g ha-1 de glyphosate, os cultivares Fabrika, Coodetec 407, BRS-Facual e ITA-90 foram mais sensíveis, apresentando redução de altura entre 84 e 90% aos 42 DAA. Os cultivares menos sensíveis na dose de 270 g ha-1 de glyphosate não foram os mesmos para a dose de 540 g ha-1.The response of nine cotton cultivars economically important in the state of Mato Grosso was evaluated in relation to the toxicity caused by reduced rates of glyphosate. The cotton cultivars used were Fabrika, Makina, ITA-90, FM 986, FM 966, Delta Opal

  8. Effect of Gamma Irradiation Doses on Some Chemical Characteristics of Cotton Seed Oil

    International Nuclear Information System (INIS)

    Saleh, O.I.

    2011-01-01

    Cotton Seeds c.v. Giza 85 (Gossypium hirsutum L.) were exposed to gamma irradiation doses of 0.5, 1.0 and 1.5 kGy to improve some chemical characteristics of cotton seed oil i.e. saturated and unsaturated fatty acids, gossypol and βsitosterol that were bound oil. The presented study showed that, the saturated fatty acids; lauric, palmitic and stearic increased when the cotton seeds were exposed to gamma irradiation doses of 0.5 up to 1.5 kGy, On the other hand, arachidic acid content decreased in all the irradiated treatments compared with untreated cotton seed. The unsaturated fatty acid oleic was increased in irradiated cotton seed samples compared with untreated one, while linoleic, the major unsaturated fatty acid decreased in irradiated cotton seed oil than untreated seeds. Gossypol and βsitosterol, bound oil, in irradiated cotton seeds increased gradually with gamma irradiated doses compared with untreated control samples

  9. A synthetic auxin (NAA) suppresses secondary wall cellulose synthesis and enhances elongation in cultured cotton fiber.

    Science.gov (United States)

    Singh, Bir; Cheek, Hannah D; Haigler, Candace H

    2009-07-01

    Use of a synthetic auxin (naphthalene-1-acetic acid, NAA) to start (Gossypium hirsutum) ovule/fiber cultures hindered fiber secondary wall cellulose synthesis compared with natural auxin (indole-3-acetic acid, IAA). In contrast, NAA promoted fiber elongation and ovule weight gain, which resulted in larger ovule/fiber units. To reach these conclusions, fiber and ovule growth parameters were measured and cell wall characteristics were examined microscopically. The differences in fiber from NAA and IAA culture were underpinned by changes in the expression patterns of marker genes for three fiber developmental stages (elongation, the transition stage, and secondary wall deposition), and these gene expression patterns were also analyzed quantitatively in plant-grown fiber. The results demonstrate that secondary wall cellulose synthesis: (1) is under strong transcriptional control that is influenced by auxin; and (2) must be specifically characterized in the cotton ovule/fiber culture system given the many protocol variables employed in different laboratories.

  10. Lightweight males of Podisus nigrispinus (Heteroptera: Pentatomidae neglect lightweight females due low reproductive fitness

    Directory of Open Access Journals (Sweden)

    A. I. A. Pereira

    Full Text Available Abstract Sexual choice by male stink bugs is important because females that experience food shortages lay fewer eggs with lower viability compared with well-fed females. In this study, we investigated whether Podisus nigrispinus (Dallas (Heteroptera: Pentatomidae males fed with a low-quality diet during its nymphal stage show selectivity for sexual partners resulting in high-quality progeny. Lightweight males and females were obtained from nymphs fed weekly with Tenebrio molitor L. (Coleoptera: Tenebrionidae pupae. By contrast, heavyweight males and females were fed three times a week and received an extra nutritional source: cotton leaves, Gossypium hirsutum L. (Malvaceae. Lightweight males preferred to mate with heavy females (77.78 ± 14.69%, whereas heavyweight males did not discriminated between light or heavyweight females. Females mated with lightweight males showed similar levels of reproduction to those mated with heavyweight males. The results provide an indication of the importance of male and female body weight for sexual selection in Asopinae stink bugs.

  11. Targeted introgression of cotton fibre quality quantitative trait loci using molecular markers

    International Nuclear Information System (INIS)

    Lacape, J.M.; Trung-Bieu Nguyen; Hau, B.; Giband, M.

    2007-01-01

    Within the framework of a cotton breeding programme, molecular markers are used to improve the efficiency of the introgression of fibre quality traits of Gossypium barbadense into G. hirsutum. A saturated genetic map was developed based on genotyping data obtained from the BC 1 (75 plants) and BC 2 (200 plants) generations. Phenotypic measurements conducted over three generations (BC 1 , BC 2 and BC 2 S 1 ) allowed 80 quantitative trait loci (QTL) to be detected for fibre length, uniformity, strength, elongation, fineness and colour. Positive QTL, i.e. those for which favourable alleles came from the G. barbadense parent, were harboured by 19 QTL-rich regions on 15 'carrier' chromosomes. In subsequent generations (BC 3 and BC 4 ), markers framing the QTL-rich regions were used to select about 10 percent of over 400 plants analysed in each generation. Although BC plants selected through the marker-assisted selection (MAS) process show promising fibre quality, only their full field evaluation will allow validation of the procedure. (author)

  12. Estimating cotton canopy ground cover from remotely sensed scene reflectance

    International Nuclear Information System (INIS)

    Maas, S.J.

    1998-01-01

    Many agricultural applications require spatially distributed information on growth-related crop characteristics that could be supplied through aircraft or satellite remote sensing. A study was conducted to develop and test a methodology for estimating plant canopy ground cover for cotton (Gossypium hirsutum L.) from scene reflectance. Previous studies indicated that a relatively simple relationship between ground cover and scene reflectance could be developed based on linear mixture modeling. Theoretical analysis indicated that the effects of shadows in the scene could be compensated for by averaging the results obtained using scene reflectance in the red and near-infrared wavelengths. The methodology was tested using field data collected over several years from cotton test plots in Texas and California. Results of the study appear to verify the utility of this approach. Since the methodology relies on information that can be obtained solely through remote sensing, it would be particularly useful in applications where other field information, such as plant size, row spacing, and row orientation, is unavailable

  13. Estimate of Alabama argillacea (Hübner (Lepidoptera: Noctuidae development with nonlinear models

    Directory of Open Access Journals (Sweden)

    R. S. Medeiros

    Full Text Available The objective of this work was to evaluate which nonlinear model [Davidson (1942, 1944, Stinner et al. (1974, Sharpe & DeMichele (1977, and Lactin et al. (1995] best describes the relationship between developmental rates of the different instars and stages of Alabama argillacea (Hübner (Lepidoptera: Noctuidae, and temperature. A. argillacea larvae were fed with cotton leaves (Gossypium hirsutum L., race latifolium Hutch., cultivar CNPA 7H at constant temperatures of 20, 23, 25, 28, 30, 33, and 35ºC; relative humidity of 60 ± 10%; and photoperiod of 14:10 L:D. Low R² values obtained with Davidson (0.0001 to 0.1179 and Stinner et al. (0.0099 to 0.8296 models indicated a poor fit of their data for A. argillacea. However, high R² values of Sharpe & DeMichele (0.9677 to 0.9997 and Lactin et al. (0.9684 to 0.9997 models indicated a better fit for estimating A. argillacea development.

  14. Confirmation and quantification of strigolactones, germination stimulants for root parasitic plants Striga and Orobanche, produced by cotton.

    Science.gov (United States)

    Sato, Daisuke; Awad, Ayman A; Takeuchi, Yasutomo; Yoneyama, Koichi

    2005-01-01

    The germination stimulants for root parasitic plants Striga and Orobanche produced by cotton (Gossypium hirsutum L.) were examined in detail. Seeds of cotton were germinated and grown on glass wool wetted with sterile distilled water in sterile filter units. The root exudate was collected daily and extracted with ethyl acetate. Each of these ethyl acetate extracts was analyzed directly by high-performance liquid chromatography linked with tandem mass spectrometry (LC/MS/MS). The results demonstrate that cotton roots exuded strigol and strigyl acetate, but no other known strigolactones such as orobanchol and alectrol. The production of strigol was detected even in the root exudate collected during the first 24 h of incubation and reached a maximum 5-7 days later. The average exudation of strigol and strigyl acetate during the incubation period was ca. 15 and 2 pg/plant/day, respectively, indicating that strigol mainly contributed to germination stimulation by the cotton root exudate.

  15. Sunflower (Helianthus annuus L.) as a pre-Columbian domesticate in Mexico

    Science.gov (United States)

    Lentz, David L.; Pohl, Mary DeLand; Alvarado, José Luis; Tarighat, Somayeh; Bye, Robert

    2008-01-01

    Mexico has long been recognized as one of the world's cradles of domestication with evidence for squash (Cucurbita pepo) cultivation appearing as early as 8,000 cal B.C. followed by many other plants, such as maize (Zea mays), peppers (Capsicum annuum), common beans (Phaseolus vulgaris), and cotton (Gossypium hirsutum). We present archaeological, linguistic, ethnographic, and ethnohistoric data demonstrating that sunflower (Helianthus annuus) had entered the repertoire of Mexican domesticates by ca. 2600 cal B.C., that its cultivation was widespread in Mexico and extended as far south as El Salvador by the first millennium B.C., that it was well known to the Aztecs, and that it is still in use by traditional Mesoamerican cultures today. The sunflower's association with indigenous solar religion and warfare in Mexico may have led to its suppression after the Spanish Conquest. The discovery of ancient sunflower in Mexico refines our knowledge of domesticated Mesoamerican plants and adds complexity to our understanding of cultural evolution. PMID:18443289

  16. In vitro degradability and total gas production of biodiesel chain byproducts used as a replacement for cane sugar feed

    Directory of Open Access Journals (Sweden)

    Milenna Nunes Moreira

    2014-09-01

    Full Text Available This study aimed to determine the in vitro degradability of dry matter and the total gas production of oil seed press cake from biodiesel production (Gossypium hirsutum L., Helianthus annuus L., Ricinus communis, Moringa oleífera L. and Pinhão manso curcas L. at four different levels of replacement (0, 30, 50, and 70% for cane sugar (Saccharum officinarum RB. in ruminant feed. Inocula were prepared using the ruminal fluid of three Holstein cows, and data were collected after 48 hours of incubation. The byproducts of Moringa had the highest degradability, and castor presented the lowest values at all evaluated levels of replacement. Castor bean byproduct showed the highest total gas production, cotton showed the lowest production, and the byproduct of Moringa at the 70% level showed the best ruminal fermentation results. These results demonstrate that the use of oil seed press cake from biodiesel production (Helianthus annuus L. and Ricinus communis can replace cane sugar in ruminant feed.

  17. Effect of Tropical Rotation Crops on Meloidogyne incognita and Other Plant-Parasitic Nematodes.

    Science.gov (United States)

    McSorley, R; Dickson, D W

    1995-12-01

    In a field experiment conducted on sandy soil in Florida during the 1993 season, rotation crops of castor (Ricinus communis), velvetbean (Mucuna deeringina), 'Mississippi Silver' cowpea (Vigna unguiculata), American jointvetch (Aeschynomene americana), 'Dehapine 51' cotton (Gossypium hirsutum), and 'SX-17' sorghum-sudangrass (Sorghum bicolor x S. sudanense) were effective in maintaining low population densities (450/100 cm(3) soil) resulted after 'Clemson Spineless' okra (Hibiscus esculentus) and 'Kirby' soybean (Glycine max). Following a winter cover crop of rye (Secale cereale), densities of M. incognita following the six most effective rotation crops (1993 season) remained relatively low (crop planted in 1994, but increased by the end of the eggplant crop. The rotation crops planted during 1993 had little effect on yield of eggplant in 1994. Eggplant yield was inversely correlated with preplant densities (Pi) of Belonolaimus longicaudatus (r = -0.282; P crop cultivars were lower (P crops intended for suppression of individual Meloidogyne spp. be evaluated for their response to other nematode pests as well.

  18. Effects of Tropical Rotation Crops on Meloidogyne arenaria Population Densities and Vegetable Yields in Microplots.

    Science.gov (United States)

    McSorley, R; Dickson, D W; de Brito, J A; Hewlett, T E; Frederick, J J

    1994-06-01

    The effects of 12 summer crop rotation treatments on population densities of Meloidogyne arenaria race 1 and on yields of subsequent spring vegetable crops were determined in microplots. The crop sequence was: (i) rotation crops during summer 1991 ; (ii) cover crop of rye (Secale cereale) during winter 1991-92; (iii) squash (Cucurbita pepo) during spring 1992; (iv) rotation crops during summer 1992; (v) rye during winter 1992-93; (vi) eggplant (Solanum melongena) during spring 1993. The 12 rotation treatments were castor (Ricinus communis), cotton (Gossypium hirsutum), velvetbean (Mucuna deeringiana), crotalaria (Crotalaria spectabilis), fallow, hairy indigo (Indigofera hirsuta), American jointvetch (Aeschynomene americana), sorghum-sudangrass (Sorghum bicolor x S. sudanense), soybean (Glycine max), horsebean (Canavalia ensiformis), sesame (Sesamum indicum), and peanut (Arachis hypogaea). Compared to peanut, the first eight rotation treatments resulted in lower (P crops may provide a means for depressing M. arenaria population densities on a short-term basis to enhance yields in a subsequent susceptible vegetable crop.

  19. Impact of mine waste dumps on growth and biomass of economically important crops.

    Science.gov (United States)

    Mathiyazhagan, Narayanan; Natarajan, Devarajan

    2012-11-01

    The present study aimed to investigate the effect of magnesite and bauxite waste dumps on growth and biochemical parameters of some edible and economically important plants such as Vigna radiata, V. mungo, V. unguiculata, Eleusine coracana, Cajanus cajan, Pennisetum glaucum, Macrotyloma uniflorum, Oryza sativa, Sorghum bicolour, Sesamum indicum, Ricinus communis, Brassica juncea, Gossypium hirsutum and Jatropha curcas. The growth rate of all the crops was observed in the range of 75 to 100% in magnesite and 15 to 100% in bauxite mine soil. The moisture content of roots and shoots of all the crops were in the range of 24 to 77, 20 to 88% and 42 to 87, 59 to 88% respectively. The height of the crops was in the range of 2.6 to 48 cm in magnesite soil and 3 to 33 cm in bauxite soil. Thus the study shows that both mine soils reflects some physical and biomolecule impact on selected crops.

  20. Functional Characterization of a Dihydroflavanol 4-Reductase from the Fiber of Upland Cotton (Gossypium hirsutum

    Directory of Open Access Journals (Sweden)

    Le Wang

    2016-01-01

    Full Text Available Dihydroflavanol 4-reductase (DFR is a key later enzyme involved in two polyphenols’ (anthocyanins and proanthocyanidins (PAs biosynthesis, however it is not characterized in cotton yet. In present reports, a DFR cDNA homolog (designated as GhDFR1 was cloned from developing fibers of upland cotton. Silencing GhDFR1 in cotton by virus-induced gene silencing led to significant decrease in accumulation of anthocyanins and PAs. More interestingly, based on LC-MS analysis, two PA monomers, (–-epicatachin and (–-epigallocatachin, remarkably decreased in content in fibers of GhDFR1-silenced plants, but two new monomers, (–-catachin and (–-gallocatachin were present compared to the control plants infected with empty vector. The ectopic expression of GhDFR1 in an Arabidopsis TT3 mutant allowed for reconstruction of PAs biosynthesis pathway and led to accumulation of PAs in seed coat. Taken together, these data demonstrate that GhDFR1 contributes to the biosynthesis of anthocyanins and PAs in cotton.

  1. Expression analysis of fiber related genes in cotton (gossypium hirsutum l.) through real time pcr

    International Nuclear Information System (INIS)

    Iqbal, N.; Khatoon, A.; Asif, M.; Bashir, A.

    2016-01-01

    Cotton fibers are unicellular seed trichomes and the largest known plant cells. Fiber morphogenesis in cotton is a complex process involving a large number of genes expressed throughout fiber development process. The expression profiling of five gene families in various cotton tissues was carried out through real time PCR. Expression analysis revealed that transcripts of expansin, tubulin and E6 were elevated from 5 to 20 days post anthesis (DPA) fibers. Three Lipid transfer proteins (LTPs) including LTP1, LTP3, LTP7 exhibited highest expression in 10 - 20 DPA fibers. Transcripts of LTP3 were detected in fibers and non fiber tissues that of LTP7 were almost negligible in non fiber tissues. Sucrose phosphate synthase gene showed highest expression in 10 DPA fibers while sucrose synthse (susy) expressed at higher rate in 5-20 DPA fibers as well as roots. The results reveal that most of fiber related genes showed high expression in 5-20 DPA fibers. Comprehensive expression study may help to determine tissue and stage specificity of genes under study. The study may also help to explore complex process of fiber development and understand the role of these genes in fiber development process. Highly expressed genes in fibers may be transformed in cotton for improvement of fiber quality traits. Genes that were expressed specifically in fibers or other tissues could be used for isolation of upstream regulatory sequences. (author)

  2. Molecular Characterization and Germination Analysis of Cotton (Gossypium hirsutum L. Genotypes under Water Deficit Irrigation

    Directory of Open Access Journals (Sweden)

    Eminur ELÇİ

    2016-09-01

    Full Text Available Cotton is an important crop in terms of economic and strategic impacts. Drought stress is one of the most important environmental stress factors which negatively affects growth and yield of plants in Turkey as occurred in many countries in the world. In this study, 11 different cotton cultivars selected based on their agronomical characters were tested under water deficit irrigation strategies. Thus, it was aimed to select and/or determine appropriate new varieties for breeding new national materials resistant to drought stress, and to characterize with the molecular microsatellite markers. According to the different irrigation levels (25%, 50%, 75% and 100% plants were observed under the stressed conditions at the irrigation levels of 50% and 25%. Among the tested varieties, Tamcot Sphinx, Tamcot 94, Tamcot CamdEs and BA525 varieties were found to be more water stress tolerant than others in terms of germination time and germinated plant. The UPGMA (Unweighted Pair-Group Method Using Arithmetic Averages analysis was carried out using 28 markers with average 0.306 polymorphism information content (PIC for molecular characterization studies. Based on the UPGMA results, the varieties were clustered into two groups. It is expected that the results obtained from this study might provide considerable data for improving new drought tolerant varieties.

  3. Study of gene flow from GM cotton (Gossypium hirsutum) varieties in El Espinal (Tolima, Colombia)

    International Nuclear Information System (INIS)

    Rache Cardenal, Leidy Yanira; Mora Oberlaender, Julian; Chaparro Giraldo, Alejandro

    2013-01-01

    In 2009, 4088 hectares of genetically modified (GM) cotton were planted in Tolima (Colombia), however there is some uncertainty about containment measures needed to prevent the flow of pollen and seed from regulated GM fields into adjacent fields. In this study, the gene flow from GM cotton varieties to conventional or feral cotton plants via seed and pollen was evaluated. ImmunostripTM, PCR and ELISA assays were used to detect gene flow. Fifty six refuges, 27 fields with conventional cotton and four feral individuals of the enterprise Remolinos Inc. located in El Espinal (Tolima) were analyzed in the first half of 2010. The results indicated seed mediated gene flow in 45 refuges (80.4 %) and 26 fields with conventional cotton (96 %), besides pollen mediated gene flow in one field with conventional cotton and nine refuges. All fields cultivated with conventional cotton showed gene flow from GM cotton. Two refuges and two feral individuals did not reveal gene flow from GM cotton.

  4. Gamma irradiation of the interspecific hybrids Gossypium hirsutum L. x G. barbadense L. Part 1

    International Nuclear Information System (INIS)

    Stoilova, A.

    1990-01-01

    The aim of the investigation is to combine the methods of hybridization and experimental mutagenesis and to widen the possibilities of interspecific hybridization for successful breeding work. Four hybrid combinations resulting from reciprocal crosses between the two species were studied. Seeds of long fibre F 1 plants from each combination were devided in four equal parts, three of which were irradiated with doses 15, 20 and 25 krad and one remained as control. The complex radiosensitivity evaluation of the four hybrid combinations investigated was based on the changes in the main biometrical indices comparing the control with 25 krad treatment and showed that the F 2 hybrids were either resistant or slightly sensitive to irradiation depending on the direction of crossing in respect to growth process, field germination and survival to the end of vegetation. 2 figs., 3 tabs., 14 refs

  5. Effect of surfactant concentration on the evaporation of droplets on cotton (Gossypium hirsutum L.) leaves.

    Science.gov (United States)

    Zhou, Zhaolu; Cao, Chong; Cao, Lidong; Zheng, Li; Xu, Jun; Li, Fengmin; Huang, Qiliang

    2018-04-05

    The evaporation kinetics of pesticide droplets deposited on a leaf surface can affect their application efficiency. Evaporation of droplets on the hydrophobic leaves has received considerable attention, but little is known about hydrophilic leaf surfaces. In this study, the effect of surfactant concentration on the evaporation of droplets deposited on cotton leaves was investigated. The evaporation time is roughly decreased for concentrations ranging from 0% to 0.01% and increased from 0.01% to 0.10%. Contrary to the widely held belief that pesticide retention on target crops can rapidly be formed only with surfactant concentrations exceeding the CMC (critical micelle concentration), this study demonstrates that, on hydrophilic cotton leaves, fast evaporation of the droplet at surfactant concentrations of 0.01% (CMC) can reduce the volume quickly, lower the loss point and enhance pesticide retention. In addition, the evolution of droplet volume, height and contact angle on the cotton leaf surface were measured to confirm this conclusion. The result presented herein can be used to guide the use of surfactants and pesticides in agriculture. Copyright © 2018 Elsevier B.V. All rights reserved.

  6. Influência da adubação com torta de café na germinação do algodoeiro Efect of coffee pomace on cotton germination

    Directory of Open Access Journals (Sweden)

    C. A. Menezes Ferraz

    1963-01-01

    Full Text Available São apresentados os resultados de três ensaios com a finalidade de estudar o efeito da adubação com torta de café, na germinação do algodoeiro. Oa ensaios foram instalados em estufa, em 1961, utilizando-se a torta de café isoladamente e em combinação com fosforita de Olinda ou cloreto de potássio. Num dos ensaios foi testada uma mistura que continha 75%, em pêso, de torta de café e 25% de cloreto de potássio, em comparação com cloreto de potássio isoladamente. De modo geral, houve efeito prejudicial na aplicação da mistura de torta e cloreto de potássio, salvo no caso em que foi aplicada ao lado e abaixo do nível das sementes. O cloreto de potássio, isoladamente, não prejudicou a germinação. Num segundo ensaio foi estudada a mistura tendo 50% de torta de café e 50% de fosforita de Olinda. O efeito prejudicial foi menor que no ensaio anterior a presente mistura causou maiores prejuízos à germinação quando em contacto com as sementes; o mesmo não ocorreu quando aplicada ao lado do sulco de semeação. No terceiro ensaio foram testadas diversas épocas de aplicação, com as duas misturas acima citadas e torta de café. Notou-se uma tendência de melhoria na germinação quando os adubos foram aplicados com antecedência à semeação do algodoeiro.The effect of coffee pomace alone or mixed with other fertilizers on cotton germination was studied in three experiments. In a first experiment a mixture of coffee pomace (75% plus potassium chloride (25%. was compared with the latter alone. The pomace mixture reduced germination comiderably when it was: placed near the cotton seeds. When applied about 2 inches from this seed and 1 inch, below the seed level, gave good results. Potassium chloride alotte did not reduce germination. In the second experiment coffee pomace (50% mixed with Olinda rock phosphate (50% was compared with the latter alone. Damage to germination was of a lesser degree than in the first experiment

  7. A Novel G-Protein-Coupled Receptors Gene from Upland Cotton Enhances Salt Stress Tolerance in Transgenic Arabidopsis.

    Science.gov (United States)

    Lu, Pu; Magwanga, Richard Odongo; Lu, Hejun; Kirungu, Joy Nyangasi; Wei, Yangyang; Dong, Qi; Wang, Xingxing; Cai, Xiaoyan; Zhou, Zhongli; Wang, Kunbo; Liu, Fang

    2018-04-12

    Plants have developed a number of survival strategies which are significant for enhancing their adaptation to various biotic and abiotic stress factors. At the transcriptome level, G-protein-coupled receptors (GPCRs) are of great significance, enabling the plants to detect a wide range of endogenous and exogenous signals which are employed by the plants in regulating various responses in development and adaptation. In this research work, we carried out genome-wide analysis of target of Myb1 ( TOM1 ), a member of the GPCR gene family. The functional role of TOM1 in salt stress tolerance was studied using a transgenic Arabidopsis plants over-expressing the gene. By the use of the functional domain PF06454, we obtained 16 TOM genes members in Gossypium hirsutum , 9 in Gossypium arboreum , and 11 in Gossypium raimondii . The genes had varying physiochemical properties, and it is significant to note that all the grand average of hydropathy (GRAVY) values were less than one, indicating that all are hydrophobic in nature. In all the genes analysed here, both the exonic and intronic regions were found. The expression level of Gh_A07G0747 (GhTOM) was significantly high in the transgenic lines as compared to the wild type; a similar trend in expression was observed in all the salt-related genes tested in this study. The study in epidermal cells confirmed the localization of the protein coded by the gene TOM1 in the plasma membrane. Analysis of anti-oxidant enzymes showed higher concentrations of antioxidants in transgenic lines and relatively lower levels of oxidant substances such as H₂O₂. The low malondialdehyde (MDA) level in transgenic lines indicated that the transgenic lines had relatively low level of oxidative damage compared to the wild types. The results obtained indicate that Gh_A07G0747 (GhTOM) can be a putative target gene for enhancing salt stress tolerance in plants and could be exploited in the future for the development of salt stress-tolerant cotton

  8. A Novel G-Protein-Coupled Receptors Gene from Upland Cotton Enhances Salt Stress Tolerance in Transgenic Arabidopsis

    Directory of Open Access Journals (Sweden)

    Pu Lu

    2018-04-01

    Full Text Available Plants have developed a number of survival strategies which are significant for enhancing their adaptation to various biotic and abiotic stress factors. At the transcriptome level, G-protein-coupled receptors (GPCRs are of great significance, enabling the plants to detect a wide range of endogenous and exogenous signals which are employed by the plants in regulating various responses in development and adaptation. In this research work, we carried out genome-wide analysis of target of Myb1 (TOM1, a member of the GPCR gene family. The functional role of TOM1 in salt stress tolerance was studied using a transgenic Arabidopsis plants over-expressing the gene. By the use of the functional domain PF06454, we obtained 16 TOM genes members in Gossypium hirsutum, 9 in Gossypium arboreum, and 11 in Gossypium raimondii. The genes had varying physiochemical properties, and it is significant to note that all the grand average of hydropathy (GRAVY values were less than one, indicating that all are hydrophobic in nature. In all the genes analysed here, both the exonic and intronic regions were found. The expression level of Gh_A07G0747 (GhTOM was significantly high in the transgenic lines as compared to the wild type; a similar trend in expression was observed in all the salt-related genes tested in this study. The study in epidermal cells confirmed the localization of the protein coded by the gene TOM1 in the plasma membrane. Analysis of anti-oxidant enzymes showed higher concentrations of antioxidants in transgenic lines and relatively lower levels of oxidant substances such as H2O2. The low malondialdehyde (MDA level in transgenic lines indicated that the transgenic lines had relatively low level of oxidative damage compared to the wild types. The results obtained indicate that Gh_A07G0747 (GhTOM can be a putative target gene for enhancing salt stress tolerance in plants and could be exploited in the future for the development of salt stress

  9. Aplicação de misturas de diuron com MSMA, e com paraquat, no controle de plantas daninhas de folhas largas em cultura de algodão (Gossypium hirsutum L. Mixture of diuron whit MSMA and with paraquat for broadleaved weeds control in cotton

    Directory of Open Access Journals (Sweden)

    L. S. P. Cruz

    1978-01-01

    Full Text Available Em ensaio de campo conduzido em 1975/76 procurou-se avaliar a ação de misturas de MSMA com diuron e de paraquat com diuron, aplicadas em pós-emergência, em jato dirigido, em duas épocas diferentes, no controle de algumas plantas daninhas de folhas largas em algodão: carrapicho- do-campo (Acanthospermum australe (Loef O. Kuntze , falsa-poaia (Borreria ala ta (Aubl DC, poaia-branca (Richardia brasiliensis Gomez e guanxuma (Sida spp . A vegetação natural da área do ensaio era formada ainda pela gramínea capim-de-colchão (Digitaria sanguinalis (L. Scop . Os resultados mostraram que as misturas de 2,00 kg e 2,70 kg/ha de MSMA com, respectivamente 0,30 kg e 0,40 kg/ha de diuron, e a mistura de 0.60 kg/ha de paraquat com 0,60 kg/ ha de diuron, foram eficientes no co ntro le daquelas dicotiledôneas, e também no da gramínea. Todos os tratamentos provocaram leves sintomas de fitotoxicidade nos algodoeiros, mas desapareceram depois e não prejudicaram o desenvolvimento vegetativo das plantas, assim como a produção de algodão em caroço.In a field trial carried out in 1975/76, a diuron mixtu re with MSMA and another with paraquat was tested on broadleaved weeds in cotton crops. The applications were done in postemergence, directed-spray, in two different periods. The broadleaved weeds observed in the trial were Acanthospermum australe , Borreria alata, Richardia brasiliensis, and Sida spp, also the grass Digitaria sanguinalis. Best results were obtained with the mixture of 0,60 kg/ha of paraquat with 0,60 kg/ha of diuron, and 2,70 kg/ha of MSMA with 0,40 kg/ ha of diuron, or 2,00 kg/ha of MSMA with 0,30 kg/ha of diuron. All the treatments caused sl ight symptons of toxic ity in cotton, which disappeared later and did not damage the production.

  10. Data set for phylogenetic tree and RAMPAGE Ramachandran plot analysis of SODs in Gossypium raimondii and G. arboreum.

    Science.gov (United States)

    Wang, Wei; Xia, Minxuan; Chen, Jie; Deng, Fenni; Yuan, Rui; Zhang, Xiaopei; Shen, Fafu

    2016-12-01

    The data presented in this paper is supporting the research article "Genome-Wide Analysis of Superoxide Dismutase Gene Family in Gossypium raimondii and G. arboreum" [1]. In this data article, we present phylogenetic tree showing dichotomy with two different clusters of SODs inferred by the Bayesian method of MrBayes (version 3.2.4), "Bayesian phylogenetic inference under mixed models" [2], Ramachandran plots of G. raimondii and G. arboreum SODs, the protein sequence used to generate 3D sructure of proteins and the template accession via SWISS-MODEL server, "SWISS-MODEL: modelling protein tertiary and quaternary structure using evolutionary information." [3] and motif sequences of SODs identified by InterProScan (version 4.8) with the Pfam database, "Pfam: the protein families database" [4].

  11. GhZFP1, a novel CCCH-type zinc finger protein from cotton, enhances salt stress tolerance and fungal disease resistance in transgenic tobacco by interacting with GZIRD21A and GZIPR5.

    Science.gov (United States)

    Guo, Ying-Hui; Yu, Yue-Ping; Wang, Dong; Wu, Chang-Ai; Yang, Guo-Dong; Huang, Jin-Guang; Zheng, Cheng-Chao

    2009-01-01

    * Zinc finger proteins are a superfamily involved in many aspects of plant growth and development. However, CCCH-type zinc finger proteins involved in plant stress tolerance are poorly understood. * A cDNA clone designated Gossypium hirsutum zinc finger protein 1 (GhZFP1), which encodes a novel CCCH-type zinc finger protein, was isolated from a salt-induced cotton (G. hirsutum) cDNA library using differential hybridization screening and further studied in transgenic tobacco Nicotiana tabacum cv. NC89. Using yeast two-hybrid screening (Y2H), proteins GZIRD21A (GhZFP1 interacting and responsive to dehydration protein 21A) and GZIPR5 (GhZFP1 interacting and pathogenesis-related protein 5), which interacted with GhZFP1, were isolated. * GhZFP1 contains two typical zinc finger motifs (Cx8Cx5Cx3H and Cx5Cx4Cx3H), a putative nuclear export sequence (NES) and a potential nuclear localization signal (NLS). Transient expression analysis using a GhZFP1::GFP fusion gene in onion epidermal cells indicated a nuclear localization for GhZFP1. RNA blot analysis showed that the GhZFP1 transcript was induced by salt (NaCl), drought and salicylic acid (SA). The regions in GhZFP1 that interact with GZIRD21A and GZIPR5 were identified using truncation mutations. * Overexpression of GhZFP1 in transgenic tobacco enhanced tolerance to salt stress and resistance to Rhizoctonia solani. Therefore, it appears that GhZFP1 might be involved as an important regulator in plant responses to abiotic and biotic stresses.

  12. Biofabricated zinc oxide nanoparticles coated with phycomolecules as novel micronutrient catalysts for stimulating plant growth of cotton

    Science.gov (United States)

    Priyanka, N.; Venkatachalam, P.

    2016-12-01

    This study describes the bioengineering of phycomolecule-coated zinc oxide nanoparticles (ZnO NPs) as a novel type of plant-growth-enhancing micronutrient catalyst aimed at increasing crop productivity. The impact of natural engineered phycomolecule-loaded ZnO NPs on plant growth characteristics and biochemical changes in Gossypium hirsutum L. plants was investigated after 21 days of exposure to a wide range of concentrations (0, 25, 50, 75, 100, and 200 mg l-l). ZnO NP exposure significantly enhanced growth and biomass by 125.4% and 132.8%, respectively, in the treated plants compared to the untreated control. Interestingly, photosynthetic pigments, namely, chlorophyll a (134.7%), chlorophyll b (132.6%), carotenoids (160.1%), and total soluble protein contents (165.4%) increased significantly, but the level of malondialdehyde (MDA) content (73.8%) decreased in the ZnO-NP-exposed plants compared to the control. The results showed that there were significant increases in superoxide dismutase (SOD, 267.8%) and peroxidase (POX, 174.5%) enzyme activity, whereas decreased catalase (CAT, 83.2%) activity was recorded in the NP-treated plants compared to the control. ZnO NP treatment did not show distinct alterations (the presence or absence of DNA) in a random amplified polymorphic DNA (RAPD) banding pattern. These results suggest that bioengineered ZnO NPs coated with natural phycochemicals display different biochemical effects associated with enhanced growth and biomass in G. hirsutum. Our results imply that ZnO NPs have tremendous potential in their use as an effective plant-growth-promoting micronutrient catalyst in agriculture.

  13. Genomics-enabled analysis of the emergent disease cotton bacterial blight.

    Directory of Open Access Journals (Sweden)

    Anne Z Phillips

    2017-09-01

    Full Text Available Cotton bacterial blight (CBB, an important disease of (Gossypium hirsutum in the early 20th century, had been controlled by resistant germplasm for over half a century. Recently, CBB re-emerged as an agronomic problem in the United States. Here, we report analysis of cotton variety planting statistics that indicate a steady increase in the percentage of susceptible cotton varieties grown each year since 2009. Phylogenetic analysis revealed that strains from the current outbreak cluster with race 18 Xanthomonas citri pv. malvacearum (Xcm strains. Illumina based draft genomes were generated for thirteen Xcm isolates and analyzed along with 4 previously published Xcm genomes. These genomes encode 24 conserved and nine variable type three effectors. Strains in the race 18 clade contain 3 to 5 more effectors than other Xcm strains. SMRT sequencing of two geographically and temporally diverse strains of Xcm yielded circular chromosomes and accompanying plasmids. These genomes encode eight and thirteen distinct transcription activator-like effector genes. RNA-sequencing revealed 52 genes induced within two cotton cultivars by both tested Xcm strains. This gene list includes a homeologous pair of genes, with homology to the known susceptibility gene, MLO. In contrast, the two strains of Xcm induce different clade III SWEET sugar transporters. Subsequent genome wide analysis revealed patterns in the overall expression of homeologous gene pairs in cotton after inoculation by Xcm. These data reveal important insights into the Xcm-G. hirsutum disease complex and strategies for future development of resistant cultivars.

  14. Reação de cultivares de algodoeiro a Rhizoctonia solani na fase de plântula e benefícios do tratamento de sementes com fungicidas

    Directory of Open Access Journals (Sweden)

    Augusto César Pereira Goulart

    Full Text Available RESUMO O objetivo desse trabalho foi avaliar a reação de onze genótipos de algodoeiro ao fungo Rhizoctonia solani AG-4, na fase de plântula, com potencial de uso em futuros programas de melhoramento bem como os benefícios do tratamento de sementes com fungicidas para cada cultivar em estudo. O experimento foi conduzido por dois anos nas casas de vegetação da Embrapa Agropecuária Oeste, em Dourados, MS. Sementes de cada cultivar, não tratadas e tratadas com a mistura fungicida tolylfluanid + pencycuron + triadimenol (30+50+50g do i.a./100kg de sementes, foram semeadas em areia contida em bandejas plásticas, dispostas em orifícios individuais, eqüidistantes e a 3cm de profundidade. A inoculação com R. solani foi feita pela distribuição homogênea do inóculo do fungo na superfície do substrato (2,5g do inóculo do fungo/bandeja plástica com dimensões de 56x35x10cm. O fungo foi cultivado por 35 dias em sementes de aveia preta autoclavadas e trituradas em moinho (1mm. As avaliações foram realizadas com base no desenvolvimento de sintomas e sobrevivência das plântulas, utilizando os dados de emergência inicial e final, tombamento de pós-emergência e plântulas lesionadas pelo patógeno. Foi observado efeito significativo da interação cultivares x tratamento com fungicidas (P<0,05. Ficou claramente demonstrada a importância do tratamento das sementes de algodoeiro com fungicidas, sendo que as melhores emergências e os menores índices de doença (tombamento e plântulas lesionadas, independente da cultivar testada, foram obtidos quando as sementes foram tratadas. Em relação as cultivares avaliadas na ausência do tratamento da sementes com fungicidas, observou-se comportamento diferenciado de alguns genótipos com relação ao ataque do fungo R. solani, merecendo destaque BRS Aroeira, seguidas de BRS Cedro, BRS Ipê e FMT 701, demonstrando uma maior tolerância destas cultivares ao ataque de R. solani em comparação

  15. Non-destructive analysis of photosynthetic pigments in cotton plants=Análise não destrutiva dos pigmentos fotossintéticos em plantas de algodoeiro.

    Directory of Open Access Journals (Sweden)

    Dalva Almeida Silva

    2011-10-01

    Full Text Available Analytical techniques used to extract chlorophyll from plant leaves are destructive and based on the use of organic solvents. This study proposes a non-destructive quantification of the photosynthetic pigment concentration in cotton leaves using two portable chlorophyll meters, the SPAD-502 and the CLOROFILOG 1030. After obtaining 200 leaf discs, each with an area of 113 mm2, the greening rate in each disc was determined by the average of five readings from both meters. Immediately after measurement, 5 mL of dimethyl sulfoxide (DMSO was added, and the samples were kept in a water bath at 70ºC for 30 min. After cooling, 3 mL of the liquid extract was used for analyses by spectrophotometry at 470, 646 and 663 nm. Mathematical models were adjusted from analytical results using the reading index obtained from both devices to predict the contents of chlorophyll a, chlorophyll b, total chlorophyll and carotenoids. Based on these results, it was concluded that both portable chlorophyll meters are an effective way to estimate the concentration of photosynthetic pigments in cotton leaves, thus saving time, space and the resources that are often required for these analyses.Técnicas analíticas empregadas na extração de clorofila em plantas são destrutivas e fundamentam-se no uso de solventes orgânicos. Este estudo propõe a quantificação não destrutiva da concentração de pigmentos fotossintéticos em folhas de algodoeiro utilizando os medidores portáteis de clorofila SPAD-502 e CLOROFILOG 1030. Com as folhas coletadas foram elaborados 200 discos foliares com área de 113 mm2. A determinação do índice de esverdeamento em cada disco foi realizada por meio da média de cinco leituras com ambos clorofilômetros portáteis e imediatamente após a determinação, adicionaram-se 5 mL de Dimetil sulfóxido (DMSO. Os discos foram mantidos em banho-maria a temperatura de 70ºC por um período de 30 min. Após o resfriamento do extrato líquido, uma

  16. Identification of miRNAs and Their Targets in Cotton Inoculated with Verticillium dahliae by High-Throughput Sequencing and Degradome Analysis

    Directory of Open Access Journals (Sweden)

    Yujuan Zhang

    2015-06-01

    Full Text Available MicroRNAs (miRNAs are a group of endogenous small non-coding RNAs that play important roles in plant growth, development, and stress response processes. Verticillium wilt is a vascular disease in plants mainly caused by Verticillium dahliae Kleb., the soil-borne fungal pathogen. However, the role of miRNAs in the regulation of Verticillium defense responses is mostly unknown. This study aimed to identify new miRNAs and their potential targets that are involved in the regulation of Verticillium defense responses. Four small RNA libraries and two degradome libraries from mock-infected and infected roots of cotton (both Gossypium hirsutum L. and Gossypium barbadense L. were constructed for deep sequencing. A total of 140 known miRNAs and 58 novel miRNAs were identified. Among the identified miRNAs, many were differentially expressed between libraries. Degradome analysis showed that a total of 83 and 24 genes were the targets of 31 known and 14 novel miRNA families, respectively. Gene Ontology analysis indicated that many of the identified miRNA targets may function in controlling root development and the regulation of Verticillium defense responses in cotton. Our findings provide an overview of potential miRNAs involved in the regulation of Verticillium defense responses in cotton and the interactions between miRNAs and their corresponding targets. The profiling of these miRNAs lays the foundation for further understanding of the function of small RNAs in regulating plant response to fungal infection and Verticillium wilt in particular.

  17. Efeito de dietas com níveis crescentes de caroço de algodão integral sobre a composição química e o perfil de ácidos graxos da carne de cordeiros Santa Inês Effect of diets with increasing levels of whole cotton seed on chemical composition and fatty acid profile of Santa Inez (Santa Inês lamb meat

    Directory of Open Access Journals (Sweden)

    Marta Suely Madruga

    2008-08-01

    Full Text Available Esta pesquisa foi realizada com o objetivo de avaliar o efeito da inclusão (0, 20, 30 e 40% de caroço de algodão integral (Gossypium hirsutum na dieta sobre a composição química e o perfil de ácidos graxos da carne de cordeiros Santa Inês. Foram utilizados 24 cordeiros machos não-castrados (peso corporal inicial de 19,0 ± 0,2 kg e 4 meses de idade, todos criados em regime de confinamento em baias individuais. Os níveis de caroço de algodão integral não afetaram a composição centesimal e os percentuais de colesterol e fosfolipídios da carne ovina. Entretanto, houve diferença entre os percentuais dos ácidos graxos mirístico, palmítico e linolênico e entre a relação C18:0 + C18:1 / C16:0. Do ponto de vista nutricional, a utilização de caroço de algodão integral na dieta pode ser recomendada, durante períodos curtos, em níveis de até 40% para ovinos em terminação. Ressalta-se que o caroço de algodão integral é um subproduto economicamente viável por apresentar baixo custo de produção em comparação ao milho e à soja.The objective of this research was to evaluate the effect of inclusion (0, 20, 30 and 40% of whole cottonseed (Gossypium hirsutum in the diet on chemical composition and fatty acids profile of Santa Inez sheep meat. Twenty four no castrated male sheep were used, (initial 19.0 ± 0.2 kg BW and 4 month old, all kept in confinement regime in individual stalls. The levels of whole cottonseed did not affect chemical composition and the percentages of cholesterol and phospholipids of the lamb meat. However, there was difference among the percentages of the miristic, palmitic and linolenic fatty acids and also to the relationship C18:0 + C18:1 / C16:0. At nutritional point of view, the utilization of whole cottonseed could be recommended, during short periods, up to the level of 40% for finishing animals. In addition, whole cottonseed is a by-product economically viable for presenting low production cost

  18. Phosphorus use efficiency in pima cotton (Gossypium barbadense L. genotypes

    Directory of Open Access Journals (Sweden)

    Elcio Santos

    2015-06-01

    Full Text Available In the Brazilian Cerrado, P deficiency restricts cotton production, which requires large amounts of phosphate fertilizer. To improve the yield of cotton crops, genotypes with high P use efficiency must be identified and used. The present study evaluated P uptake and use efficiency of different Gossypium barbadense L. genotypes grown in the Cerrado. The experiment was carried out in a greenhouse with a completely randomized design, 15 x 2 factorial treatment structure (15 genotypes x 2 P levels, and four replicates. The genotypes were MT 69, MT 70, MT 87, MT 91, MT 92, MT 94, MT 101, MT 102, MT 103, MT 105, MT 106, MT 110, MT 112, MT 124, and MT 125; P levels were sufficient (1000 mg pot-1, PS treatment or deficient (PD treatment. Dry matter (DM and P levels were determined in cotton plant parts and used to calculate plant P content and use efficiency. In general, DM and P content were higher in the PS than in the PD treatment, with the exception of root DM and total DM in some genotypes. Genotypes also differed in terms of P uptake and use capacity. In the PS treatment, genotypes MT 92 and MT 102 had the highest response to phosphate fertilization. Genotype MT 69 exhibited the most efficient P uptake in the PD treatment. Genotype MT 124 showed the best shoot physiological efficiency, apparent recovery efficiency, and utilization efficiency, whereas MT 110 exhibited the highest root physiological efficiency.

  19. Efeito de fatores ambientais sobre a seletividade do alachlor ao algodoeiro Effect of environmental factors on the selectivity of alachlor to cotton

    Directory of Open Access Journals (Sweden)

    S.C. Guimarães

    2007-12-01

    Full Text Available Cotonicultores do cerrado, receosos da ocorrência de fitotoxicidade, têm utilizado o herbicida alachlor em dosagens inferiores à mínima recomendada na bula, com baixo efeito residual. Com o objetivo de estudar fatores relacionados à seletividade do alachlor ao algodoeiro, foram realizados dois experimentos. No primeiro, em caixas de germinação com substrato areia, foi estudado o herbicida alachlor em dois níveis (sem alachlor e na dose de 96 µg kg-1 de substrato, em ambientes compostos pela combinação das temperaturas de 20, 25, 30 e 35 ºC com três níveis de umidade no substrato (40, 60 e 80% da capacidade de retenção de água. A avaliação foi realizada aos 10 dias. As condições do ambiente influenciaram o crescimento das plântulas, mas essa resposta foi reduzida ou anulada na presença do alachlor; quanto mais favoráveis as condições, proporcionalmente maiores foram as reduções. O herbicida reduziu características da parte aérea e, em maior intensidade, o comprimento das raízes. No segundo ensaio, em vasos com solo, foram estudados três tratamentos de irrigação (23, 34 e 45 mm após aplicação de dois níveis de alachlor (0 e 2,88 kg ha-1. A avaliação foi realizada aos 21 dias. Maiores níveis de irrigação causaram redução na matéria fresca e seca das raízes. O alachlor reduziu todas as variáveis medidas na parte aérea das plantas, mas, de modo geral, esse efeito foi de baixa intensidade e ocorreu de maneira semelhante nos níveis de irrigação. A independência dos efeitos entre alachlor e irrigação não corroboraram a premissa de que maiores níveis de água aumentariam a lixiviação do herbicida e a fitotoxicidade ao algodoeiro.Brazilian savanna cotton growers in fear of phytotoxicity have been using the herbicide alachlor below the minimum dosage recommended by the manufacturer, with low residual activity. Two experiments were carried out to study factors related to alachlor selectivity to

  20. Efeitos de misturas de dinitramine e diuron em pré-plantio incorporado na cultura do algodão (Gossypium hirsutum L. Effects of dinitramine and diuron mixtures applied pre-planting incorporated on cotton (Gossypium hirsutum L.

    Directory of Open Access Journals (Sweden)

    R. Victoria Filho

    1982-06-01

    Full Text Available Com o objetivo de se verificar o comportamento de misturas de dinitramine e diuron no controle de plantas daninhas na cultura do algodão, foram conduzidos dois experimentos de campo nos municípios paulistas de Casa Branca e Jaboticabal, em solo argiloso (3,6% m.o. e barrento (2,3% m.o., respectivamente. A variedade de algodão semeada foi a IAC -13-1 em Casa Branca (05-11-75 e a RM-4A em Jaboticabal (03-12-75. O delineamento experimental adotado foi o de blocos ao acaso com os tratamentos de dinitramine a 0,25 kg; 0,40 kg; 0,50 kg/ha; de diuron a 1,20 kg; 1,50 kg; 1,80 kg/ha, e das misturas de dinitramine e diuron nas combinações possíveis com essas doses além do tratamento de trifluralin a 1,00 kg/ha ou mistura com diuron a 1,20 kg/ha. Constou do experimento também um tratamento sem aplicação de herbicida, mantido no limpo por meios mecânicos. Quando foi considerado o controle geral das plantas daninhas, no ensaio de Casa Branca, os melhores resultados foramobtidos pelas misturas em comparação com as aplicações isoladas de dinitramine e de diuron sobre capim-colchão (Digitaria sanguinalis (L. Scop., capimpé-de-galinha (Eleusine indica (L. Gaertn., carrapicho-rasteiro (Acanthospermum australe (Loef O. Kúntze, poaia (Borreria alata (Aubl. D.C., poaia -branca (Richardia brasiliensis Gomez e guanxuma (Sida spp. Porém, no experimento de Jaboticabal, onde as plantas daninhas mais frequentes foram capim-colchão, capim-carrapicho (Cenchrus echinatus L., capim-oferecido (Pennisetum setosum L. Rich. Pers. carrapicho-rasteiro, poaia e guanxuma, os melhores índices de controle foram obtidos com trifluralin + diuron e com dinitramine a 0,25 kg; 0,40 kg; 0,50 kg/ha em mistura com diuron a 1,80 kg/ha. Não foram observados sintomas fitotóxicos à cultura na fase inicial de desenvolvimento; e, não houve diferença significativa na produção de algodão em caroço obtida.A field research was conducted to evaluate the effects of dinitramine and diuron mixtures on weed control in cotton at two experiments at Casa Branca - SP on a clay soil (3 ,6% organic matter and Jaboticabal - SP on a clay loam (2,3% organic matter. The cotton variety sowed was IAC-13 -1 at Casa Branca (nov, 05, 1975 and RM-4A at Jaboticabal (dec. 3, 1975. The experiment had a design of randomized blocks with the treatments dinitramine at 0.25 kg; 0.40 kg; 0.50 kg/ha; diuron at 1.20 kg; 1.50 kg; 1.80 kg/ha and ali dinitramine + diuron mixture s with this rates; one treatment with trifluralin + diuron at 1.00 + 1.20 kg/ha, and one hoeded treatment. The best weed control results on the clay soil were obta ined by the mixtures when compared with the dinitramine and diuron appl ication on large crabgrass (Digitaria sanguinallis (L. Scop., go ose gras s (Eleusine indica (L . Gaertn., Paraguay starbur (Acanthospermum australe ( Loef. O. Kuntze, Borreria alata (Aubl. D.C., Brasil callalily (Richardia brasiliensis Gomez and sidas (Sida spp. but on the clay loam soil were the most important weeds we re la r ge c rabg ras s , s outhe rn s andbur (Cenchrus echinatus L. , West Indies pennisetum (Pennisetum setosum (L. Rich. Pers, Paraguay sandbur, Brasil callalily and sidas the be st weed control results were obtained with trifluralin + diuron and with dinitramine at 0.25 kg; 0.40 kg; 0.50 kg in mixture with diuron at 1.80 kg/ha. The treatments used didn't present any phyto toxicity to cotton at the initial development and there wasn't significant difference in the total yield.

  1. Methylation-sensitive amplified polymorphism analysis of Verticillium wilt-stressed cotton (Gossypium).

    Science.gov (United States)

    Wang, W; Zhang, M; Chen, H D; Cai, X X; Xu, M L; Lei, K Y; Niu, J H; Deng, L; Liu, J; Ge, Z J; Yu, S X; Wang, B H

    2016-10-06

    In this study, a methylation-sensitive amplification polymorphism analysis system was used to analyze DNA methylation level in three cotton accessions. Two disease-sensitive near-isogenic lines, PD94042 and IL41, and one disease-resistant Gossypium mustelinum accession were exposed to Verticillium wilt, to investigate molecular disease resistance mechanisms in cotton. We observed multiple different DNA methylation types across the three accessions following Verticillium wilt exposure. These included hypomethylation, hypermethylation, and other patterns. In general, the global DNA methylation level was significantly increased in the disease-resistant accession G. mustelinum following disease exposure. In contrast, there was no significant difference in the disease-sensitive accession PD94042, and a significant decrease was observed in IL41. Our results suggest that disease-resistant cotton might employ a mechanism to increase methylation level in response to disease stress. The differing methylation patterns, together with the increase in global DNA methylation level, might play important roles in tolerance to Verticillium wilt in cotton. Through cloning and analysis of differently methylated DNA sequences, we were also able to identify several genes that may contribute to disease resistance in cotton. Our results revealed the effect of DNA methylation on cotton disease resistance, and also identified genes that played important roles, which may shed light on the future cotton disease-resistant molecular breeding.

  2. Distribuição espacial de Aphis gossypii (Glover (Hemiptera, Aphididae e Bemisia tabaci (Gennadius biótipo B (Hemiptera, Aleyrodidae em algodoeiro Bt e não-Bt Spatial distribution of Aphis gossypii (Glover (Hemiptera, Aphididae and Bemisia tabaci (Gennadius biotype B (Hemiptera, Aleyrodidae on Bt and non-Bt cotton

    Directory of Open Access Journals (Sweden)

    Tatiana Rojas Rodrigues

    2010-03-01

    Full Text Available Distribuição espacial de Aphis gossypii (Glover (Hemiptera, Aphididae e Bemisia tabaci (Gennadius biótipo B (Hemiptera, Aleyrodidae em algodoeiro Bt e não-Bt. O estudo da distribuição espacial de adultos de Bemisia tabaci e de Aphis gossypii nas culturas do algodoeiro Bt e não-Bt é fundamental para a otimização de técnicas de amostragens, além de revelar diferenças de comportamento de espécies não-alvo dessa tecnologia Bt entre as duas cultivares. Nesse sentido, o experimento buscou investigar o padrão da distribuição espacial dessas espécies de insetos no algodoeiro convencional não-Bt e no cultivar Bt. As avaliações ocorreram em dois campos de 5.000 m² cada, nos quais se realizou 14 avaliações com contagem de adultos da mosca-branca e colônias de pulgões. Foram calculados os índices de agregação (razão variância/média, índice de Morisita e Expoente k da Distribuição Binomial Negativa e realizados os testes ajustes das classes numéricas de indivíduos encontradas e esperadas às distribuições teóricas de freqüência (Poisson, Binomial Negativa e Binomial Positiva. Todas as análises mostraram que, em ambas as cultivares, a distribuição espacial de B. tabaci ajustou-se a distribuição binomial negativa durante todo o período analisado, indicando que a cultivar transgênica não influenciou o padrão de distribuição agregada desse inseto. Já com relação às análises para A. gossypii, os índices de agregação apontaram distribuição agregada nas duas cultivares, mas as distribuições de freqüência permitiram concluir a ocorrência de distribuição agregada apenas no algodoeiro convencional, pois não houve nenhum ajuste para os dados na cultivar Bt. Isso indica que o algodão Bt alterou o padrão normal de dispersão dos pulgões no cultivo.The study of spatial distribution of the adults of Bemisia tabaci and the colonies of Aphis gossypii on Bt and non-Bt cotton crop is fundamental for

  3. Phenotyping Root System Architecture of Cotton (Gossypium barbadense L. Grown Under Salinity

    Directory of Open Access Journals (Sweden)

    Mottaleb Shady A.

    2017-12-01

    Full Text Available Soil salinity causes an annual deep negative impact to the global agricultural economy. In this study, the effects of salinity on early seedling physiology of two Egyptian cotton (Gossypium barbadense L. cultivars differing in their salinity tolerance were examined. Also the potential use of a low cost mini-rhizotron system to measure variation in root system architecture (RSA traits existing in both cultivars was assessed. Salt tolerant cotton cultivar ‘Giza 90’ produced significantly higher root and shoot biomass, accumulated lower Na+/K+ ratio through a higher Na+ exclusion from both roots and leaves as well as synthesized higher proline contents compared to salt sensitive ‘Giza 45’ cultivar. Measuring RSA in mini-rhizotrons containing solid MS nutrient medium as substrate proved to be more precise and efficient than peat moss/sand mixture. We report superior values of main root growth rate, total root system size, main root length, higher number of lateral roots and average lateral root length in ‘Giza 90’ under salinity. Higher lateral root density and length together with higher root tissue tolerance of Na+ ions in ‘Giza 90’ give it an advantage to be used as donor genotype for desirable root traits to other elite cultivars.

  4. Resposta do algodoeiro à aplicação de calcário e de cloreto de potássio Effect of liming and potassium fertilization on cotton

    Directory of Open Access Journals (Sweden)

    Nelson Machado da Silva

    1984-01-01

    Full Text Available Durante cinco anos agrícolas, foi conduzido ensaio permanente de calagem e adubação potássica com o algodoeiro em Latossolo Roxo, ácido, no município de Guaíra (SP com 2,4% de matéria orgânica (M.O., 5,1 de índice pH (em água; 0,4, 0,8 e 0,3meq/100cm³ de terra fina seca ao ar (T.F.S.A. respectivamente de Al3+, Ca2+ e Mg2+, e 38 e 2µg/ml de K e P. Em esquema de parcelas subdivididas, o calcário dolomítico (com poder relativo de neutralização total, PRNT, de 51,8% foi incorporado às parcelas nas doses de 0, 2, 4 e 6t/ha, no primeiro ano. O potássio foi aplicado anualmente, nas doses de 0, 50, 100 e 150kg/ha de K2O na forma de cloreto. A adubação básica constou de 100kg/ha de P2O5 e 50-60kg/ha de N, conforme o ano. Na ausência de potássio, o efeito da calagem sobre a produção do algodoeiro foi de natureza quadrática, enquanto na presença de dose adequada do nutriente (100kg/ha de K2O foi sempre linear. Em contrapartida, a reação das plantas a potássio foi mais acentuada na presença de calcário, confirmando a importância de considerar o equilíbrio de bases no critério de recomendação de adubo potássico para o algodoeiro. Na dose mais adequada, a calagem elevou consideravelmente o nível de (Ca2+ + Mg2+ e o pH da camada arável do solo, sendo observada uma estreita correlação positiva da produtividade com as citadas características. O índice pH manteve-se, após o terceiro ano, na faixa de 5,8-6,0. Devido ao baixo teor original de Al3+ e ao excelente efeito da calagem, teria sido determinada uma subdosagem caso fosse adotado o critério de recomendação de corretivo visando apenas neutralizar o Al livre do solo. Com referência à análise química do limbo foliar, a calagem contribuiu para aumentar as concentrações de Ca e de Mg e para diminuir as de K e Mn. Com a aplicação de cloreto de potássio, observou-se exatamente o inverso. Além disso, aumentou de forma sensível a concentração de Cl. Em fun

  5. Mining and Analysis of SNP in Response to Salinity Stress in Upland Cotton (Gossypium hirsutum L.).

    Science.gov (United States)

    Wang, Xiaoge; Lu, Xuke; Wang, Junjuan; Wang, Delong; Yin, Zujun; Fan, Weili; Wang, Shuai; Ye, Wuwei

    2016-01-01

    Salinity stress is a major abiotic factor that affects crop output, and as a pioneer crop in saline and alkaline land, salt tolerance study of cotton is particularly important. In our experiment, four salt-tolerance varieties with different salt tolerance indexes including CRI35 (65.04%), Kanghuanwei164 (56.19%), Zhong9807 (55.20%) and CRI44 (50.50%), as well as four salt-sensitive cotton varieties including Hengmian3 (48.21%), GK50 (40.20%), Xinyan96-48 (34.90%), ZhongS9612 (24.80%) were used as the materials. These materials were divided into salt-tolerant group (ST) and salt-sensitive group (SS). Illumina Cotton SNP 70K Chip was used to detect SNP in different cotton varieties. SNPv (SNP variation of the same seedling pre- and after- salt stress) in different varieties were screened; polymorphic SNP and SNPr (SNP related to salt tolerance) were obtained. Annotation and analysis of these SNPs showed that (1) the induction efficiency of salinity stress on SNPv of cotton materials with different salt tolerance index was different, in which the induction efficiency on salt-sensitive materials was significantly higher than that on salt-tolerant materials. The induction of salt stress on SNPv was obviously biased. (2) SNPv induced by salt stress may be related to the methylation changes under salt stress. (3) SNPr may influence salt tolerance of plants by affecting the expression of salt-tolerance related genes.

  6. Evaluation of Brevibacillus brevis as a potential plant growth promoting rhizobacteria for cotton (Gossypium hirsutum) crop.

    Science.gov (United States)

    Nehra, Vibha; Saharan, Baljeet Singh; Choudhary, Madhu

    2016-01-01

    The present investigation was undertaken to isolate, screen and evaluate a selected promising PGPR Brevibacillus brevis on cotton crop. Out of 156 bacterial isolates one of the most promising isolate was analyzed for the various PGP traits. A seed germination analysis was conducted with cotton seeds to evaluate the potential of the isolate to promote plant growth. The bacterial isolate was checked for its growth and survival at high temperatures. The isolate was also analyzed for the PGP traits exhibited after the heat treatment. To identify the isolate morphological, biochemical and molecular characterization was performed. The isolate was found positive for many of the PGP attributes like IAA, ARA, anti-fungal activity and ammonia production. Effect of seed bacterization on various plant growth parameters was used as an indicator. The isolate showed significant growth and exhibited various PGP traits at high temperature making it suitable as an inoculant for cotton crop. Isolate was identified as Brevibacillus brevis [SVC(II)14] based on phenotypic as well as genotypic attributes and after conducting this research we propose that the B. brevis which is reported for the first time for its PGP potential in cotton, exerts its beneficial effects on cotton crop through combined modes of actions.

  7. Transformation and evaluation of Cry1Ac+Cry2A and GTGene in Gossypium hirsutum L.

    Directory of Open Access Journals (Sweden)

    Agung Nugroho Puspito

    2015-11-01

    Full Text Available More than 50 countries around the globe cultivate cotton on a large scale. It is a major cash crop of Pakistan and is considered white gold because it is highly important to the economy of Pakistan. In addition to its importance, cotton cultivation faces several problems, such as insect pests, weeds, and viruses. In the past, insects have been controlled by insecticides, but this method caused a severe loss to the economy. However, conventional breeding methods have provided considerable breakthroughs in the improvement of cotton, but it also has several limitations. In comparison with conventional methods, biotechnology has the potential to create genetically modified plants that are environmentally safe and economically viable. In this study, a local cotton variety VH 289 was transformed with two Bt genes (Cry1Ac and Cry2A and a herbicide resistant gene (cp4 EPSPS using the Agrobacterium mediated transformation method. The constitutive CaMV 35S promoter was attached to the genes taken from Bacillus thuringiensis (Bt and to an herbicide resistant gene during cloning, and this promoter was used for the expression of the genes in cotton plants. This construct was used to develop the Glyphosate Tolerance Gene (GTGene for herbicide tolerance and insecticidal gene (Cry1Ac and Cry2A for insect tolerance in the cotton variety VH 289. The transgenic cotton variety performed 85% better compared with the non-transgenic variety. The study results suggest that farmers should use the transgenic cotton variety for general cultivation to improve the production of cotton.

  8. STUDY OF GENE FLOW FROM GM COTTON (Gossypium hirsutum VARIETIES IN “EL ESPINAL” (TOLIMA, COLOMBIA.

    Directory of Open Access Journals (Sweden)

    Alejandro Chaparro Giraldo

    2013-09-01

    Full Text Available In 2009, 4088 hectares of genetically modified (GM cotton were planted in Tolima (Colombia, however there is some uncertainty about containment measures needed to prevent the flow of pollen and seed from regulated GM fields into adjacent fields. In this study, the gene flow from GM cotton varieties to conventional or feral cotton plants via seed and pollen was evaluated. ImmunostripTM, PCR and ELISA assays were used to detect gene flow. Fifty six refuges, 27 fields with conventional cotton and four feral individuals of the enterprise “Remolinos Inc.” located in El Espinal (Tolima were analyzed in the first half of 2010. The results indicated seeds mediated gene flow in 45 refuges (80,4 % and 26 fields with conventional cotton (96 %, besides a pollen mediated gene flow in one field with conventional cotton and nine refuges. All fields cultivated with conventional cotton showed gene flow from GM cotton. Two refuges and two feral individuals did not reveal gene flow from GM cotton.

  9. How to be sweet? Extra floral nectar allocation by Gossypium hirsutum fits optimal defense theory predictions

    NARCIS (Netherlands)

    Wäckers, F.L.; Bonifay, C.

    2004-01-01

    Plants employ nectar for two distinct functions. Floral nectar has traditionally been viewed in the context of pollination. Extrafloral nectar on the other hand, can act as an indirect defense, allowing the plant to recruit predators and parasitoids. Whereas this makes for a clear-cut

  10. How to be sweet? Extra floral nectar allocation by Gossypium hirsutum fits optimal defense theory predictions

    OpenAIRE

    Wäckers, F.L.; Bonifay, C.

    2004-01-01

    Plants employ nectar for two distinct functions. Floral nectar has traditionally been viewed in the context of pollination. Extrafloral nectar on the other hand, can act as an indirect defense, allowing the plant to recruit predators and parasitoids. Whereas this makes for a clear-cut categorization, in reality the functions may not be so discrete. Extrafloral nectar may serve a role in pollination, while floral nectar can be utilized by predators and parasitoids and thus can contribute to pl...

  11. A Long-Read Transcriptome Assembly of Cotton (Gossypium hirsutum L. and Intraspecific Single Nucleotide Polymorphism Discovery

    Directory of Open Access Journals (Sweden)

    Hamid Ashrafi

    2015-07-01

    Full Text Available Upland cotton ( L. has a narrow germplasm base, which constrains marker development and hampers intraspecific breeding. A pressing need exists for high-throughput single nucleotide polymorphism (SNP markers that can be readily applied to germplasm in breeding and breeding-related research programs. Despite progress made in developing new sequencing technologies during the past decade, the cost of sequencing remains substantial when one is dealing with numerous samples and large genomes. Several strategies have been proposed to lower the cost of sequencing for multiple genotypes of large-genome species like cotton, such as transcriptome sequencing and reduced-representation DNA sequencing. This paper reports the development of a transcriptome assembly of the inbred line Texas Marker-1 (TM-1, a genetic standard for cotton, its usefulness as a reference for RNA sequencing (RNA-seq-based SNP identification, and the availability of transcriptome sequences of four other cotton cultivars. An assembly of TM-1 was made using Roche 454 transcriptome reads combined with an assembly of all available public expressed sequence tag (EST sequences of TM-1. The TM-1 assembly consists of 72,450 contigs with a total of 70 million bp. Functional predictions of the transcripts were estimated by alignment to selected protein databases. Transcriptome sequences of the five lines, including TM-1, were obtained using an Illumina Genome Analyzer-II, and the short reads were mapped to the TM-1 assembly to discover SNPs among the five lines. We identified >14,000 unfiltered allelic SNPs, of which ∼3,700 SNPs were retained for assay development after applying several rigorous filters. This paper reports availability of the reference transcriptome assembly and shows its utility in developing intraspecific SNP markers in upland cotton.

  12. Radiation and chemical mutagen induced somaclonal variations through in vitro organogenesis of cotton (Gossypium hirsutum L.).

    Science.gov (United States)

    Muthusamy, Annamalai; Jayabalan, Narayanasamy

    2014-12-01

    The purpose of the investigation was to induce somaclonal variations by gamma rays (GR), ethylmethane sulphonate (EMS) and sodium azide (SA) during in vitro organogenesis of cotton. The shoot tip explants were irradiated with 5-50 Gray (Gy) GR (Cobalt 60), 0.5-5.0 mM EMS and SA separately, and inoculated on Murashige and Skoog (MS) medium fortified with plant growth regulator (PGR) for organogenesis. The plantlets with well-developed root systems were acclimatized and transferred into the experimental field to screen the somaclonal variations during growth and development. The number of somaclonal variations was observed in growth of irradiated/treated shoot tips, multiplication, plantlet regeneration and growth in vitro and ex vitro. The lower doses/concentrations of mutagenic treatments showed significant enhancement in selected agronomical characters and they showed decreased trends with increasing doses/concentrations of mutagenic agents. The results of the present study revealed the influence of lower doses/concentrations of mutagenic treatments on in vitro and ex vitro growth of cotton plantlets and their significant improvement in agronomical characters which needs further imperative stability analysis. The present observations showed the platform to use lower doses/concentrations of mutagenic agents to induce variability for enhanced agronomical characters, resistant and tolerant cotton varieties.

  13. Influence of foliar application of glycine betaine on gas exchange characteristics of cotton (gossypium Hirsutum L.)

    International Nuclear Information System (INIS)

    Makhdum, M.I.; Din, S.U.

    2007-01-01

    Water is the most limiting factor in cotton production and numerous efforts are being made to improve crop drought tolerance. A field study was conducted with the objectives to determine the effects of different application rates of glycine betaine in field grown cotton at Central Cotton Research Institute, Multan. Four levels of glycine betaine (0.0, 1.0, 3.0 and 6.0 kg ha-1) were applied at three physiological growth stages i.e. at squaring, first flower and peak flowering. Cotton cultivar CIM-448 was used as test crop. Results showed that crop sprayed with glycine betaine at the rate of 6.0 kg ha-1 maintained 120.0, 62.1, 69.7 and 35.5 percent higher net CO/sub 2/ assimilation rate (PN), transpiration rate (E), stomatal resistance (gs) and water use efficiency (PN/E), respectively over that of untreated crop. Crop spayed with glycine betaine at peak flowering stage maintained higher PN, E, gs and PN/E compared to at other stages of growth. (author)

  14. Aplicação seqüencial de cloreto de mepiquat em algodoeiro Sequential applications of mepiquat chloride in cotton plants

    Directory of Open Access Journals (Sweden)

    Manoel Luiz Ferreira Athayde

    1999-03-01

    Full Text Available Com o objetivo de avaliar o efeito de doses de cloreto de mepiquat aplicadas de forma parcelada, foi conduzido, em Jaboticabal, SP, um experimento com a cultivar de algodoeiro IAC 22. O delineamento experimental foi o de blocos casualizados, com 13 tratamentos e 4 repetições. O efeito do cloreto de mepiquat sobre a redução da altura das plantas foi mais evidenciado pela dose total aplicada do que pelo uso do esquema de parcelamento. A menor dose estudada (55 g/ha foi suficiente para que as plantas, por ocasião da colheita, estivessem com altura inferior a 1,30 m. O cloreto de mepiquat proporcionou redução no comprimento dos ramos e um melhor equilíbrio entre as partes reprodutiva e vegetativa. As características peso de capulho, peso de 100 sementes, porcentagem de fibra e produção de algodão em caroço, não foram significativamente afetadas pelos tratamentos.The objective of this work was to evaluate the effect of split dosis of mepiquat chloride on the cotton cultivar IAC 22 at Jaboticabal, SP. The experimental design was in completely randomized blocks constituted by 13 treatments, and four replicates. The effect of dosis on plant height was more pronounced than the splitting effect. The smallest dosis used (55 g/ha was enough to declare plant height to less than 1.30 m, at harvest. The effect of mepiquat chloride reduced branch length and provided better reproductive/vegetative relation. The effects on boll weight, 100 seed weight, percentage of fiber and seed yield were not significant.

  15. Sesquiterpene Synthase-3-Hydroxy-3-Methylglutaryl Coenzyme A Synthase Fusion Protein Responsible for Hirsutene Biosynthesis in Stereum hirsutum.

    Science.gov (United States)

    Flynn, Christopher M; Schmidt-Dannert, Claudia

    2018-06-01

    The wood-rotting mushroom Stereum hirsutum is a known producer of a large number of namesake hirsutenoids, many with important bioactivities. Hirsutenoids form a structurally diverse and distinct class of sesquiterpenoids. No genes involved in hirsutenoid biosynthesis have yet been identified or their enzymes characterized. Here, we describe the cloning and functional characterization of a hirsutene synthase as an unexpected fusion protein of a sesquiterpene synthase (STS) with a C-terminal 3-hydroxy-3-methylglutaryl-coenzyme A (3-hydroxy-3-methylglutaryl-CoA) synthase (HMGS) domain. Both the full-length fusion protein and truncated STS domain are highly product-specific 1,11-cyclizing STS enzymes with kinetic properties typical of STSs. Complementation studies in Saccharomyces cerevisiae confirmed that the HMGS domain is also functional in vivo Phylogenetic analysis shows that the hirsutene synthase domain does not form a clade with other previously characterized sesquiterpene synthases from Basidiomycota. Comparative gene structure analysis of this hirsutene synthase with characterized fungal enzymes reveals a significantly higher intron density, suggesting that this enzyme may be acquired by horizontal gene transfer. In contrast, the HMGS domain is clearly related to other fungal homologs. This STS-HMGS fusion protein is part of a biosynthetic gene cluster that includes P450s and oxidases that are expressed and could be cloned from cDNA. Finally, this unusual fusion of a terpene synthase to an HMGS domain, which is not generally recognized as a key regulatory enzyme of the mevalonate isoprenoid precursor pathway, led to the identification of additional HMGS duplications in many fungal genomes, including the localization of HMGSs in other predicted sesquiterpenoid biosynthetic gene clusters. IMPORTANCE Hirsutenoids represent a structurally diverse class of bioactive sesquiterpenoids isolated from fungi. Identification of their biosynthetic pathways will provide

  16. Proteomic profiling of developing cotton fibers from wild and domesticated Gossypium barbadense.

    Science.gov (United States)

    Hu, Guanjing; Koh, Jin; Yoo, Mi-Jeong; Grupp, Kara; Chen, Sixue; Wendel, Jonathan F

    2013-10-01

    Pima cotton (Gossypium barbadense) is widely cultivated because of its long, strong seed trichomes ('fibers') used for premium textiles. These agronomically advanced fibers were derived following domestication and thousands of years of human-mediated crop improvement. To gain an insight into fiber development and evolution, we conducted comparative proteomic and transcriptomic profiling of developing fiber from an elite cultivar and a wild accession. Analyses using isobaric tag for relative and absolute quantification (iTRAQ) LC-MS/MS technology identified 1317 proteins in fiber. Of these, 205 were differentially expressed across developmental stages, and 190 showed differential expression between wild and cultivated forms, 14.4% of the proteome sampled. Human selection may have shifted the timing of developmental modules, such that some occur earlier in domesticated than in wild cotton. A novel approach was used to detect possible biased expression of homoeologous copies of proteins. Results indicate a significant partitioning of duplicate gene expression at the protein level, but an approximately equal degree of bias for each of the two constituent genomes of allopolyploid cotton. Our results demonstrate the power of complementary transcriptomic and proteomic approaches for the study of the domestication process. They also provide a rich database for mining for functional analyses of cotton improvement or evolution. © 2013 The Authors. New Phytologist © 2013 New Phytologist Trust.

  17. AVALIAÇÃO DE DANOS Spodoptera frugiperda (J. E. Smith, 1797 (Lepidoptera, Noctuidae NO ALGODOEIRO CULTIVAR IAC-17 EVALUATION OF Spodoptera frugiperda (J. E. SMITH, 1797 (LEPIDOPTERA, NOCTUIDAE DAMAGES IN THE COTTON PLANT IAC-17 CULTIVAR

    Directory of Open Access Journals (Sweden)

    Valquíria da Rocha Santos Veloso

    2007-09-01

    Full Text Available

    Com a finalidade de avaliar os danos causados por Spodoptera frugiperda (J. E. Smith, 1797 na produção do algodoeiro, foi conduzido o presente trabalho. Foram utilizados quatro níveis de infestação artificial aos 75 e 95 dias da germinação das plantas. As avaliações foram feitas através da produção de algodão em caroço, por parcela. As diferenças na produção em plantas infestadas aos 75 e 95 dias da germinação, comparadas com a testemunha, foram estatisticamente significativas para as infestações com 1, 2 e 4 lagartas por planta. Aos 75 dias, devido ao fato de existirem poucos órgãos frutíferos, a redução na produção deu-se devido ao ataque das lagartas aos ponteiros e aos caules, com corte parcial ou total. Na infestação aos 95 dias a produção diminuiu linearmente em relação aos diferentes níveis de infestação; nesta época as lagartas mostraram preferência pelas estruturas frutíferas do algodoeiro.

    This work was conducted with the purpose of evaluate the damages provoked by Spodoptera frugiperda (J. E. Smith, 1797 in cotton-plant yield. To evaluate the decrease in the cotton yield four levels of artificial infestation were used at 75 and 95 days from plant germination. The damage was evaluated on cotton seeds per plot. The differences in the yield of infested plants at 75 and 95 days from germination, when compared to the check, were statistically significant for the infestations of 1, 2 and 4 larvae per plant. At 75 days when the plants presented a low number of fruit organs, the yield decrease was due to the attack of larvae cutting partially or totally the shoots and stems. As to the infestation at 95 days the yield decreased linearly in relation to the different levels of infestation; at this time the larvae showed a preference for the fruit

  18. Response of cotton varieties to different environments flowering behavior and fiber quality

    International Nuclear Information System (INIS)

    Jawdat, D.; Ayyoubi, Z.; Al-Safadi, B.

    2015-01-01

    The flowering behavior and fiber quality traits were analyzed of six Gossypium hirsutum L. varieties and one G. barbadense variety that were cultivated in two environmentally different locations. Records of days after planting (DAP) at first floral bud emergence, DAP at first floral opening, plant height at first flower and nodes above white flower (NAWF) were analyzed statistically to study flowering behavior in both locations. Fiber traits were tested and records of micronaire, fiber length, strength, cohesion, elongation, ginning percentage, and weight of seed cotton were statistically analyzed to look for significant differences and correlations. Earliness and a decline in fiber strength, and fiber cohesion were obtained in varieties cultivated in Soujeh accompanied with an increase in ginning percentages. Uniquely, fiber elongation showed no significant differences in varieties between the two environments in both seasons. Our results indicated that stability in some fiber traits such as, micronaire, fiber length, strength and cohesion was a variety specific. Evidently, fiber elongation in our work was not affected by cultivation managements and environmental conditions which suggest the solid genetic bases that control this trait.(author)

  19. Characterization of Developmental- and Stress-Mediated Expression of Cinnamoyl-CoA Reductase in Kenaf (Hibiscus cannabinus L.)

    Science.gov (United States)

    Lim, Hyoun-Sub; Park, Sang-Un; Bae, Hyeun-Jong; Natarajan, Savithiry

    2014-01-01

    Cinnamoyl-CoA reductase (CCR) is an important enzyme for lignin biosynthesis as it catalyzes the first specific committed step in monolignol biosynthesis. We have cloned a full length coding sequence of CCR from kenaf (Hibiscus cannabinus L.), which contains a 1,020-bp open reading frame (ORF), encoding 339 amino acids of 37.37 kDa, with an isoelectric point (pI) of 6.27 (JX524276, HcCCR2). BLAST result found that it has high homology with other plant CCR orthologs. Multiple alignment with other plant CCR sequences showed that it contains two highly conserved motifs: NAD(P) binding domain (VTGAGGFIASWMVKLLLEKGY) at N-terminal and probable catalytic domain (NWYCYGK). According to phylogenetic analysis, it was closely related to CCR sequences of Gossypium hirsutum (ACQ59094) and Populus trichocarpa (CAC07424). HcCCR2 showed ubiquitous expression in various kenaf tissues and the highest expression was detected in mature flower. HcCCR2 was expressed differentially in response to various stresses, and the highest expression was observed by drought and NaCl treatments. PMID:24723816

  20. Isolation and characterization of gene sequences expressed in cotton fiber

    Directory of Open Access Journals (Sweden)

    Taciana de Carvalho Coutinho

    2016-06-01

    Full Text Available ABSTRACT Cotton fiber are tubular cells which develop from the differentiation of ovule epidermis. In addition to being one of the most important natural fiber of the textile group, cotton fiber afford an excellent experimental system for studying the cell wall. The aim of this work was to isolate and characterise the genes expressed in cotton fiber (Gossypium hirsutum L. to be used in future work in cotton breeding. Fiber of the cotton cultivar CNPA ITA 90 II were used to extract RNA for the subsequent generation of a cDNA library. Seventeen sequences were obtained, of which 14 were already described in the NCBI database (National Centre for Biotechnology Information, such as those encoding the lipid transfer proteins (LTPs and arabinogalactans (AGP. However, other cDNAs such as the B05 clone, which displays homology with the glycosyltransferases, have still not been described for this crop. Nevertheless, results showed that several clones obtained in this study are associated with cell wall proteins, wall-modifying enzymes and lipid transfer proteins directly involved in fiber development.

  1. Carbon Accumulation during Photosynthesis in Leaves of Nitrogen- and Phosphorus-Stressed Cotton.

    Science.gov (United States)

    Radin, J W; Eidenbock, M P

    1986-11-01

    Leaves of cotton (Gossypium hirsutum L.) accumulate considerable dry mass per unit area during photosynthesis. The percentage of C in that accumulated dry mass was estimated as the regression coefficient (slope) of a linear regression relating C per unit area to total dry mass per unit area. Plants were grown on full nutrients or on N- or P-deficient nutrient solutions. In the fully nourished controls, the mass that accumulated over a 9-hour interval beginning at dawn contained 38.6% C. N and P stress increased the C concentration of accumulated mass to 49.7% and 45.1%, respectively. Nutrient stress also increased the starch concentration of accumulated mass, but starch alone could not account for the differences in C concentration. P stress decreased the estimated rate of C export from source leaves, calculated as the difference between C assimilation and C accumulation. The effect of P stress on apparent export was very sensitive to the C concentration used in the calculation, and would not have been revealed with an assumption of unchanged C concentration in the accumulated mass.

  2. Response of cotton varieties to different environments: flowering behavior and fiber quality

    International Nuclear Information System (INIS)

    Jawdat, D.; Ayyoub, Z.; Elias, R.

    2012-01-01

    Flowering behavior and fiber quality traits were analyzed of six Gossypium hirsutum L. varieties and one G. barbadense variety that were cultivated in two environmentally different locations. Records of days after planting (DAP) at first floral bud emergence, DAP at first floral opening, plant height at first flower and nodes above white flower (NAWF) were analyzed statistically to study flowering behavior in both locations. Fiber traits were tested and records of micronaire, fiber length, strength, cohesion, elongation, ginning percentage, and weight of seed cotton were statistically analyzed to look for significant differences and correlations. Earliness and a decline in fiber strength, and fiber cohesion were obtained in varieties cultivated in Soujeh accompanied with an increase in ginning percentages. Uniquely, fiber elongation showed no significant differences in varieties between the two environments in both seasons. Our results indicated that stability in some fiber traits such as, micronaire, fiber length, strength and cohesion was a variety specific. Evidently, fiber elongation in our work was not affected by cultivation managements and environmental conditions which suggest the solid genetic bases that control this trait. (author)

  3. Detoxification of Fusaric Acid by the Soil Microbe Mucor rouxii.

    Science.gov (United States)

    Crutcher, Frankie K; Puckhaber, Lorraine S; Bell, Alois A; Liu, Jinggao; Duke, Sara E; Stipanovic, Robert D; Nichols, Robert L

    2017-06-21

    Fusarium oxysporum f. sp. vasinfectum race 4 (VCG0114), which causes root rot and wilt of cotton (Gossypium hirsutum and G. barbadense), has been identified recently for the first time in the western hemisphere in certain fields in the San Joaquin Valley of California. This pathotype produces copious quantities of the plant toxin fusaric acid (5-butyl-2-pyridinecarboxylic acid) compared to other isolates of F. oxysporum f. sp. vasinfectum (Fov) that are indigenous to the United States. Fusaric acid is toxic to cotton plants and may help the pathogen compete with other microbes in the soil. We found that a laboratory strain of the fungus Mucor rouxii converts fusaric acid into a newly identified compound, 8-hydroxyfusaric acid. The latter compound is significantly less phytotoxic to cotton than the parent compound. On the basis of bioassays of hydroxylated analogues of fusaric acid, hydroxylation of the butyl side chain of fusaric acid may affect a general detoxification of fusaric acid. Genes that control this hydroxylation may be useful in developing biocontrol agents to manage Fov.

  4. Characterization of Developmental- and Stress-Mediated Expression of Cinnamoyl-CoA Reductase in Kenaf (Hibiscus cannabinus L.

    Directory of Open Access Journals (Sweden)

    Ritesh Ghosh

    2014-01-01

    Full Text Available Cinnamoyl-CoA reductase (CCR is an important enzyme for lignin biosynthesis as it catalyzes the first specific committed step in monolignol biosynthesis. We have cloned a full length coding sequence of CCR from kenaf (Hibiscus cannabinus L., which contains a 1,020-bp open reading frame (ORF, encoding 339 amino acids of 37.37 kDa, with an isoelectric point (pI of 6.27 (JX524276, HcCCR2. BLAST result found that it has high homology with other plant CCR orthologs. Multiple alignment with other plant CCR sequences showed that it contains two highly conserved motifs: NAD(P binding domain (VTGAGGFIASWMVKLLLEKGY at N-terminal and probable catalytic domain (NWYCYGK. According to phylogenetic analysis, it was closely related to CCR sequences of Gossypium hirsutum (ACQ59094 and Populus trichocarpa (CAC07424. HcCCR2 showed ubiquitous expression in various kenaf tissues and the highest expression was detected in mature flower. HcCCR2 was expressed differentially in response to various stresses, and the highest expression was observed by drought and NaCl treatments.

  5. Influence of Aphelenchus avenae on Vesicular-arbuscular Endomycorrhizal Growth Response in Cotton.

    Science.gov (United States)

    Hussey, R S; Roncadori, R W

    1981-01-01

    The influence of Aphelenchus avenae on the relationship between cotton (Gossypium hirsutum 'Stoneville 213') and Gigaspora margarita or Glomus etunicatus was assessed by its effect on the mycorrhizal stimulation of plant growth and microorganism reproduction. The mycophagous nematode usually did not suppress stimulation of shoot growth resulting from mycorrhizae (G. margarita) at inoculum levels of 3,000 or 6,000 nematodes per pot, but retarded root growth at 6,000 per pot. When the nematode inoculum was increased to 10, 40, or 80 thousand, G. margarita stimulation of shoot or root growth was retarded at the two higher rates. Shoot growth enhancement by G. etunicatus was suppressed by 10 thousand A. avenae but not by 40 or 80 thousand. A. avenae reproduced better when the nematode was added 3 wk after G. margarita than with simultaneous inoculations. Sporulation of both fungi was affected little by the mycophagous nematode. The high numbers of A. avenae required for an antagonistic effect probably precludes the occurrence of any significant interaction between these two organisms under field conditions.

  6. Optimisation de la transformation génétique de la pomme de terre par Agrobacterium tumefaciens. Utilisation de la résistance à l'hygromycine comme marqueur sélectif

    Directory of Open Access Journals (Sweden)

    Rouvière C.

    2003-01-01

    Full Text Available Optimization of potato genetic transformation by Agrobacterium tumefaciens using hygromycin resistance as selective marker. The objective of this work is the optimization of a genetic transformation and a regeneration protocol of transgenic plants in Solanum tuberosum cv Désirée using hygromycin resistance as selective marker. The gene Cat2 of Nicotiana plumbaginifolia and the gene SU2 of Gossypium hirsutum, both coding for catalases, have been used. Two antibiotic concentrations (5 and 10 mg . l -1 of culture medium combined with two preculture periods (5 and 20 days on non-selective medium were tested. Coculture medium was supplemented with 10 mg . l -1 of acetosyringone to test its effect on potato transformation. The addition of this phenolic compound to the coculture medium affected positively the regeneration aptitude of transgenic SU2 plants. Only the combination of 5 mg . l -1 of hygromycin and 20 days of preculture without antibiotic allowed the obtention of plants transformed with the gene SU2. Screening of the rooted shoots with PCR showed 45% of transgenic plants for both molecular constructions used.

  7. Fatty Acid and Proximate Composition of Bee Bread

    Directory of Open Access Journals (Sweden)

    Muammer Kaplan

    2016-01-01

    Full Text Available Palynological spectrum, proximate and fatty acid (FA composition of eight bee bread samples of different botanical origins were examined and significant variations were observed. The samples were all identified as monofloral, namely Castanea sativa (94.4 %, Trifolium spp. (85.6 %, Gossypium hirsutum (66.2 %, Citrus spp. (61.4 % and Helianthus annuus (45.4 %. Each had moisture content between 11.4 and 15.9 %, ash between 1.9 and 2.54 %, fat between 5.9 and 11.5 %, and protein between 14.8 and 24.3 %. A total of 37 FAs were determined with most abundant being (9Z,12Z,15Z-octadeca-9,12,15-trienoic, (9Z,12Z-octadeca-9,12-dienoic, hexadecanoic, (Z-octadec-9-enoic, (Z-icos-11-enoic and octadecanoic acids. Among all, cotton bee bread contained the highest level of ω-3 FAs, i.e. 41.3 %. Unsaturated to saturated FA ratio ranged between 1.38 and 2.39, indicating that the bee bread can be a good source of unsaturated FAs.

  8. Manejo de plantas daninhas na cultura do algodoeiro com S-metolachlor e trifloxysulfuron-sodium em sistema de plantio convencional Weed Management with S-metolachlor and trifloxysulfuron-sodium in cotton field

    Directory of Open Access Journals (Sweden)

    R.S. Freitas

    2006-06-01

    Full Text Available Objetivou-se com este trabalho desenvolver tecnologia para manejo de plantas daninhas na cultura do algodoeiro, em sistema de plantio convencional, combinando os herbicidas S-metolachlor em pré-emergência com trifloxysulfuron-sodium em pós-emergência. Foram avaliados 14 tratamentos, em arranjo fatorial 3 x 4 (três doses de S-metolachlor: 384, 768 e 1.152 g ha-1 e quatro doses de trifloxysulfuron-sodium: 0,0; 2,625; 5,250; e 7,875 g ha-1, mais duas testemunhas (com e sem convivência com as plantas daninhas por todo o ciclo do algodoeiro, em delineamento de blocos casualizados, com quatro repetições. Na área, foi verificada a presença das seguintes espécies daninhas: Alternanthera tenella, representando mais de 80% do total, Bidens spp., Acanthospermum hispidum, Cenchrus echinatus, Digitaria horizontalis, Eleusine indica e Commelina benghalensis. S-metolachlor apresentou alta eficiência no controle de A. tenella, C. echinatus, D. horizontalis, E. indica e C. benghalensis. Trifloxysulfuron-sodium controlou as espécies dicotiledôneas eficientemente. Os tratamentos que proporcionaram melhor produtividade de algodão em caroço foram Smetolachlor (768 g ha-1 mais trifloxysulfuron-sodium (7,875 g ha-1 e S-metolachlor (1.152 g ha-1 mais trifloxysulfuron-sodium (5,250 e 7,875 g ha-1. O melhor controle de plantas daninhas na colheita do algodão foi obtido com 1.152 g ha-1 de S-metolachlor mais 7,875 g ha-1 de trifloxysulfuron-sodium.This work aimed to develop a strategy for weed management in conventionally tilled cotton by combining the herbicides S-metolachlor in pre-emergence and trifloxysulfuron-sodium in post-emergence. Fourteen treatments were evaluated arranged in a factorial scheme 3 (three doses of S-metolachlor 384; 768 and 1,152 g ha-1 x 4 (four doses of trifloxysulfuron-sodium 0.0; 2.625; 5.250 and 7.875 g ha-1, plus two controls (with and without weeds throughout the cotton planting cycle. The following weed species were

  9. Characterization of the late embryogenesis abundant (LEA) proteins family and their role in drought stress tolerance in upland cotton.

    Science.gov (United States)

    Magwanga, Richard Odongo; Lu, Pu; Kirungu, Joy Nyangasi; Lu, Hejun; Wang, Xingxing; Cai, Xiaoyan; Zhou, Zhongli; Zhang, Zhenmei; Salih, Haron; Wang, Kunbo; Liu, Fang

    2018-01-15

    Late embryogenesis abundant (LEA) proteins are large groups of hydrophilic proteins with major role in drought and other abiotic stresses tolerance in plants. In-depth study and characterization of LEA protein families have been carried out in other plants, but not in upland cotton. The main aim of this research work was to characterize the late embryogenesis abundant (LEA) protein families and to carry out gene expression analysis to determine their potential role in drought stress tolerance in upland cotton. Increased cotton production in the face of declining precipitation and availability of fresh water for agriculture use is the focus for breeders, cotton being the backbone of textile industries and a cash crop for many countries globally. In this work, a total of 242, 136 and 142 LEA genes were identified in G. hirsutum, G. arboreum and G. raimondii respectively. The identified genes were classified into eight groups based on their conserved domain and phylogenetic tree analysis. LEA 2 were the most abundant, this could be attributed to their hydrophobic character. Upland cotton LEA genes have fewer introns and are distributed in all chromosomes. Majority of the duplicated LEA genes were segmental. Syntenic analysis showed that greater percentages of LEA genes are conserved. Segmental gene duplication played a key role in the expansion of LEA genes. Sixty three miRNAs were found to target 89 genes, such as miR164, ghr-miR394 among others. Gene ontology analysis revealed that LEA genes are involved in desiccation and defense responses. Almost all the LEA genes in their promoters contained ABRE, MBS, W-Box and TAC-elements, functionally known to be involved in drought stress and other stress responses. Majority of the LEA genes were involved in secretory pathways. Expression profile analysis indicated that most of the LEA genes were highly expressed in drought tolerant cultivars Gossypium tomentosum as opposed to drought susceptible, G. hirsutum. The tolerant

  10. Estabelecimento de normas DRIS para o algodoeiro com diferentes critérios de seleção da população de referência

    Directory of Open Access Journals (Sweden)

    Ademar Pereira Serra

    2013-11-01

    Full Text Available O objetivo deste trabalho foi avaliar o efeito de critérios de seleção de populações de referência no estabelecimento de normas DRIS na cultura do algodoeiro. Criou-se um banco de dados com a produtividade e os teores foliares de macro e micronutrientes, obtidos de talhões médios de 100 ha. Os critérios para o estabelecimento das subpopulações de alta produtividade foram talhões com: produtividade acima da média (4.380 kg ha-1; produtividade acima da média + 2/3 desvio-padrão (acima de 4.650 kg ha-1; produtividade acima da média + 1 desvio-padrão (acima de 4.785 kg ha-1; e produtividade acima da média + 4/3 desvio-padrão (acima de 4.920 kg ha-1. Os critérios de seleção da população de referência proporcionam baixa frequência de relações nutricionais concordantes, para cada norma DRIS avaliada. Independentemente do critério de seleção utilizado, os dados de produtividade média e o índice de balanço nutricional relacionam-se significativamente; e essa relação intensifica-se com o aumento no rigor do critério de inclusão de lavouras na população de referência.

  11. Conservação de sementes de algodoeiro deslintadas por diferentes métodos Preservation of cottonseeds delinted by different methods

    Directory of Open Access Journals (Sweden)

    Francisco S. O. Rodrigues Filho

    1979-01-01

    Full Text Available Estudaram-se os efeitos de quatro métodos de deslintamento na germinação e longevidade de sementes de algodoeiro do cultivar IAC 13-1, tratadas e não tratadas com o fungicida PCNB 75% e armazenadas em condições não controladas de armazém na região de Campinas (SP, por um período total de 21 meses. As sementes deslintadas por gás clorídrico e tratadas com fungicida mantiveram germinação acima de 80% até aos 15 meses de armazenamento. Aos 21 meses, as sementes que apresentaram germinação acima de 60% foram aquelas deslintadas por gás clorídrico ou ácido sulfúrico e tratadas com fungicida. Tais sementes apresentaram germinação mais alta e se conservaram melhor do que aquelas deslintadas a fogo ou mecanicamente. Independente do método de deslintamento. o tratamento com fungicida foi benéfico à germinação das sementes.Effects of four delinting methods on the germination and longevity of cottonseeds of the cultivar IAC 13-1, treated and non-treated with the fungicide PCNB 75% were studied. The seeds were stored in uncontrolled conditions at Campinas, State of São Paulo for a period of 21 months. Seeds delinted by gas and treated with fungicide maintained germination rates higher than 80 %, up to 15 months storage. At the end of the storage period, the seeds that presented germination higher than 60% were those delinted by gas or acid and treated with fungicide. Seeds delinted by gas or acid presented higher germination percentages and stored longer than those delinted by mechanical means or by flame. Aside the delinting method, the fungicide treatment was beneficial to the germination of the seeds.

  12. Efeito do ataque de Alabama argillacea no crescimento vegetativo e sua relação com a fenologia do algodoeiro Effect of Alabama argillacea attack on vegetative growth and its relationship with cotton phenology

    Directory of Open Access Journals (Sweden)

    Ednaldo da Silva Quirino

    2001-08-01

    Full Text Available O objetivo deste trabalho foi estudar o efeito do ataque do curuquerê (Alabama argillacea Hübner, 1818, no desenvolvimento vegetativo do algodoeiro e sua relação com a fenologia da planta. Foram utilizadas as cultivares CNPA 7H e CNPA Precoce 2, e semeadas em vasos de plástico com capacidade para 10 kg de solo, mantendo-se uma planta por vaso após o desbaste. O delineamento experimental utilizado foi inteiramente casualizado, com sete tratamentos e quatro repetições. Foram utilizadas lagartas de terceiro ínstar de A. argillacea, provenientes de criação massal mantida em laboratório. A infestação por estas lagartas teve início 40 dias após o plantio, mediante a identificação das folhas que caracterizavam os tratamentos. Foram avaliadas as variáveis diâmetro caulinar e altura de plantas, em 1996; e em 1997, foi acrescentada a variável área foliar. O ataque de A. argillacea afeta o diâmetro caulinar e a altura das plantas em ambas as cultivares e em qualquer fase de desenvolvimento do algodoeiro. Com relação à área foliar, os maiores decréscimos foram verificados nos tratamentos que tiveram as folhas dos ramos principais consumidas; o tratamento mais afetado foi aquele em que o ataque ocorreu após a floração.This work was carried out to study the effect of cotton leaf worm attack on vegetative growth and its relation with plant phenology. The CNPA 7H and CNPA Precoce 2 cultivars were planted in plastic pots with capacity for 10 kg of soil, and one plant per pot was maintained after pruning. A completely randomized block design was used with seven treatments and four replications. Third-instar caterpillars of Alabama argillacea were used in the experiment, which were originated from a massal rearing creation kept in laboratory. Infestation with caterpillars started 40 days after the planting by identification of leaves that characterized the treatments. The variables analyzed were plant diameter and height in 1996, and

  13. Viabilidade econômica de sistemas de preparo do solo e métodos de controle de Tiririca em algodoeiro Economic viability of soil preparation systems and methods of Cyperus rotundus control in cotton

    Directory of Open Access Journals (Sweden)

    Francineuma P. de Arruda

    2005-12-01

    Full Text Available As plantas infestadas são responsáveis por perdas significativas na produção do algodão a nível mundial, cujo controle é difícil e oneroso. Com o objetivo de se estimar custos de produção e analisar economicamente a eficiência da plasticultura e de métodos de controle de ervas daninhas na cultura do algodoeiro herbáceo irrigado e em sequeiro, utilizaram-se dados obtidos de ensaios conduzidos nos municípios de Barbalha e Missão Velha, no Cariri Cearense, determinando-se o custo de produção, a receita líquida, o índice de lucratividade e os indicadores de viabilidade econômica: Valor Presente Líquido (VPL, Taxa Interna de Retorno (TIR e Relação Benefício-Custo (B/C. Verificou-se que tanto no cultivo irrigado como no cultivo de sequeiro, o método de controle de ervas daninhas mais eficiente e bem menos oneroso, foi o mecânico com preparo do solo convencional, e mais lucrativo no cultivo de sequeiro, apresentando maior VPL e TIR que os demais. O maior custo de produção por hectare foi obtido no cultivo irrigado, utilizando-se o método e controle integrado em sistema de preparo do solo com aiveca. O uso da plasticultura como método de controle de ervas daninhas, é economicamente viável apenas para o cultivo do algodoeiro de sequeiro.Weeds are responsible for significant losses in cotton production in the world and, its control is difficult and expensive. This work has the main objective to estimate production costs and analyse economically the efficiency of plasticulture and different methods of weeds control in irrigated and dry land herbaceous cotton, using data obtained in Barbalha and Missão Velha areas, in the state of Ceará, Brazil, evaluating production costs, net revenues, profitability index and economic viability indicators: Liquid Present Value (LPV, Ratio of Internal Return (RIT and Benefit-Cost Ratio (B/C. It was verified that in irrigated as well as in rainfed crop, the more efficient and economically

  14. Biological and behavior aspects of Chrysoperla externa (Hagen, 1861 on cotton plantsAspectos biológicos e comportamentais de Chrysoperla externa (Hagen, 1861 em algodoeiro

    Directory of Open Access Journals (Sweden)

    Luciano Pacelli Medeiros Macedo

    2010-02-01

    Full Text Available It was aimed to study biological and behavior aspects of larvae and adults of Chrysoperla externa in greenhouse, on cotton plants. Recently hatched larvae were released on the upper third of cotton plants, which were previously infested with Aphis gossypii,. After emergence, adults were separated by sex and packed in cylindrical PVC recipients with cotton plant. We evaluated the duration of each larval, pre-pupal and pupal periods, pre-oviposition, oviposition, effective oviposition and post-oviposition periods, male and female logevity, daily and total oviposition capacity. The behavior of pupal stage was also evaluated, which released three larvae of the 3rd instar per cotton plant and they were put on the lower, medium and upper sections. As treatments, it was used naked soil, dried leaves from cotton plant, crushed rock nº 1; and crushed rock nº 1 + dried leaves. Larvae from different instars were released on the upper section of the cotton plants infested with A. gossypii to verify the search timing that marked the period the prey was exposed to the predator. C. externa larvae passed through all the phases of their biological cycle and there was no significant influence on the type of the soil covering used on pupal stage, since all of them were significantly higher on naked soil. There was no significative difference on the prey search by C. externa larvae.Objetivou-se estudar aspectos biológicos e comportamentais de larvas e adultos de Chrysoperla externa em casa-de-vegetação, em plantas de algodão. Larvas recém eclodidas foram liberadas no terço superior de plantas de algodão previamente infestadas com Aphis gossypii, onde permaneceram até a pupação. Após a emergência, adultos foram separados por sexo, acondicionados em recipientes cilíndricos de PVC contendo uma planta de algodoeiro. Avaliaram-se a duração de cada ínstar, dos períodos larval, pré-pupal e pupal, dos períodos de pré-oviposição, oviposi

  15. Fungitoxicidade de grupos químicos sobre Myrothecium roridum in vitro e sobre a mancha-de-mirotécio em algodoeiro Fungitoxicity of chemical groups on Myrothecium roridum in vitro and on myrothecium leaf spot on cotton plants

    Directory of Open Access Journals (Sweden)

    Juliano César da Silva

    2006-05-01

    Full Text Available O objetivo deste trabalho foi avaliar a fungitoxicidade de produtos pertencentes aos grupos dos benzimidazóis, triazóis, estrobilurinas, isoftalonitrilas e ditiocarbamatos sobre a germinação conidial e o crescimento micelial in vitro de isolados de Myrothecium roridum e, in vivo, sobre a severidade da mancha-de-mirotécio em plantas de algodoeiro. Nos testes in vitro os fungicidas foram solubilizados em meio BDA, utilizando-se as concentrações de 0,1, 1, 10 e 100 mg L-1 de ingrediente ativo. A fungitoxidade dos produtos foi avaliada por meio da ED50 (dose necessária para inibir 50% da germinação conidial ou crescimento micelial. Em casa de vegetação, estimou-se a severidade da mancha-de-mirotécio pela porcentagem de área foliar lesionada nas plantas de algodoeiro tratadas antes (preventivo e depois (curativo da inoculação do patógeno. Os fungicidas tiofanato metílico, carbendazim, metconazol, tiofanato metílico + clorotalonil, piraclostrobina + epoxiconazol, piraclostrobina + metiram, triflostrobina + propiconazol e tebuconazol inibiram com alta eficácia (ED50The objective of this work was to evaluate the toxicity of benzimidazoles, triazoles, strobilurins, isoftalonitrils and ditiocarbamats on Myrothecium roridum conidial germination and micelial growth in vitro, and the myrothecium leaf spot severity on cotton plants. On in vitro tests, fungicides were solubilized in PDA media at the following concentrations: 0.1, 1, 10 and 100 mg L-1. The toxicity of the products were evaluated by the ED50 rate (required for inhibiting 50% of the conidial germination or mycelial growth. In greenhouse tests, the severity of myrothecium leaf spot was quantified by measuring the leaf area affected by the pathogen in cotton plants sprayed before (preventive and after (curative the pathogen inoculation. The fungicides thiophanate methyl, carbendazim, metconazole, thiophanate methyl + chlorothalonil, pyraclostrobin + epoxyconazole, pyraclostrobin

  16. Study on the Mitochondrial Genome of Sea Island Cotton (Gossypium barbadense) by BAC Library Screening

    Institute of Scientific and Technical Information of China (English)

    SU Ai-guo; LI Shuang-shuang; LIU Guo-zheng; LEI Bin-bin; KANG Ding-ming; LI Zhao-hu; MA Zhi-ying; HUA Jin-ping

    2014-01-01

    The plant mitochondrial genome displays complex features, particularly in terms of cytoplasmic male sterility (CMS). Therefore, research on the cotton mitochondrial genome may provide important information for analyzing genome evolution and exploring the molecular mechanism of CMS. In this paper, we present a preliminary study on the mitochondrial genome of sea island cotton (Gossypium barbadense) based on positive clones from the bacterial artiifcial chromosome (BAC) library. Thirty-ifve primers designed with the conserved sequences of functional genes and exons of mitochondria were used to screen positive clones in the genome library of the sea island cotton variety called Pima 90-53. Ten BAC clones were obtained and veriifed for further study. A contig was obtained based on six overlapping clones and subsequently laid out primarily on the mitochondrial genome. One BAC clone, clone 6 harbored with the inserter of approximate 115 kb mtDNA sequence, in which more than 10 primers fragments could be ampliifed, was sequenced and assembled using the Solexa strategy. Fifteen mitochondrial functional genes were revealed in clone 6 by gene annotation. The characteristics of the syntenic gene/exon of the sequences and RNA editing were preliminarily predicted.

  17. Genetic diversity of sea-island cotton (Gossypium barbadense) revealed by mapped SSRs.

    Science.gov (United States)

    Wang, X Q; Feng, C H; Lin, Z X; Zhang, X L

    2011-12-08

    In order to evaluate the genetic diversity of sea-island cotton (Gossypium barbadense), 237 commonly mapped SSR markers covering the cotton genome were used to genotype 56 sea-island cotton accessions. A total of 218 polymorphic primer pairs (91.98%) amplified 361 loci, with a mean of 1.66 loci. Polymorphism information content values of the SSR primers ranged from 0.035 to 0.862, with a mean of 0.320. The highest mean polymorphism information content value for the SSR motifs was from a compound motif (0.402), and for the chromosomes it was Chr10 (0.589); the highest ratio of polymorphic primers in Xinjiang accessions was from Chr21 (83.33%). Genetic diversity was high in Xinjiang accessions. AMOVA showed that variation was 8 and 92% among populations and within populations, respectively. The 56 sea-island accessions were divided into three groups in the UPGMA dendrogram: Xinhai5 was in the first group; accessions from Xinjiang, except the five main ones, were in the second group, and the other 34 accessions were in the third group. Accessions from the former Soviet Union and Xinjiang main accessions were closely related. Both PCA and UPGMA confirmed that Xinhai5 was distinct from the other accessions, and accessions from Xinjiang were in an independent group. Given the differences between principal components analysis and UPGMA results, it is necessary to combine molecular markers and pedigree information so that genetic diversity can be objectively analyzed.

  18. Genome-Wide Analysis of the RNA Helicase Gene Family in Gossypium raimondii

    Directory of Open Access Journals (Sweden)

    Jie Chen

    2014-03-01

    Full Text Available The RNA helicases, which help to unwind stable RNA duplexes, and have important roles in RNA metabolism, belong to a class of motor proteins that play important roles in plant development and responses to stress. Although this family of genes has been the subject of systematic investigation in Arabidopsis, rice, and tomato, it has not yet been characterized in cotton. In this study, we identified 161 putative RNA helicase genes in the genome of the diploid cotton species Gossypium raimondii. We classified these genes into three subfamilies, based on the presence of either a DEAD-box (51 genes, DEAH-box (52 genes, or DExD/H-box (58 genes in their coding regions. Chromosome location analysis showed that the genes that encode RNA helicases are distributed across all 13 chromosomes of G. raimondii. Syntenic analysis revealed that 62 of the 161 G. raimondii helicase genes (38.5% are within the identified syntenic blocks. Sixty-six (40.99% helicase genes from G. raimondii have one or several putative orthologs in tomato. Additionally, GrDEADs have more conserved gene structures and more simple domains than GrDEAHs and GrDExD/Hs. Transcriptome sequencing data demonstrated that many of these helicases, especially GrDEADs, are highly expressed at the fiber initiation stage and in mature leaves. To our knowledge, this is the first report of a genome-wide analysis of the RNA helicase gene family in cotton.

  19. Atividade antibacteriana in vitro de quatro espécies vegetais em diferentes graduações alcoólicas In vitro antibacterial activity of four plant species at different alcoholic contents

    Directory of Open Access Journals (Sweden)

    G.S. Miranda

    2013-01-01

    Full Text Available Neste trabalho foi realizada a caracterização fitoquímica e avaliada a atividade antibacteriana in vitro dos extratos de Ageratum conyzoides L. (mentrasto, Gossypium hirsutum (algodão, Phyllanthus tenellus (quebra pedra, e Polygonum hydropiperoides (erva de bicho frente à Staphylococcus aureus e Escherichia coli. Para a avaliação da atividade antibacteriana foi utilizado o método de difusão em ágar. Os testes foram realizados com o extrato nas graduações alcoólicas de 0 a 100% (v/v, na proporção de 20% (m/v - massa/extrator. Os testes fitoquímicos constataram a presença de açucares redutores, compostos fenólicos, flavonoides, taninos, triterpenos, e esteróides nas quatro espécies. O crescimento das culturas de S. aureus foi inibido por todos os extratos, com exceção do extrato de Mentrasto. A maior atividade de inibição foi observada pelo extrato de quebra pedra. Entretanto, nenhum dos extratos foi capaz de inibir o crescimento das cepas de E. coli. Os resultados são promissores, visto que três das quatro plantas selecionadas demonstraram possuir substâncias antibacterianas, o que motiva estudos subsequentes para o isolamento e identificação dos princípios ativos responsáveis por essa atividade, com potencial de uso na indústria farmacêutica.In this study, phytochemical characterization was conducted and the in vitro antibacterial activity of extracts of Ageratum conyzoides L. (whiteweed, Gossypium hirsutum (cotton, Phyllanthus tenellus (shatterstone and Polygonum hydropiperoides (swamp smartweed was evaluated against Staphylococcus aureus and Escherichia coli. To assess the antibacterial activity, the agar diffusion method was used. Tests were performed with the extract at alcoholic contents from 0 to 100% (v/v, at 20% proportion (m/v - mass/extractor. Phytochemical tests indicated the presence of reducing sugars, phenolic compounds, flavonoids, tannins, triterpenes and steroids in all four species. The growth

  20. Estudo de caso de três espécies de plantas bioindicadoras de solos salinos

    Directory of Open Access Journals (Sweden)

    Mercia Fonseca Carvalho

    2015-07-01

    Full Text Available Bioindicadores, de uma maneira geral, são seres vivos de natureza diversa, vegetais ou animais, utilizados para analisar a qualidade de um determinado ambiente. A degradação ambiental do solo pela salinidade é um problema muito antigo e de extensão mundial, geralmente, mais pronunciado nas regiões áridas e semi-áridas. As plantas que se desenvolvem em áreas com elevadas concentrações de sais são chamadas de halófitas, e algumas delas são usadas na recuperar desses solos. O objetivo desse trabalho é analisar três espécies de plantas resistentes ao estresse salino gerar recomendações a respeito das mesmas, disponibilizando uma indicação de espécie que possa recuperar o ambiente salinizado. Foram selecionadas aleatoriamente três espécies de plantas resistentes a salinidade Copernicia prunifera, Atriplex nummularia L. e Gossypium hirsutum L, as mesmas foram analisados por uma planilha com características que identificam um bioindicador ideal e em seguida as espécies foram avaliadas de acordo com sua fisiologia e etiologia. Embora as propriedades da espécie A. nummularia tenha se destacado por recuperar os solos salinizados a espécie Copernicia prunifera foi considerada como um bioindicador ideal. Recomendam-se ainda estudos mais aprofundados acerca desse assunto.Case study of three species of saline soil bioindicatorsAbstract: Bioindicators, in general, living organisms are diverse in nature, plant or animal used to assess the quality of a given environment. Environmental degradation by soil salinity is a very old problem and expanse world generally more pronounced in arid and semi-arid regions. Plants that thrive in areas with high concentrations of salts are called halophytes, and some of them are used in recovering these soils. The aim of this work is to analyze three species of plants resistant to salt stress generate recommendations regarding the same, providing an indication of species that can restore the

  1. Azotobacter chroococcum as a potentially useful bacterial biofertilizer for cotton (Gossypium hirsutum): Effect in reducing N fertilization.

    Science.gov (United States)

    Romero-Perdomo, Felipe; Abril, Jorge; Camelo, Mauricio; Moreno-Galván, Andrés; Pastrana, Iván; Rojas-Tapias, Daniel; Bonilla, Ruth

    The aim of this research was to evaluate whether the application of two plant growth-promoting (rhizo)bacteria might reduce nitrogen fertilization doses in cotton. We used strains Azotobacter chroococcum AC1 and AC10 for their proven ability to promote seed germination and cotton growth. These microorganisms were characterized by their plant growth-promoting activities. Then, we conducted a glasshouse study to evaluate the plant growth promoting ability of these strains with reduced doses of urea fertilization in cotton. Results revealed that both strains are capable of fixing nitrogen, solubilizing phosphorus, synthesizing indole compounds and producing hydrolytic enzymes. After 12 weeks, the glasshouse experiment showed that cotton growth was positively influenced due to bacterial inoculation with respect to chemical fertilization. Notably, we observed that microbial inoculation further influenced plant biomass (p<0.05) than nitrogen content. Co-inoculation, interestingly, exhibited a greater beneficial effect on plant growth parameters compared to single inoculation. Moreover, similar results without significant statistical differences were observed among bacterial co-inoculation plus 50% urea and 100% fertilization. These findings suggest that co-inoculation of A. chroococcum strains allow to reduce nitrogen fertilization doses up to 50% on cotton growth. Our results showed that inoculation with AC1 and AC10 represents a viable alternative to improve cotton growth while decreasing the N fertilizer dose and allows to alleviate the environmental deterioration related to N pollution. Copyright © 2017 Asociación Argentina de Microbiología. Publicado por Elsevier España, S.L.U. All rights reserved.

  2. Effect of Phosphorus Fertilizer and Water Stress on Protein and Phenolic Contents in Cotton (Gossypium Hirsutum L.)

    International Nuclear Information System (INIS)

    Abbas, Z.; Muhammad, S.; Murtaza, G.; Ahmad, I.; Shakeel, A.; Islam, M.; Ahmad, M.; Abdullah, M.

    2015-01-01

    Crop quality and production are affected by various fertilizers and water stress. In present research, the response of cotton variety CIM-496 to water stress and phosphorus fertilizer was investigated. Samples were collected after 90 days of planting. Kjeldahl method and thin layer chromatography (TLC) were used for the quantitative and qualitative analysis of total protein and phenolic compounds, respectively. Proteins were greatly affected by fertilizer treatment and water stress, but phenolic compounds remained unchanged upon fertilizer treatment. However, they were greatly affected by irrigation and water stress. Crop treated with 100 kg ha/sup -1/ P/sub 2/O/sub 5/ under water stress maintained high protein content as compared to unfertilized and no water stress treatments. However, phenolic compounds were found higher in fully irrigated plants as compared to water stress ones. Fertilizer treatments had no considerable effect on phenolic compounds. (author)

  3. microRNAs involved in auxin signalling modulate male sterility under high-temperature stress in cotton (Gossypium hirsutum).

    Science.gov (United States)

    Ding, Yuanhao; Ma, Yizan; Liu, Nian; Xu, Jiao; Hu, Qin; Li, Yaoyao; Wu, Yuanlong; Xie, Sai; Zhu, Longfu; Min, Ling; Zhang, Xianlong

    2017-09-01

    Male sterility caused by long-term high-temperature (HT) stress occurs widely in crops. MicroRNAs (miRNAs), a class of endogenous non-coding small RNAs, play an important role in the plant response to various abiotic stresses. To dissect the working principle of miRNAs in male sterility under HT stress in cotton, a total of 112 known miRNAs, 270 novel miRNAs and 347 target genes were identified from anthers of HT-insensitive (84021) and HT-sensitive (H05) cotton cultivars under normal-temperature and HT conditions through small RNA and degradome sequencing. Quantitative reverse transcriptase-polymerase chain reaction and 5'-RNA ligase-mediated rapid amplification of cDNA ends experiments were used to validate the sequencing data. The results show that miR156 was suppressed by HT stress in both 84021 and H05; miR160 was suppressed in 84021 but induced in H05. Correspondingly, SPLs (target genes of miR156) were induced both in 84021 and H05; ARF10 and ARF17 (target genes of miR160) were induced in 84021 but suppressed in H05. Overexpressing miR160 increased cotton sensitivity to HT stress seen as anther indehiscence, associated with the suppression of ARF10 and ARF17 expression, thereby activating the auxin response that leads to anther indehiscence. Supporting this role for auxin, exogenous Indole-3-acetic acid (IAA) leads to a stronger male sterility phenotype both in 84021 and H05 under HT stress. Cotton plants overexpressing miR157 suppressed the auxin signal, and also showed enhanced sensitivity to HT stress, with microspore abortion and anther indehiscence. Thus, we propose that the auxin signal, mediated by miRNAs, is essential for cotton anther fertility under HT stress. © 2017 The Authors The Plant Journal © 2017 John Wiley & Sons Ltd.

  4. Genome-wide identification of differentially expressed genes under water deficit stress in upland cotton (Gossypium hirsutum L.).

    Science.gov (United States)

    Park, Wonkeun; Scheffler, Brian E; Bauer, Philip J; Campbell, B Todd

    2012-06-15

    Cotton is the world's primary fiber crop and is a major agricultural commodity in over 30 countries. Like many other global commodities, sustainable cotton production is challenged by restricted natural resources. In response to the anticipated increase of agricultural water demand, a major research direction involves developing crops that use less water or that use water more efficiently. In this study, our objective was to identify differentially expressed genes in response to water deficit stress in cotton. A global expression analysis using cDNA-Amplified Fragment Length Polymorphism was conducted to compare root and leaf gene expression profiles from a putative drought resistant cotton cultivar grown under water deficit stressed and well watered field conditions. We identified a total of 519 differentially expressed transcript derived fragments. Of these, 147 transcript derived fragment sequences were functionally annotated according to their gene ontology. Nearly 70 percent of transcript derived fragments belonged to four major categories: 1) unclassified, 2) stress/defense, 3) metabolism, and 4) gene regulation. We found heat shock protein-related and reactive oxygen species-related transcript derived fragments to be among the major parts of functional pathways induced by water deficit stress. Also, twelve novel transcripts were identified as both water deficit responsive and cotton specific. A subset of differentially expressed transcript derived fragments was verified using reverse transcription-polymerase chain reaction. Differential expression analysis also identified five pairs of duplicated transcript derived fragments in which four pairs responded differentially between each of their two homologues under water deficit stress. In this study, we detected differentially expressed transcript derived fragments from water deficit stressed root and leaf tissues in tetraploid cotton and provided their gene ontology, functional/biological distribution, and possible roles of gene duplication. This discovery demonstrates complex mechanisms involved with polyploid cotton's transcriptome response to naturally occurring field water deficit stress. The genes identified in this study will provide candidate targets to manipulate the water use characteristics of cotton at the molecular level.

  5. Fine mapping and candidate gene analysis of the virescent gene v 1 in Upland cotton (Gossypium hirsutum).

    Science.gov (United States)

    Mao, Guangzhi; Ma, Qiang; Wei, Hengling; Su, Junji; Wang, Hantao; Ma, Qifeng; Fan, Shuli; Song, Meizhen; Zhang, Xianlong; Yu, Shuxun

    2018-02-01

    The young leaves of virescent mutants are yellowish and gradually turn green as the plants reach maturity. Understanding the genetic basis of virescent mutants can aid research of the regulatory mechanisms underlying chloroplast development and chlorophyll biosynthesis, as well as contribute to the application of virescent traits in crop breeding. In this study, fine mapping was employed, and a recessive gene (v 1 ) from a virescent mutant of Upland cotton was narrowed to an 84.1-Kb region containing ten candidate genes. The GhChlI gene encodes the cotton Mg-chelatase I subunit (CHLI) and was identified as the candidate gene for the virescent mutation using gene annotation. BLAST analysis showed that the GhChlI gene has two copies, Gh_A10G0282 and Gh_D10G0283. Sequence analysis indicated that the coding region (CDS) of GhChlI is 1269 bp in length, with three predicted exons and one non-synonymous nucleotide mutation (G1082A) in the third exon of Gh_D10G0283, with an amino acid (AA) substitution of arginine (R) to lysine (K). GhChlI-silenced TM-1 plants exhibited a lower GhChlI expression level, a lower chlorophyll content, and the virescent phenotype. Analysis of upstream regulatory elements and expression levels of GhChlI showed that the expression quantity of GhChlI may be normal, and with the development of the true leaf, the increase in the Gh_A10G0282 dosage may partially make up for the deficiency of Gh_D10G0283 in the v 1 mutant. Phylogenetic analysis and sequence alignment revealed that the protein sequence encoded by the third exon of GhChlI is highly conserved across diverse plant species, in which AA substitutions among the completely conserved residues frequently result in changes in leaf color in various species. These results suggest that the mutation (G1082A) within the GhChlI gene may cause a functional defect of the GhCHLI subunit and thus the virescent phenotype in the v 1 mutant. The GhChlI mutation not only provides a tool for understanding the associations of CHLI protein function and the chlorophyll biosynthesis pathway but also has implications for cotton breeding.

  6. Agrobacterium-mediated transformation of cotton (Gossypium hirsutum) shoot apex with a fungal phytase gene improves phosphorus acquisition.

    Science.gov (United States)

    Ma, Zhiying; Liu, Jianfeng; Wang, Xingfen

    2013-01-01

    Cotton is an important world economic crop plant. It is considered that cotton is recalcitrant to in vitro proliferation. Somatic embryogenesis and plant regeneration has been successful by using hypocotyl, whereas it is highly genotype dependent. Here, a genotype-independent cotton regeneration protocol from shoot apices is presented. Shoot apices from 3- to 5-day-old seedlings of cotton are infected with an Agrobacterium strain, EHA105, carrying the binary vector pC-KSA contained phytase gene (phyA) and the marker gene neomycin phosphotransferase (NPTII), and directly regenerated as shoots in vitro. Rooted shoots can be obtained within 6-8 weeks. Plants that survived by leaf painting kanamycin (kan) were -further analyzed by DNA and RNA blottings. The transgenic plants with increased the phosphorus (P) acquisition efficiency were obtained following the transformation method.

  7. Improvement of growth and productivity of cotton (Gossypium hirsutum L. through foliar applications of naphthalene acetic acid

    Directory of Open Access Journals (Sweden)

    Shazia Parveen

    2017-05-01

    Full Text Available Plant growth regulators like naphthalene acetic acid (NAA positively affect the growth and yield of crop plants. An experiment was conducted to check the foliar application of NAA on growth and yield components of cotton variety Bt.121 under field condition at research area of agriculture farm near Cholistan Institute of Desert Studies (CIDS, The Islamia University of Bahawalpur, Pakistan. The experiment was comprised of foliar application of NAA (1% viz. T0 (control, T1 (One spray of NAA, T2 (Two sprays of NAA, T3 (Three sprays of NAA, T4 (Four sprays of NAA. The first foliar spray was applied at 45 days after sowing (DAS and later on it was continued with 15 days interval with skilled labour by hand pump sprayer. The experiment was laid out in randomized complete block design and each treatment was replicated three times. Data recorded on growth, chlorophyll contents, yield and yield components showed a significant increase with the application of NAA. Furthermore, earliness index, mean maturity date and production rate index were also influenced with foliar application of NAA. On the basis of growth and yield parameters it can be concluded that four spray of NAA (1% can be applied commercially under field conditions.

  8. Dynamics of soil diazotrophic community structure, diversity, and functioning during the cropping period of cotton (Gossypium hirsutum).

    Science.gov (United States)

    Rai, Sandhya; Singh, Dileep Kumar; Annapurna, Kannepalli

    2015-01-01

    The soil sampled at different growth stages along the cropping period of cotton were analyzed using various molecular tools: restriction fragment length polymorphism (RFLP), terminal restriction length polymorphism (T-RFLP), and cloning-sequencing. The cluster analysis of the diazotrophic community structure of early sampled soil (0, 15, and 30 days) was found to be more closely related to each other than the later sampled one. Phylogenetic and diversity analysis of sequences obtained from the first (0 Day; C0) and last soil sample (180 day; C180) confirmed the data. The phylogenetic analysis revealed that C0 was having more unique sequences than C180 (presence of γ-Proteobacteria exclusively in C0). A relatively higher richness of diazotrophic community sequences was observed in C0 (S(ACE) : 30.76; S(Chao1) : 20.94) than C180 (S(ACE) : 18.00; S(Chao1) : 18.00) while the evenness component of Shannon diversity index increased from C0 (0.97) to C180 (1.15). The impact of routine agricultural activities was more evident based on diazotrophic activity (measured by acetylene reduction assay) than its structure and diversity. The nitrogenase activity of C0 (1264.85 ± 35.7 ηmol of ethylene production g(-1) dry soil h(-1) ) was statistically higher when compared to all other values (p structure/diversity and N2 fixation rates. Thus, considerable functional redundancy of nifH was concluded to be existing at the experimental site. © 2015 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

  9. Produção de biomassa por cultivos de cobertura do solo e produtividade do algodoeiro em plantio direto Cover crops biomass production and cotton yield in no-tillage system

    Directory of Open Access Journals (Sweden)

    Alexandre Cunha de Barcellos Ferreira

    2010-06-01

    Full Text Available O objetivo deste trabalho foi avaliar a produção, a persistência da matéria seca e a eficiência da dessecação em espécies vegetais utilizadas para cultivos de cobertura do solo, e quantificar seus efeitos sobre a produtividade do algodoeiro em plantio direto. O trabalho foi realizado em Santa Helena de Goiás, GO, com 16 tratamentos: Panicum maximum, cultivares Mombaça, Tanzânia e Massai; Urochloa brizantha, cultivares Piatã, Xaraés, Marandu e MG4; U. decumbens; Paspalum atratum cv. Pojuca; Sorghum bicolor cultivares Santa Eliza e BRS 700; Pennisetum glaucum cv. ADR 500; Raphanus sativus; Eleusine coracana, Crotalaria spectabilis, além da testemunha em pousio. As espécies foram semeadas no início de março (2007. As espécies com menores produtividades e persistência da matéria seca foram C. spectabilis, E. coracana e R. sativus. As produtividades de algodão em caroço e fibra foram maiores no cultivo sobre palhas residuais das cultivares Tanzânia e Mombaça de P. maximum, em comparação às observadas com uso de P. atratum cv. Pojuca, R. sativus e pousio. Em geral, S. bicolor, P. glaucum e as cultivares Tanzânia e Mombaça de P. maximum, e MG4, Piatã e Xaraés de U. brizantha apresentam produção e persistência da matéria seca adequadas para o cultivo do algodoeiro no sistema de plantio direto, no cerrado brasileiro.The objectives of this work were to evaluate biomass production and persistence and the desiccation efficiency in plant species used as cover crops, and to quantify its effects on cotton yield in a no-tillage system. The study was carried out in Santa Helena de Goiás, GO, Brazil, using 16 plant species: Panicum maximum, cultivars Mombaça, Tanzânia and Massai; Urochloa brizantha, cultivars Piatã, Xaraés, Marandu and MG4; U. decumbens; Paspalum atratum cv. Pojuca; Sorghum bicolor cultivars Santa Eliza and BRS 700; Pennisetum glaucum cv. ADR 500; Raphanus sativus; Eleusine coracana, Crotalaria spectabilis

  10. Genetic regulation of salt stress tolerance revealed by RNA-Seq in cotton diploid wild species, Gossypium davidsonii.

    Science.gov (United States)

    Zhang, Feng; Zhu, Guozhong; Du, Lei; Shang, Xiaoguang; Cheng, Chaoze; Yang, Bing; Hu, Yan; Cai, Caiping; Guo, Wangzhen

    2016-02-03

    Cotton is an economically important crop throughout the world, and is a pioneer crop in salt stress tolerance research. Investigation of the genetic regulation of salinity tolerance will provide information for salt stress-resistant breeding. Here, we employed next-generation RNA-Seq technology to elucidate the salt-tolerant mechanisms in cotton using the diploid cotton species Gossypium davidsonii which has superior stress tolerance. A total of 4744 and 5337 differentially expressed genes (DEGs) were found to be involved in salt stress tolerance in roots and leaves, respectively. Gene function annotation elucidated salt overly sensitive (SOS) and reactive oxygen species (ROS) signaling pathways. Furthermore, we found that photosynthesis pathways and metabolism play important roles in ion homeostasis and oxidation balance. Moreover, our studies revealed that alternative splicing also contributes to salt-stress responses at the posttranscriptional level, implying its functional role in response to salinity stress. This study not only provides a valuable resource for understanding the genetic control of salt stress in cotton, but also lays a substantial foundation for the genetic improvement of crop resistance to salt stress.

  11. Transgenic cotton plants expressing Cry1Ia12 toxin confer resistance to fall armyworm (Spodoptera frugiperda and cotton boll weevil (Anthonomus grandis

    Directory of Open Access Journals (Sweden)

    Raquel Sampaio Oliveira

    2016-02-01

    Full Text Available Gossypium hirsutum (commercial cooton is one of the most economically important fibers sources and a commodity crop highly affected by insect pests and pathogens. Several transgenic approaches have been developed to improve cotton resistance to insect pests, through the transgenic expression of different factors, including Cry toxins, proteinase inhibitors, and toxic peptides, among others. In the present study, we developed transgenic cotton plants by fertilized floral buds injection (through the pollen-tube pathway technique using an DNA expression cassette harboring the cry1Ia12 gene, driven by CaMV35S promoter. The T0 transgenic cotton plants were initially selected with kanamycin and posteriorly characterized with PCR and Southern blot experiments to confirm the genetic transformation. Western blot and ELISA assays indicated the transgenic cotton plants with higher Cry1Ia12 protein expression levels to be further tested in the control of two major G. hirsutum insect pests. Bioassays with T1 plants revealed the Cry1Ia12 protein toxicity on Spodoptera frugiperda larvae, as evidenced by mortality up to 40% and a significant delay in the development of the target insects compared to untransformed controls (up to 30-fold. Also, a significant reduction of Anthonomus grandis emerging adults (up to 60% was observed when the insect larvae were fed on T1 floral buds. All the larvae and adult insect survivors on the transgenic lines were weaker and significantly smaller compared to the non-transformed plants. Therefore, this study provides GM cotton plant with simultaneous resistance against the Lepidopteran (S. frugiperda and the Coleopteran (A. grandis insect orders, and all data suggested that the Cry1Ia12 toxin could effectively enhance the cotton transgenic plants resistance to both insect pests.

  12. Transgenic Cotton Plants Expressing Cry1Ia12 Toxin Confer Resistance to Fall Armyworm (Spodoptera frugiperda) and Cotton Boll Weevil (Anthonomus grandis).

    Science.gov (United States)

    de Oliveira, Raquel S; Oliveira-Neto, Osmundo B; Moura, Hudson F N; de Macedo, Leonardo L P; Arraes, Fabrício B M; Lucena, Wagner A; Lourenço-Tessutti, Isabela T; de Deus Barbosa, Aulus A; da Silva, Maria C M; Grossi-de-Sa, Maria F

    2016-01-01

    Gossypium hirsutum (commercial cooton) is one of the most economically important fibers sources and a commodity crop highly affected by insect pests and pathogens. Several transgenic approaches have been developed to improve cotton resistance to insect pests, through the transgenic expression of different factors, including Cry toxins, proteinase inhibitors, and toxic peptides, among others. In the present study, we developed transgenic cotton plants by fertilized floral buds injection (through the pollen-tube pathway technique) using an DNA expression cassette harboring the cry1Ia12 gene, driven by CaMV35S promoter. The T0 transgenic cotton plants were initially selected with kanamycin and posteriorly characterized by PCR and Southern blot experiments to confirm the genetic transformation. Western blot and ELISA assays indicated the transgenic cotton plants with higher Cry1Ia12 protein expression levels to be further tested in the control of two major G. hirsutum insect pests. Bioassays with T1 plants revealed the Cry1Ia12 protein toxicity on Spodoptera frugiperda larvae, as evidenced by mortality up to 40% and a significant delay in the development of the target insects compared to untransformed controls (up to 30-fold). Also, an important reduction of Anthonomus grandis emerging adults (up to 60%) was observed when the insect larvae were fed on T1 floral buds. All the larvae and adult insect survivors on the transgenic lines were weaker and significantly smaller compared to the non-transformed plants. Therefore, this study provides GM cotton plant with simultaneous resistance against the Lepidopteran (S. frugiperda), and the Coleopteran (A. grandis) insect orders, and all data suggested that the Cry1Ia12 toxin could effectively enhance the cotton transgenic plants resistance to both insect pests.

  13. Transgenic Cotton Plants Expressing Cry1Ia12 Toxin Confer Resistance to Fall Armyworm (Spodoptera frugiperda) and Cotton Boll Weevil (Anthonomus grandis)

    Science.gov (United States)

    de Oliveira, Raquel S.; Oliveira-Neto, Osmundo B.; Moura, Hudson F. N.; de Macedo, Leonardo L. P.; Arraes, Fabrício B. M.; Lucena, Wagner A.; Lourenço-Tessutti, Isabela T.; de Deus Barbosa, Aulus A.; da Silva, Maria C. M.; Grossi-de-Sa, Maria F.

    2016-01-01

    Gossypium hirsutum (commercial cooton) is one of the most economically important fibers sources and a commodity crop highly affected by insect pests and pathogens. Several transgenic approaches have been developed to improve cotton resistance to insect pests, through the transgenic expression of different factors, including Cry toxins, proteinase inhibitors, and toxic peptides, among others. In the present study, we developed transgenic cotton plants by fertilized floral buds injection (through the pollen-tube pathway technique) using an DNA expression cassette harboring the cry1Ia12 gene, driven by CaMV35S promoter. The T0 transgenic cotton plants were initially selected with kanamycin and posteriorly characterized by PCR and Southern blot experiments to confirm the genetic transformation. Western blot and ELISA assays indicated the transgenic cotton plants with higher Cry1Ia12 protein expression levels to be further tested in the control of two major G. hirsutum insect pests. Bioassays with T1 plants revealed the Cry1Ia12 protein toxicity on Spodoptera frugiperda larvae, as evidenced by mortality up to 40% and a significant delay in the development of the target insects compared to untransformed controls (up to 30-fold). Also, an important reduction of Anthonomus grandis emerging adults (up to 60%) was observed when the insect larvae were fed on T1 floral buds. All the larvae and adult insect survivors on the transgenic lines were weaker and significantly smaller compared to the non-transformed plants. Therefore, this study provides GM cotton plant with simultaneous resistance against the Lepidopteran (S. frugiperda), and the Coleopteran (A. grandis) insect orders, and all data suggested that the Cry1Ia12 toxin could effectively enhance the cotton transgenic plants resistance to both insect pests. PMID:26925081

  14. Characterization of indigenous gossypium arboreum L. genotypes for various fiber quality traits

    International Nuclear Information System (INIS)

    Iqbal, M. A.; Abbas, A.; Zafar, Y.

    2015-01-01

    Diploid cotton (Gossypium arboreum L.) being an Old World cultivated cotton species, evolved in Indo-Pak subcontinent, has been known for conferring resistance to biotic and abiotic stresses. To the extent of our knowledge, there is no comprehensive report available on the characterization of G. arboreum germplasm. Hence, the present study was conducted to characterize 26 G. arboreum genotypes by deploying univariate and multivariate analysis in 2010 at NIBGE, Faisalabad. All these genotypes were characterized for boll weight, GOT percentage, micronaire value, staple length, fiber bundle strength and uniformity index. Genotypic variation was significant (p<0.01) for all the analyzed traits except boll weight. Maximum boll weight (2.47g) was observed for genotype 23718. GOT ranged from 18.75% (Haroonabad) to 36.94 percentage (DC-116).The finest fiber was obtained from synthetic (4.37 micro g/inch) and this genotype also exhibited the higher values for staple length (23.81 mm) and fiber bundle strength (27.37 g/tex). Range for uniformity index was observed from 76.19 percentage (Garohill) to 77.98 percentage (212). Principal component analysis (PCA) exhibited that first five components accounted for >63 percentage of the total variability. Cluster analysis identified four groups based on their agronomic properties. Significant relationships among different traits can be useful to select best genotypes having good fiber quality traits. These genotypes may prove a valuable resource to fuel the breeding efforts for not only broadening the genetic base of the newly developed material but can also add synergy to various cotton genomic projects. (author)

  15. Produção do algodoeiro em função da salinidade e tratamento de sementes com regulador de crescimento Cotton yield as a function of salinity and seeds treatment with growth regulator

    Directory of Open Access Journals (Sweden)

    Francisco de Assis de Oliveira

    2012-06-01

    Full Text Available Este trabalho foi realizado com o objetivo de avaliar o efeito de diferentes níveis de salinidade da água de irrigação e sementes tratadas com regulador de crescimento na produção do algodoeiro. O delineamento experimental adotado foi inteiramente ao acaso, arranjados em esquema fatorial 5 x 2 com quatro repetições. Os tratamentos resultaram da combinação de cinco níveis de condutividade elétrica da água de irrigação (S1-0,5; S2-2,0; S3-3,5; S4-5,0 e S5-6,5 dS m-1 em sementes tratadas e não tratadas com regulador de crescimento. As variáveis avaliadas foram: produção de algodão em caroço, produção de sementes e de fibra, peso de 100 sementes e porcentagem de fibra. Não houve interação entre os níveis de salinidades e as sementes tratadas com regulador de crescimento. Os parâmetros produtivos do algodoeiro são reduzidos com uso de água de salinidade a partir de 3,5 dS m-1, independente das sementes serem tratadas com regulador de crescimento. As características agronômicas: peso de 100 sementes, porcentagem de fibra e produção de algodão em caroço não são influenciadas pelo cloreto de mepiquat. O tratamento das sementes com regulador de crescimento não afeta o efeito adverso da salinidade.This study was conducted to evaluate the effect of different salinity levels of irrigation water and seed treated with growth regulator on the yield of cotton. It was used an entirely statistical randomized design, in a factorial scheme 5 x 2, with four replications. The treatments resulted from the combination of four salinity levels of irrigation water (S1-0.5; S2-2.0; S3-3.5; S4-5.0 and S5-6.5 dS m-1 in treated and untreated seeds with growth regulator. The variables were: production of cotton, seed and fiber, 100 seed weight and percentage of fiber. There was not interaction between salinity levels and seed treated. The parameters of cotton production are reduced with the use of water salinity from 3.5 dS m-1

  16. Combined effect of soil amendment with oil cakes and seed priming in the control of root rot fungi of leguminous and non-leguminous crops

    International Nuclear Information System (INIS)

    Rafi, H.; Dawar, S.; Tariq, M.

    2016-01-01

    Organic amendments of soil help in proper aeration, rising of temperature and water holding capacity which results in better uptake of nutrients with root system gets extensive establishment. In this study, effects of soil amendment with oil seed cakes including mustard (Brassica campestris L.), cotton (Gossypium hirsutum L.), almond (Prunus amygdalus L.) and black seed (Nigella sativa L.) cakes at the rate of 0.1 and 1% w/w and priming of seeds with Acacia nilotica (L.) Willd. ex Delile and Sapindus mukorossi (L.) leaves extracts and microbial antagonists (Trichoderma harzianum and Rhizobium melilotii) was observed on the growth of plants and in the suppression of root infecting fungi. The results obtained showed that combined effect of bio-priming of seeds with T. harzianum spore suspension and amendment of soil with mustard cake at the rate of 1% was found to be most effective for the growth of leguminous and non-leguminous crop plants (peanut, chickpea, okra and sunflower) and for the reduction of root infecting fungi like Macrophomina phaseolina, Fusarium spp followed by R. meliloti primed seeds in combination with cotton, almond and black seed cakes amendment respectively as compared to control (non treated seeds and soil). (author)

  17. [Characterization of the damage of Spodoptera eridania (Cramer) and Spodoptera cosmioides (Walker) (Lepidoptera: Noctuidae) to structures of cotton plants].

    Science.gov (United States)

    Santos, Karen B Dos; Meneguim, Ana M; Santos, Walter J Dos; Neves, Pedro M O J; Santos, Rachel B Dos

    2010-01-01

    The cotton plant, Gossypium hirsutum, hosts various pests that damage different structures. Among these pests, Spodoptera cosmioides (Walker) and Spodoptera eridania (Cramer) (Lepidoptera: Noctuidae) are considered important. The objectives of this study were to characterize and to quantify the potential damage of S. eridania and S. cosmioides feeding on different structures of cotton plants. For this purpose, newly-hatched larvae were reared on the following plant parts: leaf and flower bud; leaf and boll; flower bud or boll; and leaf, flower bud and boll. The survival of S. cosmioides and S. eridania was greater than 80% and 70% for larvae fed on cotton plant parts offered separately or together, respectively. One larva of S. eridania damaged 1.7 flower buds, but did not damage bolls, while one larva of S. cosmioides damaged 5.2 flower buds and 3.0 cotton bolls. Spodoptera eridania and S. cosmioides can be considered species with potential to cause economic damage to cotton plants because they can occur throughout cotton developmental stages causing defoliation and losses of reproductive structures. Therefore, the results validate field observations that these two species of Spodoptera are potential pests for cotton.

  18. GhWRKY25, a group I WRKY gene from cotton, confers differential tolerance to abiotic and biotic stresses in transgenic Nicotiana benthamiana.

    Science.gov (United States)

    Liu, Xiufang; Song, Yunzhi; Xing, Fangyu; Wang, Ning; Wen, Fujiang; Zhu, Changxiang

    2016-09-01

    WRKY transcription factors are involved in various processes, ranging from plant growth to abiotic and biotic stress responses. Group I WRKY members have been rarely reported compared with group II or III members, particularly in cotton (Gossypium hirsutum). In this study, a group I WRKY gene, namely, GhWRKY25, was cloned from cotton and characterized. Expression analysis revealed that GhWRKY25 can be induced or deduced by the treatments of abiotic stresses and multiple defense-related signaling molecules. Overexpression of GhWRKY25 in Nicotiana benthamiana reduced plant tolerance to drought stress but enhanced tolerance to salt stress. Moreover, more MDA and ROS accumulated in transgenic plants after drought treatment with lower activities of SOD, POD, and CAT. Our study further demonstrated that GhWRKY25 overexpression in plants enhanced sensitivity to the fungal pathogen Botrytis cinerea by reducing the expression of SA or ET signaling related genes and inducing the expression of genes involved in the JA signaling pathway. These results indicated that GhWRKY25 plays negative or positive roles in response to abiotic stresses, and the reduced pathogen resistance may be related to the crosstalk of the SA and JA/ET signaling pathways.

  19. The Cotton WRKY Gene GhWRKY41 Positively Regulates Salt and Drought Stress Tolerance in Transgenic Nicotiana benthamiana.

    Directory of Open Access Journals (Sweden)

    Xiaoqian Chu

    Full Text Available WRKY transcription factors constitute a very large family of proteins in plants and participate in modulating plant biological processes, such as growth, development and stress responses. However, the exact roles of WRKY proteins are unclear, particularly in non-model plants. In this study, Gossypium hirsutum WRKY41 (GhWRKY41 was isolated and transformed into Nicotiana benthamiana. Our results showed that overexpression of GhWRKY41 enhanced the drought and salt stress tolerance of transgenic Nicotiana benthamiana. The transgenic plants exhibited lower malondialdehyde content and higher antioxidant enzyme activity, and the expression of antioxidant genes was upregulated in transgenic plants exposed to osmotic stress. A β-glucuronidase (GUS staining assay showed that GhWRKY41 was highly expressed in the stomata when plants were exposed to osmotic stress, and plants overexpressing GhWRKY41 exhibited enhanced stomatal closure when they were exposed to osmotic stress. Taken together, our findings demonstrate that GhWRKY41 may enhance plant tolerance to stress by functioning as a positive regulator of stoma closure and by regulating reactive oxygen species (ROS scavenging and the expression of antioxidant genes.

  20. Interspecific Associations between Cycloneda sanguinea and Two Aphid Species (Aphis gossypii and Hyadaphis foeniculi) in Sole-Crop and Fennel-Cotton Intercropping Systems.

    Science.gov (United States)

    Fernandes, Francisco S; Ramalho, Francisco S; Malaquias, José B; Godoy, Wesley A C; Santos, Bárbara Davis B

    2015-01-01

    Aphids cause significant damage to crop plants. Studies regarding predator-prey relationships in fennel (Foeniculum vulgare Mill.) and cotton (Gossypium hirsutum L.) crops are important for understanding essential ecological interactions in the context of intercropping and for establishing pest management programs for aphids. This study evaluated the association among Hyadaphis foeniculi (Passerini) (Hemiptera: Aphididae), Aphis gossypii Glover (Hemiptera: Aphididae) and Cycloneda sanguinea (L.) (Coleoptera: Coccinellidae) in cotton with coloured fibres, fennel and cotton intercropped with fennel. Association analysis was used to investigate whether the presence or absence of prey and predator species can indicate possible interactions between aphids and ladybugs. Significant associations among both apterous and alate H. foeniculi and C. sanguinea were observed in both the fennel and fennel-cotton intercropping systems. The similarity analysis showed that the presence of aphids and ladybugs in the same system is significantly dependent on the type of crop. A substantial amount of evidence indicates that the presence of the ladybug C. sanguinea, is associated with apterous or alate A. gossypii and H. foeniculi in fennel-cotton intercropping system. We recommend that future research vising integrated aphid management taking into account these associations for take decisions.

  1. Identification and Functional Analysis of microRNAs Involved in the Anther Development in Cotton Genic Male Sterile Line Yu98-8A

    Directory of Open Access Journals (Sweden)

    Xiaojie Yang

    2016-10-01

    Full Text Available Hybrid vigor contributes in a large way to the yield and quality of cotton (Gossypium hirsutum fiber. Although microRNAs play essential regulatory roles in flower induction and development, it is still unclear if microRNAs are involved in male sterility, as the regulatory molecular mechanisms of male sterility in cotton need to be better defined. In this study, two independent small RNA libraries were constructed and sequenced from the young buds collected from the sporogenous cell formation to the meiosis stage of the male sterile line Yu98-8A and the near-isogenic line. Sequencing revealed 1588 and 1536 known microRNAs and 347 and 351 novel miRNAs from male sterile and male fertile libraries, respectively. MicroRNA expression profiles revealed that 49 conserved and 51 novel miRNAs were differentially expressed. Bioinformatic and degradome analysis indicated the regulatory complexity of microRNAs during flower induction and development. Further RT-qPCR and physiological analysis indicated that, among the different Kyoto Encyclopedia Gene and Genomes pathways, indole-3-acetic acid and gibberellic acid signaling transduction pathways may play pivotal regulatory functions in male sterility.

  2. Genetic and epigenetic status of triple exotic consanguinity cotton introgression lines.

    Science.gov (United States)

    He, S P; Sun, J L; Du, X M

    2011-10-03

    Introgression lines are some of the most important germplasm for breeding applications and other research conducted on cotton crops. The DNA methylation level among 10 introgression lines of cotton (Gossypium hirsutum) and three exotic parental species (G. arboreum, G. thurberi and G. barbadense) were assessed by methylation-sensitive amplified polymorphism (MSAP) technology. The methylation level in the introgression lines ranged from 33.3 to 51.5%. However, the lines PD0111 and PD0113 had the lowest methylation level (34.6 and 33.3%, respectively) due to demethylation of most non-coding sequences. Amplified fragment length polymorphism (AFLP) was used to evaluate the genetic polymorphism in the cotton introgression lines. A high degree of polymorphism was observed in all introgression lines (mean 47.2%) based on AFLP and MSAP analyses. This confirmed the effects of genetic improvement on cotton introgression lines. The low methylation varieties, PD0111 and PD0113 (introgression lines), clustered outside of the introgression lines based on MSAP data, which was incongruent with an AFLP-based dendrogram. This phenomenon could be caused by environmental changes or introgression of exotic DNA fragments.

  3. Feeding and oviposition preference of Phyllophaga cuyabana (Moser) (Coleoptera: Melolonthidae) on several crops

    International Nuclear Information System (INIS)

    Oliveira, Lenita J.; Hoffmann-Campo, Clara B.

    2007-01-01

    Laboratory and greenhouse experiments were carried out to study food and oviposition preference by Phyllophaga cuyabana (Moser) on different plant species as Cajanus cajan L. (pigeon pea), Crotalaria juncea L. (sun hemp), Crotalaria spectabilis Roth (showy crotalaria), Crotalaria ochroleuca G. Don (slenderleaf rattlebox), Glycine max [L.] Merrill (soybean), Gossypium hirsutum L. (cotton), Helianthus annuus L. (sunflower), Stizolobium aterrimum [Mucuna aterrima] Piper and Tracey (velvetbean) and Zea mays L. (mayze). In no-choice experiments, the number of eggs layed in sunflower, C. juncea and soybean was larger compared to cotton. Despite the fact that the adults did not discriminate among plants, in dual-choice test, the proportion of eggs layed and leaf consumption by P. cuyabana adults in soybean were significantly higher than in C. spectabilis. The larval distribution in the soil was at random in multiple-choice, without any trend of preference, but in dual-choice, when soybean was the control, larvae always preferred to feed on its roots. P. cuyabana adults had preference for more suitable hosts and that could stand their offspring survival. This behaviour can be usefully exploited in an integrated management program for this pest. (author)

  4. Feeding and oviposition preference of Phyllophaga cuyabana (Moser) (Coleoptera: Melolonthidae) on several crops

    Energy Technology Data Exchange (ETDEWEB)

    Oliveira, Lenita J.; Hoffmann-Campo, Clara B. [EMBRAPA Soja, Londrina, PR (Brazil). Centro Nacional de Pesquisa de Soja]. E-mail: lenita@cnpso.embrapa.br; Garcia, Maria A. [Universidade Estadual de Campinas (UNICAMP), Campinas, SP (Brazil). Inst. de Biologia. Dept. de Zoologia; Amaral, Maria L.B. do [Conselho Nacional de Desenvolvimento Cientifico e Tecnologico (CNPq), Brasilia, DF (Brazil)

    2007-09-15

    Laboratory and greenhouse experiments were carried out to study food and oviposition preference by Phyllophaga cuyabana (Moser) on different plant species as Cajanus cajan L. (pigeon pea), Crotalaria juncea L. (sun hemp), Crotalaria spectabilis Roth (showy crotalaria), Crotalaria ochroleuca G. Don (slenderleaf rattlebox), Glycine max [L.] Merrill (soybean), Gossypium hirsutum L. (cotton), Helianthus annuus L. (sunflower), Stizolobium aterrimum [Mucuna aterrima] Piper and Tracey (velvetbean) and Zea mays L. (mayze). In no-choice experiments, the number of eggs layed in sunflower, C. juncea and soybean was larger compared to cotton. Despite the fact that the adults did not discriminate among plants, in dual-choice test, the proportion of eggs layed and leaf consumption by P. cuyabana adults in soybean were significantly higher than in C. spectabilis. The larval distribution in the soil was at random in multiple-choice, without any trend of preference, but in dual-choice, when soybean was the control, larvae always preferred to feed on its roots. P. cuyabana adults had preference for more suitable hosts and that could stand their offspring survival. This behaviour can be usefully exploited in an integrated management program for this pest. (author)

  5. Floral to green: mating switches moth olfactory coding and preference.

    Science.gov (United States)

    Saveer, Ahmed M; Kromann, Sophie H; Birgersson, Göran; Bengtsson, Marie; Lindblom, Tobias; Balkenius, Anna; Hansson, Bill S; Witzgall, Peter; Becher, Paul G; Ignell, Rickard

    2012-06-22

    Mating induces profound physiological changes in a wide range of insects, leading to behavioural adjustments to match the internal state of the animal. Here, we show for the first time, to our knowledge, that a noctuid moth switches its olfactory response from food to egg-laying cues following mating. Unmated females of the cotton leafworm (Spodoptera littoralis) are strongly attracted to lilac flowers (Syringa vulgaris). After mating, attraction to floral odour is abolished and the females fly instead to green-leaf odour of the larval host plant cotton, Gossypium hirsutum. This behavioural switch is owing to a marked change in the olfactory representation of floral and green odours in the primary olfactory centre, the antennal lobe (AL). Calcium imaging, using authentic and synthetic odours, shows that the ensemble of AL glomeruli dedicated to either lilac or cotton odour is selectively up- and downregulated in response to mating. A clear-cut behavioural modulation as a function of mating is a useful substrate for studies of the neural mechanisms underlying behavioural decisions. Modulation of odour-driven behaviour through concerted regulation of odour maps contributes to our understanding of state-dependent choice and host shifts in insect herbivores.

  6. Molecular Markers and Cotton Genetic Improvement: Current Status and Future Prospects

    Directory of Open Access Journals (Sweden)

    Waqas Malik

    2014-01-01

    Full Text Available Narrow genetic base and complex allotetraploid genome of cotton (Gossypium hirsutum L. is stimulating efforts to avail required polymorphism for marker based breeding. The availability of draft genome sequence of G. raimondii and G. arboreum and next generation sequencing (NGS technologies facilitated the development of high-throughput marker technologies in cotton. The concepts of genetic diversity, QTL mapping, and marker assisted selection (MAS are evolving into more efficient concepts of linkage disequilibrium, association mapping, and genomic selection, respectively. The objective of the current review is to analyze the pace of evolution in the molecular marker technologies in cotton during the last ten years into the following four areas: (i comparative analysis of low- and high-throughput marker technologies available in cotton, (ii genetic diversity in the available wild and improved gene pools of cotton, (iii identification of the genomic regions within cotton genome underlying economic traits, and (iv marker based selection methodologies. Moreover, the applications of marker technologies to enhance the breeding efficiency in cotton are also summarized. Aforementioned genomic technologies and the integration of several other omics resources are expected to enhance the cotton productivity and meet the global fiber quantity and quality demands.

  7. Assessing genetic diversity among six populations of Gossypium arboreum L. using microsatellites markers.

    Science.gov (United States)

    Sethi, Khushboo; Siwach, Priyanka; Verma, Surender Kumar

    2015-10-01

    Among the four cultivated cotton species, G. hirsutum (allotetraploid) presently holds a primary place in cultivation. Efforts to further improve this primary cotton face the constraints of its narrow genetic base due to repeated selective breeding and hence demands enrichment of diversity in the gene pool. G. arboreum (diploid species) is an invaluable genetic resource with great potential in this direction. Based on the dispersal and domestication in different directions from Indus valley, different races of G. arboreum have evolved, each having certain traits like drought and disease resistance, which the tetraploid cotton lack. Due to lack of systematic, race wise characterization of G. arboreum germplasm, it  has not been explored fully. During the present study, 100 polymorphic SSR loci were  used to genotype 95 accessions belonging to 6 races of G. arboreum producing 246 polymorphic alleles; mean number of effective alleles was 1.505. AMOVA showed 14 % of molecular variance among population groups, 34 % among individuals and remaining 52 % within individuals. UPGMA dendrogram, based on Nei's genetic distance, distributed the six populations in two major clusters of 3 populations each; race 'bengalense' was found more close to 'cernuum' than the others. The clustering of 95 genotypes by UPGMA tree generation as well as PCoA analysis clustered 'bengalense' genotypes into one group along with some genotypes of 'cernuum', while rest of the genotypes made separate clusters. Outcomes of this research should be helpful in identifying the genotypes for their further utilization in hybridization program to obtain high level of germplasm diversity.

  8. Seletividade de inseticidas recomendados para a cultura do algodão ao parasitóide de pupas Palmistichus elaeisis (Hymenoptera: Eulophidae)

    OpenAIRE

    Barbosa, Wagner Faria

    2010-01-01

    Insetos pragas podem reduzir a produção do algodoeiro e o controle biológico pode reduzir o uso excessivo de inseticidas nessa cultura. O endoparasitóide gregário de pupas de lepidópteros e coleópteros Palmistichus elaeisis Delvare & LaSalle (Hymenoptera: Eulophidae), por ter hábito generalista e facilidade de criação em hospedeiro alternativo, pode ser utilizado no controle biológico de pragas do algodoeiro. O objetivo dessa pesquisa foi estudar o impacto dos inseticidas acefato, cartape, cl...

  9. Cadmium (Cd) Localization in Tissues of Cotton (Gossypium hirsutum L.), and Its Phytoremediation Potential for Cd-Contaminated Soils.

    Science.gov (United States)

    Chen, Zhifan; Zhao, Ye; Fan, Lidong; Xing, Liteng; Yang, Yujie

    2015-12-01

    Phytoremediation using economically valuable, large biomass, non-edible plants is a promising method for metal-contaminated soils. This study investigated cotton's tolerance for Cd and remediation potential through analyzing Cd bioaccumulation and localization in plant organs under different soil Cd levels. Results showed cotton presents good tolerance when soil Cd concentration ≤20.26 mg kg(-1). Cotton had good Cd accumulation ability under low soil Cd levels (soil Cd, while roots and stems were the main compartments of Cd storage. Cd complexation to other organic constituents in root and stem cell sap could be a primary detoxifying strategy. Therefore, cotton is a potential candidate for phytoremediation of Cd-contaminated soils.

  10. Relationship Between Piercing-Sucking Insect Control and Internal Lint and Seed Rot in Southeastern Cotton (Gossypium hirsutum L.).

    Science.gov (United States)

    Medrano, Enrique G; Bell, Alois A; Greene, Jeremy K; Roberts, Phillip M; Bacheler, Jack S; Marois, James J; Wright, David L; Esquivel, Jesus F; Nichols, Robert L; Duke, Sara

    2015-08-01

    In 1999, crop consultants scouting for stink bugs (Hemiptera spp.) in South Carolina discovered a formerly unobserved seed rot of cotton that caused yield losses ranging from 10 to 15% in certain fields. The disease has subsequently been reported in fields throughout the southeastern Cotton Belt. Externally, diseased bolls appeared undamaged; internally, green fruit contain pink to dark brown, damp, deformed lint, and necrotic seeds. In greenhouse experiments, we demonstrated transmission of the opportunistic bacterium Pantoea agglomerans by the southern green stink bug, Nezara viridula (L.). Here, green bolls were sampled from stink bug management plots (insecticide protected or nontreated) from four South Atlantic coast states (North Carolina, South Carolina, Georgia, and Florida) to determine disease incidence in the field and its association with piercing-sucking insects feeding. A logistic regression analysis of the boll damage data revealed that disease was 24 times more likely to occur (P = 0.004) in bolls collected from plots in Florida, where evidence of pest pressure was highest, than in bolls harvested in NC with the lowest detected insect pressure. Fruit from plots treated with insecticide, a treatment which reduced transmission agent numbers, were 4 times less likely to be diseased than bolls from unprotected sites (P = 0.002). Overall, punctured bolls were 125 times more likely to also have disease symptoms than nonpunctured bolls, irrespective of whether or not plots were protected with insecticides (P = 0.0001). Much of the damage to cotton bolls that is commonly attributed to stink bug feeding is likely the resulting effect of vectored pathogens. Published by Oxford University Press on behalf of Entomological Society of America 2015. This work is written by US Government employees and is in the public domain in the US.

  11. Identification and application of biocontrol agents against Cotton leaf curl virus disease in Gossypium hirsutum under greenhouse conditions

    Directory of Open Access Journals (Sweden)

    Memoona Ramzan

    2016-05-01

    Full Text Available Biological control is a novel approach in crop protection. Bacteria, such as Bacillus spp. and Pseudomonas spp., are reported for this purpose and some of their products are already commercially available. In this study, the rhizosphere and phyllosphere of healthy cotton plants were used as a source of bacterial isolates with properties of potential biocontrol agents. The isolates were screened for phosphate solubilization activity, indole acetic acid (IAA production and antifungal activity. Two isolates, S1HL3 and S1HL4, showed phosphate solubilization and IAA production simultaneously, while another two, JS2HR4 and JS3HR2, demonstrated potential to inhibit fungal pathogens. These bacteria were identified as Pseudomonas aeruginosa (S1HL3, Burkholderia sp. (S1HL4 and Bacillus sp. (JS2HR4 and JS3HR2 based on biochemical and molecular characteristics. The isolates were tested against Cotton leaf curl virus (CLCuV in greenhouse conditions, both as individual bacterial isolates and consortia. Treated plants were healthy as compared to control plants, where up to 74% of the plants were symptomatic for CLCuV infection. Maximum inhibition of CLCuV was observed in the plants treated with a mixture of bacterial isolates: the viral load in the treated plants was only 0.4% vs. up to 74% in controls. This treatment consortium included P. aeruginosa S1HL3, Burkholderia sp. S1HL4 and Bacillus spp. isolates, JS2HR4 and JS3HR2. The principal-component biplot showed a highly significant correlation between the viral load percentage and the disease incidence.

  12. Endogenous Ethylene Concentration Is Not a Major Determinant of Fruit Abscission in Heat-Stressed Cotton (Gossypium hirsutum L.

    Directory of Open Access Journals (Sweden)

    Ullah Najeeb

    2017-09-01

    Full Text Available We investigated the role of ethylene in the response of cotton to high temperature using cotton genotypes with genetically interrupted ethylene metabolism. In the first experiment, Sicot 71BRF and 5B (a lintless variant with compromised ethylene metabolism were exposed to 45°C, either by instantaneous heat shock or by ramping temperatures by 3°C daily for 1 week. One day prior to the start of heat treatment, half the plants were sprayed with 0.8 mM of the ethylene synthesis inhibitor, aminoethoxyvinylglycine (AVG. In a subsequent experiment, Sicot 71BRF and a putatively heat-tolerant line, CIM 448, were exposed to 36 or 45°C for 1 week, and half the plants were sprayed with 20 μM of the ethylene precursor, 1-aminocyclopropane-1-carboxylic acid, (ACC. High temperature exposure of plants in both experiments was performed at the peak reproductive phase (65–68 days after sowing. Elevated temperature (heat shock or ramping to 45°C significantly reduced production and retention of fruits in all cotton lines used in this study. At the termination of heat treatment, cotton plants exposed to 45°C had at least 50% fewer fruits than plants under optimum temperature in all three genotypes, while plants at 36°C remained unaffected. Heat-stressed plants continued producing new squares (fruiting buds after termination of heat stress but these squares did not turn into cotton bolls due to pollen infertility. In vitro inhibition of pollen germination by high temperatures supported this observation. Leaf photosynthesis (Pn of heat-stressed plants (45°C measured at the end of heat treatments remained significantly inhibited, despite an increased leaf stomatal conductance (gs, suggesting that high temperature impairs Pn independently of stomatal behavior. Metabolic injury was supported by high relative cellular injury and low photosystem II yield of the heat-stressed plants, indicating that high temperature impaired photosynthetic electron transport. Both heat shock and ramping of heat significantly reduced ethylene release from cotton leaf tissues measured at the end of heat treatment but modulating ethylene production via AVG or ACC application had no significant effect on fruit production or retention in heat-stressed cotton plants. Instead, high temperature accelerated fruit abortion by impairing pollen development and/or restricting leaf photosynthesis.

  13. Effect of Gossypium hirsutum and Ricinus comunis meals in growth and yield of Brassica oleracea var. italica Plenck

    Directory of Open Access Journals (Sweden)

    Juan Francisco Avendaño Mora

    2018-01-01

    Full Text Available Cultivation of broccoli in Equador uses high doses of inorganic nitrogen fertilizers, which cause problems in the soil, the environment and the crop yield itself. In this work organic amendments were applied to Haplustolls soil by implementing the following trial treatments: castor bean meal (270 kg N ha-1, 202.5 kg N ha-1, 152 kg N ha-1, cotton seed meal (270 kg N ha-1, 202.5 kg N ha-1, 152 kg N ha-1, and control without organic fertilization. Results confirmed that applications of organic meals made from cotton seed and castor bean had a favorable effect on growth and yield of Broccoli in the canton Riobamba, Chimborazo province, Ecuador. Result gets into the hands of broccoli farmers give new alternatives of organic fertilization to restore physical, chemical and biological properties of the soil and will increase crop yields and help environmental preservation.

  14. Estudo regional da adubaçáo boratada do algodoeiro no Estado de São Paulo Regional tests of boron fertilization on cotton

    Directory of Open Access Journals (Sweden)

    Nelson Machado da Silva

    1991-01-01

    Full Text Available Quinze experimentos de adubação boratada foram realizados em condições de campo com o algodoeiro, em diferentes regiões produtoras paulistas, no período de 1979-86.O micronutriente foi aplicado na adubação do plantio, nas doses de 0,0; 0,2; 0,4; 0,8; 1,6 e 3,2kg/ha de B, como bórax, em esquema estatístico de quadrado latino. Utilizaram-se sementes dos cultivares IAC 17, nos quatro primeiros anos, e IAC 20, nos demais. Na maioria dos experimentos, houve resposta favorável à adubação, em termos de produção, embora se tenham obtido em apenas três deles (20% dos casos diferenças estatisticamente significativas. Quanto à concentração de boro no limbo (quinta folha, ocorreu aumento significativo em seis dos onze ensaios amostrados (55%. Reunindo os experimentos em função do histórico das glebas estudadas e da ocorrência de sintomas de deficiência ou de toxicidade de boro, discriminou-se muito bem o efeito geral da adubação. As mais altas produtividades foram alcançadas nos solos tradicionalmente cultivados e adubados e com a acidez corrigida. No entanto, a ação do micronutriente foi maior nos solos corrigidos e adubados com NPK, diminuindo para as glebas em fase de correção ou que já haviam recebido adubação boratada, sendo praticamente nula nos solos pouco cultivados, de pastagens. Observou-se uma relação significativa entre a produção e a concentração de B no solo, extraído pela solução de Mehlich ou, em especial, pela água quente, assim como entre a produção e a concentração de boro no limbo foliar. Como primeira aproximação, sugerem-se as faixas de 0,20 a 0,40ppm de B no solo (água quente, e de 25 a 40ppm de B no limbo da quinta folha, como indicadoras da necessidade de uso do boro na adubação do algodoeiro.After the confirmation of problems on cotton concerning boron nutrition in the State of São Paulo, Brazil, at the decade of 1970, experimental field tests were carried out and demonstrated

  15. Estabilidade fenotípica de genótipos de algodoeiro no Estado do Mato Grosso Phenotypic stability in cotton genotypes in Mato Grosso State, Brazil

    Directory of Open Access Journals (Sweden)

    Eulália Soler Sobreira Hoogerheide

    2007-05-01

    Full Text Available Foram avaliados oito genótipos de algodoeiro herbáceo, sendo três linhagens e cinco cultivares, com o objetivo de estimar a adaptabilidade e estabilidade fenotípica para o caráter produtividade de algodão em caroço, pelo método Eberhart e Russell. Foram conduzidos 12 experimentos em 11 locais no Estado do Mato Grosso, sob um delineamento de blocos ao acaso com oito repetições, no ano agrícola 2000/2001. Praticamente todos os genótipos apresentaram coeficiente de determinação acima de 85%, exceto Delta Opal. As estimativas de adaptabilidade indicam que todos os genótipos apresentaram adaptação ampla (b i = 1. Quanto à estabilidade, os genótipos CNPA ITA 90, BRS Antares, CNPA 96-124, CNPA 96-283 e BRS Aroeira revelaram-se estáveis (S²d i= 0. Os melhores genótipos, caracterizados pela maior produtividade, estabilidade e adaptabilidade ampla foram CNPA ITA 90, BRS Aroeira e CNPA 96-124.Eight cotton genotypes, three lines and five cultivars, were evaluated for estimation of phenotypic adaptability and stability parameters relative to cotton yield using the method proposed by Eberhart and Russell. Twelve yield trials, in randomized complete blocks, comprising eight replications, were carried out in 11 locations of the Mato Grosso State, during the 2000/2001 crop season. All the genotypes showed determination coefficient above of 85%, except Delta Opal. For the estimates of adaptability, all the genotypes presented broad adaptation (b i = 1. The genotypes CNPA ITA 90, BRS Antares, CNPA 96-124, CNPA 96-283 and BRS Aroeira showing hight stability (S²d i= 0. The best genotypes, characterized by higher yield, stability and broad adaptability, were CNPA ITA 90, BRS Aroeira and CNPA 96-124.

  16. Analysis of the Complete Mitochondrial Genome Sequence of the Diploid Cotton Gossypium raimondii by Comparative Genomics Approaches

    Directory of Open Access Journals (Sweden)

    Changwei Bi

    2016-01-01

    Full Text Available Cotton is one of the most important economic crops and the primary source of natural fiber and is an important protein source for animal feed. The complete nuclear and chloroplast (cp genome sequences of G. raimondii are already available but not mitochondria. Here, we assembled the complete mitochondrial (mt DNA sequence of G. raimondii into a circular genome of length of 676,078 bp and performed comparative analyses with other higher plants. The genome contains 39 protein-coding genes, 6 rRNA genes, and 25 tRNA genes. We also identified four larger repeats (63.9 kb, 10.6 kb, 9.1 kb, and 2.5 kb in this mt genome, which may be active in intramolecular recombination in the evolution of cotton. Strikingly, nearly all of the G. raimondii mt genome has been transferred to nucleus on Chr1, and the transfer event must be very recent. Phylogenetic analysis reveals that G. raimondii, as a member of Malvaceae, is much closer to another cotton (G. barbadense than other rosids, and the clade formed by two Gossypium species is sister to Brassicales. The G. raimondii mt genome may provide a crucial foundation for evolutionary analysis, molecular biology, and cytoplasmic male sterility in cotton and other higher plants.

  17. Adubação do algodoeiro: III - Ensaios sôbre a aplicação de azôto em cobertura Fertilizer experiments with cotton: III - Nitrogen application as top-dressing

    Directory of Open Access Journals (Sweden)

    O. S. Neves

    1957-01-01

    Full Text Available Nêste trabalho são apresentados os resultados de três ensaios realizados entre 1937-38 e 1941-42 nas Estações Experimentais de Mococa (em solo massapê, Tietê (em solo argiloso e Tatuí (em terra-roxa-misturada, nos quais canteiros adubados com fósforo e potássio foram comparados com outros que receberam esses nutrientes e mais azoto. O azôto, nas formas de salitre do Chile e de Calnitro IG (mistura de nitrato de amônio e carbonato de cálcio, foi aplicado pelo método usual - nos sulcos destinados às sementes, no momento do plantio - ou em cobertura, ao achar-se o algodoeiro em pleno desenvolvimento. O fósforo e o potássio foram sempre empregados nos sulcos de plantio. Em Mococa e Tietê os ensaios foram conduzidos, nos mesmos canteiros, por três anos; em Tatuí, por dois. Os dois adubos azotados deram o mesmo resultado. Em Mococa eles aumentaram apreciavelmente a produção, não se notando diferença entre os dois métodos de aplicação, mas em Tietê e Tatuí o azôto empregado nos sulcos de plantio em regra pouco aumentou ou mesmo deprimiu a produção, ao passo que a elevou consideravelmente quando aplicado em cobertura. • Em Mococa, tendo chovido nos dias imediatos ao plantio, os adubos azotados não prejudicaram o "stand"; por outro lado, as chuvas caídas não foram suficientes para lixiviar o azôto do massapê utilizado para o ensaio. Em Tietê o motivo principal da inferioridade da aplicação dos adubos azotados nos sulcos de plantio foi o prejuízo que eles causaram às sementes em germinação, devido à elevada concentração local de sais. Num dos dois anos de ensaio em Tatuí ficou patente que o azôto empregado nos sulcos foi arrastado antes de o algodoeiro o ter podido absorver, enquanto o aplicado em cobertura não sofreu esse inconveniente. O arrastamento do azôto, que se dá sobretudo quando êle é empregado por ocasião do plantio, não teve grande influência nos presentes ensaios, porque os solos

  18. Differential expression of genes regulated in response to drought stress in diploid cotton (Gossypium arboreum) (abstract)

    International Nuclear Information System (INIS)

    Hussain, T.; Majeed, A.; Maqbool, A.; Hussain, S.S.; Ali, T.; Riazuddin, S.

    2005-01-01

    Negative effects on the Water status of plants is one of the most common and deleterious stresses experienced by wild and cultivated plants throughout the World. Our project is designed to identify, clone and characterize gene sequences regulated in response to Water stress (e.g., drought). We used the differential-display reverse transcriptase polymerase chain reaction (DD-RT- PCA) methodology to accomplish our Objectives. Structural and functional characterization of environmental stress-induced genes has contributed to a better understanding of how plants respond and adapt to different abiotic stresses. Differential display was used to compare overall difference in gene expression between draught stressed and unstressed (control) plants of diploid Cotton (Gossypium arboreum). DDRT-PCR product from stressed and unstressed samples resolved side by side on 6% PAGE to compare qualitative and quantitative difference in mRNA expression. A total of 81 primer combinations were tested. DDRT -PCR enabled us to identify differentially expressed transcripts between water stressed and non-stressed cotton seedlings. PAGE revealed a total of 347 DNA transcripts in stressed samples (New Transcripts) while 110 down regulated and 209 up regulated DNA transcripts were also recorded. Similarly. 22 DNA transcripts were identified based on the comparative study of PAGE and Agarose gel electrophoresis. These sequences showed various degree homology With draught tolerant genes in the gene bank. (author)

  19. Construction of a plant-transformation-competent BIBAC library and genome sequence analysis of polyploid Upland cotton (Gossypium hirsutum L.)

    Science.gov (United States)

    Cotton is a world’s leading crop important to the world’s textile and energy industries, and a model species for studies of plant polyploidization, cellulose biosynthesis and cell wall biogenesis. Here, we report the construction and extensive analysis of a binary bacterial artificial chromosome (BI...

  20. Density responses and spatial distribution of cotton yield and yield components in jujube (Zizyphus jujube)/cotton (Gossypium hirsutum) agroforestry

    NARCIS (Netherlands)

    Wang, Qi; Han, Shuo; Zhang, Lizhen; Zhang, Dongsheng; Werf, van der Wopke; Evers, Jochem B.; Sun, Hongquan; Su, Zhicheng; Zhang, Siping

    2016-01-01

    Trees are the dominant species in agroforestry systems, profoundly affecting the performance of understory crops. Proximity to trees is a key factor in crop performance, but rather little information is available on the spatial distribution of yield and yield components of crop species under the

  1. Differential Cotton leaf crumple virus-VIGS-mediated gene silencing and viral genome localization in different Gossypium hirsutum genetic backgrounds

    KAUST Repository

    Idris, Ali; Tuttle, John Richard; Robertson, Dominique Niki; Haigler, Candace H.; Brown, Judith K.

    2010-01-01

    inoculation resulted in systemic and persistent photo-bleaching of the leaves and bolls of the seven cultivars tested, however, the intensity of silencing was variable. CLCrV-VIGS-mediated expression of green fluorescent protein was used to monitor

  2. Title: Potassium application regulates nitrogen metabolism and osmotic adjustment in cotton (Gossypium hirsutum L.) functional leaf under drought stress.

    Science.gov (United States)

    Zahoor, Rizwan; Zhao, Wenqing; Abid, Muhammad; Dong, Haoran; Zhou, Zhiguo

    2017-08-01

    To evaluate the role of potassium (K) in maintaining nitrogen metabolism and osmotic adjustment development of cotton functional leaves to sustain growth under soil drought and rewatering conditions, the plants of two cotton cultivars Siza 3 (low-K sensitive) and Simian 3 (low-K tolerant), were grown under three different K rates (K0, K1, and K2; 0, 150, and 300kgK 2 Oha -1 , respectively) and exposed to drought stress with 40±5% soil relative water content (SRWC). The drought stress was applied at flowering stage by withholding water for eight days followed by rewatering to a well-watered level (75±5% SRWC). The results showed that drought-stressed plants of both cultivars showed a decrease in leaf relative water content (RWC) and osmotic potential in the functional leaves and developed osmotic adjustment with an increase in the contents of free amino acids, soluble sugars, inorganic K, and nitrate as compared to well-watered plants. In drought-stressed plants, nitrogen-metabolizing enzyme activities of nitrogen reductase (NR), glutamine synthetase (GS), and glutamate synthase (GOGAT) were diminished significantly (P≤0.05) along with decreased chlorophyll content and soluble proteins. However, drought-stressed plants under K application not only exhibited higher osmotic adjustment with greater accumulation of osmolytes but also regulated nitrogen metabolism by maintaining higher enzyme activities, soluble proteins, and chlorophyll content in functional leaves as compared to the plants without K application. Siza 3 showed better stability in enzyme activities and resulted in 89% higher seed cotton yield under K2 as compared to K0 in drought-stressed plants, whereas this increase was 53% in the case of Simian 3. The results of the study suggested that K application enhances cotton plants' potential for sustaining high nitrogen-metabolizing enzyme activities and related components to supplement osmotic adjustment under soil drought conditions. Copyright © 2017 Elsevier GmbH. All rights reserved.

  3. Carbon source dependent somatic embryogenesis and plant regeneration in cotton, Gossypium hirsutum L. cv. SVPR2 through suspension cultures.

    Science.gov (United States)

    Ganesan, M; Jayabalan, N

    2005-10-01

    Highly reproducible and simple protocol for cotton somatic embryogenesis is described here by using different concentrations of maltose, glucose, sucrose and fructose. Maltose (30 g/l) is the best carbon source for embryogenic callus induction and glucose (30 g/l) was suitable for induction, maturation of embryoids and plant regeneration. Creamy white embryogenic calli of hypocotyl explants were formed on medium containing MS basal salts, myo-inositol (100 mg/l), thiamine HCI (0.3 mg/l), picloram (0.3 mg/l), Kin (0.1 mg/l) and maltose (30 g/l). During embryo induction and maturation, accelerated growth was observed in liquid medium containing NH3NO4 (1 g/l), picloram (2.0 mg/l), 2 ip (0.2 mg/l), Kin (0.1 mg/l) and glucose (30 g/l). Before embryoid induction, large clumps of embryogenic tissue were formed. These tissues only produced viable embryoids. Completely matured somatic embryos were germinated successfully on the medium fortified with MS salts, myo-inositol (50 mg/l), thiamine HCl (0.2 mg/l), GA3 (0.2 mg/l), BA (1.0 mg/l) and glucose (30 g/l). Compared with earlier reports, 65% of somatic embryo germination was observed. The abnormal embryo formation was highly reduced by using glucose (30 g/l) compared to other carbon sources. The regenerated plantlets were fertile but smaller in height than the seed derived control plants.

  4. Variations in seed protein content of cotton (Gossypium hirsutum L.) mutant lines by in vivo and in vitro mutagenesis.

    Science.gov (United States)

    Muthusamy, Annamalai; Jayabalan, Narayanasamy

    2013-01-01

    The present work describes the influence of gamma irradiation (GR), ethyl methane sulphonate (EMS) and sodium azide (SA) treatment on yield and protein content of selected mutant lines of cotton. Seeds of MCU 5 and MCU 11 were exposed to gamma rays (GR), ethyl methane sulphonate (EMS) and sodium azide (SA). Lower dose of gamma irradiation (100-500 Gy), 10-50 mM EMS and SA at lower concentration effectively influences in improving the yield and protein content. Significant increase in yield (258.9 g plant(-1)) and protein content (18.63 mg g(-1) d. wt.) as compared to parental lines was noted in M2 generations. During the subsequent field trials, number of mutant lines varied morphologically in terms of yield as well as biochemical characters such as protein. The selected mutant lines were bred true to their characters in M3 and M4 generations. The significant increase in protein content and profiles of the mutant lines with range of 10.21-18.63 mg g(-1). The SDS-PAGE analysis of mutant lines revealed 9 distinct bands of different intensities with range of 26-81 kDa. The difference in intensity of bands was more (41, 50 and 58 kDa) in the mutant lines obtained from in vitro mutation than in vivo mutation. Significance of such stimulation in protein content correlated with yielding ability of the mutant lines of cotton in terms of seed weight per plant. The results confirm that in cotton it is possible to enhance the both yield and biochemical characters by in vivo and in vitro mutagenic treatments.

  5. Influence of cytokinins, auxins and polyamines on in vitro mass multiplication of cotton (Gossypium hirsutum L. cv. SVPR2).

    Science.gov (United States)

    Ganesan, M; Jayabalan, N

    2006-06-01

    In the present investigation, the influence of different forms of cytokinins, auxins and polyamines were tested for mass multiplication and regeneration of cotton. Initially, for the identification of effective concentration for multiple shoot induction, various concentrations of BAP, Kin and 2iP along with IAA and NAA were tested. Among tested concentrations, media fortified with MS salts; B5 vitamins; 30 g/l, glucose; 2.0 mg/l, 2iP; 2.0 mg/l, IAA and 0.7 % agar showed best response for multiplication of shoot tip explants (20 shoots per shoot tip explants). In nodal explants, maximum of 18.6 shoots were obtained in the media fortified with MS salts, B5 vitamins, 30 g/l, glucose, 2.0 mg/l, 2iP, 1.0 mg/l, NAA and 0.7 % agar. Effect of different concentrations of polyamines like spermidine and putrescine were also tested along with the above said multiplication media. Among the various treatments, 20 mg/l of putrescine showed best response and the multiple of shoots were increased to 26.5 shoots per shoot tip explants and 24.5 shoots per nodal explants. Elongation of shoots was achieved on multiple shoot induction medium. Significant number of roots were initiated in the medium supplemented with MS salts, vitamin B5 and IBA (2.0 mg/l). The frequency of root induction was increased by addition of, PVP (10 mg/l) along with root induction medium and after 2 weeks, the roots reached the maximum length of 22 cm. Further, these plantlets were hardened by using sand, soil and vermiculate in 1:1:1 ratio. The hardened plants were transferred to the environmental growth chamber for proper acclimatization. The hardened plants were then transferred to field for boll yielding and they exhibited 100% survival.

  6. The use of different clustering methods in the evaluation of genetic diversity in upland cotton

    Directory of Open Access Journals (Sweden)

    Laíse Ferreira de Araújo

    Full Text Available The continuous development and evaluation of new genotypes through crop breeding is essential in order to obtain new cultivars. The objective of this work was to evaluate the genetic divergences between cultivars of upland cotton (Gossypium hirsutum L. using the agronomic and technological characteristics of the fibre, in order to select superior parent plants. The experiment was set up during 2010 at the Federal University of Ceará in Fortaleza, Ceará, Brazil. Eleven cultivars of upland cotton were used in an experimental design of randomised blocks with three replications. In order to evaluate the genetic diversity among cultivars, the generalised Mahalanobis distance matrix was calculated, with cluster analysis then being applied, employing various methods: single linkage, Ward, complete linkage, median, average linkage within a cluster and average linkage between clusters. Genetic variability exists among the evaluated genotypes. The most consistant clustering method was that employing average linkage between clusters. Among the characteristics assessed, mean boll weight presented the highest contribution to genetic diversity, followed by elongation at rupture. Employing the method of mean linkage between clusters, the cultivars with greater genetic divergence were BRS Acacia and LD Frego; those of greater similarity were BRS Itaúba and BRS Araripe.

  7. Olfaction in the boll weevil,Anthonomus grandis Boh. (Coleoptera: Curculionidae): Electroantennogram studies.

    Science.gov (United States)

    Dickens, J C

    1984-12-01

    Electroantennogram (EAG) techniques were utilized to measure the antennal olfactory responsiveness of adult boll weevils,Anthonomus grandis Boh. (Coleoptera: Curculionidae), to 38 odorants, including both insect and host plant (Gossypium hirsutum L.) volatiles. EAGs of both sexes were indicative of at least two receptor populations: one receptor population primarily responsive to pheromone components and related compounds, the other receptor population primarily responsive to plant odors. Similar responses to male aggregation pheromone components (i.e., compounds I, II, and III + IV) were obtained from both sexes, but females were slightly more sensitive to I. Both sexes were highly responsive to components of the "green leaf volatile complex," especially the six-carbon saturated and monounsaturated primary alcohols. Heptanal was the most active aldehyde tested. More acceptors responded to oxygenated monoterpenes than to monoterpene hydrocarbons. β-Bisabolol, the major volatile of cotton, was the most active sesquiterpene. In general, males, which are responsible for host selection and pheromone production, were more sensitive to plant odors than were females. In fact, males were as sensitive to β-bisabolol and heptanal as to aggregation pheromone components. Electrophysiological data are discussed with regard to the role of insect and host plant volatiles in host selection and aggregation behavior of the boll weevil.

  8. Oilseed Meal Effects on the Emergence and Survival of Crop and Weed Species

    Directory of Open Access Journals (Sweden)

    Katie L. Rothlisberger

    2012-01-01

    Full Text Available Oilseed crops are being widely evaluated for potential biodiesel production. Seed meal (SM remaining after extracting oil may have use as bioherbicides or organic fertilizers. Brassicaceae SM often contains glucosinolates that hydrolyze into biologically active compounds that may inhibit various pests. Jatropha curcas SM contains curcin, a phytoxin. A 14-day greenhouse study determined that Sinapis alba (white mustard, Brassica juncea (Indian mustard, Camelina sativa, and Jatropha curcas applied to soil at varying application rates [0, 0.5, 1.0, and 2.5% (w/w] and incubation times (1, 7, and 14 d prior to planting affected seed emergence and seedling survival of cotton [Gossypium hirsutum (L.], sorghum [Sorghum bicolor (L. Moench], johnsongrass (Sorghum halepense, and redroot pigweed (Amaranthus retroflexus. With each species, emergence and survival was most decreased by 2.5% SM application applied at 1 and 7 d incubations. White mustard SM incubated for 1 d applied at low and high rates had similar negative effects on johnsongrass seedlings. Redroot pigweed seedling survival was generally most decreased by all 2.5% SM applications. Based on significant effects determined by ANOVA, results suggested that the type, rate, and timing of SM application should be considered before land-applying SMs in cropping systems.

  9. De novo biosynthesis of volatiles induced by insect herbivory in cotton plants

    International Nuclear Information System (INIS)

    Pare, P.W.; Tumlinson, J.H.

    1997-01-01

    In response to insect feeding on the leaves, cotton (Gossypium hirsutum L.) plants release elevated levels of volatiles, which can serve as a chemical signal that attracts natural enemies of the herbivore to the damaged plant. Pulse-labeling experiments with [13C]CO2 demonstrated that many of the volatiles released, including the acyclic terpenes (E,E)-alpha-farnesene, (E)-beta-farnesene, (E)-beta-ocimene, linalool,(E)-4,8-dimethyl-1,3,7-nonatriene, and (E,E)-4,8,12-trimethyl-1,3,7,11-tridecatetrane, as well as the shikimate pathway product indole, are biosynthesized de novo following insect damage. However, other volatile constituents, including several cyclic terpenes, butyrates, and green leaf volatiles of the lipoxygenase pathway are released from storage or synthesized from stored intermediates. Analysis of volatiles from artificially damaged plants, with and without beet armyworm (Spodoptera exigua Hubner) oral secretions exogenously applied to the leaves, as well as volatiles from beet armyworm-damaged and -undamaged control plants, demonstrated that the application of caterpillar oral secretions increased both the production and release of several volatiles that are synthesized de novo in response to insect feeding. These results establish that the plant plays an active and dynamic role in mediating the interaction between herbivores and natural enemies of herbivores

  10. Differential contributions to the transcriptome of duplicated genes in response to abiotic stresses in natural and synthetic polyploids.

    Science.gov (United States)

    Dong, Shaowei; Adams, Keith L

    2011-06-01

    Polyploidy has occurred throughout plant evolution and can result in considerable changes to gene expression when it takes place and over evolutionary time. Little is known about the effects of abiotic stress conditions on duplicate gene expression patterns in polyploid plants. We examined the expression patterns of 60 duplicated genes in leaves, roots and cotyledons of allotetraploid Gossypium hirsutum in response to five abiotic stress treatments (heat, cold, drought, high salt and water submersion) using single-strand conformation polymorphism assays, and 20 genes in a synthetic allotetraploid. Over 70% of the genes showed stress-induced changes in the relative expression levels of the duplicates under one or more stress treatments with frequent variability among treatments. Twelve pairs showed opposite changes in expression levels in response to different abiotic stress treatments. Stress-induced expression changes occurred in the synthetic allopolyploid, but there was little correspondence in patterns between the natural and synthetic polyploids. Our results indicate that abiotic stress conditions can have considerable effects on duplicate gene expression in a polyploid, with the effects varying by gene, stress and organ type. Differential expression in response to environmental stresses may be a factor in the preservation of some duplicated genes in polyploids. © 2011 The Authors. New Phytologist © 2011 New Phytologist Trust.

  11. Ethylene: Response of Fruit Dehiscence to CO(2) and Reduced Pressure.

    Science.gov (United States)

    Lipe, J A; Morgan, P W

    1972-12-01

    These studies were conducted to determine whether ethylene serves as a natural regulator of fruit wall dehiscence, a major visible feature of ripening in some fruits. We employed treatments to inhibit ethylene action or remove ethylene and observed their effect on fruit dehiscence. CO(2) (13%), a competitive inhibitor of ethylene action in many systems, readily delayed dehiscence of detached fruits of cotton (Gossypium hirsutum L.), pecan (Carya illinoensis [Wang.] K. Koch), and okra (Hibiscus esculentus L.). The CO(2) effect was duplicated by placing fruits under reduced pressure (200 millimeters mercury), to promote the escape of ethylene from the tissue. Dehiscence of detached fruits of these species as well as attached cotton fruits was delayed. The delay of dehiscence of cotton and okra by both treatments was achieved with fruit harvested at intervals from shortly after anthesis until shortly before natural dehiscence. Pecan fruits would not dehisce until approximately 1 month before natural dehiscence, and during that time, CO(2) and reduced pressure delayed dehiscence. CO(2) and ethylene were competitive in their effects on cotton fruit dehiscence. All of the results are compatible with a hypothetical role of ethylene as a natural regulator of dehiscence, a dominant aspect of ripening of cotton, pecan, and some other fruits.

  12. Ethylene: Response of Fruit Dehiscence to CO2 and Reduced Pressure 1

    Science.gov (United States)

    Lipe, John A.; Morgan, Page W.

    1972-01-01

    These studies were conducted to determine whether ethylene serves as a natural regulator of fruit wall dehiscence, a major visible feature of ripening in some fruits. We employed treatments to inhibit ethylene action or remove ethylene and observed their effect on fruit dehiscence. CO2 (13%), a competitive inhibitor of ethylene action in many systems, readily delayed dehiscence of detached fruits of cotton (Gossypium hirsutum L.), pecan (Carya illinoensis [Wang.] K. Koch), and okra (Hibiscus esculentus L.). The CO2 effect was duplicated by placing fruits under reduced pressure (200 millimeters mercury), to promote the escape of ethylene from the tissue. Dehiscence of detached fruits of these species as well as attached cotton fruits was delayed. The delay of dehiscence of cotton and okra by both treatments was achieved with fruit harvested at intervals from shortly after anthesis until shortly before natural dehiscence. Pecan fruits would not dehisce until approximately 1 month before natural dehiscence, and during that time, CO2 and reduced pressure delayed dehiscence. CO2 and ethylene were competitive in their effects on cotton fruit dehiscence. All of the results are compatible with a hypothetical role of ethylene as a natural regulator of dehiscence, a dominant aspect of ripening of cotton, pecan, and some other fruits. PMID:16658260

  13. Ethnopharmacological Assessment of Medicinal Plants Used against Livestock Infections by the People Living around Indus River

    Directory of Open Access Journals (Sweden)

    Sakina Mussarat

    2014-01-01

    Full Text Available The present study was aimed to document detailed ethnopharmacological knowledge of medicinal plants against livestock infections of an unexplored remote region of Pakistan. Semistructured questionnaires were used for data collection. Total 43 plants belonging to 26 families were found to be used in ethnoveterinary practices. Seeds (29% were found to be the most frequent plant part used followed by leaves (22%. Ethnoveterinary recipes were mostly prepared in the form of decoction and powdering. Informant consensus factor (Fic results revealed high consensus for gastrointestinal (0.81, mastitis (0.82, and dermatological infections (0.80. Curcuma longa ranked first with highest fidelity level (FL value (66% followed by Trachyspermum ammi that ranked second (58%. Preference ranking (PR results showed that Zingiber officinale, Punica granatum, Triticum aestivum, Gossypium hirsutum, and Withania coagulans were the most preferred species for the treatment of diarrhea. Direct matrix ranking (DMR results showed that Morus alba, Melia azedarach, Withania coagulans, Cassia fistula, Azadirachta indica, and Tamarix aphylla were the multipurpose species of the region. We invite the attention of pharmacologists and chemists for further exploration of plants having high Fic, FL, and PR values in the present study. Conservation strategies should be adopted for the protection of multipurpose plant species.

  14. Effect of altered sink:source ratio on photosynthetic metabolism of source leaves

    International Nuclear Information System (INIS)

    Plaut, Z.; Mayoral, M.L.; Reinhold, L.

    1987-01-01

    When seven crop species were grown under identical environmental conditions, decreased sink:source ratio led to a decreased photosynthetic rate within 1 to 3 days in Cucumis sativus L., Gossypium hirsutum L., and Raphanus sativus L., but not in Capsicum annuum L., Solanum melongena L., Phaseolus vulgaris L., or Ricinus communis L. The decrease was not associated with stomatal closure. In cotton and cucumbers, sink removal led to an increase in starch and sugar content, in glucose 6-phosphate and fructose 6-phosphate pools, and in the proportion of 14 C detected in sugar phosphates and UDPglucose following 14 CO 2 supply. When mannose was supplied to leaf discs to sequester cytoplasmic inorganic phosphate, promotion of starch synthesis, and inhibition of CO 2 fixation, were observed in control discs, but not in discs from treated plants. Phosphate buffer reduced starch synthesis in the latter, but not the former discs. The findings suggest that sink removal led to a decreased ratio inorganic phosphate:phosphorylated compounds. In beans 14 C in sugar phosphates increased following sink removal, but without sucrose accumulation, suggesting tighter feedback control of sugar level. Starch accumulated to higher levels than in the other plants, but CO 2 fixation rate was constant for several days

  15. Cover Crop Biomass Harvest Influences Cotton Nitrogen Utilization and Productivity

    Directory of Open Access Journals (Sweden)

    F. Ducamp

    2012-01-01

    Full Text Available There is a potential in the southeastern US to harvest winter cover crops from cotton (Gossypium hirsutum L. fields for biofuels or animal feed use, but this could impact yields and nitrogen (N fertilizer response. An experiment was established to examine rye (Secale cereale L. residue management (RM and N rates on cotton productivity. Three RM treatments (no winter cover crop (NC, residue removed (REM and residue retained (RET and four N rates for cotton were studied. Cotton population, leaf and plant N concentration, cotton biomass and N uptake at first square, and cotton biomass production between first square and cutout were higher for RET, followed by REM and NC. However, leaf N concentration at early bloom and N concentration in the cotton biomass between first square and cutout were higher for NC, followed by REM and RET. Seed cotton yield response to N interacted with year and RM, but yields were greater with RET followed by REM both years. These results indicate that a rye cover crop can be beneficial for cotton, especially during hot and dry years. Long-term studies would be required to completely understand the effect of rye residue harvest on cotton production under conservation tillage.

  16. Identification of a New Cotton Disease Caused by an Atypical Cotton Leafroll Dwarf Virus in Argentina.

    Science.gov (United States)

    Agrofoglio, Yamila C; Delfosse, Verónica C; Casse, María F; Hopp, Horacio E; Kresic, Iván Bonacic; Distéfano, Ana J

    2017-03-01

    An outbreak of a new disease occurred in cotton (Gossypium hirsutum) fields in northwest Argentina starting in the 2009-10 growing season and is still spreading steadily. The characteristic symptoms of the disease included slight leaf rolling and a bushy phenotype in the upper part of the plant. In this study, we determined the complete nucleotide sequences of two independent virus genomes isolated from cotton blue disease (CBD)-resistant and -susceptible cotton varieties. This virus genome comprised 5,866 nucleotides with an organization similar to that of the genus Polerovirus and was closely related to cotton leafroll dwarf virus, with protein identity ranging from 88 to 98%. The virus was subsequently transmitted to a CBD-resistant cotton variety using Aphis gossypii and symptoms were successfully reproduced. To study the persistence of the virus, we analyzed symptomatic plants from CBD-resistant varieties from different cotton-growing fields between 2013 and 2015 and showed the presence of the same virus strain. In addition, a constructed full-length infectious cDNA clone from the virus caused disease symptoms in systemic leaves of CBD-resistant cotton plants. Altogether, the new leafroll disease in CBD-resistant cotton plants is caused by an atypical cotton leafroll dwarf virus.

  17. Propagación clonal in vitro y enraizamiento de estacas de algodón nativo (Gossypium barbadense L.

    Directory of Open Access Journals (Sweden)

    Consuelo Rojas-Idrogo

    2013-12-01

    Full Text Available En este trabajo se evalúo el efecto de reguladores de crecimiento en la propagación clonal in vitro y el efecto de diferentes soluciones nutritivas y reguladores de crecimiento en el enraizamiento de estacas de algodón (Gossypium barbadense. En el enraizamiento se evaluó el efecto del agua corriente, las soluciones nutritivas de Knop y Knudson y los reguladores de crecimiento AIA, AIB y floroglucinol sobre estacas obtenidas de las zonas apical, media y basal de la planta. En la combinación ANA 0.1 mg/lt - BAP 1.0 y 2.0 mg/lt, después de 30 días de cultivo in vitro, se alcanzó la mayor elongación de brotes (38.1 y 30.7 mm y número de nudos formados (4.1 y 3.4; el mejor enraizamiento se observó con AIA 0.2 mg/lt formando 3.6 raíces. El enraizamiento de estacas, con brotes formados (40 y 50%, fue mayor cuando se utilizó el tercio medio y superior, tanto en agua corriente como en la solución de Knop y únicamente suplementados con AIB 25 y 50 mg/lt.

  18. Efeito de doses reduzidas de oxyfluorfen em cultivares de algodoeiro Effect of reduced oxyfluorfen rates on cotton cultivars

    Directory of Open Access Journals (Sweden)

    O.M. Yamashita

    2008-01-01

    Full Text Available O agronegócio do algodão apresenta-se, no Brasil, como uma atividade de grande importância para a economia nacional, ocupando posição de destaque no processo produtivo do Estado do Mato Grosso. Para que a cultura possa expressar o máximo potencial produtivo, é necessária a adoção de técnicas de manejo e práticas agronômicas, visando o controle das plantas daninhas. A fim de que a lavoura se mantenha limpa e livre de matocompetição, o controle químico é o método mais utilizado. Os herbicidas registrados para algodão devem ser aplicados, quando do estabelecimento da cultura, em jato dirigido. O contato desses produtos, como o oxyfluorfen, nas folhas pode incorrer em fitointoxicação e prejuízos para o produtor. O objetivo do presente trabalho foi mensurar o potencial de danos provocados pelo oxyfluorfen, quando em contato com diferentes cultivares de algodoeiro em estádio inicial de desenvolvimento. Para isso, foram avaliados cinco cultivares, tratados com 90 e 180 g ha-1 do herbicida, aplicado em plantas com 15 e 30 dias de emergência. Quanto às variáveis analisadas (fitointoxicação, altura de planta, número de folhas, massa seca de planta, foi possível observar que não houve diferença entre cultivares e que as plantas menores foram mais afetadas que as mais velhas, havendo aumento dos danos à medida que as doses eram aumentadas.Cotton agribusiness is a very important economic activity in Brazil, occupying a prominent position in the productive process of the state of Mato Grosso. For cotton crop to express its maximum productive potential, it is necessary to adopt handling techniques and agronomic practices seeking the control of weeds. For farming to stay clean and free from weed competition, chemical control is the most frequently used method. The herbicides registered for cotton crop should be applied when the culture is established in driven jet. The contact of products, such as oxyfluorfen, on the leaves may

  19. Transcriptome-wide identification of salt-responsive members of the WRKY gene family in Gossypium aridum.

    Science.gov (United States)

    Fan, Xinqi; Guo, Qi; Xu, Peng; Gong, YuanYong; Shu, Hongmei; Yang, Yang; Ni, Wanchao; Zhang, Xianggui; Shen, Xinlian

    2015-01-01

    WRKY transcription factors are plant-specific, zinc finger-type transcription factors. The WRKY superfamily is involved in abiotic stress responses in many crops including cotton, a major fiber crop that is widely cultivated and consumed throughout the world. Salinity is an important abiotic stress that results in considerable yield losses. In this study, we identified 109 WRKY genes (GarWRKYs) in a salt-tolerant wild cotton species Gossypium aridum from transcriptome sequencing data to elucidate the roles of these factors in cotton salt tolerance. According to their structural features, the predicted members were divided into three groups (Groups I-III), as previously described for Arabidopsis. Furthermore, 28 salt-responsive GarWRKY genes were identified from digital gene expression data and subjected to real-time quantitative RT-PCR analysis. The expression patterns of most GarWRKY genes revealed by this analysis are in good agreement with those revealed by RNA-Seq analysis. RT-PCR analysis revealed that 27 GarWRKY genes were expressed in roots and one was exclusively expressed in roots. Analysis of gene orthology and motif compositions indicated that WRKY members from Arabidopsis, rice and soybean generally shared the similar motifs within the same subgroup, suggesting they have the similar function. Overexpression-GarWRKY17 and -GarWRKY104 in Arabidopsis revealed that they could positively regulate salt tolerance of transgenic Arabidopsis during different development stages. The comprehensive data generated in this study provide a platform for elucidating the functions of WRKY transcription factors in salt tolerance of G. aridum. In addition, GarWRKYs related to salt tolerance identified in this study will be potential candidates for genetic improvement of cultivated cotton salt stress tolerance.

  20. Transcriptome-wide identification of salt-responsive members of the WRKY gene family in Gossypium aridum.

    Directory of Open Access Journals (Sweden)

    Xinqi Fan

    Full Text Available WRKY transcription factors are plant-specific, zinc finger-type transcription factors. The WRKY superfamily is involved in abiotic stress responses in many crops including cotton, a major fiber crop that is widely cultivated and consumed throughout the world. Salinity is an important abiotic stress that results in considerable yield losses. In this study, we identified 109 WRKY genes (GarWRKYs in a salt-tolerant wild cotton species Gossypium aridum from transcriptome sequencing data to elucidate the roles of these factors in cotton salt tolerance. According to their structural features, the predicted members were divided into three groups (Groups I-III, as previously described for Arabidopsis. Furthermore, 28 salt-responsive GarWRKY genes were identified from digital gene expression data and subjected to real-time quantitative RT-PCR analysis. The expression patterns of most GarWRKY genes revealed by this analysis are in good agreement with those revealed by RNA-Seq analysis. RT-PCR analysis revealed that 27 GarWRKY genes were expressed in roots and one was exclusively expressed in roots. Analysis of gene orthology and motif compositions indicated that WRKY members from Arabidopsis, rice and soybean generally shared the similar motifs within the same subgroup, suggesting they have the similar function. Overexpression-GarWRKY17 and -GarWRKY104 in Arabidopsis revealed that they could positively regulate salt tolerance of transgenic Arabidopsis during different development stages. The comprehensive data generated in this study provide a platform for elucidating the functions of WRKY transcription factors in salt tolerance of G. aridum. In addition, GarWRKYs related to salt tolerance identified in this study will be potential candidates for genetic improvement of cultivated cotton salt stress tolerance.

  1. Correlação entre a resposta do algodoeiro à adubação e a porcentagem de saturação em bases em vários tipos de solos do Estado de São Paulo Correlation between cotton responses to fertilizers and percentage of base saturation in soils

    Directory of Open Access Journals (Sweden)

    Milton Geraldo Fuzatto

    1966-01-01

    Full Text Available É discutido um aspecto da relação entre o efeito da adubação no algodoeiro e a análise química do solo, nas condições do Estado de São Paulo. Correlação entre a resposta à adubação e a porcentagem de saturação em bases no solo, foi verificada no estudo de 126 experimentos, conduzidos em vários tipos de solo. Uma equação polinomial de 2.° grau, descreve a correlação obtida, com um coeficiente R = 0,676xx.In this paper, the correlation between cotton responses to fertilization, and percentage of base saturation in soils, in the State of São Paulo, is discussed. A second degree polynomial, based on data collected from 126 experiments, was found to fit the data satisfactorily, with a correlation coefficient R = 0.676xx. The results indicate the possibility of estimating the effects due to fertilization in cotton crops, by use of the mentioned chemical characteristic of soils.

  2. Identification and evaluation of new reference genes in Gossypium hirsutum for accurate normalization of real-time quantitative RT-PCR data

    Directory of Open Access Journals (Sweden)

    Alves-Ferreira Marcio

    2010-03-01

    Full Text Available Abstract Background Normalizing through reference genes, or housekeeping genes, can make more accurate and reliable results from reverse transcription real-time quantitative polymerase chain reaction (qPCR. Recent studies have shown that no single housekeeping gene is universal for all experiments. Thus, suitable reference genes should be the first step of any qPCR analysis. Only a few studies on the identification of housekeeping gene have been carried on plants. Therefore qPCR studies on important crops such as cotton has been hampered by the lack of suitable reference genes. Results By the use of two distinct algorithms, implemented by geNorm and NormFinder, we have assessed the gene expression of nine candidate reference genes in cotton: GhACT4, GhEF1α5, GhFBX6, GhPP2A1, GhMZA, GhPTB, GhGAPC2, GhβTUB3 and GhUBQ14. The candidate reference genes were evaluated in 23 experimental samples consisting of six distinct plant organs, eight stages of flower development, four stages of fruit development and in flower verticils. The expression of GhPP2A1 and GhUBQ14 genes were the most stable across all samples and also when distinct plants organs are examined. GhACT4 and GhUBQ14 present more stable expression during flower development, GhACT4 and GhFBX6 in the floral verticils and GhMZA and GhPTB during fruit development. Our analysis provided the most suitable combination of reference genes for each experimental set tested as internal control for reliable qPCR data normalization. In addition, to illustrate the use of cotton reference genes we checked the expression of two cotton MADS-box genes in distinct plant and floral organs and also during flower development. Conclusion We have tested the expression stabilities of nine candidate genes in a set of 23 tissue samples from cotton plants divided into five different experimental sets. As a result of this evaluation, we recommend the use of GhUBQ14 and GhPP2A1 housekeeping genes as superior references for normalization of gene expression measures in different cotton plant organs; GhACT4 and GhUBQ14 for flower development, GhACT4 and GhFBX6 for the floral organs and GhMZA and GhPTB for fruit development. We also provide the primer sequences whose performance in qPCR experiments is demonstrated. These genes will enable more accurate and reliable normalization of qPCR results for gene expression studies in this important crop, the major source of natural fiber and also an important source of edible oil. The use of bona fide reference genes allowed a detailed and accurate characterization of the temporal and spatial expression pattern of two MADS-box genes in cotton.

  3. Identification and evaluation of new reference genes in Gossypium hirsutum for accurate normalization of real-time quantitative RT-PCR data.

    Science.gov (United States)

    Artico, Sinara; Nardeli, Sarah M; Brilhante, Osmundo; Grossi-de-Sa, Maria Fátima; Alves-Ferreira, Marcio

    2010-03-21

    Normalizing through reference genes, or housekeeping genes, can make more accurate and reliable results from reverse transcription real-time quantitative polymerase chain reaction (qPCR). Recent studies have shown that no single housekeeping gene is universal for all experiments. Thus, suitable reference genes should be the first step of any qPCR analysis. Only a few studies on the identification of housekeeping gene have been carried on plants. Therefore qPCR studies on important crops such as cotton has been hampered by the lack of suitable reference genes. By the use of two distinct algorithms, implemented by geNorm and NormFinder, we have assessed the gene expression of nine candidate reference genes in cotton: GhACT4, GhEF1alpha5, GhFBX6, GhPP2A1, GhMZA, GhPTB, GhGAPC2, GhbetaTUB3 and GhUBQ14. The candidate reference genes were evaluated in 23 experimental samples consisting of six distinct plant organs, eight stages of flower development, four stages of fruit development and in flower verticils. The expression of GhPP2A1 and GhUBQ14 genes were the most stable across all samples and also when distinct plants organs are examined. GhACT4 and GhUBQ14 present more stable expression during flower development, GhACT4 and GhFBX6 in the floral verticils and GhMZA and GhPTB during fruit development. Our analysis provided the most suitable combination of reference genes for each experimental set tested as internal control for reliable qPCR data normalization. In addition, to illustrate the use of cotton reference genes we checked the expression of two cotton MADS-box genes in distinct plant and floral organs and also during flower development. We have tested the expression stabilities of nine candidate genes in a set of 23 tissue samples from cotton plants divided into five different experimental sets. As a result of this evaluation, we recommend the use of GhUBQ14 and GhPP2A1 housekeeping genes as superior references for normalization of gene expression measures in different cotton plant organs; GhACT4 and GhUBQ14 for flower development, GhACT4 and GhFBX6 for the floral organs and GhMZA and GhPTB for fruit development. We also provide the primer sequences whose performance in qPCR experiments is demonstrated. These genes will enable more accurate and reliable normalization of qPCR results for gene expression studies in this important crop, the major source of natural fiber and also an important source of edible oil. The use of bona fide reference genes allowed a detailed and accurate characterization of the temporal and spatial expression pattern of two MADS-box genes in cotton.

  4. Overexpression of a cotton (Gossypium hirsutum) WRKY gene, GhWRKY34, in Arabidopsis enhances salt-tolerance of the transgenic plants.

    Science.gov (United States)

    Zhou, Li; Wang, Na-Na; Gong, Si-Ying; Lu, Rui; Li, Yang; Li, Xue-Bao

    2015-11-01

    Soil salinity is one of the most serious threats in world agriculture, and often influences cotton growth and development, resulting in a significant loss in cotton crop yield. WRKY transcription factors are involved in plant response to high salinity stress, but little is known about the role of WRKY transcription factors in cotton so far. In this study, a member (GhWRKY34) of cotton WRKY family was functionally characterized. This protein containing a WRKY domain and a zinc-finger motif belongs to group III of cotton WRKY family. Subcellular localization assay indicated that GhWRKY34 is localized to the cell nucleus. Overexpression of GhWRKY34 in Arabidopsis enhanced the transgenic plant tolerance to salt stress. Several parameters (such as seed germination, green cotyledons, root length and chlorophyll content) in the GhWRKY34 transgenic lines were significantly higher than those in wild type under NaCl treatment. On the contrary, the GhWRKY34 transgenic plants exhibited a substantially lower ratio of Na(+)/K(+) in leaves and roots dealing with salt stress, compared with wild type. Growth status of the GhWRKY34 transgenic plants was much better than that of wild type under salt stress. Expressions of the stress-related genes were remarkably up-regulated in the transgenic plants under salt stress, compared with those in wild type. Based on the data presented in this study, we hypothesize that GhWRKY34 as a positive transcription regulator may function in plant response to high salinity stress through maintaining the Na(+)/K(+) homeostasis as well as activating the salt stress-related genes in cells. Copyright © 2015 Elsevier Masson SAS. All rights reserved.

  5. Predawn respiration rates during flowering are highly predictive of yield response in Gossypium hirsutum when yield variability is water-induced

    Science.gov (United States)

    Respiratory carbon evolution by leaves under abiotic stress is implicated as a major limitation to crop productivity; however, respiration rates of fully expanded leaves are positively associated with plant growth rates. Given the substantial sensitivity of plant growth to drought, it was hypothesiz...

  6. Estimates of genetic parameters from line x tester mating design for some quantitative traits in upload cotton, gossypium hirsutum L

    International Nuclear Information System (INIS)

    Baloch, M.H.; Kumbher, M.B.; Jatoi, W.A.

    2008-01-01

    Combining abilities of cotton varieties were evaluated using a line x tester design with eight lines and 4 testers. Good performance combination was found between the varieties CRIS-134 and BH-147. The former was a good candidate for fibre length improvement and the latter, a good parent for yield improvement. The specific combining ability suggested that both additive and dominant genes controlled the characters. Hybrid performance per se may be used to predict the parental performance for specific combining ability and thus for hybrid crop development. (author)

  7. Screening of post emergence herbicides for weed control in cotton (GOSSYPIUM HIRSUTUM) and their effect on yield and yield components

    International Nuclear Information System (INIS)

    Hussain, N.; Khan, M.B.; Khan, M.A.; Hameed, R.A.

    2005-01-01

    Response of varying herbicides at different levels: round up 490 G/L at the rate of 4.7 L ha/sup -1/ and 1.5 L ha/sup -1/ (Glyphosat) and Gramaxone 20 EC (Paraquat) at the rate of 2.5 L ha/sup -1/ against untreated (control, were investigated to cotton cultivar CIM-473 under field conditions during Kharif 2002 at Agronomic Research Area. Central Cotton Research Institute, Multan. Significant control of weeds and increase in yield and yield contributing factors were observed. It was indicated that maximum yield and weed control were obtained by using Round up (Glyphosate) at the rate of 4.7 L ha/sup -1/ as compared to other treatments including untreated (control). Average boll weight was not significant among treatments but significant against control. Maximum net profit was obtained from Round up 490 G/L when treated at the rate of 4.7 L ha/sup -1/ than all other treatments. (author)

  8. Near-optimal response of instantaneous transpiration efficiency to vapour pressure deficit, temperature and [CO2] in cotton (Gossypium hirsutum L.).

    Science.gov (United States)

    The instantaneous transpiration efficiency (ITE, the ratio of photosynthesis rate to transpiration) is an important variable for crops, because it ultimately affects dry mass production per unit of plant water lost to the atmosphere. The theory that stomata optimize carbon uptake per unit water used...

  9. Transcriptomic analysis of fiber strength in upland cotton chromosome introgression lines carrying different Gossypium barbadense chromosomal segments.

    Directory of Open Access Journals (Sweden)

    Lei Fang

    Full Text Available Fiber strength is the key trait that determines fiber quality in cotton, and it is closely related to secondary cell wall synthesis. To understand the mechanism underlying fiber strength, we compared fiber transcriptomes from different G. barbadense chromosome introgression lines (CSILs that had higher fiber strengths than their recipient, G. hirsutum acc. TM-1. A total of 18,288 differentially expressed genes (DEGs were detected between CSIL-35431 and CSIL-31010, two CSILs with stronger fiber and TM-1 during secondary cell wall synthesis. Functional classification and enrichment analysis revealed that these DEGs were enriched for secondary cell wall biogenesis, glucuronoxylan biosynthesis, cellulose biosynthesis, sugar-mediated signaling pathways, and fatty acid biosynthesis. Pathway analysis showed that these DEGs participated in starch and sucrose metabolism (328 genes, glycolysis/gluconeogenesis (122 genes, phenylpropanoid biosynthesis (101 genes, and oxidative phosphorylation (87 genes, etc. Moreover, the expression of MYB- and NAC-type transcription factor genes were also dramatically different between the CSILs and TM-1. Being different to those of CSIL-31134, CSIL-35431 and CSIL-31010, there were many genes for fatty acid degradation and biosynthesis, and also for carbohydrate metabolism that were down-regulated in CSIL-35368. Metabolic pathway analysis in the CSILs showed that different pathways were changed, and some changes at the same developmental stage in some pathways. Our results extended our understanding that carbonhydrate metabolic pathway and secondary cell wall biosynthesis can affect the fiber strength and suggested more genes and/or pathways be related to complex fiber strength formation process.

  10. Genome-Wide Identification of R2R3-MYB Genes and Expression Analyses During Abiotic Stress in Gossypium raimondii

    Science.gov (United States)

    He, Qiuling; Jones, Don C.; Li, Wei; Xie, Fuliang; Ma, Jun; Sun, Runrun; Wang, Qinglian; Zhu, Shuijin; Zhang, Baohong

    2016-01-01

    The R2R3-MYB is one of the largest families of transcription factors, which have been implicated in multiple biological processes. There is great diversity in the number of R2R3-MYB genes in different plants. However, there is no report on genome-wide characterization of this gene family in cotton. In the present study, a total of 205 putative R2R3-MYB genes were identified in cotton D genome (Gossypium raimondii), that are much larger than that found in other cash crops with fully sequenced genomes. These GrMYBs were classified into 13 groups with the R2R3-MYB genes from Arabidopsis and rice. The amino acid motifs and phylogenetic tree were predicted and analyzed. The sequences of GrMYBs were distributed across 13 chromosomes at various densities. The results showed that the expansion of the G. Raimondii R2R3-MYB family was mainly attributable to whole genome duplication and segmental duplication. Moreover, the expression pattern of 52 selected GrMYBs and 46 GaMYBs were tested in roots and leaves under different abiotic stress conditions. The results revealed that the MYB genes in cotton were differentially expressed under salt and drought stress treatment. Our results will be useful for determining the precise role of the MYB genes during stress responses with crop improvement. PMID:27009386

  11. Differential potassium influx influences growth of two cotton varieties in hydroponics

    International Nuclear Information System (INIS)

    Ali, L.; Maqsood, M.A.; Kanwal, S.; Aziz, T.

    2010-01-01

    Potassium uptake rate of two cotton (Gossypium hirsutum L.) varieties viz., NIBGE-2 and MNH-786 was investigated in nutrient solution culture having deficient K at the rate 0.3 mM and deficient K+ Na at the rate 0.3 +2.7 mM. Depletion of K from solution was monitored over a period of 24 h at regular time intervals after 0, 0.5, 1.0, 1.5, 2, 3, 4, 5, 6, 8, 10, 12 and 24 h to estimate K uptake kinetics of the roots i.e. maximum influx, I/sub max/ and the Michaelis-Menten constant, Km. NIBGE-2 had about 2-fold higher (2.0 mg g rdw-1 hr-1) I/sub max/ value for K uptake rate at deficient K+Na than that (1.207 mg g rdw-1 hr-1) for MNH-786. Higher, Michaelis-Menten constant, Km (12.82 ppm) for K uptake rate was observed in both cultivars NIBGE-2 and MNH-786 at deficient K+Na than that at deficient K. Main effects of treatments and varieties had significant (p< 0.05) effect on shoot dry matter, root dry matter, total dry matter and leaf area per plant. Maximum K influx in NIBGE-2 at deficient K and deficient K +Na was attributed to enhanced growth response as compared to that in MNH-786. (author)

  12. Inoculant of arbuscular mycorrhizal fungi (Rhizophagus clarus increase yield of soybean and cotton under field conditions

    Directory of Open Access Journals (Sweden)

    Martha Viviana Torres Cely

    2016-05-01

    Full Text Available Nutrient availability is an important factor in crop production, and regular addition of chemical fertilizers is the most common practice to improve yield in agrosystems for intensive crop production. The use of some groups of microorganisms that have specific activity providing nutrients to plants is a good alternative, and arbuscular mycorrhizal fungi (AMF enhance plant nutrition by providing especially phosphorus (P, improving plant growth and increasing crop production. Unfortunately, the use of AMF as an inoculant on a large scale is not yet widely used, because of several limitations in obtaining a large amount of inoculum due to several factors, such as low growth, the few species domesticated under in vitro conditions, and high competition with native AMF. The objective of this work was to test the infectivity of a Rhizophagus clarus inoculum and its effectiveness as an alternative for P supply in soybean (Glycine max L. and cotton (Gossypium hirsutum L.. The experiments were carried out in plots and the treatments were: Fertilizer; AMF, AMF + Fertilizer and AMF + ½ Fertilizer; non-inoculated and non-fertilized plants were considered the control. The parameters evaluated were AMF root colonization and effect of inoculation on plant growth and yield under a field conditions. The results showed that AMF inoculation increased the effect of fertilizer application in soybean, and that in cotton R. clarus was more effective than chemical fertilizer

  13. Carbon partitioning and export from mature cotton leaves

    International Nuclear Information System (INIS)

    Hendrix, D.L.; Grange, R.I.

    1991-01-01

    The partitioning of carbon in intact, mature cotton (Gossypium hirsutum L.) leaves was examined by steady-state 14 CO 2 labeling. Plants were exposed to dark periods of varying lengths, followed by similar illuminated labeling periods. These treatments produced leaves with a range of starch and soluble sugar contents, carbon exchange, and carbon export rates. Export during the illuminated periods was neither highly correlated with photosynthesis nor was export during the illuminated periods significantly different among the treatments. In contrast, the rate of subsequent nocturnal carbon export from these leaves varied widely and was found to be highly correlated with leaf starch content at the end of the illumination period and with nocturnal leaf respiration. Leaves which had accumulated the highest levels of starch (about 275 micrograms per square centimeter) by the end of the illumination period exhibited nocturnal export rates very similar to those during the daylight hours. Leaves which accumulated starch to only 50 to 75 micrograms per square centimeter virtually ceased nocturnal carbon export. For leaves with starch accumulations of between 50 and 275 micrograms per square centimeter, nocturnal export was directly proportional to leaf starch at the end of the illumination period. After the nocturnal export rate was established, it continued at a constant rate throughout the night even though leaf starch and sucrose contents declined

  14. Flavonoid biosynthesis controls fiber color in naturally colored cotton

    Directory of Open Access Journals (Sweden)

    Hai-Feng Liu

    2018-04-01

    Full Text Available The existence of only natural brown and green cotton fibers (BCF and GCF, respectively, as well as poor fiber quality, limits the use of naturally colored cotton (Gossypium hirsutum L.. A better understanding of fiber pigment regulation is needed to surmount these obstacles. In this work, transcriptome analysis and quantitative reverse transcription PCR revealed that 13 and 9 phenylpropanoid (metabolic pathway genes were enriched during pigment synthesis, while the differential expression of phenylpropanoid (metabolic and flavonoid metabolic pathway genes occurred among BCF, GCF, and white cotton fibers (WCF. Silencing the chalcone flavanone isomerase gene in a BCF line resulted in three fiber phenotypes among offspring of the RNAi lines: BCF, almost WCF, and GCF. The lines with almost WCF suppressed chalcone flavanone isomerase, while the lines with GCF highly expressed the glucosyl transferase (3GT gene. Overexpression of the Gh3GT or Arabidopsis thaliana 3GT gene in BCF lines resulted in GCF. Additionally, the phenylpropanoid and flavonoid metabolites of BCF and GCF were significantly higher than those of WCF as assessed by a metabolomics analysis. Thus, the flavonoid biosynthetic pathway controls both brown and green pigmentation processes. Like natural colored fibers, the transgenic colored fibers were weaker and shorter than WCF. This study shows the potential of flavonoid pathway modifications to alter cotton fibers’ color and quality.

  15. Carbohydrate production and transport in cotton cultivars grown under boron deficiency

    Directory of Open Access Journals (Sweden)

    Julio Cesar Bogiani

    2013-12-01

    Full Text Available An adequate supply of boron (B is required for the optimal growth and development of cotton (Gossypium hirsutum L. plants, but the low phloem mobility of B limits the possibilities of correcting B deficiency. There are indications that different cotton cultivars could have different responses to B deficiency. The differences in responses of cotton cultivars to B regarding photoassimilate production and transport were studied in a greenhouse experiment with nutrient solution. Treatments consisted of three cotton cultivars (FMT 701, DP 604BG and FMX 993 and five concentrations of B (0.0, 2.5, 5.0, 10.0 and 20.0 µmol L−1. Sampling began at the phenological stage B1 (first square and continued for four weeks. The leaf area and the number of reproductive branches and structures decreased due to B deficiency. A higher level of abortion of reproductive structures was observed under B deficiency. Boron deficiency increased the internal CO2 concentration but decreased the transpiration rate, stomatal conductance and photosynthesis. Despite the decrease in photosynthesis, nonstructural carbohydrates accumulated in the leaves due to decreased export to bolls in B-deficient plants. The response to B deficiency is similar among cotton cultivars, which shows that the variability for this trait is low even for cultivars with different genetic backgrounds.

  16. Carbon partitioning and export from mature cotton leaves.

    Science.gov (United States)

    Hendrix, D L; Grange, R I

    1991-01-01

    The partitioning of carbon in intact, mature cotton (Gossypium hirsutum L.) leaves was examined by steady-state (14)CO(2) labeling. Plants were exposed to dark periods of varying lengths, followed by similar illuminated labeling periods. These treatments produced leaves with a range of starch and soluble sugar contents, carbon exchange, and carbon export rates. Export during the illuminated periods was neither highly correlated with photosynthesis nor was export during the illuminated periods significantly different among the treatments. In contrast, the rate of subsequent nocturnal carbon export from these leaves varied widely and was found to be highly correlated with leaf starch content at the end of the illumination period (r = 0.934) and with nocturnal leaf respiration (r = 0.954). Leaves which had accumulated the highest levels of starch (about 275 micrograms per square centimeter) by the end of the illumination period exhibited nocturnal export rates very similar to those during the daylight hours. Leaves which accumulated starch to only 50 to 75 micrograms per square centimeter virtually ceased nocturnal carbon export. For leaves with starch accumulations of between 50 and 275 micrograms per square centimeter, nocturnal export was directly proportional to leaf starch at the end of the illumination period. After the nocturnal export rate was established, it continued at a constant rate throughout the night even though leaf starch and sucrose contents declined.

  17. Flight attraction of Spodoptera littoralis (Lepidoptera, Noctuidae to cotton headspace and synthetic volatile blends

    Directory of Open Access Journals (Sweden)

    Felipe eBorrero-Echeverry

    2015-06-01

    Full Text Available The insect olfactory system discriminates odor signals of different biological relevance, which drive innate behavior. Identification of stimuli that trigger upwind flight attraction towards host plants is a current challenge, and is essential in developing new, sustainable plant protection methods, and for furthering our understanding of plant-insect interactions. Using behavioral, analytical and electrophysiological studies, we here show that both females and males of the Egyptian cotton leafworm, Spodoptera littoralis (Lepidoptera, Noctuidae, use blends of volatile compounds to locate their host plant, cotton, Gossypium hirsutum (Malvales, Malvaceae. Female S. littoralis were engaged in upwind orientation flight in a wind tunnel when headspace collected from cotton plants was delivered through a piezoelectric sprayer. Although males took off towards cotton headspace significantly fewer males than females flew upwind towards the sprayed headspace. Subsequent assays with antennally active synthetic compounds revealed that a blend of nonanal, (Z-3 hexenyl acetate, (E-β-ocimene, and (R-(+-limonene was as attractive as cotton headspace to females and more attractive to males. DMNT and (R-(--linalool, both known plant defense compounds may have reduced the flight attraction of both females and males; more moths were attracted to blends without these two compounds. Our findings provide a platform for further investigations on host plant signals mediating innate behavior, and for the development of novel insect plant protection strategies against S. littoralis.

  18. Analysis of flavonoids and the flavonoid structural genes in brown fiber of upland cotton.

    Directory of Open Access Journals (Sweden)

    Hongjie Feng

    Full Text Available BACKGROUND: As a result of changing consumer preferences, cotton (Gossypium Hirsutum L. from varieties with naturally colored fibers is becoming increasingly sought after in the textile industry. The molecular mechanisms leading to colored fiber development are still largely unknown, although it is expected that the color is derived from flavanoids. EXPERIMENTAL DESIGN: Firstly, four key genes of the flavonoid biosynthetic pathway in cotton (GhC4H, GhCHS, GhF3'H, and GhF3'5'H were cloned and studied their expression profiles during the development of brown- and white cotton fibers by QRT-PCR. And then, the concentrations of four components of the flavonoid biosynthetic pathway, naringenin, quercetin, kaempferol and myricetin in brown- and white fibers were analyzed at different developmental stages by HPLC. RESULT: The predicted proteins of the four flavonoid structural genes corresponding to these genes exhibit strong sequence similarity to their counterparts in various plant species. Transcript levels for all four genes were considerably higher in developing brown fibers than in white fibers from a near isogenic line (NIL. The contents of four flavonoids (naringenin, quercetin, kaempferol and myricetin were significantly higher in brown than in white fibers and corresponding to the biosynthetic gene expression levels. CONCLUSIONS: Flavonoid structural gene expression and flavonoid metabolism are important in the development of pigmentation in brown cotton fibers.

  19. Intracellular localization of phosphatidylcholine and phosphatidylethanolamine synthesis in cotyledons of cotton seedlings

    International Nuclear Information System (INIS)

    Chapman, K.D.; Trelease, R.N.

    1991-01-01

    Subfractionation of clarified cotyledon homogenates of cotton (Gossypium hirsutum L.) seedlings on sucrose gradients revealed a single coincident peak of cholinephosphotransferase (CPT) and ethanolaminephosphotransferase (EPT) activities, which equilibrated with the main peak of Anti-mycin A-insensitive NADH: cytochrome c reductase (CCR) activity. The small percentage of CPT and EPT activities in glyoxysome-enriched pellets equilibrated with cytochrome c oxidase activity, not with catalase activity. Preincubation of microsomes in 0.2 millimolar MgCl 2 followed by subfractionation on sucrose gradients resulted in peak CPT and EPT activities equilibrating with peak CCR activity at 24% (w/w) sucrose. Preincubation of microsomes with 14 C-CCP choline (or 14 C-CDPethanolamine) resulted in synthesis and incorporation of 14 C-phosphatidylcholine (PC) (or 14 C-phosphatidylethanolamine, PE) into membranes at the same density. Increasing the Mg 2+ concentration to 2.0 millimolar facilitated binding of ribosomes and caused a concomitant shift in density (to 34% w/w sucrose) of peak CPT, EPT, and CCR activities. under these conditions, newly synthesized and incorporated 14 C-PC (or PE) was recovered in these membranes. These results indicate that Er in cotyledons of germinated cotton seedlings is the primary subcellular site of PC and PE synthesis. This is similar to the situation in endosperm tissue but distinctly different from root and hypocotyl tissue where Golgi are a major subcellular site of PC and PE synthesis

  20. Case Study: Trap Crop with Pheromone Traps for Suppressing Euschistus servus (Heteroptera: Pentatomidae in Cotton

    Directory of Open Access Journals (Sweden)

    P. G. Tillman

    2012-01-01

    Full Text Available The brown stink bug, Euschistus servus (Say, can disperse from source habitats, including corn, Zea mays L., and peanut, Arachis hypogaea L., into cotton, Gossypium hirsutum L. Therefore, a 2-year on-farm experiment was conducted to determine the effectiveness of a sorghum (Sorghum bicolor (L. Moench spp. bicolor trap crop, with or without Euschistus spp. pheromone traps, to suppress dispersal of this pest to cotton. In 2004, density of E. servus was lower in cotton fields with sorghum trap crops (with or without pheromone traps compared to control cotton fields. Similarly, in 2006, density of E. servus was lower in cotton fields with sorghum trap crops and pheromone traps compared to control cotton fields. Thus, the combination of the sorghum trap crop and pheromone traps effectively suppressed dispersal of E. servus into cotton. Inclusion of pheromone traps with trap crops potentially offers additional benefits, including: (1 reducing the density of E. servus adults in a trap crop, especially females, to possibly decrease the local population over time and reduce the overwintering population, (2 reducing dispersal of E. servus adults from the trap crop into cotton, and (3 potentially attracting more dispersing E. servus adults into a trap crop during a period of time when preferred food is not prevalent in the landscape.