Valik arvamusi läbi aastate / Ain-Elmar Kaasik
Kaasik, Ain-Elmar, 1934-
2008-01-01
Valik Eesti Teaduste Akadeemia Aastaraamatus rubriigis "Arvamusi akadeemikutelt" ilmunud kirjutisi, kus vabas vormis käsitletakse mitmesuguseid aktuaalseid küsimusi, eelkõige hariduse, teadustöö ning ühiskonna suhteid. Kokku on rubriigis avaldatud ligi kaks ja poolsada kirjutist. Siinse valiku autoriteks akadeemikud Raimund Hagelberg, Mart Saarma, Boris Tamm, Ene Ergma, Arvo Krikmann, Agu Laisk, Hans-Voldemar Trass, Harald Keres, Anto Raukas, Rein Küttner, Enn Tõugu, Raimund-Johannes Ubar, Ain-Elmar Kaasik
Katrin Pudersell kaitses farmaatsiadoktori väitekirja / Ain Raal, Elmar Arak
Raal, Ain, 1961-
2006-01-01
3. mail 2006 kaitses farmaatsiamagister Tartu Ülikooli arstiteaduskonna nõukogu ees doktoriväitekirja "Tropaanalkaloidide ja riboflaviini produktsioon koera-pöörirohu (Hyoscyamus niger L.) põllu- ja koekultuurides
Ajakiri LibeRaal Tartine esitleb uut numbrit / Marju Himma
Himma, Marju
2009-01-01
Esitletakse Tartu Kultuuritehase liberaalset kultuuriajakirja LibeRaal Tartine, mis on tasuta leitav nii internetist kui ka 200-eksemplaris trükitult. Selle väljaandmiseks on programm Euroopa Noored andnud 75 000 krooni. Ajakirja plaanitakse välja anda maikuu lõpuni. Veebiaadress http://web.zone.ee/LibeRaalTartine/
Teadmiste lõikepunkt : intervjuu Elmar Mittleriga / Elmar Mittler ; küsitlenud Katrin Kaugver
Mittler, Elmar
2008-01-01
Intervjuu Euroopa Teadusraamatukogude Konsortsiumi (CERL) esimehe ning Göttingeni Riigi- ja Ülikooliraamatukogu endise direktori Elmar Mittleriga, kes oli TLÜAR-i külaline ning pidas Tallinnas loengu "Libraries as worldwide infrastructures for open access"
Elmar sai 10! Laulev kokk avas Eesti suurima restorani
2007-01-01
Eesti muusikat mängiv raadiojaam Elmar pidas sünnipäeva Tallinnas, Tartus ja Pärnus. 3. dets. avati Tallinnas Ülemiste City's Mercado kompleks (omanikuks kokk Imre Kose), esinesid Koit Toome ja Chalice
Tunne Kelam - kolleeg ja sõber / Christopher Beazley, Elmar Bork, Ari Vatanen ...[jt.
2009-01-01
Euroopa Parlamendi väliskomisjoni liikmed Christopher Beazley, Elmar Bork, Ari Vatanen, Leedu Vabariigi president Valdas Adamkus, Euroopa Parlamendi asepresident Alejo Vidal-Quadras ja Euroopa Parlamendi president Hans-Gert Pöttering Tunne Kelamist
Vil! Elmar Õun jr 2010. aasta visiidid Tallinna ja Keilasse / Tõnu Tooming
Tooming, Tõnu
2010-01-01
Korporatsiooni Fraternitas Liviensis Rootsis elava kaasvenna külaskäigust Eestisse. Keila linna päevadel anti Elmar Õunale üle linna teenetemärk sõprussuhete loomise ja hoidmise eest Keila ja Nacka linna vahel
Kibuvits üllatab ja pakub leevendust / Ain Raal
Raal, Ain, 1961-
2005-01-01
Taani teadlased avastasid-eraldasid kibuvitsaseemnetest ja viljakestadest uue põletikuvastase toimeaine galaktolipiidi (GOPO). Seda lipiidi sisaldub kõige enam koer-kibuvitsa alamliigis Hyben Vital Litos. Nüüdseks on GOPO saamisviis ja nimi patenteeritud nii Euroopas kui ka USAs
Ain Kivisaar : äärelinn pole kvaliteetne investeering / Ain Kivisaar ; interv. Enn Tosso
Kivisaar, Ain, 1978-
2007-01-01
Ilmunud ka: Delovõje Vedomosti : Nedvizhimost 24. okt. lk. 2-3. Küsimustele kinnisvaraturu olukorra ja investeeringute kohta vastab Metro Capital Managementi finantsjuht Ain Kivisaar. CV: Ain Kivisaar
Energy Technology Data Exchange (ETDEWEB)
Cho, Sung Chul; Han, Jun Hyun [Chungnam National University, Daejeon (Korea, Republic of); Ko, Se-Hyun [Korea Institute of Industrial Technology, Incheon (Korea, Republic of); Kim, Hye Sung [Pusan National University, Miryang (Korea, Republic of); Han, Jun Hyun [Korea Institute of Science and Technology, Seoul (Korea, Republic of)
2015-12-15
AIN/Cu composite powders with a core-shell structure were synthesized by a new technique using electroless plating of Cu on AIN particles and consolidated by spark plasma sintering (SPS). Dependence of the thermal conductivity and coefficient of thermal expansion (CTE) of the AIN/Cu composites on the particle size of AIN were studied. The thermal conductivity and coefficient of thermal expansion were significantly dependent on the existence of both boundary pores surrounding the Cu-coated AIN particles and the internal pores of the AIN particles. In order to eliminate the pores, the temperature and pressure of SPS were increased and the AIN particles were heat-treated at high temperature. Adoption of the core-shell AIN/Cu composite powders facilitated the fabrications of AIN/Cu composites with low porosity and uniform distribution in the AIN in Cu matrix.
Põder, Thomas-Andreas, 1976-
2008-01-01
Ülevaade Tartu Ülikoolis ja Tallinnas EELK Usuteaduse Instituudis 9.-10.05 2008 toimunud teoloog Elmar Salumaa 100. sünnipäeva tähistamisele pühendatud konverentsi ettekannetest ja diskussioonidest
Alvela, Ain, 1967-
2011-01-01
Eesti Arengufondi juhatuse esimehe Ott Pärna, ASi Kalev Chocolate Factory juhataja Kaido Kaare ja ASi Balsnack International Holding juhatuse esimehe Elmar Rusingu ettekannetest toiduainetööstuse aastakonverentsil "Uue tõusu ootuses". Graafik
Profilaxis de la úlcera gastrointestinal producida por AINES
Directory of Open Access Journals (Sweden)
Carlos Bustamante Rojas
1998-04-01
Full Text Available Como grupo, los AINES son los fármacos más frecuentemente relacionados con informes acerca de Reacciones Adversas en varios países, se considera que más de 30 millones de personas en el mundo toman a diario AINES por prescripción médica o por autoprescripción y que un alto porcentaje de dichas personas corresponden al grupo de edad mayor de 60 años. Diversos metaanálisis revelan que el riesgo de presentar eventos gastrointestinales graves en consumidores regulares de AINES puede ser de 3 a 4 veces mayor que en no usuarios al cabo de 30 dias y que dicho riesgo relativo estimado puede elevarse a 5.5 en pacientes ancianos (7 y a valores cercanos a 8.0 cuando se usan altas dosis del AINE (I, 8. También se ha relacionado el empleo crónico de AINES con un aumento en la mortalidad en ancianos.
Baudelaire Eestis : märkmeid. III / Ain Kaalep
Kaalep, Ain, 1926-
2004-01-01
Ants Orase loodud eesti aleksandriinist. Artiklis tuuakse välja Charles Baudelaire luuletuse "Correspondances" eri tõlked (Ants Oras, Ain Kaalep) ja luuletuse "Le rêve d'un curieux" tõlked (Ilmar Laaban, Ain Kaalep)
Baudelaire Eestis : märkmeid. III / Ain Kaalep
Kaalep, Ain, 1926-
2013-01-01
Ants Orase loodud eesti aleksandriinist. Artiklis tuuakse välja Charles Baudelaire luuletuse "Correspondances" eri tõlked (Ants Oras, Ain Kaalep) ja luuletuse "Le rêve d'un curieux" tõlked (Ilmar Laaban, Ain Kaalep)
African Journals Online (AJOL)
Hamaidi-Chergui F, Brahim Errahmani M, Debib A, Hamaidi M.S
2016-05-01
May 1, 2016 ... Water from boreholes in Arib (Ain Defla) was investigated to ... of 100 ml is drawn through a membrane filter (0.45 μm pore size) using a vacuum pump. The .... boreholes are very important as clean and hygienic environment ...
Electronic structure and optical properties of AIN under high pressure
International Nuclear Information System (INIS)
Li Zetao; Dang Suihu; Li Chunxia
2011-01-01
We have calculated the electronic structure and optical properties of Wurtzite structure AIN under different high pressure with generalized gradient approximation (GGA) in this paper. The total energy, density of state, energy band structure and optical absorption and reflection properties under high pressure are calculated. By comparing the changes of the energy band structure, we obtained AIN phase transition pressure for 16.7 GPa, which is a direct band structure transforming to an indirect band structure. Meanwhile, according to the density of states distribution and energy band structure, we analyzed the optical properties of AIN under high-pressure, the results showed that the absorption spectra moved from low-energy to high-energy. (authors)
Oxidation behaviour of Ti2AIN films composed mainly of nanolaminated MAX phase.
Wang, Q M; Garkas, W; Renteria, A Flores; Leyens, C; Kim, K H
2011-10-01
In this paper, we reported the oxidation behaviour of Ti2AIN films on polycrystalline Al2O3 substrates. The Ti2AIN films composed mainly of nanolaminated MAX phase was obtained by first depositing Ti-Al-N films using reactive sputtering of two elemental Ti and Al targets in Ar/N2 atmosphere and subsequent vacuum annealing at 800 degrees C for 1 h. The Ti2AIN films exhibited excellent oxidation resistance and thermal stability at 600-900 degrees C in air. Very low mass gain was observed. At low temperature (600 degrees C), no oxide crystals were observed on film surface. Blade-like Theta-Al2O3 fine crystals formed on film surfaces at 700-800 degrees C. At high temperature (900 degrees C), firstly Theta-Al2O3 formed on film surface and then transformed into alpha-Al2O3. At 700-900 degrees C, a continuous Al2O3 layer formed on Ti2AIN films surface, acting as diffusion barrier preventing further oxidation attack. The mechanism of the excellent oxidation resistance of Ti2AIN films was discussed based on the experimental results.
Ain Hanschmidt jättis küsijad vastuseta / Andrus Karnau
Karnau, Andrus
2005-01-01
Ühispanga endise juhi Ain Hanschmidti 26. septembri pöördumine ei andnud vastuseid tema äritehingutega seoses esile kerkinud olulistele küsimustele: mille eest ta sai osalused laevakompaniis Tallink Grupp ja Haapsalu HRM-is. Lisa: Ain Hanschmidti argumendid. Küsimusele, kas Hanschmidti seletused olid piisavad vastavad Eesti Investorite Liidu juhatuse liige Heldur Meerits ja Sillamäe Soojuselektrijaama juhataja Väino Sarnet
Põhikooli ainesõnastikud / Heiki Jaan Kaalep, Jaan Mikk
Kaalep, Heiki-Jaan, 1962-
2008-01-01
Eesti vene õppekeelega koolidele keskastme ainesõnastike loomise konkursi tulemustest, kirjeldatakse koostatud sõnastike eesmärke ja kirjestruktuuri, samuti loomisprotsessi etappe. Vaadeldakse ka morfoloogiaalase tarkvara kasutamisvõimalusi sõnastiku loomisel
HPV infection, anal intra-epithelial neoplasia (AIN and anal cancer: current issues
Directory of Open Access Journals (Sweden)
Stanley Margaret A
2012-09-01
Full Text Available Abstract Background Human papillomavirus (HPV is well known as the major etiological agent for ano-genital cancer. In contrast to cervical cancer, anal cancer is uncommon, but is increasing steadily in the community over the last few decades. However, it has undergone an exponential rise in the men who have sex with men (MSM and HIV + groups. HIV + MSM in particular, have anal cancer incidences about three times that of the highest worldwide reported cervical cancer incidences. Discussion There has therefore traditionally been a lack of data from studies focused on heterosexual men and non-HIV + women. There is also less evidence reporting on the putative precursor lesion to anal cancer (AIN – anal intraepithelial neoplasia, when compared to cervical cancer and CIN (cervical intraepithelial neoplasia. This review summarises the available biological and epidemiological evidence for HPV in the anal site and the pathogenesis of AIN and anal cancer amongst traditionally non-high risk groups. Summary There is strong evidence to conclude that high-grade AIN is a precursor to anal cancer, and some data on the progression of AIN to invasive cancer.
Fabrication and performance of AIN insulator coatings for application in fusion reactor blankets
International Nuclear Information System (INIS)
Natesan, K.
1995-09-01
The liquid-metal blanket concept for fusion reactors requires an coating on the first-wall structural material to minimize the magnetohydrodynamic pressure drop that occurs during the flow of liquid metal in a magnetic field. Based on the thermodynamics of interactions betwen the coating and the liquid lithium on one side and the structural V-base alloy on the other side, an AIN coating was selected as a candidate. Detailed investigations were conducted on the fabrication, metallurgical microstructure, compatibility in liquid Li, and electrical characteristics of AIN material obtained from several sources. Lithium compatibility was studied in static systems by exposing AIN-coated specimens to liquid Li for several time periods. Electrical resistance was measured at room temperature on the specimens before and after exposure to liquid Li. The results obtained in this study indicate that AIN is a viable coating from the standpoint of chemical compatibility in Li, electrical insulation, and ease of fabrication; for these reasons, the coating should be examined further for fusion reactor applications
Dozhivjom do võborov / Ain Seppik ; interv. Tatjana Opekina
Seppik, Ain, 1952-
2007-01-01
Riigikogu liige vastab küsimustele, mis puudutavad Keskerakonna poliitikat, parlamendivalimisi, aprillisündmusi, korruptsiooni, riigieelarvet. Ain Seppik leiab, et Keskerakonna missiooniks on arendada riiki ja kaitsta nõrku
F-type centers in neutron-irradiated AIN
International Nuclear Information System (INIS)
Atobe, Kozo; Honda, Makoto; Fukuoka, Noboru; Okada, Moritami; Nakagawa, Masuo.
1990-01-01
The production of point defects by neutron irradiation and thermal decay in sintered AIN polycrystal are investigated. The absorption band at 370 nm is observed after reactor neutron irradiation to a dose of 10 16 n/cm 2 (E > 0.1 MeV). The defect corresponding to the band is tentatively assigned as an F-type center from the optical absorption and electron spin resonance. (author)
Leaky surface acoustic waves in Z-LiNbO3 substrates with epitaxial AIN overlays
International Nuclear Information System (INIS)
Bu, G.; Ciplys, D.; Shur, M.S.; Namkoong, G.; Doolittle, W.A.; Hunt, W.D.
2004-01-01
The properties of leaky surface acoustic waves (LSAW) in MBE grown AIN layer on Z-cut LiNbO 3 structures have been studied by numerical simulation and experimental measurements and compared with those of Rayleigh waves in the same structure. In the range of AIN layer thicknesses studied (0 3 substrate was essentially constant at around 4400 m/s. The measured electromechanical coupling coefficients (K 2 ) for the LSAW are roughly 1/4 of the predicted values, which might be due to the strong attenuation of the leaky wave unaccounted for during the parameter extraction. The thin AIN film slightly improved the measured temperature coefficient of frequency for the LSAW over that attained for the Z-cut, X-propagating LiNbO 3 substrate alone
Kurja lilled / Charles Baudelaire ; prantsuse k. tlk. Ain Kaalep ja Märt Väljataga
Baudelaire, Charles
2000-01-01
Sisu: Õnnistamine ; "Jumaldan Sind ma siin, öist taevavõlvi nägev / tlk. Ain Kaalep ; Palkon / tlk. Märt Väljataga ; Kodukäija ; Kassid / tlk. A. Kaalep ; Armastades valet / tlk. M. Väljataga ; Üksildase vein ; Päeva lõpp / tlk. Ain Kaalep. Orig.: Bénédiction ; "Je t'adore ̉ l'égal de la vo͠te nocturne ; Le balcon ; Les chats ; L'amour du mensonge ; Le vin du solitaire ; La fin de la journée
ISO sertifikaat kuulutab tootja mainet üle maailma / Ain Alvela
Alvela, Ain, 1967-
2006-01-01
Ilmunud ka: Delovõje Vedomosti 12. apr. lk. 24-25. ISO standardi rakendamine tagab toodangu kvaliteedi ja annab firmale usaldusväärsuse. Kommenteerib Ain Noormägi. Vt. samas: ISO 9001; ISO 14 001; Universaalne standard kohandub ettevõtte vajadustega
Farias Santos, Juliana; Suruagy Amaral, Monique; Lima Oliveira, Suzana; Porto Barbosa, Júnia; Rego Cabral, Cyro; Sofia Melo, Ingrid; Bezerra Bueno, Nassib; Duarte Freitas, Johnatan; Goulart Sant'ana, Antônio; Rocha Ataíde, Terezinha
2015-05-01
There are several standard diets for animals used in scientific research, usually conceived by scientific institutions. The AIN-93 diet is widely used, but there are some reports of fatty liver in Wistar rats fed this diet. We aimed to evaluate the hepatic repercussions of the AIN-93 diet intake in Wistar rats. Forty newly-weaned 21-day-old male Wistar rats were fed either the AIN-93 diet or a commercial diet for either 1 month or 4 months. Weight gain, serum biochemistry, hepatic histology, and hepatic fatty acid profile were analyzed. Hepatic steatosis was observed, especially in the group fed the AIN-93 diet. Serum blood glucose, absolute and relative liver weight and hepatic levels of oleic, palmitoleic, stearic, and palmitic fatty acids were related to the observed steatosis, while lipidogram and serum markers of liver function and injury were not. AIN-93 diet induced acute hepatic steatosis in Wistar rats, which may compromise its use as a standard diet for experimental studies with rodents. The hepatic fatty acid profile was associated with steatosis, with possible implications for disease prognosis. Copyright AULA MEDICA EDICIONES 2014. Published by AULA MEDICA. All rights reserved.
Keila Tervisekeskus. Ujula = Keila Health Club. Swimming Pool / Ain Padrik
Padrik, Ain, 1947-
2001-01-01
Projekteerija: Arhitektuuribüroo Künnapu & Padrik. Arhitektid Ain Padrik ja Kristi Alamaa, sisearhitekt Sirje Männik. Konstruktsioonid: Jaan Laks, A-Grupp. Ujulas on võistlus- ja lastebassein, suvel on avatud välibassein. 5 ill.: I korruse plaan, ristlõige, vaated
Tumedad ained kirjanduses ja päriselt / Mare Müürsepp
Müürsepp, Mare
2007-01-01
Analüüsitud on Philip Pullmani triloogiasse "Tema tumedad ained" kuuluvaid romaane : Pullman, Philip. Kuldne kompass. Tallinn : Tiritamm, 2002; Pullman, Philip. Inglite torn. Tallinn : Tiritamm, 2004; Pullman, Philip. Vaigust kiiker. Tallinn : Tiritamm, 2005
Directory of Open Access Journals (Sweden)
Ferrán Catalá-López
2014-09-01
Conclusiones: Existe poca evidencia para sugerir que alguno de los AINE estudiados es seguro en términos de riesgo cardiovascular. Naproxeno parece ser menos perjudicial que el resto. El riesgo cardiovascular asociado al uso de AINE debe ser tenido en cuenta en la prescripción de cualquiera de estos medicamentos.
Poolsajandi õnnesoovid Jaak Aaviksoole / Ain Heinaru, Jaak Kangilaski, Tõnu Lehtsaar...[jt.
2004-01-01
Mõtteid Tartu Ülikooli rektorist tema 50. sünnipäeva puhul : Ain Heinaru, Jaak Kangilaski, Tõnu Lehtsaar, Indrek Reimand, Toomas Kiho, Leelo Kriisa, Peeter Olesk, Risto Tammelo, Birute Klaas, Peeter Saari, Andrus Ansip, Mait Klaassen, Marika Kullamaa, Kaupo Bend
The Scientific Method Ain't What It Used to Be
Herreid, Clyde Freeman
2010-01-01
Remember the time when all you had to do was memorize these five steps: ask a question, formulate a hypothesis, perform experiment, collect data, and draw conclusions? And you received full credit for defining the scientific method. Well, those days are gone. This article discusses why the "scientific method ain't what it used to be." (Contains 2…
Fiedler, John L; Villalobos, Carlos A; De Mattos, Annette C
2008-11-01
The Honduras AIN-C programme is a preventive health and nutrition programme of the Honduras Ministry of Health (MOH) that relies on volunteers to help mothers monitor and maintain the adequate growth of young children. A quasi-experimental, design-based evaluation found that the programme achieved near-universal coverage and was effective in improving mothers' child-rearing knowledge, attitudes and practices, including feeding and appropriate care-giving and care-seeking practices for children with diarrhoea and acute respiratory illness. The programme is widely regarded as a model. This study was undertaken to provide the first comprehensive estimates of the cost of the AIN-C programme, with the goal of providing a programme and financial planning tool for Honduras. An additional comparison of study findings was also undertaken to determine the cost of the AIN-C programme's community-based services relative to a similar facility-based service. Expressed in mid-2005 US dollars, the study found that after the programme is phased-in: (1) the annual, recurrent cost per child under 2 years participating in the programme is $6.43; (2) the annual, incremental budget requirements per child under 2 years participating in the programme are $3.90; (3) the cost of an AIN-C monthly growth monitoring and counselling session per child is 11% of the cost of a traditional MOH, facility-based growth and development consultation per child; and (4) the effect of mothers substituting AIN-C monitor care for MOH facility-based care 'saves' 203 000 outpatient visits a year, with a potential cost saving of $1.66 million, the equivalent of 60% of the recurrent cost of the programme and roughly equal to the annual incremental budget requirements of the programme. Sensitivity analysis of the cost estimates is performed to provide insight, for countries considering introducing a similar programme, into how modifications of key characteristics of the programme affect its costs.
Directory of Open Access Journals (Sweden)
Augusto García-Poma
2007-03-01
Full Text Available Objetivo: Evaluar la terapia con pamidronato, en pacientes con espondilitis anquilosante (EA activa, con respuesta subóptima o falla a los antiinflamatorios no-esteroideos (AINES y sulfasalazina. Diseño: Estudio clínico comparativo. Lugar: Hospital Nacional Edgardo Rebagliati Martins, EsSalud, Lima, Perú. Participantes: Pacientes con espondilitis anquilosante. Intervenciones. Se incluyó 9 pacientes con EA (6 varones, con enfermedad activa (BASDAI > o = 4, actividad axial y falta de respuesta a los Aines y sulfasalazina a dosis de 3g/d. Todos los pacientes recibieron 60 mg de pamidronato mensual, en infusión endovenosa, durante 6 meses, y continuaron tomando AINES y sulfasalazina. La mejoría clínica fue evaluada usando el ASAS 20. En forma secundaria se evaluó el ASAS 40, BASDAI 50, BASDAI, BASFI Y BASMI, a las 24 y 48 semanas (32 a 86 semanas. La diferencia entre el índice de pre y postratamiento fue evaluada usando la prueba de Wilcoxon. Principales medidas de resultados: Evaluación del ASAS 20. Resultados: El 67% alcanzó un Asas 20 a las 24 semanas y 78% a las 48 semanas; 33,3% y 55,6% tuvieron ASAS 40 y 33,3%; y 44,4% alcanzó BASDAI 50 a las 24 y 48 semanas, respectivamente. Un paciente recayó a la semana 20. Tres pacientes (33,3% permanecieron sin cambios. A las 24 y 48 semanas, la media de BASDAI disminuyó en 45,1% (p=0,007 y en 52,1% (p=0,01, la media de BASFI en 38,2% (p=0,007 y en 52,3% (p=0,007, y la media de BASMI en 39,2% (p=0,01 y 39,2% (p=0,01, respectivamente. Los eventos adversos no fueron importantes con esta terapia. Conclusiones: El tratamiento con pamidronato demostró ser efectivo en este grupo de pacientes con EA, refractaria a AINES y a sulfasalazina.
Aineüleste pädevuste koolitus Pestalozzi programmi raames / Tiia Pukk, Tiiu Vaher
Pukk, Tiia
2011-01-01
1969 alguse saanud Pestalozzi koolitusprogramm on suunatud Euroopa kultuurikonventsiooniga ühinenud 49 riigi haridustöötajatele. Seekordne üritus toimus Tartus, koolituse teemaks aineülesed pädevused
GarcÍa Lorca luulest ja Ain Kaalepi tõlkest / Jüri Talvet
Talvet, Jüri, 1945-
1998-01-01
Arvustus: GarcÍa Lorca, Federico. Mu kätes põleb tuli : valitud luuletused / tlk. ja saateks: Ain Kaalep. 2. tr. Tallinn : Vagabund, 1997. Ilmunud ka kogumikus: Talvet, Jüri. Tõrjumatu äär. Tartu : Ilmamaa, 2005, lk. 442-453
New frameshift CF mutation 3729delAinsTCT in a Tunisian cystic
Indian Academy of Sciences (India)
Home; Journals; Journal of Genetics; Volume 92; Issue 1. New frameshift CF mutation 3729delAinsTCT in a Tunisian cystic fibrosis patient. Sondess Hadj Fredj Monia Boudaya Sabrine Oueslati Safa Sahnoun Chaima Sahli Hajer Siala Khedija Boussetta Amina Bibi Taieb Messaoud. Research Note Volume 92 Issue 1 April ...
COxSwAIN: Compressive Sensing for Advanced Imaging and Navigation
Kurwitz, Richard; Pulley, Marina; LaFerney, Nathan; Munoz, Carlos
2015-01-01
The COxSwAIN project focuses on building an image and video compression scheme that can be implemented in a small or low-power satellite. To do this, we used Compressive Sensing, where the compression is performed by matrix multiplications on the satellite and reconstructed on the ground. Our paper explains our methodology and demonstrates the results of the scheme, being able to achieve high quality image compression that is robust to noise and corruption.
Rodríguez, Daniela C; Peterson, Lauren A
2016-05-06
Factors that influence performance of community health workers (CHWs) delivering health services are not well understood. A recent logic model proposed categories of support from both health sector and communities that influence CHW performance and program outcomes. This logic model has been used to review a growth monitoring program delivered by CHWs in Honduras, known as Atención Integral a la Niñez en la Comunidad (AIN-C). A retrospective review of AIN-C was conducted through a document desk review and supplemented with in-depth interviews. Documents were systematically coded using the categories from the logic model, and gaps were addressed through interviews. Authors reviewed coded data for each category to analyze program details and outcomes as well as identify potential issues and gaps in the logic model. Categories from the logic model were inconsistently represented, with more information available for health sector than community. Context and input activities were not well documented. Information on health sector systems-level activities was available for governance but limited for other categories, while not much was found for community systems-level activities. Most available information focused on program-level activities with substantial data on technical support. Output, outcome, and impact data were drawn from various resources and suggest mixed results of AIN-C on indicators of interest. Assessing CHW performance through a desk review left gaps that could not be addressed about the relationship of activities and performance. There were critical characteristics of program design that made it contextually appropriate; however, it was difficult to identify clear links between AIN-C and malnutrition indicators. Regarding the logic model, several categories were too broad (e.g., technical support, context) and some aspects of AIN-C did not fit neatly in logic model categories (e.g., political commitment, equity, flexibility in implementation). The
Monsieur Philippe Galli Préfet de l’Ain France
Maximilien Brice
2011-01-01
Photo 35: Le chef du département Physique P. Bloch, le porte-parole de la Collaboration CMS G. Tonelli,le Sous-Préfet de Gex O. Laurens-Bernard, le chef du département Technologie F. Bordry, le Péfet de l'Ain P. Galli et le Directeur-général R. Heuer. Photo 62: signature du livre d'or avec le Directeur de la recherche et de l'informatique S. Bertolucci.
Application of electrical geophysics to the release of water resources, case of Ain Leuh (Morocco
Directory of Open Access Journals (Sweden)
Zitouni A.
2018-01-01
In the present work, which concerns only the methodology of the electric resistivity, we treat the adopted methodological approach and the study of the case of application in the tray of Ajdir Ain Leuh.
CSIR Research Space (South Africa)
Raal, PA
1996-05-01
Full Text Available ELSEVIER Landscape and Urban Planning 34 (1996) 389-400 Mapping and conservation importance rating of the South African coastal vegetation as an aid to development planning P.A. Raal *, M.E.R. Bums Division of Earth, Marine...-incide with the local authority administrative boundaries. Areas which have not yet been mapped are also shown. P.A. Raal, M.E.R. Burns/ Landscape and Urban Planning 34 (1996) 389-400 391 a botanical map series which can be used...
Mida sina täna õppisid? / Veikko Täär, Ain Aaviksoo, Ingrid Tõniste ... [jt.
2012-01-01
Oma õppimistest ja tulevikuplaanidest räägivad näitleja ja ettevõtja Veikko Täär, tervishoiuteadlane Ain Aaviksoo, tegevjuht Ingrid Tõniste, TV3 avalike suhete juht ja uudisteankur Anneli Adermann, arenduskonsultant Anu Puusaag, personaaltreener Katrin Pärt ja loodusarst Tiina Keldrima
Ain't Gonna Study War No More? Explorations of War through Picture Books
Crawford, Patricia A.; Roberts, Sherron Killingsworth
2009-01-01
At the height of the Vietnam War, Down by the Riverside was transformed from a traditional folk song to a popular anti-war anthem. The raucous and repetitive chorus, "I ain't gonna study war no more ...," became a rallying cry for those who wanted nothing to do with the war and the pain and controversy that surrounded it. Although it seems…
Derdour Abdessamed; Bouanani Abderrazak; Babahamed Kamila
2018-01-01
Ain Sefra is one of the Algerian cities that had been experienced several devastating floods during the past 100 years. The purpose of this study is to simulate runoff in the semi-arid region of Ain Sefra watershed through the employing of the Hydrologic Engineering Center – Hydrologic Modelling System (HEC-HMS). In this paper, the frequency storm is used for the meteorological model, the Soil Conservation Service – curve number (SCS-CN) is selected to calculate the loss rate and Soil Conserv...
International Nuclear Information System (INIS)
Ben Ammar, Safouan
2007-01-01
In the semiarid central part of Tunisia the water resources are becoming increasingly rare because of the scarcity and irregularity of the precipitation and a steadily growing need for fresh water. This study addresses the use of geochemical and isotopic data to analyze the relationship between the El Haouareb dam and the Ain El Beidha and the Kairouan alluvial plain aquifers systems for durable groundwater management. In the Ain El Beidha basin the hydrogeological and geochemical investigations showed that: - The general direction of the groundwater flow is mainly from the SW to the NE, i.e. towards the hydraulic sill of El Haouareb which allows the connection between the Ain El Beidha basin and the Kairouan plain, - The salinity distribution displays a zonation in apparent relationship with the lithological variation of the aquifer formation, - Mineral exchange between groundwater and the aquifer matrix is the dominant process in determining groundwater salinity. The isotopic data confirm the flow directions of groundwater and shows that the recharge of Ain El Beidha aquifers takes place from the floods of the Khechem and Ben Zitoun wadies and also by preferential infiltration of runoff at the front of hill slopes area. Close to preferential recharge areas, groundwater 3H contents reflect a recent input of surface water, whereas the radiocarbon data indicate a longer residence time downstream. The isotopic characteristics of Ain El Beidha groundwater (small space and temporal changes) authorize the use of averaged values for the dam-aquifer water exchange. Under natural conditions, groundwater recharge of the alluvial aquifer of Kairouan plain occurs by infiltration of the Merguellil floods and from the Ain el Beidha groundwater flow close the karstic hydraulic sills. Since the construction of the El Haouareb dam, these natural mechanisms have been strongly modified: the dam waters infiltrate into the karst, mix with the Ain el Beidha groundwater, and feed the
T his article is m ainly about using sim ple trigonom etric identities ...
Indian Academy of Sciences (India)
T his article is m ainly about using sim ple trigonom etric identities and basic calculus to deduce som e new and interesting series. In particular, I use basic aspects of. G am m a and B eta integrations to deduce these series. T hese lead to interesting series for ¼ or functions of ¼ . O ne form ofbeta integration w hich is often ...
National Research Council Canada - National Science Library
2006-01-01
.... The Center was to be funded by the Department of Defense, Office of Naval Research (ONR). The TDRI AINS Center's objectives were to advance ONR's technologies and to improve exposure and participation in science, math, and engineering (SME...
International Nuclear Information System (INIS)
Aly, A.I.M.; Nada, A.; Awad, M.; Salman, A.B.; Hamza, M.S.
1991-01-01
Groundwater samples collected from some localities in the vicinity of Moghra and Ain El-Sharip in the north western desert were subjected to chemical and to isotopic analyses. The combination of the hydrochemical data with the isotopic compositions of deuterium, oxygen-18 and tritium shows that the groundwater in this region represents a mixture of water recharged from different sources including : Nile, sea and paleo-waters.5 fig.,2 tab
2012-01-01
Tartus Sadama 1 auva Ahhaa teaduskeskuse arhitektuurist ja sisearhitektuurist. Arhitektid: Ain Padrik ja Vilen Künnapu, kaasa töötasid Kristjan Tõlk, Kristiin Keernik, Siim Tuksam, Hannes Tilk (Künnapu & Padrik). Sisearhitektid: Tea Tammelaan, Krista Lepland ja Malle Jürgenson (Laika, Belka & Strelka). Infograafika: Alar Pikkorainen
International Nuclear Information System (INIS)
Jubeli, Y.; Al-Hilal, M.; Al-Ali, A.
1998-06-01
A combination of several exploration techniques was carried out at the main phosphatic outcrop of Ain Laylon in the Syrian coastal region. The survey was extended along an E-W profile parallel to Wadi Al-Mzeraa over a distance of about 23 km from Ain Laylon site towards the shoreline of the Mediterranean Sea. The techniques used in this survey included soil radon emanometry, gamma ray spectrometry and soil geochemistry, with the purpose of evaluating the effects of weathering and erosion on the uranium-hearing phosphate formations in the study ares. Soil radon concentration and gamma ray total count rates found to be ranging between 115-472 pCi/l and 52-520 cps over the main phosphate deposit of Ain Layton and between 16-241 pCi/l and 15-300 cps along the profile of Wadi Al-Mzeraa - Rwemiyeh respectively. Some suitable elements such as U, Zn, Pb, Cr, Fe and Sr were also analyzed to trace the dispersion pattern of uranium and its controls throughout the area. The results showed that the distribution of both radon emission and gamma ray activity, in accordance with chemical uranium and some associated trace elements, were almost identical over the study area. The anomalously high values in all cases were basically found to be related to the main phosphatic outcrop and to the reprecipitation processes at their vicinity following the alteration of the phosphates. The prevailing topographic conditions of the drainage system has probably played a crucial role in carrying the uraniferous solutions from its phosphatic source down to the nearby sedimentary environment. This appears to be sufficient enough to produce an anomalous halo resulting in the detection of some relatively high radon and gamma values of about 7 and 15 times the background respectively, especially close to the main phosphate outcrop. A notable gradual decrease was then observed at the following sampling sites along the pathway west of Ain Laylon site approaching the background level at a distance of
2007-01-01
Eripedagoogide vestlusringis osalevad: Tartu Ülikooli eripedagoogika osakonna juhataja Kaja Plado, emeriitdotsent pedagoogikadoktor Karl Karlep, Tartu Kroonuaia Kooli direktor Ain Ostrat ja õppealajuhataja Meelike Maila, Tartu Hiie Kooli õppealajuhataja Hene Binsol ning Tartu Nõustamis- ja õpiabi keskuse juhataja Ana Kontor
International Nuclear Information System (INIS)
Kattan, Z.
2003-01-01
This work is an attempt to estimate the mean residence time of groundwater in the Ain Al-Tanour and Ain-Samak, which are the major karst springs in the Upper Orontes Basin (Central Syria). This estimate, which consists on the application of a mathematical modeling approach, was based on the use of tritium, as a natural radioisotope tracer and a tool for ground water age dating. By adopting a completely mixed reservoir model, linked with exponential time distribution function, the mean residence time (turnover time) of these two springs was evaluated to be about 50 years. This result is in good agreement with previous estimation obtained for the Figeh main spring, which belongs to the same aquifer (Cenomanian-Turonian complex) in the Damascus Basin. On the basis of this evaluation, a value of about 800 million m 3 was obtained for the maximum groundwater reservoir size
2008-01-01
Vastavad restoranklubi Atlantis tegevjuht Olga Aasav, ametiühingute keskliidu osakonnajuhataja Arno Arukuusk, AS Estiko Investeeringud juhataja Ain Tammvere, Tartu Ülikooli ametiühingu esimees Aleksander Jakobson, AS Samelin tegevdirektor Leida Kikka, AS Enics Eesti tegevjuht Kalle Kuusik, personalispetsialist Lea Oras ja Tartu Tarbijate Kooperatiivi juhatuse esimees Tarmo Punger
Abou Zakhem, Boulos; Kattaa, Bassam
2017-10-01
The effects of climate change and overexploitation are being strongly perceived in the studied area and the springs discharge is obviously affected. In this paper, Ras El Ain spring discharge and precipitation were analyzed by normalized methods on an yearly timescale. The deficit of Ras El Ain spring discharge due to overexploitation factors and drought effects was estimated. Cumulative drought analyses were carried out using SPI10 and SQI10. Finally, the decreasing trends of the spring discharge due to the deficiency in rainfall were analyzed. The main results reveal that the annual mean deficit of Ras El Ain spring discharge due to overpumping was between 32 and 45%, whereas, annual mean deficit related to drought was between 22 and 35% on average, during the last 30 years (post-1984). The moving averages of SPI and SQI delineate very well the drought periods during last three decades. The cumulative droughts using SPI10 and SQI10 reveal that wet period (pre-1984) with positive values was characterized by high precipitation and spring discharge. Overexploitation period (1984-1989) is distinguished by decreasing SQI10 values whereas, SPI10 is almost stable. The response of the karst system to the precipitation signal has been changed, during the drought period (1990-2000), and the spring behaviour has been modified due to the first overexploitation period. Finally, overexploitation period (2001-2008) is related to the second phase of groundwater intensive pumping for irrigation purposes. Consequently, this period is completely catastrophic causing the drying up of the spring. The decreasing trends analyzed using DPI and DQI showed annual decreasing rates relative to the mean values of -0.268% and -0.105%, respectively. Thus, the results of theoretical model reveal that precipitation will decrease by about DPI = -20.7% and the discharge will decline by about -9.2% by 2050. Consequently, the declining discharge due to climatic variation under natural conditions as
Directory of Open Access Journals (Sweden)
Derdour Abdessamed
2018-03-01
Full Text Available Ain Sefra is one of the Algerian cities that had been experienced several devastating floods during the past 100 years. The purpose of this study is to simulate runoff in the semi-arid region of Ain Sefra watershed through the employing of the Hydrologic Engineering Center – Hydrologic Modelling System (HEC-HMS. In this paper, the frequency storm is used for the meteorological model, the Soil Conservation Service – curve number (SCS-CN is selected to calculate the loss rate and Soil Conservation Service unit hydrograph method have been applied to simulate the runoff rate. After calibration and validation, the simulated peak discharges were very close with observed values. The Nash–Sutcliffe efficiency coefficient was 0.95, indicates that the hydrological modeling results are satisfactory and accepted for simulation of rainfall-runoff. The peak discharges obtained for the 10, 50, 100 and 1000 year storms are respectively 425.8, 750.5, 904.3 and 1328.3 m3∙s−1.
Analysis of Urban Expansion of the Resort City of Al Ain Using Remote Sensing and GIS
Issa, S.; Al Shuwaihi, A.
2009-12-01
The urban growth of AL Ain city has been investigated using remote sensing data for three different dates, 1972, 1990 and 2000. We used three Landsat images together with socio-economic data in a post-classification analysis to map the spatial dynamics of land use/cover changes and identify the urbanization process in Al Ain resort city, United Arab Emirates. Land use/cover statistics, extracted from Landsat Multi-spectral Scanner (MSS). Thematic Mapper (TM) and Enhanced Thematic Mapper plus (ETM +) images for 1972. 1990 and 2000 respectively, revealed that the built-up area has expanded by about 170.53km2. The city was found to have a tendency for major expansion in four different directions: along the Abu Dhabi highway, along Dubai highway, Myziad direction and Hafeet recreational area. Expansion in any direction was found to be governed by the availability of road network, suitability for construction, utilities, economic activities, geographical constraints, and legal factors (boundary with Sultanate of Oman). The road network in particular has influenced the spatial patterns and structure of urban development, so that the expansion of the built-up areas has assumed an accretive as well as linear growth along the major roads. The research concludes that the development is based on conservation of agricultural areas (oases) and reclamation of the desert for farming and agricultural activities. The integration of remote sensing and GIS was found to be effective in monitoring LULC changes and providing valuable information necessary for planning and research.
International Nuclear Information System (INIS)
Bienk, E.J.; Mikkelsen, N.J.
1997-01-01
Two methods of surface improvement widely used in the modern plastics industry are compared, with a view to improving productivity and product quality. Ion implantation of plastics and physical vapour deposition coatings both offer surface engineering advantages. Each method is described and evaluated with reference to plastics moulding. TiAIN coatings are used to protect hard bulk materials, subjected to evenly distributed loads. The more ductile CrN coatings are used for softer materials which give less support to the coatings. (UK)
Ehitusmaailma stipendiumid / Triin Ojari
Ojari, Triin, 1974-
2001-01-01
Ehitusmaailma kaupluseketi omanik AS "Fanaal" jagas kolmandat korda välja stipendiumid ehitus-, arhitektuuri- ja restaureerimisala üliõpilastele. Stipendiumi said: Mati Raal (EKA), Andrus Räämet, Eero Tuhkanen (TTÜ), Priit Lõhmus, Mauro Ilves, Maidu Saar (EPÜ)
Lellep, Kaili
2010-01-01
Aine või toote määratlemisest toiduna, kosmeetikatootena, meditsiiniseadmena, ravimina. Määratlustest Eestis ja nende vastavusest Euroopa Liidu õigusega, määratluste tagajärgedest, ettepanekutest vastuolulise õigusakti muutmiseks
Evaluation of the clinical maxim: "If it ain't broke, don't fix it".
Howell-Duffy, Chris; Hrynchak, Patricia K; Irving, Elizabeth L; Mouat, Graham S V; Elliott, David B
2012-01-01
A significant number of patients return to optometric practice dissatisfied with their spectacles. An important question is whether any of these cases are preventable. There are several different clinical maxims that are used to modify the subjective refraction when determining the refractive prescription. These maxims aim to improve patient comfort and adaptation and thereby reduce patient dissatisfaction with new spectacles. They are not based on research evidence, but rather on expert opinion gained from clinical experience. The aim of this study was to retrospectively analyze a large number of case records of dissatisfied patients to assess the possible usefulness of the prescribing maxim "if it ain't broke, don't fix it." Three hundred eighteen non-tolerance cases from a university-based Canadian optometric clinic were categorized by a focus group of optometrists. Three prescribing categories were defined and comprised cases in which application of the proposed maxim may have prevented the recheck eye examination; a more limited application of the maxim for one working distance may have been appropriate; and finally scenarios in which the maxim did not work in that the practitioner was judged to have initially followed the maxim, yet patient dissatisfaction was still reported. The remaining unallocated records comprised prescribing situations outside the scope of this study. Approximately 32% of non-tolerance cases were judged to have been preventable by use of the proposed maxim. Furthermore, an additional 10% reduction in recheck cases may have been possible by a more liberal interpretation of the maxim. Conversely, 4% of cases were deemed to comprise scenarios in which the maxim was followed yet the patient returned later to report problems with their spectacles. The prescribing maxim "if it ain't broke, don't fix it" appears to have a role in reducing recheck eye examinations and improving patient satisfaction with new spectacles.
Directory of Open Access Journals (Sweden)
Didaoui Hayat
2018-03-01
Full Text Available Background and aims: The aim of the current study was to assess the impact of environmental factors; food, socio-economic, and physical activity, on a group of obese children living in Ain-Defla (Center Algeria and Sidi-Bel-Abbes (West Algeria.
Directory of Open Access Journals (Sweden)
Rosa Maria Garcia Camin
2015-03-01
Conclusiones: El tratamiento con IECA, ARA II, diuréticos y/o AINES presenta elevada incidencia de ingreso por FRA, siendo los diuréticos en monoterapia, doble y triple terapia combinada los que ocasionan la mayor incidencia. El FRAETW supone elevados costes sanitarios y muertes evitables.
TEM and XANES study of MOVPE grown InAIN layers with different indium content
International Nuclear Information System (INIS)
Kret, S; Wolska, A; Klepka, M T; Letrouit, A; Ivaldi, F; Szczepańska, A; Carlin, J-F; Kaufmann, N A K; Grandjean, N
2011-01-01
We present structure and spatially resolved composition studies by TEM (Transmission Electron Microscopy) and XANES (X-ray Absorption Near Edge Structure) of InAIN MOVPE (Metal-Organic Vapor Phase Epitaxy) epilayers containing 16-27 at% of indium. Investigations of the In L 3 edge by synchrotron radiation absorption show a significant change of the post-edge structure depending on the indium content. We attribute this to the solubility limit and phase separation in this system. Our measurements suggest that the critical composition is 18% for our growth conditions. HRTEM cross-sectional and EDX investigations confirm such phase separation as well as the changing of the structure from 2D growth to columnar like growth for the sample with the highest indium content.
Management of toxic cyanobacteria for drinking water production of Ain Zada Dam.
Saoudi, Amel; Brient, Luc; Boucetta, Sabrine; Ouzrout, Rachid; Bormans, Myriam; Bensouilah, Mourad
2017-07-01
Blooms of toxic cyanobacteria in Algerian reservoirs represent a potential health problem, mainly from drinking water that supplies the local population of Ain Zada (Bordj Bou Arreridj). The objective of this study is to monitor, detect, and identify the existence of cyanobacteria and microcystins during blooming times. Samples were taken in 2013 from eight stations. The results show that three potentially toxic cyanobacterial genera with the species Planktothrix agardhii were dominant. Cyanobacterial biomass, phycocyanin (PC) concentrations, and microcystin (MC) concentrations were high in the surface layer and at 14 m depth; these values were also high in the treated water. On 11 May 2013, MC concentrations were 6.3 μg/L in MC-LR equivalent in the drinking water. This study shows for the first time the presence of cyanotoxins in raw and treated waters, highlighting that regular monitoring of cyanobacteria and cyanotoxins must be undertaken to avoid potential health problems.
2005-01-01
Elmar Sepp ja Tõnis Palts vastavad küsimusele, mis puudutab Taavi Veskimäe väidet, et Res Publica koostöö Tallinnas on Res Publica suurima poliitilise libastumise tagajärg. Elmar Sepp ei välista sügisestel valimistel Keskerakonna ja Res Publica koostöö jätkumist Tallinnas, tema sõnul ei ole Keskerakond mitte totalitaarne, vaid Eesti üks demokraatlikumaid erakondi. Vt. samas: Katkend Taavi Veskimäe kõnest Res Publica üldkogul
Antiinflamatorios no esteroideos (AINES.: Consideraciones para su uso estomatológico
Directory of Open Access Journals (Sweden)
Andrés A. Pérez Ruiz
2002-08-01
Full Text Available Se realiza una revisión extensa y actualizada sobre los antiinflamatorios no esteroideos (AINEs, con el fin de actualizar al estomatólogo en su uso. Para ello se revisan aspectos importantes del proceso inflamatorio en estructuras de la boca que como las pulpitis, presentan sus peculiaridades. Se identifica a una de las 2 familias de autacoides provenientes de los fosfolípidos de membrana celular, es decir, los eicosanoides derivados a partir de algunos ácidos grasos polisaturados, en particular, ácido araquidónico, que tras la acción de enzimas da lugar a la formación de prostaglandinas, prostaciclinas, tromboxeno A2 y leucotrienos. Conocidos estos antecedentes, nos ocupamos de fármacos usados para combatir los síntomas y signos de la inflamación. Casi todos los antiinflamatorios no esteroideos utilizados en la actualidad, casi todos, inhiben las actividades de la ciclooxigenasa 1 constitutiva y la ciclooxigenasa 2, inducida en el sitio de la inflamación y con ello, la síntesis de prostaglandinas y tromboxanos. Se alude a la ventaja terapéutica de los inhibidores de la COX-2 que aparecen hoy en el mercado. Se expone las dosis y frecuencias de los AINEs, sus interacciones, así como las reacciones adversas al medicamento y contraindicaciones, y se proponen aquellos que son de interés en la práctica estomatológica.Non-steroidal anti-inflammatory drugs. Considerations about their dental use. An extensive updated review of non-steroidal anti-inflammatory agents (NSAIN was made to give an updated information to the dentist about their use. To this purpose, important aspects of the inflammatory process in mouth structures like pulpitis that present with their own peculiarities are reviewed. We identified one of the two autacoid families from cell membrane phospholipids, that is, eicosanoids derived from some polysaturated fatty acids, in particular, arachidonic acid, which, after the action of enzymes, give rise to the formation of
Journal of Endocrinology, Metabolism and Diabetes of South Africa ...
African Journals Online (AJOL)
The Achievement of Glycaemic, Blood Pressure and LDL Cholesterol Targets in Patients with Type 2 Diabetes Attending a South African Tertiary Hospital Outpatient Clinic · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. Y Pinchevsky, V Shukla, N Butkow, FJ Raal, ...
Alvela, Ain, 1967-
2011-01-01
Spetsiaalsed jõulutooted aitavad aasta lõpul suurendada toiduainetööstuste käivet. ASi Atria Eesti müügi- ja turundusdirektori Margus Masingu, ASi Fazer Eesti juhatuse esimehe Kristjan Kongo ja ASi Salvest turundusdirektori Ain Nõlvaku kommentaare
Caraban Gonzalez, Noemi
2018-01-01
Madame Olga Givernet Députée 3ème circonscription de l’Ain. Participants CERN, Signature du livre d’or. M. Frédérick Bordry Directeur des accélérateurs et de la technologie Mme Fabiola Gianotti Directrice générale
Lepik, Kerli, 1989-
2013-01-01
Suures koguses narkootilise ja psühhotroopse aine käsitlemisest, suure varalise kasu saamise eesmärgist, võrdlus teiste Euroopa riikidega (EL, Läti, Leedu, Soome, Norra, Tšehhi), suurest varalisest kasust kui koosseisutunnusest ja alternatiividest
Application of electrical geophysics to the release of water resources, case of Ain Leuh (Morocco)
Zitouni, A.; Boukdir, A.; El Fjiji, H.; Baite, W.; Ekouele Mbaki, V. R.; Ben Said, H.; Echakraoui, Z.; Elissami, A.; El Maslouhi, M. R.
2018-05-01
Being seen needs in increasing waters in our contry for fine domestics, manufactures and agricultural, the prospecting of subterranean waters by geologic and hydrogeologic classic method remains inaplicable in the cases of the regions where one does not arrange drillings or polls (soundings) of gratitude (recongnition) in very sufficient (self-important) number. In that case of figure, the method of prospecting geophysics such as the method of nuclear magnetic resonance (NMR) and the method of the geophysics radar are usually used most usually because they showed, worldwide, results very desive in the projects of prospecting and evaluation of the resources in subterranean waters. In the present work, which concerns only the methodology of the electric resistivity, we treat the adopted methodological approach and the study of the case of application in the tray of Ajdir Ain Leuh.
Water-rock interaction and geochemistry of groundwater from the Ain Azel aquifer, Algeria.
Belkhiri, Lazhar; Mouni, Lotfi; Tiri, Ammar
2012-02-01
Hydrochemical, multivariate statistical, and inverse geochemical modeling techniques were used to investigate the hydrochemical evolution within the Ain Azel aquifer, Algeria. Cluster analysis based on major ion contents defined 3 main chemical water types, reflecting different hydrochemical processes. The first group water, group 1, has low salinity (mean EC = 735 μS/cm). The second group waters are classified as Cl-HCO(3)-alkaline earth type. The third group is made up of water samples, the cation composition of which is dominated by Ca and Mg with anion composition varying from dominantly Cl to dominantly HCO(3) plus SO(4). The varifactors obtained from R-mode FA indicate that the parameters responsible for groundwater quality variations are mainly related to the presence and dissolution of some carbonate, silicate, and evaporite minerals in the aquifer. Inverse geochemical modeling along groundwater flow paths indicates the dominant processes are the consumption of CO(2), the dissolution of dolomite, gypsum, and halite, along with the precipitation of calcite, Ca-montmorillonite, illite, kaolinite, and quartz. © Springer Science+Business Media B.V. 2011
2007-01-01
Jõekääru Jazz'ile järgneval nädalal tõi ürituse peakorraldaja Allan Liik toimetusse seal esinenud muusikud. Vestlusringis olid: Allan Liik, Hedvig Hanson, Andre Maaker, Ain Agan, Raivo Tafenau ja Sergio Bastos
Mechergui, M. Mohamed; Henda Saoudi, Mme
2016-04-01
This study aims to assess the impact of water harvesting constructed hydraulic structures (big and small dams, terraces, seuils for recharge…) on the evolution of piezometric head of Ain El Beidha groundwater table. The measurements of depth of water table, taken at the end of rain season and at the end of irrigation season, in many piezometers and monitoring wells, for a long period of observation before and after implementation of all the hydraulic structures, were used with the cumulative rain to the highest water table to diagnostic the effect of natural recharge and constructed hydraulic structures. According to the analysis of curves illustrating the evolution of piezometric head and rainfall over time, it was shown that despite the fact that the same amount of rain fall on the total area in the limits of Ain El Beidha groundwater table, the piezometers respond differently. This is because there are many sources of recharge and many factors affecting the recharge. First of all, the aquifer is divided in four compartments (the calcareous formation of Djebel El Houyareb, the plio-quaternary formation, the Miocene formation: Baglia and Saouaf). All those respond differently to the recharge by their capacity of infiltration and their hydrodynamic characteristics. The recharge of the groundwater table was increased by the implementation of small soil and water conservation structures, artificial lakes, El Haouareb Dam, run off in the natural Oued bads and seuils for recharge installed in the bads of oueds. The different piezometric drown maps were used to determine the flow direction and hydraulic gradient in order to identify the recharge areas, while tracking maps for three equal piezometric heads 210 m 300 m and 370 m established over different years made it possible to assess the impact of hydraulic structures, namely the effect of SWC and Ben Zitoun Lake. To illustrate the impact of El Houareb dam on the groundwater, the piezometric maps and local values
Climate change and their consequences on coastal zone of Ain el Turck in Oran
Directory of Open Access Journals (Sweden)
Mohammed Tewfik Bouroumi
2017-12-01
Full Text Available Algeria does not escape the problem of the climate change, its geographical position in zone of transition, and its dry and semi-arid climate, in fact a very vulnerable space. In Algeria, approximately two thirds of the population is concentrated on the coast which represents only 4 % of the territory. The Mediterranean coast, in particular in Algeria, is subjected to pressures: financial stakes, climatic risks, pollutions and conservation of the water. It is on the basis of the critical and objective report with regard to a wild urbanization of the Algerian coast as well as the influence of the demographic pressure that the choice of the search for this article was held. This publication has for objective to raise (to draw up a current situation (inventory of fixtures of the sector of the environment in Algeria and to present through the case of the coastal city of Oran the consequences of climate change. We propose, to review the situation through the case of the municipality of Ain El Türck, by basing itself on data relative to the evolution of the temperatures and the sea level.
Estudio biofarmacéutico de geles antiinflamatorios no esteroideos (AINES
Directory of Open Access Journals (Sweden)
Margarita Restrepo
2000-02-01
Full Text Available
Los antiinflamatorios no esteroideos (AINES son un grupo heterogéneo de compuestos con actividad analgésica, antipirética y antiinflamatoria que comparten efectos secundarios indeseables, tales como: ulceración gástrica e intestinal, anemia, bloqueo de la agregación plaquetaria, inhibición de la motilidad uterina e hipersensibilidad. Los AINES se utilizan por vía tópica con el fin de aliviar lesiones en tejidos blandos a los cuales puede llegarse directamente a través de la piel, evitando así los efectos colaterales indeseables.
Actualmente para la gran mayoría de los medicamentos se exige valorar la Biodisponibilidad como criterio de calidad. Biodisponibilidad se define como la cantidad de fármaco que llega a sangre o plasma después de la administración del medicamento que lo contiene y la velocidad a la cual este proceso ocurre; esta determinación de Biodisponibilidad no resulta útil en el caso de medicamentos que se administran a través de la piel y no alcanzan circulación sistémica; la biodisponibilidad relativa o Bioequivalencia es la comparación de las biodisponibilidades de dos medicamentos para determinar si son similares en su comportamiento farmacocinético dentro del organismo.
El presente trabajo pretende estandarizar y validar un método que permita determinar concentraciones de fármaco en tejidos, en este tipo de medicamentos administrados por vía tópica, que no alcanzan circulación sistémica y por lo tanto no pueden ser cuantificados en sangre o plasma; además pretendemos que esta metodología pueda ser propuesta como una técnica para determinar biodisponibilidad y/o bioequivalencia para este tipo de productos. Para lograr estos objetivos, inicialmente, se induce la inflamación a un grupo
Suvemaja, Antler Island, Fairy Lake, Ontario / Ants Elken
Elken, Ants, 1917-2012
1997-01-01
Tuli projekteerida suvila kasvavale perele, mis algusest peale kasutamiskõlblikuna areneks koos perekonna laienemisega. Kerged paviljonid meenutavad küla. Ehitati 1966-1989. Arhitekt Elmar Tampõld. Joonised, vaated.
Pärnu haridusjuht napsas suupillikonkursi peavõidu / Kaupo Meiel
Meiel, Kaupo, 1975-
2005-01-01
Nädalavahetusel Pärnus suupillifestivali "Baltic-Nordic Harmonica" raames toimunud konkursi "Baltic-Nordic Open" peavõidu ja puuskulptuuri Vatti pälvis Andrus Haugas. Intervjuu festivali direktor Elmar Tringiga
Vitamin D deficiency among healthy adolescents in Al Ain, United Arab Emirates
2013-01-01
Background Although vitamin D deficiency has been studied in various adult populations, there are few data on the prevalence of this nutritional deficiency among healthy adolescents in the United Arab Emirates (UAE). This study was conducted to determine the prevalence of vitamin D deficiency and to examine its correlates in adolescents aged 15 to 18 years. Methods This was a cross-sectional study in urban schools. Healthy adolescents (N=315) from a sample of 8 schools were randomly selected from the 142 schools in Al Ain, Abu Dhabi Emirate. Outcomes measured included serum concentrations of 25-hydroxy vitamin D (25OHD), plasma lipids, blood sugar, blood pressure and anthropometric data, nutrition and lifestyle variables. Results Fourty-one participants (19.7%) were vitamin D deficient (serum 25OHD level ≤15 ng/mL [≤37.5 nmol/L]. Using a cutoff level of 25(OH) D of ≤20 ng/ml [≤50 nmol/l] 143 participants (45.4%) were vitamin D insufficient. Overall 65.1% of study participants were either vitamin D deficient or insufficient. The prevalence of vitamin D deficiency varied between boys (10%) and girls (28%). In a final multivariate model, serum 25(OH) D concentrations were inversely correlated with female gender, consumption of fast food per week, and body mass index and positively correlated with physical activity scores after adjustment for age. Conclusions Vitamin D deficiency and insufficiency were highly prevalent in adolescents, and more common in girls. PMID:23311702
Energy Technology Data Exchange (ETDEWEB)
Montes de Oca, J.; Gonzalez, H. J. [Centro de Investigacion en Ciencia Aplicada y Tecnologia Avanzada, IPN, Unidad Altamira, Km. 14.5 Carretera Tampico-Puerto industrial Altamira, 89600 Altamira, Tamaulipas (Mexico); Solis, E. [Hy-Teck Fluid Power, Blvd. A. Lopez Mateos No. 310, Col. Nuevo Aeropuerto, 89337 Tampico, Tamaulipas (Mexico); Moreno, J. [Departamento de Ingenieria Metalurgica, Escuela Superior de Ingenieria Quimica e Industrias Extractivas, IPN, UPALM Unidad Zacatenco, 07730 Mexico D. F. (Mexico); Munoz S, J. [Centro de Investigacion y de Estudios Avanzados, Unidad Queretaro, Libramiento Norponiente No. 2000, Fracc. Real de Juriquilla, 76230 Santiago de Queretaro, Queretaro (Mexico)], e-mail: jmontedeocav@ipn.mx
2009-07-01
The present work reports a study to increase wear resistance of a ball passage floodgate (steel type T9) trough the application of a thick film (coating). This study have included a material and process selection, synthesis of the coating on steel plates as substrates and spherical device, assembling of the coated floodgate on the ball valves, and finally an evaluation of the valves in the process of a thermoelectric power station. Taking into account the different requirements, a TiAIN coating prepared by cathodic arc evaporation was finally retained. The crystal structure, morphology and chemical composition of the coating were evaluated by x-ray diffraction (XRD) and scanning electron microscopy equipped with an energy dispersive spectrometer (SEM-EDS). Finally, mechanical properties such as hardness and Young modulus were determined by nano indentation. (Author)
Muttika, Jüri
2006-01-01
Mart Kivastiku kunstniketriloogia kolmandas osas "Kits viiuli ja õngega" on peategelane Elmar Kits. Näidendi aluseks on kunstniku päevikud, antud tütre Saskia Kasemaa poolt. Harry Liivranna kommentaar
International Nuclear Information System (INIS)
Montes de Oca, J.; Gonzalez, H. J.; Solis, E.; Moreno, J.; Munoz S, J.
2009-01-01
The present work reports a study to increase wear resistance of a ball passage floodgate (steel type T9) trough the application of a thick film (coating). This study have included a material and process selection, synthesis of the coating on steel plates as substrates and spherical device, assembling of the coated floodgate on the ball valves, and finally an evaluation of the valves in the process of a thermoelectric power station. Taking into account the different requirements, a TiAIN coating prepared by cathodic arc evaporation was finally retained. The crystal structure, morphology and chemical composition of the coating were evaluated by x-ray diffraction (XRD) and scanning electron microscopy equipped with an energy dispersive spectrometer (SEM-EDS). Finally, mechanical properties such as hardness and Young modulus were determined by nano indentation. (Author)
Graafiline disain elektrikitarri pickguard'idel / Rasmus Raal
Raal, Rasmus
2011-01-01
Uurimuse eesmärgiks oli selgitada, mis funktsiooni pickguard (kaitseplaat) kannab ja missugused tehnoloogilised lahendused eksisteerivad oma kujunduste pickguard'ile transponeerimiseks, samuti vaadelda pickguard'idele tehtud kujundusi (200) ja neid liigitada ning analüüsida nii kujunduslikust kui tehnilisest küljest. Praktilise tööna kujundati ja teostati viis erinevat pickguard'i kujundust erinevate värvilahendustega
Prokurör nägi inimliku jõhkruse piiritust / Hinge Brand ; interv. Tiiu Põld
Brand, Hinge, 1940-2007
2006-01-01
Intervjuu ametist lahkuva prokurör Hinge Brandiga. Lisatud: Hinge Brandi CV; Hinge Brandi osavõtul peetud kõmulisemad mõrvaprotsessid. Kommenteerivad Aivar Pilv, Elmar Vaher, Alar Kirs, Eda Murak, Dilaila Nahkur-Tammiksaar
Directory of Open Access Journals (Sweden)
B BENRACHI
2002-12-01
Full Text Available La construction d’un édifice de qualité standard et répondant aux exigences techniques est obtenue grâce au développement du savoir-faire et au respect des règles de l’art et de la réglementation en vigueur. Une étude détaillée sur les exigences techniques et le respect de la réglementation d’un logement en collectif nouvellement construit et inhabité à Ain-Smara, nous a montré qu’il y a une satisfaction pour certaines d'entre-elles et une non-conformité pour d’autres. Il en résulte que le degré de satisfaction de ce logement est inférieur à celui recommandé dans le cadre de la réglementation, ce qui diminue sa qualité par rapport au standard exigé.
Professor Peep Veski meie meenutustes
2014-01-01
Mälestusi Tartu Ülikooli Farmaatsia instituudi juhatajast Peep Veskist jagavad: Eve-Irene Lepist, Urve Paaver, Karin Kogermann, Kristian Semjonov, Jaak Koppel, Kristin Raudsepp, Imre Klebovich, Filiz Hincal, A. Atilla Hincal ja Elmar Arak
Estonia laemaal taastatakse oktoobriks / Allar Viivik
Viivik, Allar
2005-01-01
1947. a. valminud laemaali autorid on Elmar Kits, Richard Sagrits ja Evald Okas. Laemaali konserveerib AS KAR-Grupp. Tarvis on korrastada ka jalutusruumi laest väljapuhastatud 1913. aasta ornamentmaalid. Kommenteerib teatri haldusdirektor Toivo Erilt
Associations of cardiovascular risk factors in Al Ain- United Arab Emirates
Directory of Open Access Journals (Sweden)
Nazirudeen Mohammad K
2009-04-01
Full Text Available Abstract Background Over the last 30 years the citizens of the United Arab Emirates have experienced major changes in life-style secondary to increased affluence. Currently, 1 in 5 adults have diabetes mellitus, but the associations (clustering among risk factors, as well as the relevance of the concept of the metabolic syndrome, in this population is unknown. Aim To investigate the prevalence and associations among cardiovascular risk factors in this population, and explore to what extent associations can be explained by the metabolic syndrome according to ATP-III criteria. Method A community based survey, of conventional risk factors for cardiovascular disease was conducted among 817 national residents of Al Ain city, UAE. These factors were fasting blood sugar, blood pressure, lipid profile, BMI, waist circumference, smoking, or CHD family history. Odds ratios between risks factors, both unadjusted and adjusted for age and sex as well as adjusted for age, sex, and metabolic syndrome were calculated. Results Various risk factors were positively associated in this population; associations that are mostly unexplained by confounding by age and sex. For example, hypertension and diabetes were still strongly related (OR 2.5; 95% CI 1.7–3.7 after adjustment. An increased waist circumference showed similar relationship with hypertension (OR 2.3; 95% CI 1.5–3.5. Diabetes was related to an increased BMI (OR 1.5; 96% CI 1.0–2.3. Smoking was also associated with diabetes (OR 1.9, 95% CI 1.0–3.3. Further adjustment for metabolic syndrome reduced some associations but several remained. Conclusion In this population risk-factors cluster, but associations do not appear to be explained by the presence/absence of the ATP-III metabolic syndrome. Associations provide valuable information in planning interventions for screening and management.
Associations of cardiovascular risk factors in Al Ain- United Arab Emirates
Baynouna, Latifa M; Revel, Anthony D; Nagelkerke, Nico JD; Jaber, Tariq M; Omar, Aziza O; Ahmed, Nader M; Nazirudeen, Mohammad K; Al Sayed, Mamdouh F; Nour, Fuad A; Abdouni, Sameh
2009-01-01
Background Over the last 30 years the citizens of the United Arab Emirates have experienced major changes in life-style secondary to increased affluence. Currently, 1 in 5 adults have diabetes mellitus, but the associations (clustering) among risk factors, as well as the relevance of the concept of the metabolic syndrome, in this population is unknown. Aim To investigate the prevalence and associations among cardiovascular risk factors in this population, and explore to what extent associations can be explained by the metabolic syndrome according to ATP-III criteria. Method A community based survey, of conventional risk factors for cardiovascular disease was conducted among 817 national residents of Al Ain city, UAE. These factors were fasting blood sugar, blood pressure, lipid profile, BMI, waist circumference, smoking, or CHD family history. Odds ratios between risks factors, both unadjusted and adjusted for age and sex as well as adjusted for age, sex, and metabolic syndrome were calculated. Results Various risk factors were positively associated in this population; associations that are mostly unexplained by confounding by age and sex. For example, hypertension and diabetes were still strongly related (OR 2.5; 95% CI 1.7–3.7) after adjustment. An increased waist circumference showed similar relationship with hypertension (OR 2.3; 95% CI 1.5–3.5). Diabetes was related to an increased BMI (OR 1.5; 96% CI 1.0–2.3). Smoking was also associated with diabetes (OR 1.9, 95% CI 1.0–3.3). Further adjustment for metabolic syndrome reduced some associations but several remained. Conclusion In this population risk-factors cluster, but associations do not appear to be explained by the presence/absence of the ATP-III metabolic syndrome. Associations provide valuable information in planning interventions for screening and management. PMID:19371412
Eestlaste matusepaik Rootsis Frösö saarel / Uno Schultz
Schultz, Uno, 1956-
2008-01-01
Frösö kiriku taga surnuaias, valgete ristide ja hauakivide all puhkavad: Elmar Aunpuu, Aarne Meri, Heino Albo, Hindrek Lipp, Kalju Mälk, Heinrich Koppel, Sulev Paju, Eugenius Gorski, Edgar Toompuu, Helmut Lillevars, Venda Oskar, Walentin Riis
Mis oli ja mida ei olnud : lisandusi kahele kirjutisele / Tiiu Erelt
Erelt, Tiiu, 1942-
2008-01-01
Lisandusi artiklitele: Koppel, Margit-Mariann. Mahalaskmine pärast surma //Eesti Ekspress, 23. aug. 2007, mis käsitleb Elmar Muugi saatust, ning: Raag, Raimo. Valter Tauli elust ja keelelisest tegevusest // Keel ja Kirjandus, (2007/Nov), nr. 11
Vom Terrorismus zum Wandel durch Annäherung: Houellebecqs ‚Soumission‘
Directory of Open Access Journals (Sweden)
Wolfgang Asholt
2016-03-01
Full Text Available Es handelt sich um den Text eines Vortrags beim von Ursula Hennigfeld und Elmar Schafroth organisierten Workshop „Zensur, Political Correctness und Terrorismus“ (Universität Düsseldorf, 30.6. – 2.7. 2015.
Directory of Open Access Journals (Sweden)
Frederick J. Raal
2016-06-01
Full Text Available These data describe the phenotypic variability in a large cohort of patients confirmed to have homozygous familial hypercholesterolemia. Herein, we describe the observed relationship of treated low-density lipoprotein cholesterol with age. We also overlay the low-density lipoprotein receptor gene (LDLR functional status with these phenotypic data. A full description of these data is available in our recent study published in Atherosclerosis, “Phenotype Diversity Among Patients With Homozygous Familial Hypercholesterolemia: A Cohort Study” (Raal et al., 2016 [1].
Eesti saatkonna ehitamisest Riiga 1938. aastal / Karin Hallas-Murula
Hallas-Murula, Karin, 1957-
2008-01-01
Riiga Eesti saatkonna hoone rajamise katsest. Välisministeeriumi poolt Aleksander Nürnbergilt tellitud eskiisist. 1938. a. korraldatud arhitektuurikonkursist ja selle tulemustest (I preemia - Erich Jacoby ja Hermann Berg, II - Herbert Johanson ja Lorenz Johanson, 1939. aastast Lorenz Haljak, III - Elmar Lohk)
Pediatric and youth traffic-collision injuries in Al Ain, United Arab Emirates: a prospective study.
Grivna, Michal; Eid, Hani O; Abu-Zidan, Fikri M
2013-01-01
To study the mechanism of road traffic collisions (RTC), use of safety devices, and outcome of hospitalized pediatric and youth RTC injured patients so as to give recommendations regarding prevention of pediatric RTC injuries. All RTC injured children and youth (0-19-year-olds) who were admitted to Al Ain City's two major trauma centers or who died after arrival to these centers were prospectively studied from April 2006 to October 2007. Demography of patients, road-user and vehicle types, crash mechanism, usage of safety devices, injured body regions, injury severity, Revised Trauma Score, Glasgow Coma Scale, intensive care unit admissions, hospital stay and mortality were analyzed. 245 patients were studied, 69% were vehicle occupants, 15% pedestrians, 9% motorcyclists and 5% bicyclists. 79% were males and 67% UAE citizens. The most common mechanism of RTC was rollover of vehicle (37%) followed by front impact collision (32%). 32 (13%) of vehicle occupants were ejected from car. 63% of ejected occupants and 70% of motorcyclists sustained head injuries. Only 2% (3/170) vehicle passengers used seatbelts and 13% (3/23) motorcyclists a helmet. Male drivers and UAE nationals were at high risk of RTC as drivers and as motorcyclists. Ejection rate was high because safety restraint use was extremely low in our community. More education and law enforcement focusing especially on car/booster seat use is needed.
El-Fakharani, Abdelhamid; Hamimi, Zakaria
2013-04-01
Ain Shams area, Western Arabian Shield, Saudi Arabia, is occupied by four main rock units; gneisses, metavolcanics, metasediments and syn- to post-tectonic granitoids. Field and structural studies reveal that the area was subjected to at least three phases of deformation (D1, D2 and D3). The structural features of the D1 are represented by tight to isoclinal and intrafolial folds (F1), axial plane foliation (S1) and stretching lineations (L1). This phase is believed to be resulted from an early NW-SE contractional phase due to the amalgamation between Asir and Jeddah tectonic terranes. D2 deformation phase progressively overprinted D1 structures and was dominated by thrusts, minor and major F2 thrust-related overturned folds. These structures indicate a top-to-the-NW movement direction and compressional regime during the D2 phase. Emplacement of the syn-tectonic granitoids is likely to have occurred during this phase. D3 structures are manifested F3 folds, which are open with steep to subvertical axial planes and axes moderately to steeply plunging towards the E, ENE and ESE directions, L3 is represented by crenulation lineations and kink bands. These structures attest NE-SW contractional phase, concurrent with the accretion of the Arabian-Nubian Shield (ANS) to the Saharan Metacraton (SM) and the final assembly between the continental blocks of East and West Gondwana.
Rein Kilk ei loobu Pärnust / Rein Kilk ; interv. Tiiu Leis
Kilk, Rein, 1953-
2007-01-01
Ilmunud ka: Linnaleht : Tartu, 12. okt. 2007, lk. 7-8; Linnaleht : Pärnu, 12. okt. 2007, lk. 7-8. Suurärimees Rein Kilk vastab küsimustele vanade majade taastamisest, plaanidest Pärnus, suhtumisest heidikutesse. Kommenteerivad Peeter Raudsepp ja Elmar Lepp
Pallaslaste maalikunst rahvusraamatukogus / Jüri Hain
Hain, Jüri, 1941-
2008-01-01
Näitus "Pallaslaste maalikunst Eesti Rahvusraamatukogus" rahvusraamatukogu peanäitusesaalis kuni 6. XII. Andrus Johani, Valdemar Väli, Juhan Nõmmiku, Eerik Haameri, Endel Kõksi, Ene Falkenbergi, Silvia Leitu, Olev Mikiveri, Richard Sagritsa, Richard Uutmaa, Valerian Loigu ja Elmar Kitse töödest
Martin S. Kulli fenomen / Arno Oja
Oja, Arno, 1950-
2011-01-01
Kriitik Arno Oja küsib, kes on salapärane romaanikangelane ja harrastusajaloolane Martin S. Kull (kas Ervin Õunapuu?) ning annab hinnangu tema raamatutele "Tartu koonduslaager", "Tapva hämaruse päevaraamat" ja "Elmar Ilp. Veri mu kätel"
Pediatric and youth traffic-collision injuries in Al Ain, United Arab Emirates: a prospective study.
Directory of Open Access Journals (Sweden)
Michal Grivna
Full Text Available AIM: To study the mechanism of road traffic collisions (RTC, use of safety devices, and outcome of hospitalized pediatric and youth RTC injured patients so as to give recommendations regarding prevention of pediatric RTC injuries. METHODS: All RTC injured children and youth (0-19-year-olds who were admitted to Al Ain City's two major trauma centers or who died after arrival to these centers were prospectively studied from April 2006 to October 2007. Demography of patients, road-user and vehicle types, crash mechanism, usage of safety devices, injured body regions, injury severity, Revised Trauma Score, Glasgow Coma Scale, intensive care unit admissions, hospital stay and mortality were analyzed. RESULTS: 245 patients were studied, 69% were vehicle occupants, 15% pedestrians, 9% motorcyclists and 5% bicyclists. 79% were males and 67% UAE citizens. The most common mechanism of RTC was rollover of vehicle (37% followed by front impact collision (32%. 32 (13% of vehicle occupants were ejected from car. 63% of ejected occupants and 70% of motorcyclists sustained head injuries. Only 2% (3/170 vehicle passengers used seatbelts and 13% (3/23 motorcyclists a helmet. CONCLUSIONS: Male drivers and UAE nationals were at high risk of RTC as drivers and as motorcyclists. Ejection rate was high because safety restraint use was extremely low in our community. More education and law enforcement focusing especially on car/booster seat use is needed.
Eestlaste ristid Frösö kiriku juures / Uno Schultz
Schultz, Uno, 1956-
2005-01-01
12. sajandi lõpus Frösö saarele ehitatud samanimeline kirik on Rootsis populaarne laulatuskirik. Kiriku taha surnuaeda on maetud eestlased: Aunpuu, Elmar, Meri, Aarne, Albo, Heino, Lipp, Hindrek, Mälk, Kalju, Koppel, Heinrich, Paju, Sulev, Gorski, Eugenius, Toompuu, Edgar, Lillevars, Helmut, Oskar, Venda, Riis, Walentin
Vaga, Airi, 1940-
2008-01-01
Dr. Arvo ja Mirjam Ederma kodus Belmontis tähistati pidulikult Eesti Vabariigi juubelit. Kohal viibisid ja sõnavõtuga esinesid ka president Toomas Hendrik Ilveselt Valgetähe IV klassi teenetemärgi pälvinud praost Thomas Vaga ja presidendi kunagine skautmaster Elmar "Emu" Saarniit
Käsitöö ja ühistöö. Tallinna diakonisside haigla kabelist Pikva Miikaeli kabeliks
2006-01-01
1891. a. arhitekt Erwin Bernhardi projekti järgi valminud puitkabeli teisaldamisest Pikva mõisa aladele. Teisaldustöid tegi OÜ Kuukaar. Projekti töörühm: Illar Kannelmäe, Mare Kelpmann, Reet Talima, Kaido Ole, Lauri Sillak, Mati Raal, Merike Kallas. Andres Sild mõõdistas ja inventeeris kabeli, Jaanus Vipper restaureeris aknad ja uksed, Tõnu Vainküla orelikapi ja pingid, Indrek Joala paigaldas konstruktsiooniosasid, Tõnu Aru ja Eve Ester jäädvustasid kabeli taastamise. Kabel pühitseti 2. XI 2005
Majadel võiksid olla arhitektide autoritahvlid
2001-01-01
15. VI avatakse hotellil Palace, büroohoonel Vabaduse väljak 10 ja Tõnismäe polikliinikul arhitekt Elmar Lohu autoritahvel tähistamaks tema 100. sünniaastapäeva. Majadele autorimärkide panemise näiteid alates juugendist. Arhitekte kutsutakse üles kinnitama autoritahvleid oma uutele majadele
Eestis võltsitakse kunsti / Pekka Erelt
Erelt, Pekka, 1965-
2000-01-01
25. X 1999 kunstiagentuuri Haus oksjonil Anne Luigele müüdud Elmar Kitse õlimaal "Tants" on tõenäoliselt võltsing. Maie Raitari, Mai Levini, Tiiu Talvistu, Saskia Kasemaa, Jüri Kuuskemaa, Silvia Jõgeveri, Valve Janovi arvamused. Maali värvide keemilise analüüsi teeb EKMi restauraator Alar Nurkse.
Piccolo tõi Soomest taas grand prix'
2009-01-01
Tänavuse Lappeenrantas toimunud rahvusvahelise suupillifestivali võistumängimisel osalesid suupilliklubi Piccolo orkester, kvartett ja noored solistid. Grand prix' ehk suure võidukarika pälvis Piccolo suupillikvartett koosseisus Ilmar Tõnisson, Andrus Haugas, Andres Kokk ja Elmar Trink. Noorte kategooria võitjaks tunnistati Martin Merevits, kolmandad kohad saavutasid Janek Sildvee bluusi- ja Eduard Einmann diatoonilise suupilli kategoorias
1. II avati Rotermanni soolalao kunstimuuseumi näitusesaalis...
2005-01-01
Marco Laimre kuraatorinäitus "Hääled". Väljas on Oskar Kallise, Jaan Toomiku, Rainer Jancise, Elmar Kitse, Evald Okase, Melissa Gordoni (UK), Eduard Wiiralti, Jasper Zoova, Leili Muuga, Marko Mäetamme, Ene-Liis Semperi, Ado Vabbe, Elin Kardi, Kiwa, Peeter Alliku, Kaja Kärneri, Jüri Arraku, Kadi Estlandi ja Ülo Soosteri tööd
Piégay, H.; Hupp, C.R.; Citterio, A.; Dufour, S.; Moulin, B.; Walling, D.E.
2008-01-01
Floodplain development is associated with lateral accretion along stable channel geometry. Along shifting rivers, the floodplain sedimentation is more complex because of changes in channel position but also cutoff channel presence, which exhibit specific overflow patterns. In this contribution, the spatial and temporal variability of sedimentation rates in cutoff channel infill deposits is related to channel changes of a shifting gravel bed river (Ain River, France). The sedimentation rates estimated from dendrogeomorphic analysis are compared between and within 14 cutoff channel infills. Detailed analyses along a single channel infill are performed to assess changes in the sedimentation rates through time by analyzing activity profiles of the fallout radionuclides 137Cs and unsupported 210Pb. Sedimentation rates are also compared within the channel infills with rates in other plots located in the adjacent floodplain. Sedimentation rates range between 0.65 and 2.4 cm a−1 over a period of 10 to 40 years. The data provide additional information on the role of distance from the bank, overbank flow frequency, and channel geometry in controlling the sedimentation rate. Channel infills, lower than adjacent floodplains, exhibit higher sedimentation rates and convey overbank sediment farther away within the floodplain. Additionally, channel degradation, aggradation, and bank erosion, which reduce or increase the distance between the main channel and the cutoff channel aquatic zone, affect local overbank flow magnitude and frequency and therefore sedimentation rates, thereby creating a complex mosaic of sedimentation zones within the floodplain and along the cutoff channel infills. Last, the dendrogeomorphic and 137Cs approaches are cross validated for estimating the sedimentation rate within a channel infill.
MR imaging findings of anterior interosseous nerve lesions
Energy Technology Data Exchange (ETDEWEB)
Dunn, Andrew J. [Royal Liverpool University Hospital, Department of Medical Imaging, Liverpool (United Kingdom); Salonen, David C. [University of Toronto, Toronto Western Hospital, Department of Medical Imaging, Toronto, Ontario (Canada); Anastakis, Dimitri J. [University of Toronto, Toronto Western Hospital, Division of Plastic Surgery, Toronto, Ontario (Canada)
2007-12-15
To study and characterise the MR imaging findings of lesions of the anterior interosseous nerve (AIN). Magnetic resonance imaging (MRI) findings of the forearm of ten patients referred to our institution with suspected AIN lesions were retrospectively studied. Five healthy volunteers with normal forearm MRI findings formed a control group. Two musculoskeletal radiologists assessed the forearm musculature for oedema in the distribution of the AIN, median, posterior interosseous and radial nerves on T2-weighted (T2W) fat-saturated sequences. T1-weighted (T1W) images were assessed and graded for the presence of muscle atrophy and fatty involution. Six patients had undergone surgical exploration; five of these had surgically confirmed AIN compression. Four patients had diagnoses other than AIN compression made on imaging features. Of the cases of proven AIN compression, oedema within the pronator quadratus (PQ) muscle was identified in all cases. PQ atrophy and fatty involution were seen in three (43%) surgically confirmed cases. Cases 2 and 3 also demonstrated oedema in the flexor digitorum profundus (FDP)1 and FDP2 muscles. These cases also showed oedema in the flexor-carpi radialis (FCR) and FDP3/FDP4 muscles, respectively. The four cases of non-AIN compression demonstrated muscle oedema patterns that were atypical for the AIN distribution. They included a rupture of the flexor pollicis longus (FPL) tendon, brachial neuritis, amyotrophic lateral sclerosis and compression of the proximal median nerve. MRI is a useful investigation in the diagnostic workup of AIN syndrome. AIN syndrome is likely when there is diffuse oedema of AIN innervated muscles on T2W fat-saturated images. The most reliable sign of an AIN lesion is oedema within the PQ. Oedema in the flexor carpi radialis, FDP3 and FDP4, although not in the classical distribution of the AIN, does not preclude the diagnosis of AIN syndrome. (orig.)
MR imaging findings of anterior interosseous nerve lesions
International Nuclear Information System (INIS)
Dunn, Andrew J.; Salonen, David C.; Anastakis, Dimitri J.
2007-01-01
To study and characterise the MR imaging findings of lesions of the anterior interosseous nerve (AIN). Magnetic resonance imaging (MRI) findings of the forearm of ten patients referred to our institution with suspected AIN lesions were retrospectively studied. Five healthy volunteers with normal forearm MRI findings formed a control group. Two musculoskeletal radiologists assessed the forearm musculature for oedema in the distribution of the AIN, median, posterior interosseous and radial nerves on T2-weighted (T2W) fat-saturated sequences. T1-weighted (T1W) images were assessed and graded for the presence of muscle atrophy and fatty involution. Six patients had undergone surgical exploration; five of these had surgically confirmed AIN compression. Four patients had diagnoses other than AIN compression made on imaging features. Of the cases of proven AIN compression, oedema within the pronator quadratus (PQ) muscle was identified in all cases. PQ atrophy and fatty involution were seen in three (43%) surgically confirmed cases. Cases 2 and 3 also demonstrated oedema in the flexor digitorum profundus (FDP)1 and FDP2 muscles. These cases also showed oedema in the flexor-carpi radialis (FCR) and FDP3/FDP4 muscles, respectively. The four cases of non-AIN compression demonstrated muscle oedema patterns that were atypical for the AIN distribution. They included a rupture of the flexor pollicis longus (FPL) tendon, brachial neuritis, amyotrophic lateral sclerosis and compression of the proximal median nerve. MRI is a useful investigation in the diagnostic workup of AIN syndrome. AIN syndrome is likely when there is diffuse oedema of AIN innervated muscles on T2W fat-saturated images. The most reliable sign of an AIN lesion is oedema within the PQ. Oedema in the flexor carpi radialis, FDP3 and FDP4, although not in the classical distribution of the AIN, does not preclude the diagnosis of AIN syndrome. (orig.)
Directory of Open Access Journals (Sweden)
Katre Talviste
2013-12-01
Full Text Available This article positions the translations of French verse works (plays and selected collections of individual poets that August Sang, Jaan Kross and Ain Kaalep made in the 1960s, onto the background of their own original works. At that time, August Sang translated four plays by Molière (The Misanthrope, Tartuffe, The School for Wives in 1961; Amphitryon in 1961, which have already been discussed in relation to the tradition of translating the French syllabic verse into Estonian, because these translations form a considerable part of the body of Estonian translations of French verse poetry. For Jaan Kross and Ain Kaalep, the wider context is created by the so-called free verse battles in the 1950s, to which we can link Kross’ translation of a selected collection of Éluard (Veel enne kostma peab, 1969 and Kaalep’s translation of a selected collection of Prévert (Kuidas portreteerida lindu, 1965. One of the two remaining translations by Kross, (Rostand’s Cyrano de Bergerac, 1964, can also be examined in relation to the problems of translating verse, but the other, (Béranger’s Laulud, 1963, should be discussed in the framework of intellectual and cultural resistance, a part of which was also the struggle put up for the existence of free verse in the 1950s and 1960s. Of August Sang’s original work, the article examines his collection of poems Võileib suudlusega (1963, written simultaneously with his translations of Molière’s plays and published right after them. Both the translations and the collection of original poems have attracted critics’ attention with their remarkable lack of linguistic constraint and simplicity. Although Sang has rarely voiced theoretical ideas about translation or explained his method, both his poetic image, outlined in the collection Võileib suudlusega, and his search for right words, reflected in the drafts of his translations, let us believe that the simplicity of expression and the avoidance of marked
80 aastat tagasi : Veebruar 1927 / Mati Märtin
Märtin, Mati
2007-01-01
Kultuuri- ja muusikasündmustest: ajaloolisest üritusest 20. veebr. Estonia Kontserdisaalis, Palamuse kiriku uue kella pühitsemisest 20. veebr., Mozarti "Reekviemi" ettekandest Estonia kontserdisaalis, Tallinna Kaarli Lauluseltsi korralisest peakoosolekust 7. veebr., kontserdist Kaarli kirikus (esinesid organist Paul Pressnikoff, laulja Tenno Vironi ja tšellist Raimond Bööcke), kontserdist Viljandi Jaani kirikus (esinesid bassilaulja Hans Siimer ja organist Elmar Rossman)
International Nuclear Information System (INIS)
Yohannan, Jinu P.; Vidyasagar, Kanamaluru
2016-01-01
Ten AInM′S 4 (A=alkali metals, Tl; M′= Ge, Sn) compounds with diverse structure types have been synthesized and characterized by single crystal and powder X-ray diffraction and a variety of spectroscopic methods. They are wide band gap semiconductors. KInGeS 4 (1-β), RbInGeS 4 (2), CsInGeS 4 (3-β), TlInGeS 4 (4-β), RbInSnS 4 (8-β) and CsInSnS 4 (9) compounds with three-dimensional BaGa 2 S 4 structure and CsInGeS 4 (3-α) and TlInGeS 4 (4-α) compounds with a layered TlInSiS 4 structure have tetrahedral [InM′S 4 ] − frameworks. On the other hand, LiInSnS 4 (5) with spinel structure and NaInSnS 4 (6), KInSnS 4 (7), RbInSnS 4 (8-α) and TlInSnS 4 (10) compounds with layered structure have octahedral [InM′S 4 ] − frameworks. NaInSnS 4 (6) and KInSnS 4 (7) compounds undergo facile topotactic ion-exchange, at room temperature, with various mono-, di- and tri-valent cations in aqueous medium to give rise to metastable layered phases. - Graphical abstract: NaInSnS 4 and KInSnS 4 compounds undergo, in aqueous medium at room temperature, facile topotactic ion-exchange with mono, di and trivalent cations. Display Omitted - Highlights: • Ten AInM′S 4 compounds with diverse structure types were synthesized. • They are wide band gap semiconductors. • NaInSnS 4 and KInSnS 4 compounds undergo facile topotactic ion-exchange at room temperature.
Energy Technology Data Exchange (ETDEWEB)
Qi-Chu Zhang [The University of Sydney (Australia). School of Physics; Shen, Y.G. [City University of Hong Kong (Hong Kong). Department of Manufacturing Engineering and Engineering Management
2004-01-25
High solar performance W-AIN cermet solar coatings were designed using a numerical computer model and deposited experimentally. In the numerical calculations aluminium oxynitride (AlON) was used as ceramic component. The dielectric functions and then complex refractive index of W-AlON cermet materials were calculated using the Sheng's approximation. The layer thickness and W metal volume fraction were optimised to achieve maximum photo-thermal conversion efficiency for W-AlON cermet solar coatings on an Al reflector with a surface AlON ceramic anti-reflection layer. Optimisation calculations show that the W-AlON cermet solar coatings with two and three cermet layers have nearly identical solar absorptance, emittance and photo-thermal conversion efficiency that are much better than those for films with one cermet layer. The optimised calculated AlON/W-AlON/Al solar coating film with two cermet layers has a high solar absorptance of 0.953 and a low hemispherical emittance of 0.051 at 80{sup o}C for a concentration factor of 2. The AlN/W-AlN/Al solar selective coatings with two cermet layers were deposited using two metal target direct current magnetron sputtering technology. During the deposition of W-AlN cermet layer, both Al and W targets were run simultaneously in a gas mixture of argon and nitrogen. By substrate rotation a multi-sub-layer system consisting of alternating AlN ceramic and W metallic sub-layers was deposited that can be considered as a macro-homogeneous W-AlN cermet layer. A solar absorptance of 0.955 and nearly normal emittance of 0.056 at 80{sup o}C have been achieved for deposited W-AlN cermet solar coatings. (author)
Anna Pantelia
2013-01-01
18 octobre 2013 - Le Préfet de l’Ain L. Touvet signe le livre d'or avec le Directeur général du CERN R. Heuer et le Chef du Département Technologie F. Bordry. Photo de groupe, de gauche à droite: T. Kupisz,\tSecrétaire général de la sous préfecture de Gex; L. Miralles, Chef du Département Infrastructure et services généraux; F. Eder, Délégué aux Relations avec les Etats hôtes; S. Donnot, Sous-préfet de Gex; L. Touvet, Préfet de l'Ain; E. Sches, Sous-préfète de Nantua; E.Gröniger-Voss, Conseiller juridique du CERN; R. Heuer, Directeur général; F. Bordry, Chef du Département Technologie et P. Bloch, Chef du Département Physique.
Tartu Ülikooli Õigusteaduskonna kogu viimase koosseisu saatusest / Artur Taska
Taska, Artur, 1912-1994
1989-01-01
Sisaldab andmeid Ants Piibu, D. Grimmi, I. Tjutrjumovi, Artur-Tõeleid Kliimanni, Ernst Eini, Nikolai Maimi, Mart Nurga, Jüri Uluotsa, Elmar Ilusa, H. Kadari, L. Leesmenti, Juhan Vaabeli, Richard, Räägo, Otto Liivi, Hans Ronimoisi, T. Grünthali, Veera Poska-Grünthali, Artur Mägi, F. Malmi, G. Rooksi, Valmar Adamsi, Paul Vihalema, Rein Eliaseri, A. Rammuli, H. Randalu, Edgar Talviku, A. Perandi ja Väino Langi kohta
Tartu maalikoolkonna entusiastlik väljendus (1962-1985) / Krista Sõster
Sõster, Krista
2010-01-01
Vaadeldakse Tartu professionaalsete maalikunstnike veidi tähelepanuta jäänud monumentaalteoseid. Detailsemalt on kirjeldatud Lagle Israeli merekividest mosaiikpannoosid "Eestlaste muistne tähistaevas" (1962-1964) Tõravere observatooriumis ja "Viljandi ürgorg" (1968-1982) EPA-s, Ilmar Malini pannood "Strata vitae" (1970-1973) Zooloogia ja Botaanika Instituudis ja "Lehed ajas" (1983) Tartu Postimehe toimetuses, Elmar Kitse segatehnikas sgrafiitopannood (1965) restoranis "Tarvas" ning ukraina kunstnik V. Tovtini mosaiikseina (1974) Tartu katseremonditehases
African Journals Online (AJOL)
Professor of Genetics (Cytogenetics), Faculty of Medicine, Ain Shams University, Cairo, Egypt. Hosam A Abdel-Ghany. Consultant of Medical Human Genetics, Medical Genetic Center, Ain Shams University, Cairo, Egypt. Nermin S Elsayed. Consultant of Medical Human Genetics, Medical Genetics Center, Ain Shams ...
Directory of Open Access Journals (Sweden)
Issam Sellika
2016-10-01
Full Text Available Au Maroc, l’utilisation des eaux souterraines pour l’irrigation a permis un développement agricole rapide dans de nombreuses régions, mais a aussi fait émerger des situations de baisse des niveaux piezométriques des nappes qui menacent la durabilité de cette agriculture irriguée. L’article présente une action de recherche portant sur la conception d’un projet de territoire agricole durable alliant développement agricole et usage pérenne des ressources en eau souterraine. L’étude a eu lieu dans la zone d’Ain Timguenay (province de Séfrou, qui connait un fort développement de la production de pommes et de prunes depuis une quinzaine d’années. Le programme de recherche a impliqué les agriculteurs, la commune rurale d’Ain Timguenay, les institutions du Ministère de l’Agriculture et l’Agence de bassin hydraulique du Sébou. Une analyse des dynamiques agricoles locales et des tendances nationales a servi de support aux discussions. L’étude de l’aquifère et de ses usages a permis d’établir un bilan sommaire et un ordre de grandeur des surfaces qui pourraient encore être plantées sans que les consommations en eau soient supérieures à la recharge de l’aquifère en année pluviométrique moyenne. Une réflexion prospective menée avec les agriculteurs a mis en évidence deux scénarios possibles à l’échelle locale: 1 un scénario où les difficultés économiques que rencontrent actuellement les exploitations de la zone se renforcent, conduisant à un ralentissement des nouvelles plantations, d’où une pression limitée sur la nappe ; 2 un scénario où les exploitations réussissent à faire face aux défis actuels de production et de commercialisation et de ce fait continuent à planter, ce qui conduit à une consommation en eau bien supérieure à la recharge de la nappe. L’ensemble des acteurs impliqués a participé à l’élaboration d’un troisième scénario permettant de concilier d
Migration as a solution to regional disparities in Estonia / Rait Raal
Raal, Rait
2003-01-01
Üheks regionaalsete erinevuste vähendamise võimaluseks on riigisisene migratsioon, mis kaotaks regionaalsed erinevused palkades ja töötuse määrades. Analüüs näitas, et ränne ei ole piisav vahend regionaalsete erinevuste vähendamiseks. Diagramm. Tabel
Lee, Su Young; Kim, Sang Ho
2014-12-01
The purpose of this study is to investigate the friction and wear behaviors of CrN, TiN, CrAlN, and TiAIN coated onto SKD61 for application to Al 7000 series extrusion dies. On the wear test, the experimental parameters are the load and the counter material's temperature. The results showed that the friction coefficient increased with load but decreased with the counter material's temperature, and the friction coefficients of CrN and CrAIN were lower than the friction coefficients of TiAIN and TIN, especially at a higher temperature. The wear track with different coatings identified different wear behaviors; the wear behavior of CrAIN was found to be abrasive, but the wear behavior of TiN, CrN, and TiAIN was adhesive. Therefore, CrAIN showed the least wear loss with a lower friction coefficient and less adhesion with counter materials at the highest range of wear load and temperature. This resulted in the easy formation of aluminum oxide in the wear track and less Al adhesion; moreover during the hard second phase, AIN dispersed in the film during deposition.
Face to face with the Muslim “other”: European cinematic responses to Al-Qaeda
Caoduro, Elena
2011-01-01
The bombings on March 11, 2004 in Madrid and on July 7, 2005 in London brought terror to the heart of Europe and amplified the feelings of fear, disbelief and suspicion developed as a consequence of 9/11 trauma. This article departs from Hollywood discourses on international terrorism to investigate how European cinema reflected upon these tragedies. Focusing on the films Fremder Freund (The Friend, Elmar Fischer, 2003)and London River (Rachid Bouchareb, 2009), it outlines the peculiarities o...
Steinbach, Kadri
2004-01-01
Uutest muusikaraamatutest Elmar Arro "Vana aja muusikud", "Neeme Järvi. Encore!", J. Jürisson "Muusikud Kapid ja Suure-Jaani", V. Ojakäär "Omad viisid võõras väes", K. Pappel "Ooper Tallinnas 19. sajandil", V. Rumessen "Eduard Tubin", "Eduard Tubin. Rändavate vete ääres", A. Vahter "Eestikeelse muusikaterminoloogia kujunemine ja areng", A. Vahter "Kui mina alles nor veel olin", "A composition as a problem", "Cyrillus Kreek. helilooja", "Lepo Sumera", "Vardo Rumessen. Bibliograafia"
Allergic Interstitial Nephritis Manifesting as a Striated Nephrogram
Directory of Open Access Journals (Sweden)
Irfan Moinuddin
2015-01-01
Full Text Available Allergic interstitial nephritis (AIN is an underdiagnosed cause of acute kidney injury (AKI. Guidelines suggest that AIN should be suspected in a patient who presents with an elevated serum creatinine and a urinalysis that shows white cells, white cell casts, or eosinophiluria. Drug-induced AIN is suspected if AKI is temporally related to the initiation of a new drug. However, patients with bland sediment and normal urinalysis can also have AIN. Currently, a definitive diagnosis of AIN is made by renal biopsy which is invasive and fraught with risks such as bleeding, infection, and hematoma. Additionally, it is frequently unclear when a kidney biopsy should be undertaken. We describe a biopsy proven case of allergic interstitial nephritis which manifested on contrast enhanced Magnetic Resonance Imaging (MRI as a striated nephrogram. Newer and more stable macrocyclic gadolinium contrast agents have a well-demonstrated safety profile. Additionally, in the presentation of AKI, gadolinium contrast agents are safe to administer in patients who demonstrate good urine output and a downtrending creatinine. We propose that the differential for a striated nephrogram may include AIN. In cases in which the suspicion for AIN is high, this diagnostic consideration may be further characterized by contrast enhanced MRI.
Risk Factors for the presence of anal intraepithelial neoplasia in HIV+ men who have sex with men
Richel, Olivier; de Vries, Henry J. C.; Dijkgraaf, Marcel G. W.; van Noesel, Carel J. M.; Prins, Jan M.
2013-01-01
Anal Intraepithelial Neoplasia (AIN) is present in the majority of HIV+ men who have sex with men (MSM) and routine AIN-screening is subject of discussion. In this study we analysed a wide range of potential risk factors for AIN in order to target screening programs. We screened 311 HIV+ MSM by high
Anterior interosseous nerve syndrome diagnosis and intraoperative findings: A case report
Directory of Open Access Journals (Sweden)
Abdulla Aljawder
2016-01-01
Conclusion: Clinical suspicion should arise in the presence of isolated paralysis of the AIN-supplied muscles. MRI and electrodiagnostic studies will confirm the diagnosis and identify the etiology. The optimal treatment of AIN syndrome has not been established. We recommend surgical intervention in confirmed AIN syndrome from compression neuropathy, refractive to conservative therapy.
Giusti, Christian; Louchet, André; Beuzen-Waller, Tara; Ragala, Rachid; Pavlopoulos, Kosmas; Fouache, Éric; Cohen, Marianne; Desruelles, Stéphane; Gramond, Delphine
2015-04-01
human settlements and occupation, it is possible to characterize a threefold transition: first, the former transition between the pre-Islamic prehistoric societies and the development of Muslim societies; second, the more recent transition between the traditional historical society (farmers) and the contemporary society, characterized by the growth of urbanization, the creation of modern transport infrastructure and the concomitant growth of tourist flows; third, the current transition between the yesterday and tomorrow Al Ain City, due to the transformation of a local town centred on national economics all along the second half of the twentieth century, into an international town more open to the wider world with the management of a possible increased 20 % of tourist flow because of the inscription of Cultural Sites of Al Ain on the UNESCO's World Heritage List. It is not possible to completely ignore the fact that the Jebel Hafit and its foothills are partly crossed by an international boundary. In case of political tensions, this may cause some difficulties for the management of this territory, with contradictory requirements between security, tourism, traditional land use, and scientific research.
Acute interstitial nephritis with acetaminophen and alcohol intoxication
Directory of Open Access Journals (Sweden)
Alexopoulou Iakovina
2011-04-01
Full Text Available Abstract Drug-induced acute interstitial nephritis (AIN represents a growing cause of renal failure in current medical practice. While antimicrobials and non-steroidal anti-inflammatory drugs are typically associated with drug-induced AIN, few reports have been made on the involvement of other analgesics. We report our experience in managing a 17-year-old female with AIN and subsequent renal injury following an acetaminophen overdose in conjunction with acute alcohol intoxication. It is well established that acetaminophen metabolism, particularly at high doses, produces reactive metabolites that may induce renal and hepatic toxicity. It is also plausible however, that such reactive species could instead alter renal peptide immunogenicity, thereby inducing AIN. In the following report, we review a possible mechanism for the acetaminophen-induced AIN observed in our patient and also discuss the potential involvement of acute alcohol ingestion in disease onset. The objective of our report is to increase awareness of healthcare professionals to the potential involvement of these commonly used agents in AIN pathogenesis.
Energy Technology Data Exchange (ETDEWEB)
Yohannan, Jinu P.; Vidyasagar, Kanamaluru, E-mail: kvsagar@iitm.ac.in
2016-06-15
Ten AInM′S{sub 4} (A=alkali metals, Tl; M′= Ge, Sn) compounds with diverse structure types have been synthesized and characterized by single crystal and powder X-ray diffraction and a variety of spectroscopic methods. They are wide band gap semiconductors. KInGeS{sub 4}(1-β), RbInGeS{sub 4}(2), CsInGeS{sub 4}(3-β), TlInGeS{sub 4}(4-β), RbInSnS{sub 4}(8-β) and CsInSnS{sub 4}(9) compounds with three-dimensional BaGa{sub 2}S{sub 4} structure and CsInGeS{sub 4}(3-α) and TlInGeS{sub 4}(4-α) compounds with a layered TlInSiS{sub 4} structure have tetrahedral [InM′S{sub 4}]{sup −} frameworks. On the other hand, LiInSnS{sub 4}(5) with spinel structure and NaInSnS{sub 4}(6), KInSnS{sub 4}(7), RbInSnS{sub 4}(8-α) and TlInSnS{sub 4}(10) compounds with layered structure have octahedral [InM′S{sub 4}]{sup −} frameworks. NaInSnS{sub 4}(6) and KInSnS{sub 4}(7) compounds undergo facile topotactic ion-exchange, at room temperature, with various mono-, di- and tri-valent cations in aqueous medium to give rise to metastable layered phases. - Graphical abstract: NaInSnS{sub 4} and KInSnS{sub 4} compounds undergo, in aqueous medium at room temperature, facile topotactic ion-exchange with mono, di and trivalent cations. Display Omitted - Highlights: • Ten AInM′S{sub 4} compounds with diverse structure types were synthesized. • They are wide band gap semiconductors. • NaInSnS{sub 4} and KInSnS{sub 4} compounds undergo facile topotactic ion-exchange at room temperature.
Berreur, B; Guerin, F; Christophe, B; Limido, G; Paubel, P
2018-01-01
To evaluate the economic impact of future prescriptions of etanercept and adalimumab biosimilars at the territorial scale covered by PharmAlp'Ain, a hospitals grouping of orders for health products. Determination of the number and status of patients (naive or in continuation of treatment) from the National Database "Datamart de Consommation Inter-Régimes" of health insurance, concerned by a dispensation in a pharmacy of etanercept or adalimumab in 2015. Calculation of potential savings in case of biosimilar requirements according to 3 hypotheses: 63% (rate observed in a previous study) of initiations are treated with biosimiliaries and the others by princeps (H 1 ); all initiations under biosimilars and continuation therapy with the princeps (H 2 ) or all patients are treated with biosimilars (H 3 ). The annual savings are estimated at 237,000 € with the H 1 hypothesis. In the case of H 2 , the expected savings would be 376,200 € per year. In the case of H 3 , savings for the community could reach almost 1,282,800 € per year. The arrival of biosimilars allows significant savings for medicines market. According to the French recommendations in 2016, the expected savings are between the H 1 and H 2 hypothesis. The rate of penetration of biosimilars depends on many factors such as the involvement of health professionals, patient adherence, or health authority recommendations. Copyright © 2017 Académie Nationale de Pharmacie. Published by Elsevier Masson SAS. All rights reserved.
LENUS (Irish Health Repository)
Garvey, J P
2009-11-01
Acute interstitial nephritis (AIN) secondary to trimethoprim-sulfamethoxazole (TMP-SMX) is well documented as a cause of acute renal failure in native kidneys. TMP-SMX is the standard prophylactic agent against pneumocystis carinii (PCP) used in the early post-transplant period, however, it has to date only been indirectly associated with AIN in renal allografts. DESIGN, SETTING, PARTICIPANTS AND MEASUREMENTS: We describe eleven renal transplant patients with acute allograft dysfunction in whom a transplant biopsy demonstrated primary histopathologic features of allergic AIN, all of whom were receiving TMP-SMX in addition to other medications known to cause AIN.
Non-native acylated homoserine lactones reveal that LuxIR quorum sensing promotes symbiont stability
Ho, Jessica S.; Geske, Grant D.; Blackwell, Helen E.; Ruby, Edward G.
2014-01-01
SUMMARY Quorum sensing, a group behavior coordinated by a diffusible pheromone signal and a cognate receptor, is typical of bacteria that form symbioses with plants and animals. LuxIR-type acyl homoserine-lactone (AHL) quorum sensing is common in Gram-negative proteobacteria, and many members of this group have additional quorum-sensing networks. The bioluminescent symbiont Vibrio fischeri encodes two AHL signal synthases: AinS and LuxI. AinS-dependent quorum sensing converges with LuxI-dependent quorum sensing at the LuxR regulatory element. Both AinS- and LuxI-mediated signaling are required for efficient and persistent colonization of the squid host, Euprymna scolopes. The basis of the mutualism is symbiont bioluminescence, which is regulated by both LuxI- and AinS-dependent quorum sensing, and is essential for maintaining a colonization of the host. Here, we used chemical and genetic approaches to probe the dynamics of LuxI- and AinS-mediated regulation of bioluminescence during symbiosis. We demonstrate that both native AHLs and non-native AHL analogs can be used to non-invasively and specifically modulate induction of symbiotic bioluminescence via LuxI-dependent quorum sensing. Our data suggest that the first day of colonization, during which symbiont bioluminescence is induced by LuxIR, is a critical period that determines the stability of the V. fischeri population once symbiosis is established. PMID:24191970
Cleary, Michelle; Horsfall, Jan; O'Hara-Aarons, Maureen; Mannix, Judy; Jackson, Debra; Hunt, Glenn E
2012-04-01
Undergraduate nurses are employed as assistants in nursing (AIN) in inpatient mental health settings; however, there is a paucity of published research exploring registered nurses' (RN) views about the AIN role in these settings. This qualitative study documents the views and experiences of RN working with undergraduate AIN. Fifty structured face-to-face interviews were analysed, and the results are discussed in three sections. The first section outlines RN perceptions of qualities and skills required of AIN in mental health, and the responses primarily focus on communication skills, initiative, and willingness to learn. The second section targets factors in the workplace that might enhance the interest of AIN in a mental health nursing career; the responses emphasize their need to work with experienced staff. The last section outlines RN expectations of AIN, most of which are met and involve physical observations and technical tasks; less fulfilled activities primarily cluster around interactions with patients. Findings highlight the advantages and disadvantages of drawing on undergraduate nursing students as AIN in mental health settings. Communication skills, personal initiative, safety training to prevent violence, and education to increase knowledge and awareness about mental illness, diagnosis, and mental status-related skills were all important concerns articulated by RN. © 2011 The Authors. International Journal of Mental Health Nursing © 2011 Australian College of Mental Health Nurses Inc.
Azab, Sonya M S; Hirshon, Jon Mark; Hirshon, John Mark; Hayes, Bryan D; El-Setouhy, Maged; Smith, Gordon S; Sakr, Mahmoud Lotfy; Tawfik, Hany; Klein-Schwartz, Wendy
2016-01-01
Pediatric poisonings represent a major and preventable cause of morbidity and mortality throughout the world. Epidemiologic information about poisoning among children in many lower- and middle-income countries is scarce. This study describes the epidemiology of acute poisonings in children presenting to Ain Shams University's Poisoning Treatment Center (ASU-PTC) in Cairo and determines the causative agents and characteristics of acute poisoning in several pediatric age groups. This retrospective study involved acutely poisoned patients, 0-18 years of age, who presented to the ASU-PTC between 1 January 2009 and 31 December 2013. Data were extracted from electronic records maintained by the ASU-PTC. Collected data included demographics, substance of exposure, circumstances of the poisoning, patient disposition, and outcome. During the 5-year study period, 38 470 patients meeting our criteria were treated by the ASU-PTC; 19 987 (52%) were younger than 6 years of age; 4196 (11%) were 6-12 years; and 14 287 (37%) were >12 years. Unintentional poisoning accounted for 68.5% of the ingestions, though among adolescents 84.1% of ingestions were with self-harm intent. In all age groups, the most frequent causative drugs were non-opioid analgesics, antipyretics, and antirheumatics. The most common nonpharmaceutical agents were corrosives in preschool children and pesticides in adolescents. Most patients had no/minor effects (29 174 [75.8%]); hospitalization rates were highest among adolescents. There were 119 deaths (case fatality rate of 0.3), primarily from pesticide ingestion. Poisoning in preschool children is mainly unintentional and commonly due to nonpharmaceutical agents whereas poisoning in adolescents is mainly intentional (self-harm). Pesticides, mainly organophosphorous compounds and carbamates, were the most frequent agents leading to morbidity and mortality.
Directory of Open Access Journals (Sweden)
Ahmad Saleh Al Khatib
2014-05-01
Full Text Available The objective of the present study was to investigate the relationship between time management, perceived stress, gender and academic achievement among United Arab Emirates college students. The respondents were 352 college students from Al Ain University of Science and Technology. The sample was stratified by sex. Among the respondents, 52.5% were female students and 47.5% were male students. The mean age of the sample was 23.4 years ranging from 18 to 39. Time management was measured by Time Management Questionnaire” developed by Britton and Tesser (1991, while perceived stress was measured by The Perceived Stress Scale developed by Cohen (1985. The findings of the study showed that there was statistically significant negative relationship between time management and perceived stress. Females reported higher time management compared to their males counter mates. Higher time management and lower perceived stress were associated with high levels of academic achievement. However, time management was the most significant predictor of academic achievement accounting for 26 % of the variance while perceived stress accounted for an additional 11.2% of the variance in academic achievement. All three predictors explained 29.4% (R = .543 of total variance. The implications and limitations are reviewed as are the suggestions for future research. Keywords: Time management, perceived stress, academic achievement, college students.
Zeng, Huawei; Ishaq, Suzanne L; Liu, Zhenhua; Bukowski, Michael R
2018-04-01
The increasing worldwide incidence of colon cancer has been linked to obesity and consumption of a high-fat Western diet. To test the hypothesis that a high-fat diet (HFD) promotes colonic aberrant crypt (AC) formation in a manner associated with gut bacterial dysbiosis, we examined the susceptibility to azoxymethane (AOM)-induced colonic AC and microbiome composition in C57/BL6 mice fed a modified AIN93G diet (AIN, 16% fat, energy) or an HFD (45% fat, energy) for 14 weeks. Mice receiving the HFD exhibited increased plasma leptin, body weight, body fat composition and inflammatory cell infiltration in the ileum compared with those in the AIN group. Consistent with the gut inflammatory phenotype, we observed an increase in colonic AC, plasma interleukin-6, tumor necrosis factor-α, monocyte chemoattractant protein-1 and inducible nitric oxide synthase in the ileum of the HFD-AOM group compared with the AIN-AOM group. Although the HFD and AIN groups did not differ in bacterial species number, the HFD and AIN diets resulted in different bacterial community structures in the colon. The abundance of certain short-chain fatty acid (SCFA) producing bacteria (e.g., Barnesiella) and fecal SCFA (e.g., acetic acid) content were lower in the HFD-AOM group compared with the AIN and AIN-AOM groups. Furthermore, we identified a high abundance of Anaeroplasma bacteria, an opportunistic pathogen in the HFD-AOM group. Collectively, we demonstrate that an HFD promotes AC formation concurrent with an increase of opportunistic pathogenic bacteria in the colon of C57BL/6 mice. Published by Elsevier Inc.
"Kurja lillede" kuus ärakeelatud luuletust / Charles Baudelaire ; saatesõna: Marek Tamm
Baudelaire, Charles
2000-01-01
Sisu: Kalliskivid / tlk. Ain Kaalep ; Lethe / tlk. Märt Väljataga ; Temale, kes on liiga rõõmus / tlk. Ain Kaalep ; Lesbos / tlk. Ilmar Laaban ; Äraneetud naised (Delphine ja Hyppolyte) / tlk. Ain Kaalep ; Vampiiri metamorfoosid / tlk. August Sang. Orig.: Les Bijoux ; Le Léthé ; A celle qui est trop gaie ; Lesbos ; Femmes damnées. Delphine et Hippolyte ; Les Métamorphoses du vampire
Fractal dimension and image statistics of anal intraepithelial neoplasia
International Nuclear Information System (INIS)
Ahammer, H.; Kroepfl, J.M.; Hackl, Ch.; Sedivy, R.
2011-01-01
Research Highlights: → Human papillomaviruses cause anal intraepithelial neoplasia (AIN). → Digital image processing was carried out to classify the grades of AIN quantitatively. → The fractal dimension as well as grey value statistics was calculated. → Higher grades of AIN yielded higher values of the fractal dimension. → An automatic detection system is feasible. - Abstract: It is well known that human papillomaviruses (HPV) induce a variety of tumorous lesions of the skin. HPV-subtypes also cause premalignant lesions which are termed anal intraepithelial neoplasia (AIN). The clinical classification of AIN is of growing interest in clinical practice, due to increasing HPV infection rates throughout human population. The common classification approach is based on subjective inspections of histological slices of anal tissues with all the drawbacks of depending on the status and individual variances of the trained pathologists. Therefore, a nonlinear quantitative classification method including the calculation of the fractal dimension and first order as well as second order image statistical parameters was developed. The absolute values of these quantitative parameters reflected the distinct grades of AIN very well. The quantitative approach has the potential to decrease classification errors significantly and it could be used as a widely applied screening technique.
Laste seksuaalse väärkohtlemise kui kuriteoliigi tendentsid / Elmar Nurmela
Nurmela, Elmar
2000-01-01
Seadusandlikest muudatustest laste seksuaalse ärakasutamise tõkestamiseks. Lisatud statistilised tabelid laste kallal toime pandud seksuaalkuritegude ja alaealiste prostituutide kohta aastatel 1994-1999
Directory of Open Access Journals (Sweden)
Saula Goulart Chaud
2007-06-01
Full Text Available Os índices séricos de glicose e lipídios, a microbiota intestinal e a produção de ácidos graxos voláteis de cadeias curtas (AGV foram determinados em ratos Wistar submetidos às dietas: padrão (AIN-P, padrão modificada (AIN-M e às dietas contendo frações de parede celular de levedura: glicana insolúvel (GI, manana (M e glicana mais manana (G+M, como única fonte de fibra alimentar. O fracionamento da parede celular (PC foi realizado por processos físicos e químicos de extração, centrifugação e secagem em "spray dryer". Os índices séricos foram dosados através de "kits" comerciais. A microbiota e a produção de AGV foram determinadas nos conteúdos intestinais, incluindo cólon, ceco e reto. Considerando os níveis de colesterol no tempo (T0 e no tempo 28 (T28, as dietas AIN-P, AIN-M e M apresentaram efeito hipocolesterolêmico, tendo em vista que a composição das dietas eram de natureza hipercolesterolêmica. Em relação à glicose sérica, no tempo (T0 observou-se uma elevação geral da glicemia, sugerindo um efeito hiperglicêmico das dietas estudadas. A dieta G+M foi a que apresentou valores significantemente mais elevados de lipídios séricos no tempo T14, e os níveis mais baixos foram observados na dieta M e na dieta GI no T14 e nas dietas AIN-M e AIN-P. A dieta AIN-P foi a que apresentou valor significantemente mais elevado de triacilgliceróis nos tempos T14 e T28. Os níveis mais baixos nos tempos T14 foram constatados para as dietas G+M e GI e no tempo T28 para as dietas AIN-M e M. De um modo geral, não houve modificações significativas na microbiota intestinal dos animais em nenhuma das dietas. Dentre os AGV, o ácido acético foi o predominante, seguido do propiônico e do butírico, em todas as dietas estudadas.The blood serum indexes of glucose and lipids, the intestinal microbiota and the production of volatile fatty acids (VFA were determined in Wistar rats which were fed a standard (AIN-P diet, a
Kebbouche-Gana, Salima; Gana, Mohamed Lamine; Ferrioune, Imen; Khemili, Souad; Lenchi, Nesrine; Akmouci-Toumi, Sihem; Bouanane-Darenfed, Nabila Amel; Djelali, Nacer-Eddine
2013-11-01
A bacterial strain E21 was isolated from a sample of water collected in the salt lake located close to Ain Salah, Algeria. The analysis of 16S rRNA gene sequence had indicated that the strain had 93 % sequence similarity with the genus Natrialba sp. strain E21 (GenBank, FR750525.1) and was considered extremely halophilic. Production of biosurfactant by the strain E21 with free and entrapped cells was investigated using soluble starch in the saline conditions. Biosurfactant synthesis was followed by measuring the surface tension and emulsifying index 9 days under optimal conditions (40 °C, pH 7). Some diffusional limitations in alginate and agar beads affected the kinetics of biosurfactant production when compared to that obtained with free cells culture. The minimum values of surface tension were 27 and 30 mN m(-1) achieved after 9 days with free and immobilized cells, respectively, while the corresponding maximum E24 values were 65.3 and 62.3 %, respectively. The re-use of bacterial cells along with the limited cell losses provided by the immobilized system might lead to significant reduction of the biosurfactant production cost.
Microstructure of Nitrided Aluminum Alloys Using an Electron-Beam-Excited-Plasma (EBEP)
Institute of Scientific and Technical Information of China (English)
L. Liu; A. Yamamoto; T. Hishida; H. Shoyama; T. Hara; T. Hara
2004-01-01
Nitriding of surface of aluminum alloys was carried out with using an electron-beam-excited-plasma (EBEP)technique. The EBEP is sustained by electron impact ionization with energetic electron beam. Two kinds of substrates,aluminum alloys AA5052 and AA5083, were exposed to the down flow of EBEP source at 843 K for 45min. The specimens were characterized with respect to following properties: crystallographic structure (XRD), morphology (SEM) and the cross sectional microstructures of the nitrided layer was observed using a scanning electron microscopy (SEM). There are some Al2O3 particles on the surface of the nitrided AA5052 and AA5083. The AIN layers were formed on the substrates with the thickness of 4.5 μ m for AA5052 and 0.5 μ m for AA5083. A relatively uniform nitrided surface layer composed of AIN can be observed on the AA5052 substrate. The grains size near the interfaces between the substrate and AIN layer were smaller than that near the surface. On the surface of AIN layer, the concentration of nitrogen was high and in the middle of AIN layer it had a constant concentration like the aluminum and the concentration was decreased with approaching to the interface. On the surface of nitrided AA5083, a uniform AIN layer was not formed as the reason for the high nitriding temperature.
Azab, Sonya M. S.; Hirshon, Jon Mark; Hayes, Bryan D.; El-Setouhy, Maged; Smith, Gordon S.; Sakr, Mahmoud Lotfy; Tawfik, Hany; Klein-Schwartz, Wendy
2016-01-01
Introduction Pediatric poisonings represent a major and preventable cause of morbidity and mortality throughout the world. Epidemiologic information about poisoning among children in many lower- and middle-income countries is scarce. This study describes the epidemiology of acute poisonings in children presenting to Ain Shams University's Poisoning Treatment Center (ASU-PTC) in Cairo and determines the causative agents and characteristics of acute poisoning in several pediatric age groups. Methods This retrospective study involved acutely poisoned patients, 0 to 18 years of age, who presented to the ASU-PTC between 1/1/2009 and 12/31/2013. Data were extracted from electronic records maintained by the ASU-PTC. Collected data included demographics, substance of exposure, circumstances of the poisoning, patient disposition, and outcome. Results During the 5-year study period, 38,470 patients meeting our criteria were treated by the ASU-PTC; 19,987 (52%) were younger than 6 years of age; 4,196 (11%) were 6 to 12 years; and 14,287 (37%) were >12 years. Unintentional poisoning accounted for 68.5% of the ingestions, though among adolescents 84.1% of ingestions were with self-harm intent. In all age groups, the most frequent causative drugs were non-opioid analgesics, antipyretics, and antirheumatics. The most common nonpharmaceutical agents were corrosives in preschool children and pesticides in adolescents. Most patients had no/minor effects (29,174 [75.8%]); hospitalization rates were highest among adolescents. There were 119 deaths (case fatality rate of 0.3), primarily from pesticide ingestion. Conclusion Poisoning in preschool children is mainly unintentional and commonly due to nonpharmaceutical agents while poisoning in adolescents is mainly intentional (self-harm). Pesticides, mainly organophosphorous compounds and carbamates, were the most frequent agent leading to morbidity and mortality. PMID:26653953
In situ EELS and TEM observation of Al implanted with nitrogen ions
International Nuclear Information System (INIS)
Hojou, K.; Furuno, S.; Kushita, K.N.; Otsu, H.; Izui, K.
1995-01-01
Formation processes of Aluminum nitride (AIN) in Aluminum (AI) implanted with nitrogen were examined by in situ EELS and TEM observations during nitrogen ion implantation in an electron microscope at room temperature and 400 deg C. AIN phase was identified both by EDP and EELS after nitrogen ion implantation to 6 x 10 20 (N + )/m 2 . The observed peak (20.8 eV) in EELS spectra was identified as plasmon loss peak of AIN formed in AI. The binding energy of N ls in AI was found to shift by about 4 eV to the lower side with increasing nitrogen-ion fluence. Unreacted AI was also found to remain in the AIN films after high fluence implantation both at room temperature and 400 deg C. (authors). 11 refs., 5 figs., 2 tabs
Teatrilugu nendest, kes teatris ei käi / Tuuli Koch
Koch, Tuuli
2000-01-01
Nr. 52/1999. Martin McDonaghi "Mägede iluduskuninganna" Vanemuises, lavastaja Ain Mäeots. Esietendus oli 5. nov. Ka Ain Mäeotsa ja näitlejate Liina Tennosaare ning Margus Jaanovitsi arvamusi näidendist
Richel, Olivier; de Vries, Henry J C; van Noesel, Carel J M; Dijkgraaf, Marcel G W; Prins, Jan M
2013-04-01
Anal cancer is an increasing issue in HIV-positive men who have sex with men (MSM). Screening for its precursor, anal intraepithelial neoplasia (AIN), is subject of discussion. Current treatment options are suboptimum and have not been compared in a prospective trial. We compared efficacy and side-effects of imiquimod, topical fluorouracil, and electrocautery for the treatment of AIN. In this open-label randomised trial, we included HIV-positive MSM older than 18 years visiting the HIV outpatient clinic of the Academic Medical Center, Amsterdam, Netherlands. Patients with histologically confirmed AIN were randomly assigned to receive either 16 weeks of imiquimod (three times a week), 16 weeks of topical fluorouracil (twice a week), or monthly electrocautery for 4 months. Randomisation was done with random block sizes of three and six, stratified for AIN grade (AIN grades 1, 2, or 3) and AIN location (peri-anal or intra-anal). Participants were assessed by high-resolution anoscopy 4 weeks after treatment. Responding patients returned for follow-up 24 weeks, 48 weeks, and 72 weeks after treatment. The primary endpoint was histological resolution of AIN measured 4 weeks after treatment and AIN recurrence at week 24, week 48, and week 72 after treatment. The primary analysis was done in a modified intention-to-treat population, including all patients who had received their assigned treatment at least once. The trial is registered at the Netherlands Trial Register, number NTR1236. Between Aug 12, 2008, and Dec 1, 2010, we screened 388 HIV-positive MSM for AIN by high resolution anoscopy. Of the 246 (63%) patients who had AIN, 156 (63%) were randomly assigned to either receive imiquimod (54 patients), topical fluorouracil (48 patients), or electrocautery (46 patients) following withdrawing of consent by eight patients. Modified intention-to-treat analysis showed a complete response in 13 (24%, 95% CI 15-37) patients in the imiquimod group, eight (17%, 8-30) of patients
Determination of aluminium nitride or free nitrogen in low carbon steel
International Nuclear Information System (INIS)
Guetaz, V.; Soler, M.; Massardier, V.; Merlin, J.; Ravaine, D.
2001-01-01
As the aluminium nitrides play an important role in the manufacturing of steel sheets, a specific methodology was developed based on the thermoelectric power (TEP) technique, in order to determine the AIN nitrogen by an indirect method. The free nitrogen was determined and then the AIN nitrogen was calculated by the difference between the total nitrogen and the free nitrogen. Indeed, it is easier to determine the dissolved nitrogen, the content of which gradually decreases during the AIN precipitation, than the AIN nitrogen. A low carbon aluminium killed steel was employed with 580 ppm of aluminium and 50 ppm of nitrogen. A comparison of the results obtained by TEP with those obtained by other techniques (hot hydrogen extraction, electrochemical dissolution followed by a mineralization, electrochemical dissolution followed by a sodic decomposition and the Beeghly method) was conducted, in order to determine a reliable technique likely to quantify the amount of aluminium nitrides in aluminium killed steels. With these techniques, it is possible to determine either free nitrogen or precipitated nitrogen. From an experimental point of view, the precipitation kinetics of AIN was followed during an annealing performed at 973 K (700 C) by TEP and then different precipitation states of AIN were investigated to compare the different techniques: three annealing states (when no nitrogen, half the nitrogen and the total nitrogen has precipitated) and two soaking states (1403 and 1523 K). Thus, it was possible to compare states where the AIN precipitates are in various forms (different shapes, crystallographic structures, sizes, distributions in the matrix). This work showed that the quantification by TEP, hot hydrogen extraction and electrochemical dissolution followed by a mineralization seem reliable whereas the Beeghly method gives good results only for the precipitates formed at high temperatures. In contrast, the quantification by electrochemical dissolution followed by
Directory of Open Access Journals (Sweden)
Guillaume Jannot
2016-12-01
Full Text Available MicroRNAs and Argonaute form the microRNA induced silencing complex or miRISC that recruits GW182, causing mRNA degradation and/or translational repression. Despite the clear conservation and molecular significance, it is unknown if miRISC-GW182 interaction is essential for gene silencing during animal development. Using Caenorhabditis elegans to explore this question, we examined the relationship and effect on gene silencing between the GW182 orthologs, AIN-1 and AIN-2, and the microRNA-specific Argonaute, ALG-1. Homology modeling based on human Argonaute structures indicated that ALG-1 possesses conserved Tryptophan-binding Pockets required for GW182 binding. We show in vitro and in vivo that their mutations severely altered the association with AIN-1 and AIN-2. ALG-1 tryptophan-binding pockets mutant animals retained microRNA-binding and processing ability, but were deficient in reporter silencing activity. Interestingly, the ALG-1 tryptophan-binding pockets mutant phenocopied the loss of alg-1 in worms during larval stages, yet was sufficient to rescue embryonic lethality, indicating the dispensability of AINs association with the miRISC at this developmental stage. The dispensability of AINs in miRNA regulation is further demonstrated by the capacity of ALG-1 tryptophan-binding pockets mutant to regulate a target of the embryonic mir-35 microRNA family. Thus, our results demonstrate that the microRNA pathway can act independently of GW182 proteins during C. elegans embryogenesis.
Wireless intelligent network: infrastructure before services?
Chu, Narisa N.
1996-01-01
The Wireless Intelligent Network (WIN) intends to take advantage of the Advanced Intelligent Network (AIN) concepts and products developed from wireline communications. However, progress of the AIN deployment has been slow due to the many barriers that exist in the traditional wireline carriers' deployment procedures and infrastructure. The success of AIN has not been truly demonstrated. The AIN objectives and directions are applicable to the wireless industry although the plans and implementations could be significantly different. This paper points out WIN characteristics in architecture, flexibility, deployment, and value to customers. In order to succeed, the technology driven AIN concept has to be reinforced by the market driven WIN services. An infrastructure suitable for the WIN will contain elements that are foreign to the wireline network. The deployment process is expected to seed with the revenue generated services. Standardization will be achieved by simplifying and incorporating the IS-41C, AIN, and Intelligent Network CS-1 recommendations. Integration of the existing and future systems impose the biggest challenge of all. Service creation has to be complemented with service deployment process which heavily impact the carriers' infrastructure. WIN deployment will likely start from an Intelligent Peripheral, a Service Control Point and migrate to a Service Node when sufficient triggers are implemented in the mobile switch for distributed call control. The struggle to move forward will not be based on technology, but rather on the impact to existing infrastructure.
Rodríguez Bernardino, Ángel
2003-01-01
La insuficiencia cardiaca congestiva (ICC) es una patología con una alta prevalencia en nuestro medio. Se ha establecido una posible relación entre la acción de los antiinflamatorios no esteroideos (AINEs) sobre la síntesis de prostaglandinas y la aparición de ICC en individuos susceptibles. Nuestro objetivo fue evaluar la asociación entre el ingreso hospitalario por ICC y el consumo previo de AINEs, estimado la contribución individual de los distintos de AINEs. Se realizó un estudio multicén...
Indian Academy of Sciences (India)
Admin
word possibly having its origin in Sanskrit). W hat is ... History and Some Perspectives on Intermolecular Forces. E Arunan. Keywords van der Waals forces, hydrogen bonding. ... A tom s have rem ained a dom ain of physics, rather than.
Pärast kõike / intervjueerinud Veiko Märka
1998-01-01
Vestlusring: Ain Mäeots, Merle Jääger, Helena Merzin, Margus Jaanovits, Riho Kütsar. Madis Kõivu võrukeelse näidendi 'Omavahelisi jutuajamisi tädi Elliga' lavastamisest Vanemuise teatris, lavastaja Ain Mäeots. Ka Kauksi Ülle kommentaar
Kaalep, Ain, 1926-
2003-01-01
Sisu: Eeslid ; Luuletaja Koghazi ; Elav kuningas ; Neli legendi : Mungasuudlus ; Dorzhiin ; Legend meister Albrechtist ; Aafrika muld. Ballaad kombaini armastusest ; Kuningakatse ; Rapsoodiad : Draakoni talveuni ; Klaassepa poeg. Kaks indiaani metamorfoosi : Roti metamorfoos ; Ahvnaine. Paani surm ; Valgjärve legend ; Katsikõsõ'
Turundusteenistus / Ain Kaljurand
Kaljurand, Ain, 1965-
2004-01-01
Ilmunud ka: 2003 : annual report : [Eesti Raudtee]. - Tallinn, 2004, lk. 15-20; 2003 : godovoi ottshjot : [Eesti Raudtee]. - Tallinn, 2004, lk. 15-20. Ülevaade AS-i Eesti Raudtee 2003. a. kaubaveost veomahtude ja kaubagruppide järgi, turundusteenistusest, hinnapoliitikast
Exegi monumentum ehk palee Tallinnas / Siim Sultson
Sultson, Siim
2007-01-01
Tallinnas Narva mnt. 7 endisest Tsentrosojuzprojektist ümber ehitatud Triumph Plazast (arhitektid Vilen Künnapu ja Ain Padrik). Maja kavandati 1981. a. büroohooneks (arhitektid Olga Bruns ja Mart Kalling). Kommenteerivad Mart Port, Dmitri Bruns, Kristiina Möldre ja Ain Padrik
Automating the AFROTC Four-Year Scholarship Program.
1986-04-01
ATCH 2 b1 C -d C4 4" %C N 0" cl4 es C4 CN 1 onin %DG C1 06 0 -0 40 V 44-4 LIU-4- c4 A: U. -4 La 4 E vt a-’ iv El "l 04 0 0.I t b U El 4 V do v 0 CoU. -4...CEEB CLAS~S BOARD 1ST 2ND DCF QEP/ STRT,"’ HWFADC CfI3; PEL SCORES SCORE COMP SCOPE STAND RAMK".,H~DC ’ PREF PREF RACE PREY" rTL B1 = 46/1 C hiroms...A/N 88 Fencing 4 AIN 89 La Crosse 4 AIN 90 Rifle/Pistol 4 AIN 91 Rugby 4 AIN 92 Track 4 A/N 93 Wrestling 4 A/N 94 Others (Name and Codes) 15 A/N 95
NUOVO, Gerard J.; GRINSZTEJN, Beatriz; FRIEDMAN, Ruth K.; VELOSO, Valdiléa G.; CUNHA, Cynthia B.; COUTINHO, José R.; VIANNA-ANDRADE, Cecilia; OLIVEIRA, Nathalia S.; WOODHAM, Andrew W.; DA SILVA, Diane M.; KAST, W. Martin
2016-01-01
Objective The aim of the current study was to evaluate secretory leukocyte protease inhibitor (SLPI) expression in anal biopsies from HIV-positive (HIV+) individuals, and compare that to anal intraepithelial neoplasia (AIN) diagnoses and human papillomavirus (HPV) status. Design This is a cross-sectional study of a cohort of 54 HIV+ (31 males and 23 females) from an AIDS clinic in Rio de Janeiro, Brazil. Methods The study material consisted of anorectal tissue biopsies obtained from HIV+ subjects, which were used to construct tissue microarray paraffin blocks for immunohistochemical analysis of SLPI expression. Biopsies were evaluated by an expert pathologist and classified as low-grade anal intraepithelial neoplasia (AIN1), high-grade anal intraepithelial neoplasia (AIN2/3), or normal squamous epithelium. Additionally, DNA from the biopsies was extracted and analyzed for the presence of low- or high-risk HPV DNA. Results Histologically normal squamous epithelium from the anorectal region showed strong positive SLPI staining in 17/20 (85%) samples. In comparison, 9/17 (53%) dysplastic squamous epithelial samples from AIN1 patients showed strong SLPI staining, and only 5/17 (29%) samples from AIN2-3 patients exhibited strong SPLI staining, which both were significantly fewer than those from normal tissue (p=0.005). Furthermore, there was a significantly higher proportion of samples in which oncogenic high-risk HPV genotypes were detected in low SLPI expressing tissues than that in tissues with high SLPI expression (p=0.040). Conclusion Taken together these results suggest that low SLPI expression is associated with high-risk HPV infections in the development of AIN. PMID:27149102
Kes räägib tõtt, kes ebatõtt? / Elmar Truu
Truu, Elmar-Johannes, 1942-
2001-01-01
Ilmunud ka: Sakala, 27. nov. 2001, lk. 2; Meie Maa, 28. nov. 2001, lk. 2; Valgamaalane, 27. nov, 2001, lk. 2; Virumaa Teataja, 28. nov. 2001, lk. 7; Nädaline, 29. nov. 2001, lk. 4; ERL Teataja, dets. 2001, nr. 12, lk. 4. Riigikogu 14. nov. infotunnis pöördumisest sotsiaalministri Eiki Nestori poole küsimustega ravimite hinna järjekindlast tõstmisest. Autor: ERL. Parlamendisaadik
Richel, Olivier; Quint, Koen D.; Lindeman, Jan; van Noesel, Carel J. M.; de Koning, Maurits N. C.; van den Munckhof, Henk A. M.; de Vries, Henry J. C.; Prins, Jan M.; Quint, Wim G. V.
2014-01-01
High-grade anal intraepithelial neoplasia (AIN) is present in many human immunodeficiency virus (HIV)-positive men who have sex with men. The major etiologic factor is infection with an oncogenic human papillomavirus (HPV) genotype. We investigated whether individual components of high-grade AIN are
Veronezi, Regina de Cássia [UNESP
2007-01-01
Os antiinflamatórios não esteroidais (AINEs) são rotineiramente usados na medicina eqüina como analgésicos e antiinflamatórios, sendo potentes controladores da dor. Entretanto, estes fármacos provocam alguns efeitos indesejáveis, como por exemplo, lesões renais e gastrointestinais. Os efeitos adversos dos AINEs ocorrem com a inibição da COX-1, enquanto os efeitos benéficos são observados com a inibição da enzima COX-2. Com o surgimento dos AINEs seletivos para COX-2, os efeitos adversos são c...
International Nuclear Information System (INIS)
Yue, Ruirui; Zhang, Qiang; Wang, Caiqin; Du, Yukou; Yang, Ping; Xu, Jingkun
2013-01-01
Highlights: • Electropolymerization of 5-aminoindole (AIn) in the presence of graphene (GE). • Significant catalytic effect of GE on the polymerization of AIn. • PAIn/GE/GC used as Pt catalyst support. • The enhanced catalytic activity of Pt/PAIn/GE/GC for methanol electrooxidation. -- Abstract: 5-Aminoindole (AIn) was electropolymerized on graphene (GE) modified glass carbon (GC) electrode in 0.5 M H 2 SO 4 aqueous solution containing 0.01 M AIn. Because of the catalytic effect of GE, the polymerization efficiency of AIn and the electrochemical activity of as-formed poly(5-aminoindole) (PAIn) were significantly improved on GE/GC electrode as compared to that on the bare GC electrode. The prepared PAIn/GE/GC electrode was used as substrate for Pt particle electrodeposition. SEM, EDX and Raman spectral were used to characterize the prepared electrodes. Electrocatalytic experiments demonstrate that the Pt/PAIn/GE/GC electrode possesses high catalytic activity toward methanol electrooxidation in alkaline medium, due to the good dispersion of Pt particles on PAIn/GE/GC and the electronic interactions between the metal particles and the polymer matrixes. Thus, PAIn can be a promising alternative for polymeric catalyst support in direct alcohol fuel cells
DEFF Research Database (Denmark)
Nielsen, Ann; Plum, Christian Edinger Munk; Kjaer, Susanne K
2012-01-01
The aim of the study was to determine the incidences of anal cancer and high-grade anal intraepithelial neoplasia (AIN2/3) over time in Danish women and men. Describing the burden of anal cancer and AIN may be valuable in future evaluations of the human papillomavirus (HPV) vaccine. We included all...... anal cancers in the Danish Cancer Register in the period 1978-2008 and all cases of AIN2/3 in the Danish Registry of Pathology. Overall and age-, period- and histology-specific incidence rates were estimated. During the 30-year period, 2187 anal cancers were identified, two thirds of which were...... in women. Between 1978-1982 and 2003-2008, the age-standardized incidence rate of anal cancer increased from 0.68 to 1.48 per 100 000 person-years in women and from 0.45 to 0.80 per 100 000 person-years in men. Although there is no systematic screening for AIN in Denmark, we nevertheless identified 608...
Surface morphology of Al0.3Ga0.7N/Al2O3-high electron mobility transistor structure.
Cörekçi, S; Usanmaz, D; Tekeli, Z; Cakmak, M; Ozçelik, S; Ozbay, E
2008-02-01
We present surface properties of buffer films (AIN and GaN) and Al0.3Gao.zN/Al2O3-High Electron Mobility Transistor (HEMT) structures with/without AIN interlayer grown on High Temperature (HT)-AIN buffer/Al2O3 substrate and Al2O3 substrate. We have found that the GaN surface morphology is step-flow in character and the density of dislocations was about 10(8)-10(9) cm(-2). The AFM measurements also exhibited that the presence of atomic steps with large lateral step dimension and the surface of samples was smooth. The lateral step sizes are in the range of 100-250 nm. The typical rms values of HEMT structures were found as 0.27, 0.30, and 0.70 nm. HT-AIN buffer layer can have a significant impact on the surface morphology of Al0.3Ga0.7N/Al2O3-HEMT structures.
Feng, C; Wang, S G; Yang, M Y; Zhang, E; Zhan, Q; Jiang, Y; Li, B H; Yu, G H
2012-02-01
Based on interfacial manipulation of the MgO single crystal substrate and non-magnetic AIN compound, a L1(0)-FePt perpendicular ultrathin film with the structure of MgO/FePt-AIN/Ta was designed, prepared, and investigated. The film is comprised of L1(0)-FePt "magnetic islands," which exhibits a perpendicular magnetic anisotropy (PMA), tunable coercivity (Hc), and interparticle exchange coupling (IEC). The MgO substrate promotes PMA of the film because of interfacial control of the FePt lattice orientation. The AIN compound is doped to increase the difference of surface energy between FePt layer and MgO substrate and to suppress the growth of FePt grains, which takes control of island growth mode of FePt atoms. The AIN compound also acts as isolator of L1(0)-FePt islands to pin the sites of FePt domains, resulting in the tunability of Hc and IEC of the films.
Pap smears for men: a vision of the future?
LENUS (Irish Health Repository)
Oon, S F
2012-02-01
BACKGROUND: Anal intraepithelial neoplasia (AIN) rarely receives as much publicity as its neighbouring orifice, the cervix. As in the cervix, intraepithelial neoplasias are precursors to cancer in the anal canal. AIN and cervical interstitial neoplasia (CIN) undergo dysplasia as a consequence of human papillomavirus (HPV) infection. Since the advent of screening with the Pap smear in CIN, cervical cancer has plummeted to a fifth of its initial incidence. Anal cancer, however, has been rising, with a predilection for human immunodeficiency virus-infected men. HPV causes a squamous epithelial dysplasia and converts healthy tissue into AINs of increasing severity until anal cancer manifests. CLINICAL CASE: This article describes a clinical case of anogenital HPV infection refractory to medical and surgical therapy. It also describes an effective surgical excision technique associated with a good cosmetic outcome. CONCLUSIONS: The paper concludes by briefly discussing the implications of a national screening programme against AIN in the future.
Hypothyroidism could be the only manifestation of mitochondrial ...
African Journals Online (AJOL)
Hoda Tomoum
2012-11-24
Nov 24, 2012 ... Hypothyroidism could be the only manifestation of mitochondrial T8993C mutation in Leigh syndrome. Hoda Tomoum a. , Solaf M. Elsayed b,. *, Elizabeth Berry-Kravis c a Department of Pediatrics, Ain Shams University, Cairo, Egypt b Genetics Unit, Department of Pediatrics, Ain Shams University, Cairo, ...
AVALIAÇÃO DA DISPENSAÇÃO DE FÁRMACOS PARCIALMENTE SELETIVOS PARA COX-2
Directory of Open Access Journals (Sweden)
Cícero Cardoso VALLE FILHO
2015-12-01
Full Text Available Uma pesquisa foi realizada com o objetivo de avaliar um potencial aumento na venda de fármacos anti-inflamatórios não esteroidais (AINEs parcialmente seletivos para a COX-2 durante o período de julho de 2009 a junho de 2011, em uma drogaria localizada no município de Itaperuna, estado do Rio de Janeiro. Durante o período estudado foi dispensado um total de 802 AINEs parcialmente seletivos para a COX-2, dentre os quais 59,85% foram de nimesulida, 5,74% de etodolaco e 34,41% de meloxicam. No primeiro semestre avaliado a dispensação total de AINEs parcialmente seletivos foi equivalente a 92, no segundo semestre a dispensação total foi equivalente a 159, no terceiro semestre a dispensação total foi de 219 AINEs parcialmente seletivos para COX-2 e no quarto semestre foram dispensados 332. Os resultados indicaram maior dispensação dos medicamentos desta classe no mês de abril de 2011 sendo que tanto a nimesulida, quanto o meloxicam e o etodolaco foram mais dispensados no último semestre do estudo. De acordo com a metodologia utilizada pode-se concluir que a dispensação dos AINEs parcialmente seletivos vem crescendo a cada ano e que a nimesulida apresenta o maior índice de crescimento; a maior indicação da nimesulida tem sido para crianças; os meses correspondentes ao período de inverno apresentam maior dispensação de AINEs parcialmente seletivos para a COX-2.
Hydrogeological and isotopic studies for selected springs in Sinai Peninsula
Energy Technology Data Exchange (ETDEWEB)
Hamza, M S; Awad, M A; El-gamal, S A [Atomic Energy Authority, Cairo Egypt and Middle Eastern Regional Radioisotope Center for The Arab Countries, Dokki, 12311, Cairo (Egypt); Hammad, F A [Desert Research Centre, Materia, Cairo, (Egypt)
1995-10-01
This paper deals with the hydrogeology and isotopic composition of water samples collected from selected spring in sinai (e.g. Algudierate, Alqusiema, qidis and Isram) in order to identify their genesis, their interaction with the host rocks and mixing trend. Results of isotopic composition have indicated the similarity in the hydrogeologic situation of Ain qidis and Ain-al-gudierate, while Ain Isram has shown a marked difference in its stable isotope and this could be due to evaporation effect. The isotopic and hydrochemical constituents of the studied springs reflect eater of a meteoric origin with a possible contamination from surficial materials (evaporates) and deeper aquifers. 6 figs., 2 tabs.
Directory of Open Access Journals (Sweden)
YOUCEF BENMOUSSA
2015-07-01
Full Text Available Resources And Water Sharing In The Oasis Of Kenadsa (Southwest Algeria; Historical Approach And Findings. Kenadsa, a peaceable oasis in southwestern Algeria, with the discovery and exploitation of coal (1917 - 1956, underwent graft of Western models for its development. That has cleared the oasis of the spatial dimension and tr ansformed into a mining village by excellence. These networks of foggaras draining groundwater, enclosed in a multilayer aquifer, which becomes free on the northern border of the Ksar. There were 25 foggaras of sources (Ain, each of which had its own drai nage channels to downstream gardens of Ksar. The distribution of water from these sources was ensured by a complex network, fed by drainage galleries that meander the alleys of Ksar and gives place to access points for domestic uses. The right to water is generally private property; one could dispose of according to modes of transmission of a property. It’s sharing for irrigation is governed by the volume and time. Currently, only some ten foggaras of sources that are still alive (Ain Sidi Mbarek, Ain Dir, Belkaid Ain, Ain Sheikh ..... These waters are characterized by mediocre quality (pH 7.31, CE: 4.88 ms / cm, RS 2420 mg / l Ca ++: 288.2 mg / l, SO4 -- : 468 83 mg / l..
Bulletin of Materials Science | Indian Academy of Sciences
Indian Academy of Sciences (India)
Laboratoire de Physique Fondamentale et Applique (LPFA), Faculté des Sciences Ain Chock, Université Hassan II, B.P. 5366 Mâarif, Casablanca, Maroc; Laboratoire de Physique des Matériaux, Micro-électronique, Automatique et Thermique (LPMMAT), Faculté des Sciences Ain Chock, Université Hassan II, B.P. 5366 ...
A Strong Impact of Genetic Background on Gut Microflora in Mice
Directory of Open Access Journals (Sweden)
R. Steven Esworthy
2010-01-01
Full Text Available Genetic background affects susceptibility to ileocolitis in mice deficient in two intracellular glutathione peroxidases, GPx1 and GPx2. The C57BL/6 (B6 GPx1/2 double-knockout (DKO mice have mild ileocolitis, and 129S1/Sv (129 DKO mice have severe inflammation. We used diet to modulate ileocolitis; a casein-based defined diet with AIN76A micronutrients (AIN attenuates inflammation compared to conventional LabDiets. Because luminal microbiota induce DKO ileocolitis, we assessed bacterial composition with automated ribosomal intergenic-spacer analysis (ARISA on cecal DNA. We found that mouse strain had the strongest impact on the composition of microbiota than diet and GPx genotypes. In comparing AIN and LabDiet, DKO mice were more resistant to change than the non-DKO or WT mice. However, supplementing yeast and inulin to AIN diet greatly altered microflora profiles in the DKO mice. From 129 DKO strictly, we found overgrowth of Escherichia coli. We conclude that genetic background predisposes mice to colonization of potentially pathogenic E. coli.
Análisis coste-efectividad del empleo de celecoxib en el tratamiento de la artrosis
Directory of Open Access Journals (Sweden)
Moreno A.
2003-01-01
Full Text Available Antecedentes: Los antiinflamatorios no esteroideos (AINE, utilizados en el tratamiento de la artrosis, pueden producir reacciones adversas gastrointestinales (GI graves. Celecoxib, un inhibidor específico de la ciclooxigenasa 2 (COX-2, ha demostrado una eficacia equivalente a los AINE convencionales con un mejor perfil de tolerabilidad y seguridad. Objetivo: La finalidad de este estudio ha sido realizar un análisis coste-efectividad sobre el uso de celecoxib frente a los AINE clásicos en el tratamiento de la artrosis. Material y métodos: El análisis coste-efectividad se ha diseñado mediante un modelo farmacoeconómico, definiéndose como unidad de efectividad a cada año de vida ganado tras la toma de celecoxib o AINE. La probabilidad de que aparezcan los diferentes resultados clínicos se ha obtenido de artículos publicados y de asunciones incorporadas. Sólo se han valorado los costes directos médicos (medicación, hospitalización, pruebas complementarias, analíticas, visitas extras, etc., sin haberse incluido otros costes. La perspectiva del estudio ha sido la del Sistema Nacional de Salud y el horizonte temporal elegido ha sido de 6 meses. Resultados: El coste adicional por cada año de vida ganado secundario al uso de celecoxib frente a los AINE clásicos asciende a 8.017 ? (1.333.834 ptas.. El análisis de sensibilidad muestra cómo estos valores son sensibles a la modificación del coste de AINE y gastroprotector, así como a la inclusión de grupos poblacionales con edades más bajas. Conclusiones: Celecoxib puede ser considerado como una opción coste-efectiva en el tratamiento de la artrosis, ya que va a evitar muertes y a ganar años de vida para los pacientes con un coste adicional razonable y moderado, cuando se compara con los AINE. Su eficiencia aumenta a medida que se utiliza en poblaciones con menor edad media y, probablemente, en aquellas con mayor riesgo de desarrollar complicaciones GI.
Há uma associação entre anti-inflamatórios não-esteroides e nefropatia induzida por contraste?
Directory of Open Access Journals (Sweden)
Luciano Passamani Diogo
Full Text Available FUNDAMENTO: A associação entre o uso de anti-inflamatórios não-esteroides (AINEs e insuficiência renal aguda ou crônica é bem documentada, mas evidências sobre a associação entre AINEs e nefropatia induzida por contraste (NIC não são encontradas na literatura. OBJETIVO: Avaliar uma possível associação entre AINEs e NIC. MÉTODOS: Em um estudo de coorte, através da entrevista clínica de pacientes que foram submetidos à cateterização cardíaca, analisamos o uso de AINEs e sua associação com desenvolvimento de NIC, através da alteração dos níveis de creatinina sérica ou taxa de filtração glomerular em 48 ou 72 horas. RESULTADOS: No período de julho de 2005 a julho de 2006, 236 pacientes foram incluídos no estudo, dos quais 29 foram posteriormente excluídos. A incidência de NIC foi 10,37% (20 de 207 e 42% dos pacientes estavam recebendo AINEs até o momento da avaliação. Não houve associação entre o uso de AINEs e o desenvolvimento de NIC com OR de 1,293; IC95% (0,46-4,2. O estudo detectou fatores de risco conhecidos para o desenvolvimento de NIC, tais como diabete, com OR de 2,77; IC95% (1,05-7,47 e insuficiência renal crônica com OR de 3,48; IC95% (1,1-11,07 e também sugeriu uma ação protetora da hidratação com solução salina com OR de 0,166; IC95% (0,03-0,92. CONCLUSÃO: Com base nos dados obtidos, concluímos que não houve associação entre NIC e uso prévio de AINEs, pelo menos com um OR > 2,85, o qual nossa amostra detectou.
Indrek Saar kehastub Pilistveres Rasputiniks / Aarne Mäe
Mäe, Aarne, 1967-
2008-01-01
7. aug. esietendub Pilistvere vanas rehehoones Ain Saviaugu kirjutatud ja lavastatud suvetükk "Rasputin". Suvelavastuse tõi välja Põltsamaa Teater Ellunäod koos professionaalsete näitlejatega. Nimiosas mängib näitlejast riigikogulane Indrek Saar. Lisaks lühike intervjuu lavastajaga "Lavastaja Ain Saviauk : "Ajalugu on karm" ja fakte Rasputinist - "Grigori Jefimovitsh Rasputin-Novõhh"
Pose de la première pierre du bâtiment SMA18 du Cern
CERN Press Office. Geneva
1999-01-01
On 30 April 1999, Jean Pépin, Sénateur for the Department of the Ain and President of the Conseil Général, and Professor Luciano Maiani the Director-General of CERN will lay the foundation stone of Building SMA18, financed by the Department of the Ain in the framework of France's special contribution to CERN's Large Hadron Collider (LHC) project.
Hirm, raha ja armastus / Margot Visnap, Kadi Herkül, Immo Mihkelson
Visnap, Margot, 1959-
1999-01-01
Teleteatri aastaringist - ETV kaheksa lavastust seitsmelt lavastajalt : Toomas Hussar/Ervin Õunapuu "Linnapea ehk Hirmu põhivormid". Rezh. T. Hussar. Eetris 1. jaan. 1998; A.H. Tammsaare/Ain Prosa "Ma armastasin sakslast". Rezh. A. Prosa. Eetris 24. veebr. 1998; Dennis Potter "Sa oled koor minu kohvis". Rezh. Vilja Palm. Eetris 1. jaan. 1999; Ain Prosa/Karl Ristikivi "lihtne lugu, lõpuga". Rezh. Ain Prosa. Eetris 28. nov. 1998; Betti Alver/Margus Kasterpalu "Tuulearmuke". Rezh. Elo Selirand. Eetris 23. mail 1998; Faama Filmi ja ETV teleteatri koostöö "Isa", sts. ja rezh. Mart Kivastik. Eetris 28. märtsil 1998; "Lilled Leale", sts. ja rezh. Olle Mirme Toomas Vindi novelli põhjal; Rein Saluri "Andke neile andeks", lav. Talvo Pabut. Eetris 19. okt. 1998
Rahvusvaheline turismikonverents / Ain Hinsberg
Hinsberg, Ain
2011-01-01
Radisson Blu Hotel Olümpias 28. aprillil korraldatud konverentsist "Läänemere regiooni turismiteadmuse toetus turismimajandusele ja -ettevõtlusele 2011-2026", millega tähistati Eesti Hotelli- ja Turismikõrgkooli EHTE 15. sünnipäeva. Thomas Mielke, Maritta Hiltuneni, Kristian Sieversi, Pauli Santala, Inese Šīrava, Maija Rozite ja Kestutis Ambrozaitise konverentsil peetud ettekannetest ja paneeldiskussioonist
DEFF Research Database (Denmark)
Di Nucci, Ezio
2016-01-01
I argue against various versions of the 'attitude' view of consent and of the 'action' view of consent: I show that neither an attitude nor an action is either necessary or sufficient for consent. I then put forward a different view of consent based on the idea that, given a legitimate epistemic ...
Oit, Ave
2012-01-01
Öko- ja looduskosmeetikas keelatud või piirangutega lubatud koostisainetest: silikoonid, etoksüleeritud emulgaatorained (PEG-ühendid), toorõli baasil valmistatud rasvained ja emulgaatorid s.h mineraalõlid ja -vahad
Directory of Open Access Journals (Sweden)
Jorge Enrique Machado-Alba
Full Text Available Con el objetivo de determinar la frecuencia de uso prolongado de antiinflamatorios no esteroideos (AINES en pacientes colombianos de alto riesgo cardiovascular (ARC se desarrolló un estudio retrospectivo en el cual se identificaron pacientes de ARC que usaron AINES por más de cinco meses continuos entre enero de 2011 y marzo de 2013. Se identificó a los pacientes que recibían crónicamente nitratos, digitálicos, y clopidogrel y ácido acetil salicílico (ASA, quienes fueron identificados como de ARC. Se realizó un análisis de frecuencias de uso según la comedicación recibida. Se encontró uso concomitante de AINES en el 0,35% de los consumidores de nitratos (tiempo promedio: 9,5 ± 4,4 meses, en el 0,36% de los consumidores de clopidogrel y ASA (tiempo promedio: 9,3 ± 3,4 meses, y en el 0,4% de los consumidores de digitálicos (10,2 ± 4,6 meses. Se concluye que existe una baja proporción de uso de AINES de manera crónica en pacientes de alto riesgo cardiovascular.
LENUS (Irish Health Repository)
Mansur, Abdurrezagh
2011-01-01
Acute interstitial nephritis (AIN) is a common cause of acute kidney injury and is characterised by a dense interstitial cellular infiltrate, which has not been well defined. Previous studies have demonstrated a correlation between Epstein-Barr virus (EBV) infection and AIN. The purpose of our study was to define the nature of the interstitial immune infiltrate and to investigate the possibility of renal infection with EBV.
Directory of Open Access Journals (Sweden)
Monsalve, A.
2005-10-01
Full Text Available An important feature of aluminium killed steels is the strong influence that aluminium nitride precipitates produce in both the mechanical properties and the final microstructural characteristics of the steel. This influence is related to the different stages of the fabrication process. This paper deals with a study of the effects of aluminium nitrides on the kinetics of recrystallisation. Different heat treatments were carried out, in one case to dissolve AIN, and in the other in order to precipitate AIN. These steels were subjected to cold rolling, followed by a batch annealing process. The recrystallised fraction was measured, thus obtaining the kinetic curves. The activation energy for recrystallisation was computed in each case. The results showed that AIN precipitation during recrystallisation produces a delay in recrystallisation kinetics through a change in the activation energy value.
Los aceros calmados con aluminio presentan como característica importante, la gran influencia que ejercen los nitruros de aluminio en las propiedades mecánicas y características microestructurales finales. Esta influencia está, a su vez, relacionada con cada una de la etapas del proceso de fabricación. En el presente trabajo se ha abordado el estudio del efecto de los nitruros de aluminio sobre la cinética de recristalización. Para ello, se han llevado a cabo diversos tipos de tratamientos térmicos, con el objeto de disolver todo el AIN y, en el otro caso, de precipitar todo el AIN. A continuación, los aceros estudiados se deformaron en frío y se les realizó un recocido convencional. Se midió la fracción recristalizada evaluando la energía de activación para la recristalización. Los resultados mostraron que la precipitación de AIN durante la recristalización produce un retraso en la cinética de recristalización, a través del cambio en el valor de la energía de activación
Teatriekspressiga Äksist Põltsamaale / Riina Mägi
Mägi, Riina, 1957-
2007-01-01
Jõgevamaa harrastus- ja projektitruppide vabaõhulavastuste esietendustest 2006. aastal : Priit Aimla "Saadjärve saamise lugu" (Tabivere Harrastusteater, lavastaja Tõnis Lepp), Oskar Lutsu loomingust inspireeritud Veiko Märka "Sabani sõlmes Luts" (Palamuse Amatöörteater, lavastaja Raivo Adlas), Marina Carri "Kassirabal" projektitrupi esituses, lavastaja Ain Saviauk, Mati Tiku "Legend" (Saare Valla Metsateater, lavastaja autor), Ain Saviaugu "Ulm ehk Unistus Liivimaast" (Põltsamaa teater Ellunäod, lavastaja autor)
AnAnalytical Study of Chinese Salt (MSG: Is it Halal or Haram (Urdu
Directory of Open Access Journals (Sweden)
Dr. Junaid Akbar
2017-01-01
Full Text Available Monosodium Glutamate is the scientific name of Chinese salt, which also called Ajinomoto. Monosodium Glutamate was first discovered by the Japanese chemist Ikeda Kibunae in 1908. The MSG was firstly derived from seaweed. Later on MSG was got from meat, gluten,and vegetables etc. It can be derived from Najasul‘ain and GherNajasul‘ain things. If it was got from Najasul ‘ain, then there is a question about MSG that is it Halal(permissible/ lawful or Haram(non-permissible/unlawful. This research in this article is concluded that if the culture of MSG is Halal or the properIsti Halah has been done in Najas; MSG will be Halal(permissible/ lawful. However, where no such details are available about the culture of MSG, it should be avoid, although it cannot be declared Haram as per Islamic Jurisprudence rules
Tawfik, Hatem A; Fouad, Yousef A; Hafez, Rashad
2015-01-01
Hatem A Tawfik,1 Yousef A Fouad,2 Rashad Hafez3 1Department of Ophthalmology, Oculoplastics Service, Ain Shams University, 2Faculty of Medicine, Ain Shams University, 3Eye Subspecialty Centre, Cairo, Egypt Objective: To introduce and evaluate the safety of a novel dual-sided electrosurgery handpiece design for simultaneous tissue cutting and coagulation. Methods: We designed a prototype double-sided handpiece allowing automatic switching between two electrodes with a simple handpiece flip. T...
Directory of Open Access Journals (Sweden)
Juan Villa
2014-11-01
Conclusiones: Algunos AINE pueden disminuir la efectividad del tratamiento antihipertensivo cuando se utilizan simultáneamente con antihipertensivos, en especial con inhibidores de la enzima conversora de angiotensina, diuréticos, bloqueadores beta y antagonistas de los receptores de angiotensina. No se encontró evidencia de la modificación del efecto de los antagonistas de los canales de calcio, especialmente dihidropiridínicos, por el uso simultáneo con AINE.
Synthesis of TiCuAg thick film inks for glass frit free metallization of aluminium nitride
International Nuclear Information System (INIS)
Adlassnig, A.; Schuster, J. C.; Smetana, W.; Reicher, R.
1997-01-01
A glas frit free screen printing ink for metallization of AIN was developed. Bonding to the substrate is achieved by active metal additives. The metallic component consists of Cu and Ag powder synthesized from inorganic salts by the polyol process, and Cu-Ti powder synthesized by arc melting, milling and ultracentrifugation. This ternary powder mixture was introduced to a specifically developed organic vehicle and screen printed onto AIN. The detailed development process and the results will be presented. (author)
International Nuclear Information System (INIS)
Wong, R.K.
2000-01-01
After implantation of As, As + Be, and As + Ga into GaN and annealing for short durations at temperatures as high as 1500 C, the GaN films remained highly resistive. It was apparent from c-RBS studies that although implantation damage did not create an amorphous layer in the GaN film, annealing at 1500 C did not provide enough energy to completely recover the radiation damage. Disorder recovered significantly after annealing at temperatures up to 1500 C, but not completely. From SIMS analysis, oxygen contamination in the AIN capping layer causes oxygen diffusion into the GaN film above 1400 C. The sapphire substrate (A1203) also decomposed and oxygen penetrated into the backside of the GaN layer above 1400 C. To prevent donor-like oxygen impurities from the capping layer and the substrate from contaminating the GaN film and compensating acceptors, post-implantation annealing should be done at temperatures below 1500 C. Oxygen in the cap could be reduced by growing the AIN cap on the GaN layer after the GaN growth run or by depositing the AIN layer in a ultra high vacuum (UHV) system post-growth to minimize residual oxygen and water contamination. With longer annealing times at 1400 C or at higher temperatures with a higher quality AIN, the implantation drainage may fully recover
Energy Technology Data Exchange (ETDEWEB)
Wong, Raechelle Kimberly [Univ. of California, Berkeley, CA (United States)
2000-04-01
After implantation of As, As + Be, and As + Ga into GaN and annealing for short durations at temperatures as high as 1500 C, the GaN films remained highly resistive. It was apparent from c-RBS studies that although implantation damage did not create an amorphous layer in the GaN film, annealing at 1500 C did not provide enough energy to completely recover the radiation damage. Disorder recovered significantly after annealing at temperatures up to 1500 C, but not completely. From SIMS analysis, oxygen contamination in the AIN capping layer causes oxygen diffusion into the GaN film above 1400 C. The sapphire substrate (A1203) also decomposed and oxygen penetrated into the backside of the GaN layer above 1400 C. To prevent donor-like oxygen impurities from the capping layer and the substrate from contaminating the GaN film and compensating acceptors, post-implantation annealing should be done at temperatures below 1500 C. Oxygen in the cap could be reduced by growing the AIN cap on the GaN layer after the GaN growth run or by depositing the AIN layer in a ultra high vacuum (UHV) system post-growth to minimize residual oxygen and water contamination. With longer annealing times at 1400 C or at higher temperatures with a higher quality AIN, the implantation drainage may fully recover.
Directory of Open Access Journals (Sweden)
Luciano Passamani Diogo
2010-12-01
Full Text Available FUNDAMENTO: A associação entre o uso de anti-inflamatórios não-esteroides (AINEs e insuficiência renal aguda ou crônica é bem documentada, mas evidências sobre a associação entre AINEs e nefropatia induzida por contraste (NIC não são encontradas na literatura. OBJETIVO: Avaliar uma possível associação entre AINEs e NIC. MÉTODOS: Em um estudo de coorte, através da entrevista clínica de pacientes que foram submetidos à cateterização cardíaca, analisamos o uso de AINEs e sua associação com desenvolvimento de NIC, através da alteração dos níveis de creatinina sérica ou taxa de filtração glomerular em 48 ou 72 horas. RESULTADOS: No período de julho de 2005 a julho de 2006, 236 pacientes foram incluídos no estudo, dos quais 29 foram posteriormente excluídos. A incidência de NIC foi 10,37% (20 de 207 e 42% dos pacientes estavam recebendo AINEs até o momento da avaliação. Não houve associação entre o uso de AINEs e o desenvolvimento de NIC com OR de 1,293; IC95% (0,46-4,2. O estudo detectou fatores de risco conhecidos para o desenvolvimento de NIC, tais como diabete, com OR de 2,77; IC95% (1,05-7,47 e insuficiência renal crônica com OR de 3,48; IC95% (1,1-11,07 e também sugeriu uma ação protetora da hidratação com solução salina com OR de 0,166; IC95% (0,03-0,92. CONCLUSÃO: Com base nos dados obtidos, concluímos que não houve associação entre NIC e uso prévio de AINEs, pelo menos com um OR > 2,85, o qual nossa amostra detectou.FUNDAMENTO: La asociación entre el uso de antiinflamatorios no esteroides (AINEs e insuficiencia renal aguda o crónica está bien documentada, pero evidencias sobre la asociación entre AINEs y nefropatía inducida por contraste (NIC no son encontradas en la literatura. OBJETIVO: Evaluar una posible asociación entre AINEs y NIC. MÉTODOS: En un estudio de cohorte, a través de la entrevista clínica de pacientes que fueron sometidos a cateterismo cardíaco, analizamos el
Impôts Français : CRDS - French version only
2003-01-01
Avis de dégrèvements IMPORTANT : Cette note d'information concerne uniquement : - les membres du personnel de nationalité française ou résidents permanents1 , domiciliés en France dans le département de l'Ain et rémunérés par le CERN (titulaires, boursiers, attachés payés et de projet) ; - Les anciens membres du personnel de l'Organisation, bénéficiaires de la Caisse de Pensions du CERN, domiciliés ou ayant été domiciliés en France dans le département de l'Ain. Ces personnes ont récemment reçu, ou sont sur le point de recevoir, un avis de dégrèvement émanant de la Direction des Services Fiscaux de l'Ain (DSFA) et portant sur la Contribution au Remboursement de la Dette Sociale (CRDS). I. Informations général...
Külmetav haigekassa / Ain Aaviksoo
Aaviksoo, Ain, 1974-
2008-01-01
Autori hinnangul on suur oht, et Eesti patsiente ootab ees Läti saatus, kus on 40-50% tervishoiukuludest patsientide endi kanda. Eesti ees seisvaid valikuid analüüsides oleks parim valik ravikindlustuse reservide läbimõeldud kasutuselevõtt, kuid eeldusel, et otsitakse ravikindlustuse rahastamisele pikaajalisi sisulisi lahendusi. Graafik: Haigekassa kulude suhteline muutus
Zamerzajushtshaja Bolnitshnaja kassa / Ain Aaviksoo
Aaviksoo, Ain, 1974-
2008-01-01
Autori hinnangul on suur oht, et Eesti patsiente ootab ees Läti saatus, kus on 40-50% tervishoiukuludest patsientide endi kanda. Eesti ees seisvaid valikuid analüüsides oleks parim valik ravikindlustuse reservide läbimõeldud kasutuselevõtt, kuid eeldusel, et otsitakse ravikindlustuse rahastamisele pikaajalisi sisulisi lahendusi
Hinsberg, Ain
2001-01-01
Helsingi ja Tallinna vahel liikuvate laevafirmade konkurents: Silja Line, Nordic Jet Line, Tallink ja Linda Line. Tabelid: reisijad laevaliinil Helsingi-Tallinn 1998-2001; Helsingi-Tallinna liinil kiirlaevade turuosad 1999-2000
Piperazine side-effects in a patient with pre-existing renal insufficiency
Directory of Open Access Journals (Sweden)
Majid Malaki
2014-01-01
Full Text Available Piperazine as an antihelminth has many adverse effects, especially on patients with renal insufficiency. We report the use of piperazine in a girl with a moderately severe kidney disease due to Biedl Bardet syndrome. She developed coma and acute kidney injury due to acute interstitial nephritis (AIN, anemia and thrombocytopenia. The presence of fever, proteinuria, acidosis, anemia, sterile pyuria and non-oliguric renal failure strongly suggested AIN. Her problems abated mostly by discontinuing of piperazine and supportive therapy, except anemia and thrombocytopenia.
Gene : CBRC-GGOR-01-1448 [SEVENS
Lifescience Database Archive (English)
Full Text Available ain Friedlin] 1e-79 49% MCLALGSAGTADDVKLHPVACADTARSTPGTSAPSTPGTSAPSTPGTSAPSTSGISAPSTSGTSAPSTLGTSAPSKPGTSAPSKPGISAPSTSGISAPSTSGTSA...PSTSGTSAPSTPGTSAPSKPGTSAPSKPGISAPYTPGTSAPSTLGTSAPSTPGTSAPSTPGTSAPSKPGTSAPSKPGTSA...PSTPGTSAPSTLGTSAPSTPGTTAPSTAGTSAPSTSGTSAPSTSGTSAPSKPTTSAPYTPGTSAPSIPGTSAPSTTGTSAPSTPGTSAPSTPGTSAPSKPGTSAPSTPGTSA...PSTLGTSAPSTPGTSAPSTPGTSAPSKPGTSAPSMSGTSAPSTPGTSVPSKAGTSAPVDPGVLWGLERPLTDTEGRWLPPYVLL
Aluminium nitrate ceramics: A potential UV dosemeter material
DEFF Research Database (Denmark)
Trinkler, L.; Bøtter-Jensen, L.; Berzina, B.
2002-01-01
The ceramic material AIN-Y2O3 is proposed as a potential ultraviolet radiation (UVR) dosemeter using optically stimulated luminescence (OSL) and thermally stimulated luminescence (TL). Experimental studies have shown that AIN ceramics exhibit attractive characteristics suitable for practical UV...... dosimetry applications. The features are: (1) the spectral sensitivity covers the 200-350 nm range, in the UV-B region it is similar to that of human skin: (2) the angular dependence of the incident radiation follows the cosine law; (3) high yields of both UVR-induced OSL and TL signals compared to those...
Relationship of brain imaging with radionuclides and with x-ray computed tomography
Energy Technology Data Exchange (ETDEWEB)
Kuhl, D.E.
1981-03-03
Because of high sensitivity and specificity for altered local cerebral structure, x-ray computed tomography (CT) is the preferred initial diagnostic imaging study under most circumstances when cerebral disease is suspected. CT has no competitor for detecting fresh intracerebral hemorrhage. Radionuclide imaging (RN) scan is preferred when relative perfusion is to be assessed, in patients allergic to contrast media, and when an adequate CT study is not technically possible. (RN) plays an important complementary role to CT, especially for patients suspected of subacute or chronic subdura hematoma, cerebral infarction, arteriovenous malformations, meningitis, encephalitis, normal pressure hydrocephalus, or when CT findings are inconclusive. When CT is not available, RN serves as a good screening study for suspected cerebral tumor, infection, recent infarction, arteriovenous malformation, and chronic subdural hematoma. Future improvement in radionuclide imaging by means of emission composition potential. The compound plating approacl threshold for all the investigated transistors and fast neutron spectra lies within the raal. The value of the potential slightly changes with the coordinate change in this region, i.e. the charge on a collecting electrode is not practically guided up to a certain moment of time during the movement of nonequilibrium carriers.
Li, Meng-xiao; Zhang, Xia; Fan, Yu-hua; Bi, Cai-feng
2016-05-01
In the present work, a novel 5-methyl-thiophene-carbaldehyde-functionalized rhodamine 6G Schiff base (RA) was designed and easily prepared as an Al(3+) fluorescent and colorimetric probe, which could selectively and sensitively detect Al(3+) by showing enhanced fluorescence emission. Meanwhile distinct color variation from colorless to pink also provided 'naked eye' detection of Al(3+), due to the ring spirolactam opening of the rhodamine derivative. Other metal ions (including K(+), Mg(2+), Na(+), Ba(2+), Mn(2+), Cd(2+), Fe(2+), Ni(2+), Pb(2+), Zn(2+), Hg(2+), Co(2+), Li(+), Sr(2+) and Cu(2+)) could only induce limited interference. The detection limit of the fluorescent probe was estimated to be 4.17 × 10(-6) M, the binding constant of the RA-Al(3+) complex was 1.4 × 10(6) M(-1). Moreover, this fluorescent probe RA possessed high reversibility. As aluminum is a ubiquitous metal in nature and plays vital roles in many biological processes, this chemosensor could be explored for biological study applications. Copyright © 2015 John Wiley & Sons, Ltd.
Gutierrez, K; Kasimanickam, R; Tibary, A; Gay, J M; Kastelic, J P; Hall, J B; Whittier, W D
2014-04-15
The objective was to determine the effects of reproductive tract score (RTS) on reproductive performance in beef heifers bred by timed artificial insemination followed by natural service (AI-NS) or by natural service only (NSO). Angus cross beef heifers (n = 2660) in the AI-NS group were artificially inseminated at a fixed time (5- or 7-day CO-Synch + controlled internal drug release protocol) once, then exposed to bulls 2 weeks later (bull-to-heifer ratio = 1:40-1:50) for the reminder of the 85-day breeding season. Angus cross beef heifers (n = 1381) in NSO group were submitted to bulls (bull-to-heifer ratio = 1:20-1:25) for the entire 85-day breeding season. Heifers were reproductive tract scored from 1 (prepubertal) to 5 (cyclic) 4 weeks before, and were body condition scored (BCS) from 1 (emaciated) to 9 (obese) at the beginning of breeding season. Pregnancy diagnosis was performed 70 days after AI for AI-NS group and 2 months after the end of breeding season for both groups. Heifers in both groups were well managed and of similar age (14.9 ± 0.4 [AI-NS] and 14.7 ± 0.8 [NSO] months). Pregnancy rates (PRs) and number of days to become pregnant were calculated using PROC GLIMMIX and PROC LIFETEST procedures of SAS. Adjusting for BCS (P = 0.07), expressed estrus (P < 0.05), year (P < 0.05), and BCS by year interaction (P < 0.05), the AI-PR was greater for heifers in AI-NS group with higher RTS (P < 0.0001; 40.7%, 48.3%, 57.6%, and 64.6% for RTS of 2 or less, 3, 4, and 5, respectively). Controlling for BCS (P < 0.05), year (P < 0.05) and the breeding season pregnancy rates (BS-PRs) were greater for heifers in the AI-NS group with higher RTS (P < 0.01; 81.2%, 86.5%, 90.4%, and 95.2% for RTS of 2 or less, 3, 4, and 5, respectively). Similarly, adjusting for BCS, year (P < 0.05), the BS-PR was greater for heifers in NSO group with higher RTS (P < 0.01; 79.7%, 84.3%, 88.4%, and 90.2% for RTS of 2 or less, 3, 4, and 5, respectively). Heifers with higher RTS
Low Median Nerve Palsy as Initial Manifestation of Churg-Strauss Syndrome.
Roh, Young Hak; Koh, Young Do; Noh, Jung Ho; Gong, Hyun Sik; Baek, Goo Hyun
2017-06-01
Anterior interosseous nerve (AIN) syndrome is typically characterized by forearm pain and partial or complete dysfunction of the AIN-innervated muscles. Although the exact etiology and pathophysiology of the disorder remain unclear, AIN syndrome is increasingly thought to be an inflammatory condition of the nerve rather than a compressive neuropathy because the symptoms often resolve spontaneously following prolonged observation. However, peripheral neuropathy can be 1 of the first symptoms of systemic vasculitis that needs early systemic immunotherapy to prevent extensive nerve damage. Churg-Strauss syndrome (CSS; eosinophilic granulomatosis with polyangiitis) is 1 type of primary systemic vasculitis that frequently damages the peripheral nervous system. CSS-associated neuropathy usually involves nerves of the lower limb, and few studies have reported on the involvement of the upper limb alone. We report on a rare case of low median nerve palsy as the initial manifestation of CSS. The patient recovered well with early steroid treatment for primary systemic vasculitis. Copyright © 2017 American Society for Surgery of the Hand. Published by Elsevier Inc. All rights reserved.
ORF Alignment: NC_003212 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available ain Clip11262) ... Length = 200 ... Query: 88 ... NAGLIKIGISEPSASLVLPQILKQFLTDFP...KLMVNVSVDDANTCSQKLIDGEIDFAICGE 147 ... NAGLIKIGISEPSASLVLPQILKQFLTDFPKLMVNVSVDDANTCSQKLIDGEIDFAICGE Sbjct: 1 ... NAGLIKIGISEPS
Directory of Open Access Journals (Sweden)
Michel Batlouni
2010-04-01
Full Text Available Os anti-inflamatórios não esteroides (AINEs encontram-se entre os medicamentos mais prescritos em todo o mundo. Essa classe heterogênea de fármacos inclui a aspirina e vários outros agentes inibidores da ciclo-oxigenase (COX, seletivos ou não. Os AINEs não seletivos são os mais antigos, e designados como tradicionais ou convencionais. Os AINEs seletivos para a COX-2 são designados COXIBEs. Nos últimos anos, tem sido questionada a segurança do uso dos AINEs na prática clínica, particularmente dos inibidores seletivos da COX-2. As evidências sobre o aumento do risco cardiovascular com o uso de AINEs são ainda incompletos, pela ausência de ensaios randomizados e controlados com poder para avaliar desfechos cardiovasculares relevantes. Entretanto, os resultados de estudos clínicos prospectivos e de meta-análises indicam que os inibidores seletivos da COX-2 exercem importantes efeitos cardiovasculares adversos, que incluem aumento do risco de infarto do miocárdio, acidente vascular cerebral, insuficiência cardíaca, insuficiência renal e hipertensão arterial. O risco desses efeitos adversos é maior em pacientes com história prévia de doença cardiovascular ou com alto risco para desenvolvê-la. Nesses pacientes, o uso de inibidores da COX-2 deve ser limitado àqueles para os quais não há alternativa apropriada e, mesmo assim, somente em doses baixas e pelo menor tempo necessário. Embora os efeitos adversos mais frequentes tenham sido relacionados à inibição seletiva da COX-2, a ausência de seletividade para essa isoenzima não elimina completamente o risco de eventos cardiovasculares, de modo que todos os fármacos do largo espectro dos AINEs somente devem ser prescritos após consideração do balanço risco/benefício.Los antiinflamatorios no esteroides (AINEs se encuentran entre los medicamentos más prescriptos en todo el mundo. Esta clase heterogénea de fármacos incluye la aspirina y varios otros agentes
Heard, Isabelle; Etienney, Isabelle; Potard, Valérie; Poizot-Martin, Isabelle; Moore, Catherine; Lesage, Anne-Carole; Ressiot, Emmanuelle; Crenn-Hebert, Catherine; Fléjou, Jean-François; Cubie, Heather; Costagliola, Dominique; Darragh, Teresa M
2015-05-15
Although human immunodeficiency virus (HIV)-infected women are at high risk for anal cancer, few data have been published on prevalence of and risk factors for anal precancer and potential screening strategies in this risk group. A cross-sectional anal screening study was nested in a gynecological cohort of HIV-infected women. Anal swab specimens were collected for cytology and human papillomavirus (HPV) testing. High-resolution anoscopy, with biopsy when indicated, was systematically performed. Among the 171 enrolled women, median age was 47.3 years and 98% were receiving combination antiretroviral therapy. Median CD4(+) count was 655 cells/µL and HIV load was associated with increased risk of HG-AIN+. Abnormal anal cytology and HPV-16 infection performed best as a screening strategy for HG-AIN+ histology, with positive likelihood ratios of 3.4 (95% CI, 2.3-5.1) and 4.7 (95% CI, 2.5-8.7) and negative likelihood ratios of 0.2 (95% CI, .07-.8) and 0.4 (95% CI, .2-.9), respectively. HIV-infected women with a history of HPV-associated cervical disease are at increased risk for HG-AIN+ and should be offered anal cancer screening. Anal cytology and HPV-16 genotyping had the best screening performance. Anal cytology is easy to perform routinely; it may be the best candidate for screening for HG-AIN among HIV-infected women. © The Author 2015. Published by Oxford University Press on behalf of the Infectious Diseases Society of America. All rights reserved. For Permissions, please e-mail: journals.permissions@oup.com.
Dun, Wang-Huan; Yang, Jing; Yang, Ling; Ding, Dun; Ma, Xue-Ying; Liang, Feng-Li; von Deneen, Karen M; Ma, Shao-Hui; Xu, Xiao-Ling; Liu, Jixin; Zhang, Ming
2017-12-01
Neuroimaging studies have demonstrated the critical role of the insula in pain pathways and its close relation with the perceived intensity of nociceptive stimuli. We aimed to identify the structural and functional characteristics of the insula during periovulatory phase in women with primary dysmenorrhea (PDM), and further investigate its association with the intensity of perceived pain during menstruation. Optimized voxel-based morphometry and functional connectivity (FC) analyses were applied by using 3-dimensional T1-weighted and resting functional magnetic resonance imaging (fMRI) in 36 patients at the peri-ovulation phase and 29 age-, education-, and gender-matched healthy controls (HC). A visual analogue scale (VAS) was used to examine the intensity of the abdominal pain at periovulation and menstruation. In our results, PDM patients had significant higher VAS-rating during menstruaion than periovulation. Compared with the HC, PDM patients had lower gray matter density in the left anterior insula (aINS). Taken the left aINS as a seed region, we further found hypoconnectivity between aINS and medial prefrontal cortex (mPFC), which showed negative relation with the VAS during menstruation. As the aINS is a key site of the salience network (SN) and the mPFC is a critical region in the default mode network (DMN), it's implicated a trait-related central-alteration that communications between pain attention and perception networks were disrupted without the ongoing menstrual pain. Moreover, result of correlation analysis, at least in part, suggested a possible role of altered FC (pain-free period) in predicting pain perception (menstruation).
KRYMCHANTOWSKI, ABOUCH V.; BARBOSA, JACKELINE
1999-01-01
Alguns antinflamatórios não esteroidais (AINE) orais são eficientes para o tratamento dos ataques de migrânea ou enxaqueca. A despeito de sua eficiência para o tratamento destas cefaléias e de outras dores, existem comercialmente poucos antinflamatórios não esteroidais disponíveis para administração parenteral. O clonixinato de lisina (CL) é um AINE derivado do ácido nicotínico que foi comprovadamente eficiente em vários tipos de síndromes álgicas como cólica renal, dor de compressão nervosa,...
Tissot, B; Lamy, A; Perraudeau, F; Manouvrier, J L; Imbert, Y
2002-07-13
We report the case of severe colitis occurring during treatment with non-steroid anti-inflammatories (NSAI). A 57 year-old woman was hospitalized for lumbar pain that had not been relieved by AINS, tramadol and then morphine. The patient presented with septic shock and peritonitis by rectal perforation, followed by acute rectorrhagia. The endoscopic aspect evoked Crohn's disease with a recto-vaginal fistula. Progression was further complicated by two episodes of collapse because of acute rectorrhagia, requiring hemostasis colectomy and abdominal-perineal amputation. The diagnosis retained was AINS-induced colitis complicated by acute colectasia on a fecaloma with recto-vaginal fistula.
ORF Alignment: NC_003212 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available ain ... Clip11262) ... Length = 73 ... Query: 8 ... ASALLELIGGKENISSVTHCATRMRFV...LLDPDNADVEAIEDIPAVKGTFTQAGQFQVIIG 67 ... ASALLELIGGKENISSVTHCATRMRFVLLDPDNADVEAIEDIPAVKGTFTQAGQFQ...VIIG Sbjct: 1 ... ASALLELIGGKENISSVTHCATRMRFVLLDPDNADVEAIEDIPAVKGTFTQAGQFQVIIG 60 ...
Directory of Open Access Journals (Sweden)
Khadija OUAISSA
2017-05-01
Full Text Available The objective of our study is to test the efficacy of an extruded food on the growth performance of rainbow trout (Oncorhynchus mykiss Walbaum, 1792 at the fish farm Ain Aghbal in Azrou (Morocco. Generally, only the biochemical composition (percentages of moisture, proteins, lipids and carbohydrates and the (digestible and crude energies of the food are previously known, which is insufficient for the choice of the food in terms of growth performance and quality/environment. The rainbow trout breeding tanks used for this test are 222 days (15 June 2015 - 28 February 2016 are fed with water directly taken from the water of the Oum Er-Rbia sources according to an open circuit with a Renewal of water every half hour. The flow rate is 11.04m3/h. The initial breeding conditions, the density (Kg per volume 1.58kg/m3 and the initial charge with respect to the flow rate is 1.05 m3 / h. Fish are fed by ratios two to three times per day depending on the rearing stage. The frequency of sampling is biweekly where we measured the zootechnical performances of the fish and taken water samples for physicochemical analyzes in order to assess the quality of the waters of exit of the basins before their rejection in the Oum-Er-Rbia river. The results show that the test food shows a better growth of the rainbow trout and a conversion index not exceeding 0.9 for a size of 1043 g of trout.
Directory of Open Access Journals (Sweden)
Jeremiah T. Steed
2017-01-01
Full Text Available Arthroscopic rotator cuff tendon repair is a common elective procedure performed by trained orthopaedic surgeons with a relatively low complication rate. Specifically, isolated neuropraxia of the anterior interosseous nerve (AIN is a very rare complication of shoulder arthroscopy. An analysis of peer-reviewed published literature revealed only three articles reporting a total of seven cases that describe this specific complication following standard shoulder arthroscopic procedures. This article reports on three patients diagnosed with AIN neuropraxia following routine shoulder arthroscopy done by a single surgeon within a three-year period. All three patients also underwent open biceps tenodesis immediately following completion of the arthroscopic procedures. The exact causal mechanism of AIN neuropraxia following shoulder arthroscopy with biceps tenodesis is not known. This case report reviews possible mechanisms with emphasis on specific factors that make a traction injury the most likely etiology in these cases. We critically analyze our operating room setup and patient positioning practices in light of the existing biomechanical and cadaveric research to propose changes to our standard practices that may help to reduce the incidence of this specific postoperative complication in patients undergoing elective shoulder arthroscopy with biceps tenodesis.
Non-nitric oxide based metallovasodilators: synthesis, reactivity and biological studies.
Sá, Denise S; Fernandes, André F; Silva, Carlos D S; Costa, Paula P C; Fonteles, Manassés C; Nascimento, Nilberto R F; Lopes, Luiz G F; Sousa, Eduardo H S
2015-08-14
There is an increasing number of compounds developed to target one or more pathways involved in vasodilation. Some studies conducted with azaindole and indazole derivatives showed cardiovascular activity associated with these compounds. Fast and easy structural modification of these organic molecules can be achieved using metal complexes promoting a much larger spatial change than organic strategies, potentially leading to novel drugs. Here, we have prepared a series of complexes with a formula cis-[RuCl(L)(bpy)(2)]PF(6), where L = 7-azaindole (ain), 5-azaindole (5-ain), 4-azaindole (4-ain), indazole (indz), benzimidazole (bzim) or quinoline (qui), which were characterized by spectroscopic and electrochemical techniques (CV, DPV). These compounds showed reasonable stability exhibiting photoreactivity only at low wavelength along with superoxide scavenger activity. Cytotoxicity assays indicated their low activity preliminarily supporting in vivo application. Interestingly, vasodilation assays conducted in rat aorta exhibited great activity that largely improved compared to free ligands and even better than the well-studied organic compound (BAY 41-42272), with IC(50) reaching 55 nM. These results have validated this strategy opening new opportunities to further develop cardiovascular agents based on metallo-bicyclic rings.
Investorid on dilemma ees / Ain Kivisaar
Kivisaar, Ain, 1978-
2007-01-01
Keskmise kuupalga eest ei saa enam ruutmeetritki elamispinda ei meil ega mujal. Aktiivsel investoril pole muud teha, kui heita kõrvale tavatarkus ja usaldada enda sisetunnet. Diagramm: Keskmise kuupalga ja korteri ruutmeetri hinna suhe
Euroopa abiraha igatseb taotlejaid / Ain Alvela
Alvela, Ain, 1967-
2008-01-01
Aastatel 2007-2013 saab Eesti Euroopa Liidult toetusi 78 miljardit krooni, millele toetudes on võimalik rasked ajad üle elada. Vt. samas: Tuhahoidlast asula jäätmepunktini; Suurima toetuse saab keskkond. Kommenteerivad Antti Tooming ja Kai Niels Willadsen
Teacher Tenure "Ain't" the Problem.
Hansen, Kenneth; Ellena, William J.
The concept of "tenure," with all its clumsy and confusing burden of historic and current misinterpretation, will probably soon disappear. However, what tenure laws intended, and have failed to do, will almost surely be preserved in other forms of administrative procedure. To be effective, administrative procedures must be (1) clear and detailed,…
VJ annab muusikale visuaalsuse / Ain Kivesti
Kivesti, Ain
2008-01-01
Videograafikast. Video jockey ehk videokunstnik maalib kunstiteoseid piltide ja visuaalsete elementide abil, tehes seda muusika taustal, tavaliselt paralleelselt disco jockey'ga. Toomas Altnurme, Taavi Varmi, Sten Saluveeri ja Erki Kannuse kommentaare
Makita kalmistu antropoloogiline aines / Luule Heapost
Heapost, Luule
1993-01-01
Tabel : Makita koljude keskmised mõõtmed ; Tabel : 13.-15. sajandi Makita koljud ja võrdlusmaterjalid Eestist ; Tabel 3 : 13. -15. sajandi Makita koljud ning võrdlusandmeid soome-ugri hõimude asualadelt ; Tabel 4 : 15.- 17. sajandi Makita koljud ja võrdlusandmed ; Tabel 5 : Makita koljude võrdlusandmed (Pernose'i meetodil) ; Tabel 6 : Makita luustike pikkade luude keskmine pikkus ; Tabel 7 : Kehapikkuse võrdlusandmed
Globaalsus + lennundus = Star Alliance? / Ain Hinsberg
Hinsberg, Ain
2002-01-01
Erinevad koostöövormid lennufirmade vahel, alliansside teke ja areng maailmas. Maailma juhtivad lennundusalliansid ja nende poolt kaetud riigid ja sihtkohad. Kommenteerib Estonian Airi president Erki Urva
Walhof, Gert
Omtrent technologiebedrijven konden we in december 2016 veel lezen over wat artificial intelligence, virtual reality, machine-to-machine automation, machine-to-machine learning en chatbots ons de komende jaren gaan brengen. Als inkoper zou je kunnen wachten tot duidelijk wordt wat de blijvertjes
Brain damage associated with apraxia of speech: evidence from case studies.
Moser, Dana; Basilakos, Alexandra; Fillmore, Paul; Fridriksson, Julius
2016-08-01
The site of crucial damage that causes acquired apraxia of speech (AOS) has been debated in the literature. This study presents five in-depth cases that offer insight into the role of brain areas involved in AOS. Four of the examined participants had a primary impairment of AOS either with (n = 2) or without concomitant mild aphasia (n = 2). The fifth participant presented with a lesion relatively isolated to the left anterior insula (AIns-L), damage that is rarely reported in the literature, but without AOS. Taken together, these cases challenge the role of the AIns-L and implicate the left motor regions in AOS.
From Concept to Commissioning: The Library - Scheduling, Programming, Phasing
Directory of Open Access Journals (Sweden)
Marie-Francoise Bisbrouck
2004-06-01
Full Text Available Following assessment of the last two seminars organised by the LIBER Architecture Group in 2000 (in Warsaw and 2002 (in Leipzig, it appeared that a certain number of participants from those seminars wished to have a re-run of the various organisational phases involved in operations for building, extending or restructuring libraries: the motivation being to ensure the clear definition of the associated processes, and identify the various players and their respective roles, together with the actions required at various times to ensure the harmonious implementation of the construction programme. I should therefore like to describe this process in as objective a fashion as possible, given that other speakers will later be telling you of their experiences as "library builders" - in particular Karl Krarup and Elmar Mittler. Karl's presentation, entitled "How to Survive in the World of Architects and Building Departments", and Elmar's, rather "combatively" (! presentation, entitled "The Battle for Good Library Buildings". This will certainly leave you with an understanding of just how much of a cool head is required, not to mention clear ideas, a sharp sense of diplomacy and a generous dose of organisational and management skills, all underpinned by a long-term vision as to the likely development of libraries in today's world and tomorrow's, in order to arrive at the goal: the realisation of a fine and efficient library. The need is also there, of finding ways to communicate the vision over the long term, to all players involved, to ensure that the necessary funds remain available. Therefore I should like first to sketch - in as dispassionate terms as I can manage - how the scenario evolves, or should evolve, if we all lived - like we deserve - in a well organised world, with each party working without the slightest ulterior motive towards the design and production of our libraries. I propose to examine the situation from certain aspects, in particular
Data of evolutionary structure change: 1ONAD-2GDFC [Confc[Archive
Lifescience Database Archive (English)
Full Text Available 1ONAD-2GDFC 1ONA 2GDF D C ADTIVAVELDTYPNTDIGDPSYPHIGIDIKSVRSKKTAK...WNMQNGKVGTAHIIYNSVDKRLSAVVSYPNADSATVSYDVDLDNVLPEWVRVGLSASTGLYKETNTILSWSFTSKLKT-NALHFMFNQFSKDQKDLILQGDATTGTDG...ain> 1ONA D 1ONAD
Data of evolutionary structure change: 1ONAD-2GDFA [Confc[Archive
Lifescience Database Archive (English)
Full Text Available 1ONAD-2GDFA 1ONA 2GDF D A ADTIVAVELDTYPNTDIGDPSYPHIGIDIKSVRSKKTAK...WNMQNGKVGTAHIIYNSVDKRLSAVVSYPNADSATVSYDVDLDNVLPEWVRVGLSASTGLYKETNTILSWSFTSKLKT-NALHFMFNQFSKDQKDLILQGDATTGTDG...ain> 1ONA D 1ONAD
Directory of Open Access Journals (Sweden)
Helena Lúcia Alves Pereira
2006-06-01
Full Text Available Os antiinflamatórios não-esteroidais (AINEs orais são eficazes no alívio da dor na osteoartrite (OA, porém têm o risco de efeitos adversos sistêmicos. Para diminuir a toxicidade é necessário reduzir a concentração plasmática uma vez que os efeitos adversos são dose-dependentes. Os AINEs de uso tópico, em teoria, alcançam altas concentrações nos tecidos-alvo com concentrações plasmáticas baixas, sendo portanto uma alternativa terapêutica, especialmente para pacientes de risco. Nossa revisão dos ensaios clínicos randomizados mostrou que os AINEs tópicos foram mais efetivos que o placebo e tão eficazes quanto os AINEs orais. Porém, o pequeno número de ensaios e falhas na metodologia nos impossibilita de fazer conclusões definitivas, sendo necessários estudos bem desenhados e de maior duração.Oral non-steroidal anti-inflammatories drugs (NSAIDs are effective in pain relief in osteoarthritis (OA, but are also associated with risks of adverse systemic side effects. In order to reduce its toxicity, it would be desirable to decrease the plasmatic levels of NSAIDs since those side effects are dose-dependent. Topical NSAIDs would be a therapeutic alternative in theory, because while they reach high levels in local tissues, they also produce low plasmatic levels. Our review analyzed clinical randomized and shown that topical NSAIDs were superior to placebo and have similar efficacy to oral NSAIDs, but due a few number of trials and methodological weaknesses we can't make definitive conclusions. Further well designed, long term studies are required.
Onodera, Rie; Kurita, Emi; Taniguchi, Kikuyo; Karakawa, Shuhei; Okada, Satoshi; Kihara, Hirotaka; Fujii, Teruhisa; Kobayashi, Masao
2017-11-01
Anti-human neutrophil antigen (HNA) antibodies have been implicated in the development of neonatal alloimmune neutropenia (NAN) and autoimmune neutropenia (AIN). There are many conventional assay methods that detect anti-HNA antibodies. However, a method to measure multiple samples and detect several anti-HNA antibodies simultaneously is needed. We developed a new method, the extracted granulocyte antigen immunofluorescence assay (EGIFA), to analyze anti-HNA-1a, -1b, and -2 antibodies in sera. The results obtained by EGIFA were evaluated in comparison with those from several standard assay methods. Anti-HNA antibodies in serum samples from nine familial cases with suspected NAN (n = 19) and children with suspected AIN (n = 88) were also measured by EGIFA. The evaluation of nine serum samples with anti-HNA antibodies suggested that EGIFA demonstrated equivalent specificity and superior sensitivity to monoclonal antibody-specific immobilization of granulocyte antigens and had comparable sensitivity to the granulocyte indirect immunofluorescence test. EGIFA successfully detected anti-HNA-1a or -1b antibodies in seven of nine familial cases with suspected NAN. EGIFA detected anti-HNA antibodies in 40.9% of children with suspected AIN. Among them, isolated anti-HNA-1a or -1b antibody was detected in 4.5 or 12.5% of children, respectively, and anti-HNA-2 antibody was identified in 3.4% of children. The 30.8% (16 of 52) of children negative for anti-HNA antibody by EGIFA were positive for anti-HLA antibody. EGIFA facilitated the measurement of anti-HNA-1a, -1b, and/or -2 antibodies in sera. The prompt measurement of anti-HNA antibodies will improve the diagnosis and clinical management of patients with suspected NAN or AIN. © 2017 AABB.
Sikora, Elżbieta; Bodziarczyk, Izabela
2013-01-01
Organism's lipid peroxidation is one of the most often examined and known physiological process evoked by free radicals. It concerns oxidation reaction of unsaturated fatty acid and/or other lipids leading to lipid oxidation products (LOP), which as a result of further changes generate among others the malondialdehyde molecules. The aim of the work was an estimation if raw or cooked kale addition to rat's diet influences antioxidant defense efficiency in their organisms in comparison to rats fed with standard AIN-93G diet. The experiment was conducted with 36 Wistar strain, male rats over 21 days. The rats were divided into 3 groups (each 12 stuck) which were fed with: standard diet AIN-93G (2 groups), AIN-93G diet with 10% addition of raw kale (2 groups), and AIN-93G with 10% addition of cooked lyophilised kale. The total content of polyphenols (FC method) and antioxidant activity (ABTS+•) were previously determined in raw and then in cooked kale. On the 20th day of experiment, half of rats (6 stuck) of each kind of the diet were injected intraperitoneally by the solution of paraquat (PQ) in physiological salt to evoke the oxidative stress. The next day animals were stunned and blood from their hearts was sampled. In the obtained serum, the levels of lipid oxidation products (LOP) and malondialdehyde (MDA) were assessed. It was observed that in blood serum of rats fed with modified diet with raw and cooked lyophilised kale addition the lipid oxides level was lower in comparison to control group fed with standard diet (p kale addition. Diet with kale, both raw and cooked, efficiently inhibited the lipid peroxidation process in rats' organisms, ongoing during natural metabolism and during evoked oxidative stress.
Directory of Open Access Journals (Sweden)
R Ramachandran
2015-01-01
Full Text Available Steroids are used in the management of drug-induced acute interstitial nephritis (AIN. The present study was undertaken to compare the efficacy of pulse methyl prednisolone with oral prednisolone in the treatment of drug-induced AIN. Patients with biopsy-proven AIN with a history of drug intake were randomized to oral prednisolone (Group 1 1 mg/kg for 3 weeks or a pulse methyl prednisolone (Group II 30 mg/kg for 3 days followed by oral prednisolone 1 mg/kg for 2 weeks, tapered over 3 weeks. Kidney biopsy scoring was done for interstitial edema, infiltration and tubular damage. The response was reported as complete remission (CR (improvement in estimated glomerular filtration rate [eGFR] to ≥60 ml/min/1.73 m 2 , partial remission (PR (improvement but eGFR <60 ml/min/1.73 m 2 or resistance (no CR/PR. A total of 29 patients, Group I: 16 and Group II: 13 were studied. Offending drugs included nonsteroidal anti-inflammatory drugs, herbal drugs, antibiotics, diuretic, rifampicin and omeprazole. There was no difference in the baseline parameters between the two groups. The biopsy score in Groups I and II was 5.9 1.1 and 5.1 1.2, respectively. At 3 months in Group I, eight patients each (50% achieved CR and PR. In Group II, 8 (61% achieved CR and 5 (39% PR. This was not significantly different. Percentage fall in serum creatinine at 1 week (56% was higher in CR as compared to (42% those with PR. ( P = 0.14. Patients with neutrophil infiltration had higher CR compared to patients with no neutrophil infiltration ( P = 0.01. Early steroid therapy, both oral and pulse steroid, is equally effective in achieving remission in drug-induced AIN.
Kaks debüüti / Lilian Vellerand
Vellerand, Lilian, 1932-
1997-01-01
"Shakespeare'i kogutud teosed" ("The Complete Works of William Shakespeare") Rakvere Teatris, lavastaja Ain Prosa ja Friedebert Tuglase - Ingomar Vihmari "Hei, Luciani!" Ugalas, lavastaja Ingomar Vihmar
Physical and mental health: from youth to age in Ohio prisons.
Lynd, Alice
2014-01-01
Who cares about health care in prisons? You do if you have a son or a granddaughter in prison. Maybe you care anyway if you have had to wait a long time to see a doctor or if you could not have the treatment you needed because it cost too much. Maybe you have run into the attitude, "You ain't bleedin', you ain't needin'." Maybe you have found it hard to face the future with little or no hope that you could ever be in a better place. Or maybe you, like some older prisoners, have been able to develop new interests, new skills, to review your life and review it, and to redefine what matters.
Data of evolutionary structure change: 1ONAD-2D3PB [Confc[Archive
Lifescience Database Archive (English)
Full Text Available 1ONAD-2D3PB 1ONA 2D3P D B ADTIVAVELDTYPNTDIGDPSYPHIGIDIKSVRSKKTAK...WNMQNGKVGTAHIIYNSVDKRLSAVVSYPNADSATVSYDVDLDNVLPEWVRVGLSASTGLYKETNTILSWSFTSKLKT------NALHFMFNQFSKDQKDLILQGDAT...ain> 1ONA D 1ONAD TR
Keratosis reduces sensitivity of anal cytology in detecting anal intraepithelial neoplasia.
ElNaggar, Adam C; Santoso, Joseph T; Xie, Huiwen Bill
2012-02-01
To identify factors that may contribute to poor sensitivity of anal cytology in contrast to the sensitivity of anoscopy in heterosexual women. We analyzed 324 patients with biopsy confirmed diagnosis of genital intraepithelial neoplasia (either vulva, vaginal, or cervical) from 2006 to 2011 who underwent both anal cytology and anoscopy. Cytology, anoscopy, and biopsy results were recorded. Biopsy specimens underwent independent analysis for quality of specimen. Also, biopsy specimens were analyzed for characteristics that may contribute to correlation, or lack thereof, between anal cytology and anoscopic directed biopsy. 133 (41%) patients had abnormal anoscopy and underwent directed biopsy. 120 patients with normal anal cytology had anoscopy directed biopsies, resulting in 58 cases of AIN (sensitivity 9.4%; 0.039-0.199). This cohort was noted to have extensive keratosis covering the entire dysplastic anal lesion. 18 patients yielded abnormal anal cytology. Of these patients, 13 had anoscopic directed biopsies revealing 6 with AIN and absent keratosis (specificity 88.6%; 0.78-0.95). The κ statistic for anal cytology and anoscopy was -0.0213 (95% CI=-0.128-0.086). Keratosis reduces the sensitivity of anal cytology. Furthermore, anal cytology poorly correlates with anoscopy in the detection of AIN (κ statistic=-0.0213). Copyright © 2011 Elsevier Inc. All rights reserved.
Directory of Open Access Journals (Sweden)
Megan C. Hallam
2016-01-01
Full Text Available The Thrifty Phenotype Hypothesis proposes that the fetus takes cues from the maternal environment to predict its postnatal environment. A mismatch between the predicted and actual environments precipitates an increased risk of chronic disease. Our objective was to determine if, following a high fat, high sucrose (HFS diet challenge in adulthood, re-matching offspring to their maternal gestational diet would improve metabolic health more so than if there was no previous exposure to that diet. Animals re-matched to a high prebiotic fiber diet (HF had lower body weight and adiposity than animals re-matched to a high protein (HP or control (C diet and also had increased levels of the satiety hormones GLP-1 and PYY (p < 0.05. Control animals, whether maintained throughout the study on AIN-93M, or continued on HFS rather than reverting back to AIN-93M, did not differ from each other in body weight or adiposity. Overall, the HF diet was associated with the most beneficial metabolic phenotype (body fat, glucose control, satiety hormones. The HP diet, as per our previous work, had detrimental effects on body weight and adiposity. Findings in control rats suggest that the obesogenic potential of the powdered AIN-93 diet warrants investigation.
Heat Transfer Characteristics in High Power LED Packaging
Directory of Open Access Journals (Sweden)
Chi-Hung Chung
2014-03-01
Full Text Available This study uses the T3Ster transient thermal resistance measuring device to investigate the effects to heat transfer performances from different LED crystal grains, packaging methods and heat-sink substrates through the experimental method. The experimental parameters are six different types of LED modules that are made alternatively with the crystal grain structure, the die attach method and the carrying substrate. The crystal grain structure includes the lateral type, flip chip type and vertical type. The die attach method includes silver paste and the eutectic structure. The carrying substrates are aluminum oxide (Alumina and aluminum nitride (AIN ceramic substrates and metal core PCB (MCPCB. The experimental results show that, under the conditions of the same crystal grain and die attach method, the thermal resistance values for the AIN substrate and the Alumina substrate are 2.1K/W and 5.1K/W, respectively and the total thermal resistance values are 7.3K/W and 10.8K/W. Compared to the Alumina substrate, the AIN substrate can effectively lower the total thermal resistance value by 32.4%. This is because the heat transfer coefficient of the AIN substrate is higher than that of the Alumina substrate, thus effectively increasing its thermal conductivity. In addition, under the conditions of the same crystal grain and the same substrate, the packaging methods are using silver paste and the eutectic structure for die attach. Their thermal resistance values are 5.7K/W and 2.7K/W, respectively, with a variance of 3K/W. Comparisons of the crystal grain structure show that the thermal resistance for the flip chip type is lower than that of the traditional lateral type by 0.9K/W. This is because the light emitting layer of the flip chip crystal grain is closer to the heat-sink substrate, shortening the heat dissipation route, and thus lowering the thermal resistance value. For the total thermal resistance, the crystal grain structure has a lesser
Meie igapäevane paanika / Ott Karulin
Karulin, Ott, 1980-
2007-01-01
Kahest Vanemuise teatri lavastusest Tartus - Saksa Kultuuri Instituudis etendunud Ingvar Ambjornseni-Axel Hellsteniuse "Elling" Ain Mäeotsa lavastuses ja Laura Cunninghami "Beautiful Bodies" Vanemuises, lavastaja Jüri Lumiste
Case C-182/15, Proceedings Relating to the Extradition of Aleksei Petruhhin / Filippo Fontanelli
Fontanelli, Fillippo
2017-01-01
Euroopa Kohtu lahendist, mis puudutab Venemaa ametiasutuste poolt Läti ametiasutustele saadetud Eesti kodaniku Aleksei Petruhhini väljaandmise taotlust seoses narkootilise aine turustamise süüteoga
Leijen, Äli, 1979-
2013-01-01
Aineõpetaja magistriõppe üliõpilaste seas läbi viidud uurimusest, milles vaadeldakse, kuidas üliõpilased koordineerivad personaalset ja professionaalset mina-positsiooni erialaste ambivalentsete olukordade kontekstis
2008-01-01
Artikkel kirjeldab õpetajakoolituse olukorda Eestis aastal 2003. Aineõpetajate, klassiõpetajate ja koolieelsete lasteasutuste õpetajate ettevalmistusest Tallinna Ülikoolis ning nende karjääriperspektiive tööturul
Directory of Open Access Journals (Sweden)
Navas Suárez Gabriel Rodolfo
2012-12-01
Full Text Available La caracterización de la megafauna de la plataforma y talud superior del Caribe yparte norte del Pacífico colombianos, realizada por diferentes exploraciones entre1998 y 2009, confirma la riqueza específica, abundancia e importancia ecológicade las familias de galateoideos (Munididae y Munidopsidae. Sus especies formanconglomerados que en las partes más someras parecen estar condicionados por lapresencia de hábitats particulares como formaciones coralinas de profundidad, aprofundidades intermedias por las variaciones más importantes en las característicasde las masas de agua, y a mayores profundidades por características biológicas de lasespecies, que les permiten adaptarse a la heterogeneidad ecológica de la costa hastalos 500 m de profundidad. No se observó una relación clara entre la formación deconglomerados de estaciones y la sectorización por ecorregiones propuesta para elmar Caribe colombiano
Rector's office as of 31 December 2006
2007-01-01
Rektor prof. Jaak Aaviksoo, teadusprorektor prof. Ain Heinaru, õppeprorektor prof. Birute Klaas, administratsioonidirektor prof. Mihkel Pärnoja, finantsdirektor Taimo saan, haldusdirektor Riho Illak, akadeemiline sekretär Ivar-Igor Saarniit
Esteet Hartshenko contra mehed punases / Heili Vaus-Tamm
Vaus-Tamm, Heili, 1961-
2007-01-01
Tantsuetendustest Kumu Kunstimuuseumis: "Red ain't dead", koreograaf - lavastajad Kaarel Väli, Kristjan Rohioja; tantsuteatri Zick esituses "Piaf", koreograaf - lavastaja Dmitri Harchenko. Dominiiklaste kloostri klausuuris "Reisijuht", koreograaf - lavastaja Dmitri Harchenko
Stirlitzi leitmotiivist rõõmsalt süüdimatu jäneste lauluni / Jüri Aarma
Aarma, Jüri, 1951-
2010-01-01
Vene filmimuusika kontserdist "Seitseteist kevadist hetke", mis toimub Vanemuise kontserdimajas 2. aprillil, Jõhvi kontserdimajas 4. aprillil ja Estonia kontserdisaalis 6. aprillil, lavastaja Ain Mäeots. Näidatakse vastavaid filmilõike
Vahemets, Aivo
2006-01-01
Uutest heliplaatidest Waltari "Blood Sample", Anthony Hamilton "Ain't Nobody Worrying", Kismabande "Polüpale", Siiri Sisask "Kuu lõhn", Les Diamants "Fortune Fools", "The Voice Clubbin", Nits "Les Nuits"
Politicians spin attacks against methadone, syringe replacement / Milda Seputyte
Seputyte, Milda
2005-01-01
Leedu parlamendiliikmed osalevad kampaanias, millega võideldakse narkomaanidele tasuta süstalde jagamise ja sõltuvuse vastase aine metadooni vastu, kuna nende arvates need meetmed pigem süvendavad narkomaaniat
Kõnnivad köiel ja hoiavad kätt / Iir Hermeliin, Jaanus Vahtra ; intervju Sven Karja
Iir Hermeliin, pseud., 1973-
2000-01-01
Teatrikunstnikud Iir Hermeliin ja Jaanus Vahtra ning nende looming. Kunstnikud lavastajatest ja lavastajad Mati Unt ja Ain Mäeots koostööst kunstnikega lavastustes "Jacques ja tema isand"; "Laulatus"
2007-01-01
Rektor prof. Jaak Aaviksoo, teadusprorektor prof. Ain Heinaru, õppeprorektor prof. Birute Klaas, administratsioonidirektor prof. Mihkel Pärnoja, finantsdirektor Taimo saan, haldusdirektor Riho Illak, akadeemiline sekretär Ivar-Igor Saarniit
CERN firemen share their expertise
Maximilien Brice
2002-01-01
Firemen from local fire brigades have been coming to CERN to learn modern fire-fighting techniques. The CERN fire brigade has some unique training equipment for two particularly dangerous fire hazards, flashover and backdraft. Flashover occurs when a room that is on fire reaches a temperature of 400 to 500°. Beyond this point, a fully developed fire breaks out. This series of photos shows recruits from the fire services of Ain (Service Départemental Incendie et Secours (SDIS)) taking part in a flashover training exercise at CERN. Photo 01: Christopher Griggs, Chief Instructor of the CERN fire brigade (seated in the centre), explains the technique of using a fire-hose during a flashover to the recruits from the Ain SDIS.
2006-01-01
Vanemuise teatri draamanäitlejad tunnistasid möödunud aasta parimaks lavastuseks augustis Setumaal Obinitsas etendunud "Taarka", mille lavastas Ain Mäeots. Parimaks naispeaosatäitjaks valiti Merle Jääger, parimaks meespeaosatäitjaks Indrek Taalmaa, parimaks naiskõrvalosatäitjaks Karin Tammaru, parimaks meeskõrvalosatäitjaks Tanel Jonas. Eesti Draamateatri 2005. aasta Antsud ehk kolleegipreemiate laureaadid : Ingomar Vihmar (parim lavastaja), Ervin Õunapuu (parim kunstnik), Ülle Kaljuste (parim naisnäitleja), Ain Lutsepp (parim meesnäitleja), Väikesed Antsud pälvisid Elina Reinold ja Taavi Teplenkov, Abi-Antsuks kuulutati teatri kirjandusala juhataja Ene Paaver. Endla 2005. aasta kolleegipreemiad said Lii Tedre (parim naisnäitleja), Tambet Seling (parim meesnäitleja), Tiit Palu (parim lavastaja) ja Silver Vahtre (parim kunstnik)
Kummitusmaja ja fusion-köök = Haunted House and Fusion Cuisine / Kai Lobjakas
Lobjakas, Kai, 1975-
2003-01-01
Tallinnas Rataskaevu 16 asuva jaapani toitu pakkuva restorani "Sushihouse" kujundus, ruumide restaureermine. Sisekujundajad Ain Nurmela ja Liina Link. Projekt 2001-2003, valmis 2003. Kõige muinsusteadlikumalt restaureeritud maja 2002. a. 3 ill
Materjalide jagamisest võidavad kõik / Maarja Soone
Soone, Maarja
2011-01-01
Koolitusest Colchesteris - Content and Language Integrated Learning, mis tähendab võõrkeelset aineõpet, kus vajadusel võetakse kasutusele ka emakeel, mistõttu viidatakse sellele tihti kui kakskeelsele õppele
Märkmeid uusima Preisi tsensuuriinstruktsiooni kohta / Karl Marx
Marx, Karl
2000-01-01
Preisi uue (1841. aasta) tsensuuriinstruktsiooni tõusikliku vaimu vastuolust vana (1818. aasta) tsensuurimääruse ratsionalismiga. Moraali ja religiooni vastuolust. Vt. ka Ain Kaalepi artiklit "Veel Karl Marxist ja tsensuurist
Tallinn pokupajet zemlju dlja prokladki shosse Põhjaväil
2007-01-01
Seoses Russalkast Ahtri tänavani ulatuva tee-ehitusega seisab linnal ees 16 maaküsimuse lahendamine. Probleemidest seoses väila osaliselt merre ehitamisega. Kommenteerivad Alo Brandt ja Ain Valdmann
Lifescience Database Archive (English)
Full Text Available oencephalopathy (CADASIL) CADASIL is a chronic cerebrovascular disorder characterized by recurrent ischemic attacks and frequent migr...aines associated with diffuse white-matter abnormalities. CADASIL is caused by muta
AHHAA keskus Tartus = The Ahhaa Science Centre in Tartu / Triin Ojari
Ojari, Triin, 1974-
2011-01-01
2011. a. valminud AHHAA teaduskeskuse arhitektid on Ain Padrik ja Vilen Künnapu (AB Künnapu & Padrik), sisearhitektid Tea Tammelaan, Krista Lepland ja Malle Jürgenson (Laika, Belka & Strelka). Projekt: 2008
Vene elu hõng Pilistvere rehealuses / Margot Visnap
Visnap, Margot, 1959-
2008-01-01
Pilistvere rehehoones etendunud Ain Saviaugu kirjutatud ja lavastatud suvetükist "Rasputin". Suvelavastuse tõi välja Põltsamaa Teater Ellunäod koos professionaalsete näitlejatega. Nimiosas Indrek Saar
Vek lovi - vek utshis / Hillar Jõõts ; interv. Kalju Hook
Jõõts, Hillar
2005-01-01
Keskkonnainspektsiooni Pärnumaa osakonna juhtivspetsialist Hillar Jõõts keskkonnaministeeriumi kalavarude osakonna juhataja Ain Soome, Eesti Kalurite Liidu juhatuse esimehe Andres Variku ja Eesti Mereinstituudi direktori Toomas Saati kohtumisest Pärnumaa kaluritega
Yeast Interacting Proteins Database: YOR171C, YOR034C [Yeast Interacting Proteins Database
Lifescience Database Archive (English)
Full Text Available ain base phosphates, which function as signaling molecules, regulates synthesis of ceramide from exogenous l...chain base phosphates, which function as signaling molecules, regulates synthesis of ceramide from exogenous
Bez kota mõsham razdolje / Jevgeni Kapov
Kapov, Jevgeni
2004-01-01
Sillamäe linnapea Ain Kiviorgi ja Vaivara vallavanema Veiko Luhalaidi kohtumisest Politseiameti peadirektori Robert Antropovi ja Ida politseiprefekti Kalev Prillopiga, kus arutati seoses politseireformiga Sillamäe regioonis tekkinud korrakaitse probleeme
President Meri annetas aumärke
1996-01-01
Riigivapi I klassi orden Jaan Krossile ja Kalju Lepikule; Riigivapi III klassi orden Ain Kaalepile, Hilja Rüütlile (Aili Helm); Riigivapi IV klassi orden Voldemar Millerile, Juhan Peeglile ja Ants Viiresele
Partii Reform ne bezrazlitshna sudba russkogo obrazovanija / Sergei Ivanov
Ivanov, Sergei, 1958-
2005-01-01
Riigikogu liige vastab küsimustele, mis puudutavad Tallinna Pedagoogikaülikoolis algavat vene koolide jaoks aineõpetajate ettevalmistamist ja selleks ettenähtud rahasummat, vene akadeemilise keskuse loomiseks eraldatud raha kulutamist
Lifescience Database Archive (English)
Full Text Available aine ... D01152 ... Oxethazaine (JP17/USAN); Oxetacaine (INN) ... D08311 ... Oxetacaine hydrochloride ... DG00801 ... Bupivacaine ... D07552 ... Bupiva...caine (USAN/INN) ... D01450 ... Bupivacaine hydrochloride (USP); Bupivacaine hydrochl
Biznes i obshtshestvo : Sillamäe võhodit iz desjatiletnei spjatshki / Artur Tooman
Tooman, Artur, 1971-
2006-01-01
Sillamäe linna eluolu, sadama mõju linna arengule. Arvamust avaldavad linnavolikogu liige Sergei Rjabkov, linnapea Ain Kiviorg ja kohalikud ettevõtjad. Lisa: diagrammid linna eelarve ja ettevõtluse kasvu kohta
Luuk, Erkki, 1971-
2004-01-01
Heliplaatidest: Current 909 "The price for existence is eternal warfare", Aapo Ilves "Pilpaküla kontsert", Yello "The Eye", Maian Kärmas, Ain Agan, Riho Sibul, Arvo Haasma "Tuigutuled", Manatark "Chaos Engine"
Üliohtliku laadungiga rongid plaanitakse Tallinnast välja saata / Signe Kalberg
Kalberg, Signe, 1959-
2006-01-01
Valitsusele esitatakse kolm Tallinna raudteeümbersõidu varianti, analüüsi koostamisse kaasati AS Deloitte&Touche Eesti. Kaart: Tallinna raudteeümbersõit. Kommenteerivad: Raivo Uukkivi, Ain Kaljurand, Toomas Vitsut
Лившиц, Лев, 1924-2013
2006-01-01
Ain Järvega Kadrioru pargist. Kadrioru Lastepargi tekkimise ajaloost ja uue Lastepargi rajamisest. Ehitatakse uus Lastemuuseumi hoone kuhu kolib Kotzebue tänavalt Tallinna Nukumuuseum. Nukumuuseumist ja muuseumidest Kadriorus, ka KUMU hoonest
Toodangu maht sõltub impordist / Ain Alvela
Alvela, Ain, 1967-
2002-01-01
Saematerjali tootjate TOP 30. Käibe TOP 10. Käibe kasvu TOP 10. Kasumi TOP 10. Kasumi kasvu TOP 10. Rentaabluse TOP 10. Varade tootlikkuse TOP 10. Kahjumi TOP 5. Saematerjali tootjate finantsnäitajad. Saematerjali tootjate üldandmed. Tabelid
Terve mõistusega ahnuse vastu / Ain Aaviksoo
Aaviksoo, Ain, 1974-
2005-01-01
Dokumentaalfilm "Ülisuur mina" ("Super Size Me") : režissöör Morgan Spurlock : Ameerika Ühendriigid 2004. Turumajandusest, dieedist ja toitumisest, filmi hoiatavast osast eelkõige teistmelistele ja nende kasvatajatele
Rumsfeldi ei ole kunagi unustatud / Ain Lember
Lember, Ain
2004-01-01
Väljaandes Teheran Times ilmunud Kian Mokhtari artiklist, milles käsitletakse USA kaitseministri Donald Rumsfeldi poliitikukarjääri, tema süüdistamist Iraagile massihävitusrelvade ja nendega seotud tehnoloogia müümise soodustamises 1980-ndatel aastatel, Iraagi-poolset keemiarelva kasutamist Iraani vastu
Puti povõshenija effektivnosti proizvodstva / Ain Alvela
Alvela, Ain, 1967-
2008-01-01
Kulude kokkuhoid aitab saavutada kõrgemat tootlikkust. Vt. samas: Indeks rosta proizvoditelnosti za period 2000-2007gg., %. Kommenteerivad: Aleksandr Miina, Ants Pak, Kaul Aulasmägi, Veljo Haube ja Kuido Kuntro
Norma Maja astub kindlalt tulevikku / Ain Alvela
Alvela, Ain, 1967-
2000-01-01
AS Norma Maja saavutas kõrged kasumi ja kasumi kasvu näitajad töötajate koondamisega. Tabel: Norma Maja valdused, AS Norma Maja areng, AS ETK Majad areng. Arvamused: Ero Toom, Ivar Lahi ja Rein Loo
Extensive Degradation and Low Bioavailability of Orally Consumed Corn miRNAs in Mice
Directory of Open Access Journals (Sweden)
Haiqiu Huang
2018-02-01
Full Text Available The current study seeks to resolve the discrepancy in the literature regarding the cross-kingdom transfer of plant microRNAs (miRNAs into mammals using an improved miRNA processing and detection method. Two studies utilizing C57BL/6 mice were performed. In the first study, mice were fed an AIN-93M diet and gavaged with water, random deoxynucleotide triphosphates (dNTP or isolated corn miRNAs for two weeks (n = 10 per group. In the second study, mice were fed an AIN-93M diet, or the diet supplemented with 3% fresh or autoclaved corn powder for two weeks (n = 10 per group. Corn miRNA levels were analyzed in blood and tissue samples by real-time PCR (RT-PCR following periodate oxidation and β elimination treatments to eliminate artifacts. After removing false positive detections, there were no differences in corn miRNA levels between control and treated groups in cecal, fecal, liver and blood samples. Using an in vitro digestion system, corn miRNAs in AIN-93M diet or in the extracts were found to be extensively degraded. Less than 1% was recovered in the gastrointestinal tract after oral and gastric phases. In conclusion, no evidence of increased levels of corn miRNAs in whole blood or tissues after supplementation of corn miRNAs in the diet was observed in a mouse model.
Interpersonal violence in the United Arab Emirates.
Osman, Ossama T; Abbas, Alaa K; Eid, Hani O; Salem, Mohamed O; Abu-Zidan, Fikri M
2014-01-01
We aimed to study the anatomical distribution, severity and outcome of hospitalised interpersonal violence-related injured patients in Al-Ain, United Arab Emirates so as to give recommendations regarding the magnitude of this problem, its causes and priorities of prevention. Data were retrieved from Al-Ain Hospital Trauma Registry, which was prospectively collected over three years. There were 75 patients (males = 85.3%) having a mean age of 30 years. Eighty-one percent had blunt trauma. The estimated annual injury hospitalisation of interpersonal violence in Al-Ain city was 6.7 per 100,000 population. Females were significantly more injured by a family member (p = 0.02), at home (p = 0.005), and had more severe injuries (p = 0.003). There was a trend for children less than 18 years old to have more penetrating trauma (p = 0.06) and to be injured by a family member (p = 0.09). There was only one case of woman sexual assault and two cases of child abuse. The mean (SD) hospital stay was 7.87 (14.1) days. Less than 3% (n = 2) were admitted to the intensive care unit with no deaths. In conclusion, the majority of patients in our study had minor injuries. Nevertheless, the psychological impact may be major. This highlights the need to develop suitable mental health services in support of victims of interpersonal violence.
Structural and frequency dependencies of a.c. and dielectric ...
Indian Academy of Sciences (India)
6Thin Film Laboratory, Department of Physics, Faculty of Education, Ain Shams ... conductivity and its frequency exponents were interpreted in terms of correlated barrier hopping ... cations in high-electron-mobility and heterostructure bipolar.
African Journals Online (AJOL)
EL-HAKIM
Immunology Unit, Department of Pediatrics, Ain Shams University, Cairo ... the case with food allergies).7,8 The parentral route ..... molecular-weight agents. ... and lack positive controls. ..... Immunology; Joint Council of Allergy, Asthma and.
Ainevaldkond "Kehakultuur" / Leila Oja
Oja, Leila, 1966-
2006-01-01
Ainevaldkonnast "Kehakultuur" Tartu Ülikooli õppekava arenduskeskuses väljatöötatud põhikooli ja gümnaasiumi riiklikus õppekavas - ainevaldkonna kirjeldus, läbivad teemad, aineõpetuse struktuur ning vajalikud ressursid
R102G polymorphism of the complement component 3 gene in ...
African Journals Online (AJOL)
Nur Afiqah Mohamad
a Malaysian Research Institute on Ageing, Universiti Putra Malaysia, Serdang 43400, Selangor ... Peer review under responsibility of Ain Shams University. ..... b Student t-test, P < 0.01. ... The International ARM Epidemiological Study Group.
Analytical solutions for one-dimensional advection– dispersion ...
Indian Academy of Sciences (India)
Department of Mathematics, AinShams University, Cairo 0020, Egypt. ∗. Corresponding author. .... Applying Laplace transformation to equations (1 and 2) gives: D d2. ∼ ...... Land, Water & Environmental Management: Integrated. Systems for ...
ETV uus seriaal "Vistrik" kavatseb nime muuta / Anne Vetik
Vetik, Anne
2006-01-01
Toimuvad ETV uue krimisarja "Vistrik" võtted, stsenarist Mihkel Ulman, režissöör Ain Prosa, produtsent Raivo Suviste, kesksetes rollides Marko Matvere, Jaan Rekkor, Elisabet Tamm, tootjaks OÜ Balti Video
[Kirjandusetendusest "Meri kümnele häälele"] / Kätlin Kaldmaa ; küsinud D. K. [Doris Kareva
Kaldmaa, Kätlin, 1970-
2011-01-01
Luulelavastus sisaldab Álvaro de Campose (Fernando Pessoa) "Mereoodi" ning Ain Kaalepi, Kalju Kruusa, fs-i jt. eesti luuletajate tekste. Lavastaja Anne Türnpu, etendused toimuvad kinos Sõprus. Vt. ka kuulutust lk. 30
Ohtlikud lennud / Simo Meinert
Meinert, Simo
2006-01-01
ETV uus algupärane krimisari "Ohtlik lend" : stsenarist Mihkel Ulman : lavastaja Ain Prosa : produtsent Raivo Suviste : peaosades Elisabet Tamm, Marko Matvere : Balti Video. Sama ka : Teleleht nr. 38, lk. 6-7 : ill
Directory of Open Access Journals (Sweden)
Gandra S
2015-01-01
Full Text Available Sumanth Gandra, Aline Azar, Mireya WessolosskyDivision of Infectious Disease and Immunology, University of Massachusetts Medical School, Worcester, MA, USABackground: Although anal high-risk human papillomavirus (HR-HPV infection and anal cytological abnormalities are highly prevalent among human immunodeficiency virus (HIV-infected men who have sex with men (MSM, there are insufficient data on these abnormalities among HIV-infected heterosexual men (HSM and women. In this study, we evaluated the prevalence of anal HR-HPV, cytological abnormalities, and performance of these screening tests in detecting high-grade anal intraepithelial neoplasia (AIN2+ among our cohort of HIV-infected MSM and non-MSM (HSM and women.Methods: A single-center, retrospective cohort study was conducted with HIV-infected individuals who underwent anal cancer screening with anal cytology and HR-HPV testing from January 2011 to January 31, 2013.Results: Screening of 221 HIV-infected individuals for both HR-HPV and anal cytology showed the presence of HR-HPV in 54% (abnormal anal cytology 48% of MSM, 28% (abnormal anal cytology 28% of HSM, and 27% (abnormal anal cytology 34% of women. Among 117 (53% individuals with abnormal results (HR-HPV-positive and/or cytology was atypical squamous cells of undetermined significance or above, 67 underwent high resolution anoscopy. Of these 67 individuals, 22 individuals had AIN2+ (17 MSM, four women, and one HSM. HR-HPV correlated better with AIN2+ than with anal cytology on biopsy in both MSM (r=0.29 versus r=0.10; P=0.05 versus P=0.49 and non-MSM (r=0.36 versus r=-0.34; P=0.08 versus P=0.09.Conclusion: Given the presence of AIN2+ in screened HIV-infected HSM and women, routine anal cancer screening in all HIV-infected individuals should be considered. HR-HPV merits further evaluation for anal cancer screening among non-MSM.Keywords: human immunodeficiency virus, anal human papillomavirus, heterosexual men, women, anal cancer
Evaluación in vitro de tabletas orales de complejos de cobre con antiinflamatorios no esteroideos
Directory of Open Access Journals (Sweden)
Julie Fernanda Benavides Arévalo
Full Text Available Introducción: los antiinflamatorios no esteroideos (AINES, son un grupo diverso y químicamente heterogéneo de fármacos analgésicos, antipiréticos y antiinflamatorios; sin embargo, su funcionamiento se ve afectado por su baja solubilidad acuosa y por la incidencia de efectos secundarios gastrointestinales. Como una alternativa a este problema, la formulación de tabletas orales con complejos de cobre con AINES muestra un adecuado comportamiento in vitro y podría tener efectos secundarios reducidos comparados con el fármaco antiinflamatorio no complejado. Objetivo: evaluar los procesos de desintegración y de disolución de tabletas orales de complejos de cobre con AINES. Métodos: luego de la síntesis y la caracterización instrumental de los complejos, se evaluó por microscopia óptica el efecto de la morfología, el tamaño de partícula y las características superficiales en el proceso de disolución; estos resultados fueron considerados para la formulación de los complejos y permitieron junto con la adecuada elección de un desintegrarte, un modificador de flujo, un lubricante y un aglutinante, la obtención de tabletas por compresión directa. Finalmente, en los comprimidos se evaluaron propiedades fisicomecánicas y los procesos de desintegración y disolución. Resultados: las tabletas de los complejos mostraron tiempos de desintegración entre 5 y 15 min y una liberación in vitro del 75 al 93 %. Conclusiones: la disolución de los AINES se vio favorecida por la formación de complejos, el menor tamaño de partícula, la presencia de poros y grietas en la superficie de las partículas y la inclusión de excipientes para la formulación de tabletas orales.
Jänes, Liina, 1977-
2000-01-01
Eesti kolhoosikeskuste arhitektuurist. Vaadeldakse aastail 1957-1990 ehitatud 24 keskusehoonet. Arhitektid Nikolai Kusmin, Harri Kingo, Toomas Rein, Vilen Künnapu, Ain Padrik, Maara Metsal, Meeli Truu jt. 17 välisvaadet, 3 joon., kaart
Mis saab maaärist? / Ester Šank
Šank, Ester, 1956-
2000-01-01
Maaostu piirava seaduseelnõu Riigikogu menetlusest välja arvamist kommenteerib Vootele Hansen. Lisatud ka eelnõu autorite Jaanus Marrandi, Harri Õunapuu ja töörühma liikme Ain Kendra seisukohad
Intel Corporation osaleb Eesti koolitusprogrammis / Raivo Juurak
Juurak, Raivo, 1949-
2001-01-01
Haridusministeeriumis tutvustati infotehnoloogiaalast koolitusprogrammi, milles osaleb maailma suuremaid arvutifirmasid Intel Corporation. Koolituskursuse käigus õpetatakse aineõpetajaid oma ainetundides interneti võimalusi kasutama. 50-tunnised kursused viiakse läbi kõigis maakondades
2008-01-01
Laseringi kauplustes müügilolevatest heliplaatidest: Compromise Blue "Loomad on lahti", Mari Boine "Remixed vol. 2 - It Ain't Necessarily Evil", Me, Myself and I "Aastaajad", Whitesnake "Good To Be Bad", Estelle "Shine"
African Journals Online (AJOL)
Pediatrics Department, Faculty of Medicine, Ain Shams University corresponding author: ..... imaging studies: The diagnosis of CMV pneumonia can be suggested by chest radiograph find- ... dictive value and can aid in identifying children who ...
Lugedes Pilve ja Pazi / Mathura
Mathura, pseud., 1973-
2007-01-01
Võrdlevalt Aare Pilve luulekogust "Näoline" (kirj. Tuum, 2007) ja Octavio Pazi luulekogust "Alati on olevik" (hispaania k. tlk. Ain Kaalep, Jaan Kaplinski, Asta Põldmäe ja Jüri Talvet, kirj. Perioodika, 1984)
The effects of composition and firing cycle on sintering of aluminium nitride
International Nuclear Information System (INIS)
Hewett, C.; Trigg, M.B.
1992-01-01
A central composite design was used to evaluate the relative effects of temperature, time and Y 2 O 3 content on the densification behaviour of a commercial aluminium nitride (AIN). Over the range of the independent variables studied, temperature was found to exert the dominate influence. Low levels of Y 2 O 3 were found to be effective for the densification of AIN. After firing, cubic 3Y 2 O 3.5 Al 2O3 (YAG) was detected for the lower levels of Y 2 O 3 addition. At the higher levels both YAG and 2Y 2 O 3 .Al 2 O 3 were detected. For a dense sample the values obtained for hardness and fracture toughness were comparable to those reported in the literature. 11 refs., 1 tab
Directory of Open Access Journals (Sweden)
A. Moreno
2003-02-01
Full Text Available Antecedentes: Los antiinflamatorios no esteroideos (AINE, utilizados en el tratamiento de la artrosis, pueden producir reacciones adversas gastrointestinales (GI graves. Celecoxib, un inhibidor específico de la ciclooxigenasa 2 (COX-2, ha demostrado una eficacia equivalente a los AINE convencionales con un mejor perfil de tolerabilidad y seguridad. Objetivo: La finalidad de este estudio ha sido realizar un análisis coste-efectividad sobre el uso de celecoxib frente a los AINE clásicos en el tratamiento de la artrosis. Material y métodos: El análisis coste-efectividad se ha diseñado mediante un modelo farmacoeconómico, definiéndose como unidad de efectividad a cada año de vida ganado tras la toma de celecoxib o AINE. La probabilidad de que aparezcan los diferentes resultados clínicos se ha obtenido de artículos publicados y de asunciones incorporadas. Sólo se han valorado los costes directos médicos (medicación, hospitalización, pruebas complementarias, analíticas, visitas extras, etc., sin haberse incluido otros costes. La perspectiva del estudio ha sido la del Sistema Nacional de Salud y el horizonte temporal elegido ha sido de 6 meses. Resultados: El coste adicional por cada año de vida ganado secundario al uso de celecoxib frente a los AINE clásicos asciende a 8.017 € (1.333.834 ptas.. El análisis de sensibilidad muestra cómo estos valores son sensibles a la modificación del coste de AINE y gastroprotector, así como a la inclusión de grupos poblacionales con edades más bajas. Conclusiones: Celecoxib puede ser considerado como una opción coste-efectiva en el tratamiento de la artrosis, ya que va a evitar muertes y a ganar años de vida para los pacientes con un coste adicional razonable y moderado, cuando se compara con los AINE. Su eficiencia aumenta a medida que se utiliza en poblaciones con menor edad media y, probablemente, en aquellas con mayor riesgo de desarrollar complicaciones GI.Background: Non
Energy Technology Data Exchange (ETDEWEB)
Jiang, Hongxing
2008-10-31
Investigations have been conducted focused on the fundamental material properties of AIN and high AI-content AIGaN alloys and further developed MOCVD growth technologies for obtaining these materials with improved crystalline quality and conductivities.
Sekulariseeruv sakraalarhitektuur / Piret Lindpere
Lindpere, Piret, 1963-
2002-01-01
Moodsatest kirikutest, sajandilõpu eesti sakraalarhitektuurist. Pikemalt Tallinna metodisti kirikust (Vilen Künnapu, Ain Padrik), Püha Brigitta keskusest (projekteerimist juhtis Ra Luhse) ja ehitama hakatavast Viimsi Püha Jaakobi kirikust (Erkki Ristoja, Martin Aunin)
Valme, Valner, 1970-
2006-01-01
Uutest heliplaatidest Graham Coxon "Love Travels At Illegal Speeds", Gabriel Rios "Ghostboy", "Sounds Of India", John Hughes "Wild Ocean", Ain Agan & Tallinn Chamber Orchestra/Toomas Vavilov, Ashanti "Collectables By Ashanti", Liv Kristine "Enter My Religion"
Itaalia seadustab ainuõige pitsa / Kaivo Kopli
Kopli, Kaivo
2004-01-01
Pizza Napolitana ained, valmistusviis ja tulemus peavad vastama nõuetele. Itaalia põllumajandusministeeriumis välja töötatud pitsareeglid on osa Itaalia pingutustest kaitsta oma kuulsat kööki. Lisaks: Pitsavalmistamise reeglid
Rector's office as of 31 December 2005
2006-01-01
TÜ rektoraadi koosseis: rektor prof. Jaak Aaviksoo, teadusprorektor prof. Ain Heinaru, õppeprorektor prof. Tõnu Lehtsaar, prorektor prof. Jaak Kangilaski; administratsioonidirektor Mihkel Pärnoja, finantsdirektor Taimo Saan, haldusdirektor Riho Illak, akadeemiline sekretär Ivar-Igor Saarniit
Sumerki klassitsizma / Iosef Kats
Kats, Iosef
2004-01-01
Tallinna Viru Keskuse juurde püstitatud Mare Mikofi kavandatud hiigelskulptuurist. Kuju on Mikofi versioon Weizenbergi "Hämarikust". Viru Keskuse arhitektide Vilen Künnapu ja Ain Padriku arvates peaks naiseskulptuur mahendama kaubakeskuse kubistlikku ja maskuliinset arhitektuuri
Vahemets, Aivo
2005-01-01
Uutest heliplaatidest The All-American Rejects "Move Along", Devendra Banhart "Criple Crow", Rod Stewart "Thank For The Memory", Him "Dark Light", Status Quo "the Party Ain't Over Yet", Ricky Martin "Life", Barbara Streisand "Guilty Pleasures"
Emajõe äärde kerkib Tartu tulevane sümbol : Kroodo-Tower / Nils Niitra
Niitra, Nils, 1975-
2005-01-01
ASi Linnaehitus nõukogu liige Alar Kroodo plaanib Emajõe äärde 23-korruselise kõrghoone ehitamist, mille ehitusmaksumuseks kujuneb 100 kuni 200 miljonit krooni. Kõrghoone on projekteerinud arhitektid Ain Padrik ja Vilen Künnapu
"Arvuti koolis" ja arvutiõpetus õppekavas / Helen Vanganen, Jevgeni Košelev
Vanganen, Helen
2002-01-01
Ligi 1500 aineõpetajat osales 2001/2002 õppeaastal kursusel "Arvuti koolis". Õpetajad tutvusid Oxfordi Ülikooli jätkukursusega - originaalprogramm kannab nime "Intelʼ Teach to the Future", mis on otseselt seotud infotehnoloogia rakendamisega õppekavas
Kes kaitseks Eesti ohvitsere NKVD-KGB laimu eest? / Peep Varju
Varju, Peep
2008-01-01
Autor polemiseerib Eesti Ekspressis ilmunud artiklitega Eesti endiste ohvitseride kohta, kus käsitletakse nende väidetavat koostööd KGBga. Vaatluse all on ohvitserid Ain Mere, Harald Nugiseks, Alfons Rebane ja Harald Riipalu
Nigel saak ähvardab kalureid pankrotiga / Jüri E Kukk
Kukk, Jüri E., 1961-
2004-01-01
Tänavune kalasaak Võrtsjärvest on jäänud väga kesiseks. Võrtsjärve Limnologiajaama juhataja Ain Järvalt peab kalade vähesuse põhjuseks heitlikke ilmastikuolusid. Lisa: Kalasaagid [1999-2003
2006-01-01
TÜ rektoraadi koosseis: rektor prof. Jaak Aaviksoo, teadusprorektor prof. Ain Heinaru, õppeprorektor prof. Tõnu Lehtsaar, prorektor prof. Jaak Kangilaski; administratsioonidirektor Mihkel Pärnoja, finantsdirektor Taimo Saan, haldusdirektor Riho Illak, akadeemiline sekretär Ivar-Igor Saarniit
Spordipreemiad leidsid omaniku / Anne Põder
Põder, Anne, 1973-
2007-01-01
Järvamaa omavalitsuste liit ja spordiliit tunnustasid maakonna parimaid sportlasi, kelleks osutusid Ain-Alar Juhanson, Mikko Vanaisak, Viktoria Leks ja Grit Shadeiko. Spordiedendaja preemia sai Tiit Kavak, spordi elutöö preemia pälvis Enn Sõmeri
Teatrid murravad päid ja piike / Dea Martinjonis
Martinjonis, Dea
2000-01-01
Eesti Televisiooni ekraanile jõuab teatriteemaline teleturniir "Bläkkpoks" : stsenarist Villu Kangur : režissöör Ain Prosa : saatejuht Sepo Seeman : toimetaja Anne Tuuling : produtsent Priit Vaher. Ka : Teleleht nr. 50, lk. 36-37
African Journals Online (AJOL)
rme
1Medical Genetic Center, Faculty of Medicine, Ain Shams University,. 2Community ... indications for amniocentesis in 60.8% were history of having previous child .... best location for placing the needle ..... leukemia, 8.5% for neural tube defects.
Geochemistry of dark coastal heavy-mineral beaches sand (Annaba ...
African Journals Online (AJOL)
Acer
3 Institute of Earth and Environmental Science, University of Potsdam, ... Some beaches are characterized by a red-brownish sand colour, the Ain Achir and the ... The occurrence of clays has been determined using the methyl-blue method.
9. II avati taas von Krahli Akna galerii
2004-01-01
Näitusel "Mute - a Register of Dreams" on vaadata Aine Phillipsi (Iirimaa), Avangardi, Diane Dwyer & Tillamook Cheddari (USA), Evelin Urmi, Kiwa, Lee Adamsi (Inglismaa), Marcello Mercado (Saksamaa), Miguel Rodriguez Sepulveda (Mehhiko) ja Renato Meneghetti (Itaalia) töid
2008-01-01
Aleksius II meenutavad: Kornelius, Tallinna ja kogu Eesti metropoliit ; Karin Jaani ; Marina Kaljurand ; Dmitri Medvedev, Venemaa president ; Helene Kamzol, Aleksius II sugulane ; Ain Seppik ; Vladimir Illjashevitsh ; Edgar Savisaar ; Jevgeni Tomberg ; Ene Ergma ; Toomas Hendrik Ilves, Eesti Vabariigi president
Lifescience Database Archive (English)
Full Text Available aine hydrochloride Neuropsychiatric agent ... DG02030 ... Anesthetics ... DG01675 ... Local anesthetic ... DG01673 ... Amide type local anesthetic... ... DG01675 ... Local anesthetic ... DG01673 ... Amide type local anesthetic ATC code: N01BB07 Local anesthetic
deletion polymorphism of ACE gene and Alzheimerв€™s disease
African Journals Online (AJOL)
Omayma M. Hassanin
2014-06-27
Jun 27, 2014 ... ease, 45 males and 39 females aged 65 ± 7 years from the Geriatric Department at Ain-Shams Uni- ..... alternative therapy provided by the ACE protein. .... enzyme (ACE) gene polymorphism in relation to physical perfor-.
Egyptian Journal of Pediatric Allergy and Immunology (The): Journal ...
African Journals Online (AJOL)
Publisher. Contact: Professor Ihab Z. El-Hakim. Email ihab.elhakim@gmail.com. Phone +201111224974. Fax … +202 33045060. Children's Hospital, Ain Shams University, Ramses Street, Abbassiya, Cairo 11566, Egypt. The Egyptian Society of Pediatric Allergy and Immunology ...
Ahhaa teaduskeskus Tartus = The Ahhaa Science Centre in Tartu
2012-01-01
Arhitektide Ain Padriku ja Vilen Künnaou projekteeritud Ahhaa teaduskeskuse (Sadama 1) ekspositsiooni ja sisekujundusest. Sisearhitektid Tea Tammelaan, Krista Lepland ja Malle Jürgenson (Laika, Belka & Strelka), loetletud nende ühiselt tehtud töid. Infograafika: Alar Pikkorainen
Keskerakonna nõrk PR-käik / Aivar Hundimägi
Hundimägi, Aivar, 1975-
2008-01-01
Seoses keskerakondlastest ettevõtjate Richard Siku ja Heldur Undi sattumisega bordelliskandaali on Keskerakonna aukohtu esimees Ain Seppik pöördunud järelpärimisega politseiameti peadirektori Raivo Aegi ja riigi peaprokuröri Norman Aasa poole
Data of evolutionary structure change: 1WPWB-1XAAA [Confc[Archive
Lifescience Database Archive (English)
Full Text Available 1WPWB-1XAAA 1WPW 1XAA B A GFTVALIQGDGIGPEIVSKSKRILAKINELYSLPIEYIE...SDGVAVGMKIITRFASERIAKVGLNFALRRRKKVTCVHKANVMRITDGLFAEACRSVLKG--KVEYSEMYVDAAAANLVRNPQMFDVIVTENVYGDILSDEASQIAGS...LEU CA 502 1XAA A 1XAAA...R CA 306 1XAA A 1XAAA...ain>A 1XAAA KANVL-EVGEF -
Tornkorteritega maja otse tulevikust / Ave Randviir
Randviir, Ave, 1981-
2006-01-01
Vilen Künnapu, Ain Padriku ja Kristi Alamaa ümberehitusprojekti järgi valminud modernsest kolme torniga elumajast Triumph Plaza Tallinnas Narva mnt. 7. Rekonstrueeriti Olga Brunsi ja Mart Kallingu 1981. a. valminud konterihoone. Kommenteerib Vilen Künnapu
Uus eksamikord tõi 13 tudengi eksmati / Inga Uusmaa
Uusmaa, Inga
2001-01-01
Eesti Sisekaitseakadeemias kehtestatud vaheeksami süsteemist, mille järgi tuleb igas aines sooritada kaks eksamit, teine eksam ei anna küll ainepunkte, kuid selles läbikukkumine tähendab seniste ainetulemuste tühistamist
African Journals Online (AJOL)
Items 51 - 100 of 149 ... ... of Pediatric Asthma Review of Ain Shams Pediatric Hospital Chest Clinic ... Vol 15, No 1 (2017), Gastrointestinal manifestations in children ... Vol 6, No 1 (2008), Immunogenetics of type 1 diabetes mellitus, Abstract PDF.
Sillar, Rein
2001-01-01
Eesti NSV KGB viimane esimees ei usu, et eestlased sooviksid minevikuhaavu lahti rebida. Vare-Shironini kokkuleppest KGB tegevuse lõpemisest Eestis, süümevandest, ENSV Riiklikust Julgeolekukomiteest. Kommenteerivad: Ain Kaalep, Peeter Olesk, Heinz Valk. Parlamendisaadik (P. Olesk)
90-aastane Tallinna Polütehnikum - ainus omataoline / Sirje Tohver
Tohver, Sirje
2005-01-01
Polütehnikumi vilistlastest õpetajate (Heiki Tähis, Andres Ojalill, Jüri Jakubovitš, Hugo Tartlan, Hergi Kruusimaa, Tiina Karja, Priit Kalman, Ardi Priks, Jaan Kuus, Jüri Puhang, Vello Vanem, Rein Kask, Kalle Sammal, Ain Saaret) meenutusi
Obtention of differential sections in nuclear reactions using a thick target
International Nuclear Information System (INIS)
Chavez R, R.
2000-01-01
The nuclear reaction analysis (NRA) technique is used mainly for detecting the presence and concentration of light elements of great importance such as: carbon, nitrogen and oxygen. This work has the objective to obtain the differential sections of 16 O and 14 N starting from the irradiation with deuterons of TiSrO 3 samples, of AIN and AIN 2 at energies of 2000 KeV and 1800 KeV respectively. The present work have four chapters; chapter 1 is focused to the physical aspects which takes part in the NRA technique. The technical requirements as well as the necessary equipment for developing the techniques are described in the chapter 2. In chapter 3 it is described the algorithm developed for to obtain the differential sections starting from experimental data, and finally, in chapter 4 are given the results and conclusions. (Author)
Fibre optique à la maison en Pays de Gex et de Bellegarde
CERN. Geneva; Goy, Jean Paul
2010-01-01
Le Syndicat Intercommunal d’Electricité de l’Ain(SIEA) déploie un réseau FTTH (Fiber To The Home) de fibres optiques dans le département de l’Ain vers l’ensemble des habitations. Le déploiement sur la zone pilote du Pays de Gex et du Bassin Bellegardien arrive dans la phase terminale vers les habitations. Le SIEA présentera ses activités, l’état du développement du réseau, les implications d’une connexion fibre optique et les procédures d’abonnement. La présentation sera donnée en Français. -------------------------------------------------------------------------------------------------------------------------------Public conference "Optical fiber To The Home in Pays de Gex et de Bellegarde" Michel Chanel et Jean Paul Goy (SIEA) Wednesday, 19th May at 11.30 hrs., Counc...
Portugalikeelse kirjanduse retseptsioon Eestis / Mele Pesti
Pesti, Mele, 1979-
2011-01-01
Portugalikeelse kirjanduse tõlgetest ja nende vastuvõtust alates esimese tõlke ilmumisest 1890. aastal kuni 2005. aastani ning retseptsiooni pärssinud teguritest. Ülevaade kahe olulisema tõlkija Aita Kurfeldti ja Ain Kaalepi tööst
Neurofibromatosis type 1 and multiple sclerosis: Genetically related ...
African Journals Online (AJOL)
Solaf M. Elsayed
2016-10-25
Oct 25, 2016 ... a Genetics Unit, Children's Hospital, Ain Shams University, Egypt b Neurology Department ... Through the past 6 months, she started to develop short term memory loss with intact long term memory. There was no other motor ...
Veel vene koolist ja krokodillipisaratest / Yana Toom
Toom, Yana, 1966-
2011-01-01
Artikli autori arvates ei ole eesti keele õpetamise kvaliteet piisav, et seada eesmärgiks eestikeelne aineõpe vene koolide gümnaasiumiastmes. Vastukaja artiklile: Priit Simson. Venekeelne kool ja krokodillipisarad. Eesti Päevaleht (2011) 9. sept., lk. 2
Uurija Rita ja näitleja Elisabet / Jüri Laulik
Laulik, Jüri, 1959-
2006-01-01
ETV uues algupärases krimisarjas "Ohtlik lend" teeb kaasa ka Tallinna Linnateatri näitlejanna Elisabet Tamm. Sarja stsenarist on Mihkel Ulman, lavastaja Ain Prosa. Näitlejannast lähemalt. Sama : Teleleht, nr. 41, lk. 6-7 : ill
2007-01-01
Laulja Annely Peebo ooperis "Jenufa" 2., 4., 6., 9., 11., 13. ja 15. mail Mailandis. Eesti Filharmoonia Kammerkoor esinemas 27. ja 28. mail Bergenis. Laulja Ain Anger 19. mail Placido-Domingo Galal ja 31. mail ooperis "Othello" Viini Riigiooperis
Parts : ministrite minevik olgu avalik / Juhan Parts ; interv. Toomas Sildam
Parts, Juhan, 1966-
2003-01-01
Peaminister Juhan Parts vastab küsimustele, mis on seotud politseinike altkäemaksu andmise avalikuks tulekuga, komissar Indrek Sirgi ametist lahkumisega ja ministrite seadusrikkumiste avalikustamisega. Kommenteerivad: Margus Leivo, Tarmo Loodus, Ain Seppik. Vt. samas: Valik saladuses peetavast teabest
City Plaza büroohoone edu üllatas asjatundjaid / Aivo Vahemets
Vahemets, Aivo
2004-01-01
Kuigi kinnisvaraspetsialistid olid City Plaza büroohoonesse äripindade rentnike leidmise suhtes skeptilised, on Tallinnas asuvas City Plaza kõrghoones 31 äripinnast rentimata veel vaid kaks. Vt. samas intervjuud Ain Kivisaarega. Lisa: City Plaza büroohoone
2006-01-01
TÜ teadustöötajaist ja õppejõududest on 2/3 doktorikraadiga. TÜ rektor Jaak Aaviksoo ja teadusprprektor Ain Heinaru valiti Euroopa kõrghariduspoliitika juhtorganitesse. Sotsiaalteaduskonna prof. Wolfgang Drechsler sai Saksa-Eesti akadeemiliste suhete arendamise eest Saksamaa Liitvabariigi Teeneteristi
Challenges in diagnosis and counseling of a family with two ...
African Journals Online (AJOL)
Heba S. Abd-Elkhalek
2015-12-29
Dec 29, 2015 ... Genetics Unit, Childrens' Hospital, Ain Shams University, Cairo, Egypt. Available online 29 ... normal milestones of development in the first 6 months of life .... most important clue in family history that indicated the pres- ence of ...
Hepatoadrenal syndrome in Egyptian children with liver cirrhosis ...
African Journals Online (AJOL)
Amel A.M. Elfaramawy
2012-08-03
Aug 3, 2012 ... E-mail address: amelhome4@gmail.com. Peer review under responsibility of Ain Shams University. Production and hosting by ..... [23] Ho JT, Al-Musalhi H, Chapman MJ, Quach T, Thomas PD, Bagley. CJ, et al. Septic shock ...
Risk factors for autism: An Egyptian study
African Journals Online (AJOL)
Farida El-Baz
IQ assessment using Stanford–Binrent intelligence scale, and assessment of severity ... All studied developmental milestones were delayed among autistic children than ... Peer review under responsibility of Ain Shams University. ..... Treatment and educa- ..... communication in people with autism and intellectual disability. J.
Determination of thorium and uranium contents in soil samples ...
Indian Academy of Sciences (India)
Experimental Nuclear Physics Department, Atomic Energy Authority, Nuclear Research Center, Abu Zabaal, 13759 Cairo, Egyp; Experimental Nuclear Physics Department, Atomic Energy Authority, Nuclear Research Center, Abu Zabaal, 13759 Cairo, Egypt; Faculty of Girls for Art, Science and Education, Ain-Shams ...
Naised Ilvesenahkades / Agnes Nõu
Nõu, Agnes
2006-01-01
Jahtlaeva Santa Maria kapteni Ain Roosma soovist kogu jahtlaeva naiskond ühtsesse vormi riietada sündis tuntud Eesti spordiriiete tootjal AS-il Ilves-Extra uus tootegrupp - purjetamisrõivad. Vt. samas: Ilves-Extra valmistab nüüd purjetamisrõivaid
3 + 2 = 450 : 3+2 õppesüsteem tõi kaasa kuni 450 tudengiga hiigelloengud / Anu Mõistlik, Jüri Saar
Mõistlik, Anu, 1980-
2002-01-01
Vastne õppekord pakib loengusaali sadu noori. 3+2 tuleku otsustas kuue inimese hääletus. Vanade õppekavade ained kaovad järjestikku tunniplaanidest. Teadusmagistreid enam ei tule. Ainepunktide ülekandmiseks peab üliõpilane ise vaeva nägema
Musta pesu pesemine / Ivar Tallo
Tallo, Ivar, 1964-
2005-01-01
Valitsuse korruptsioonivastase asjatundjate komisjoni juht aastatel 2002-2003 on seisukohal, et ajakirjandus on ainult üks võimalikest vahenditest tõe tuvastamisel ning lõpliku tõe Edgar Savisaare ja Ain Hanschmidti jt seotud skandaalide kohta peavad selgitama võimuinstitutsioonid
Antibacterial, antioxidant and cytotoxic activities of extracts from the ...
African Journals Online (AJOL)
Unicellular green algal strains, identified as Cosmarium (Chlorophyta), were isolated from Ain-Echeffa hot spring in north Tunisia. Different extracts (methanol, hexane, acetone, acetone: methanol and water) obtained from both biomass and extracellular polysaccharides (EPS) were evaluated for their antibacterial, ...
Väikesed inimesed kodumaises seebivahus / Margot Visnap
Visnap, Margot, 1959-
2000-01-01
Kanal 2 uus teleseriaal "Me saame hakkama" : stsenarist Mihkel Ulman : režissöör Ain Prosa : helilooja Ardo-Ran Varres : mängivad Andrus, Maarika ja Marta Vaarik, Ülle Kaljuste, Maria Avdjushko, Hilja Varem jt. : Wireframe Productions
Nad saidki hakkama / Jüri Laulik
Laulik, Jüri, 1959-
2000-01-01
Kanal 2 uus teleseriaal "Me saame hakkama" : stsenarist Mihkel Ulman : režissöör Ain Prosa : helilooja Ardo-Ran Varres : mängivad Andrus, Maarika ja Marta Vaarik, Ülle Kaljuste, Maria Avdjushko, Hilja Varem jt. : Wireframe Productions
Tallinn hakkab Põhjaväila tarvis maid ostma
2007-01-01
Seoses Russalkast Ahtri tänavani ulatuva tee-ehitusega seisab linnal ees 16 maaküsimuse lahendamine. Probleemidest seoses väila osaliselt merre ehitamisega ja väila lõpuniehitamiseks lammutada tulevad hooned. Kommenteerivad Alo Brandt ja Ain Valdmann
Reiljan, Savisaar show who's in charge / Joel Alas
Alas, Joel
2006-01-01
Eestimaa Rahvaliidu esimees Villu Reiljan ja Eesti Keskerakonna esimees Edgar Savisaar otsustavad uue presidendi üle. Villu Reiljan toetab Arnold Rüütlit. Edgar Savisaare, Ene Ergma, Toomas Hendrik Ilvese ja Riigikogu liikme Ain Seppiku väljaütlemised
Pilistvere rehehoones tapetakse Rasputin / Kaarel Aluoja
Aluoja, Kaarel
2008-01-01
7. aug. Pilistvere vanas rehehoones esietendunud Ain Saviaugu kirjutatud ja lavastatud suvetükist "Rasputin". Suvelavastuse tõi välja Põltsamaa Teater Ellunäod koos professionaalsete näitlejatega. Nimiosas mängib näitlejast riigikogulane Indrek Saar
Rasputin - lugu rahva latvade juurimisest / Kati Murutar
Murutar, Kati, 1967-
2008-01-01
7. aug. Pilistvere vanas rehehoones esietendunud Ain Saviaugu kirjutatud ja lavastatud suvetükist "Rasputin". Suvelavastuse tõi välja Põltsamaa Teater Ellunäod koos professionaalsete näitlejatega. Nimiosas mängib näitlejast riigikogulane Indrek Saar
Pilistvere vana rehe all päästetakse Venemaad / Krista Valdvee
Valdvee, Krista, 1978-
2008-01-01
7. aug. Pilistvere vanas rehehoones esietendunud Ain Saviaugu kirjutatud ja lavastatud suvetükist "Rasputin". Suvelavastuse tõi välja Põltsamaa Teater Ellunäod koos professionaalsete näitlejatega. Nimiosas mängib näitlejast riigikogulane Indrek Saar
Pilistveres saab homme kohtuda Rasputiniga / Ülle Lätte
Lätte, Ülle, 1955-
2008-01-01
7. aug. Pilistvere vanas rehehoones esietenduvast Ain Saviaugu kirjutatud ja lavastatud suvetükist "Rasputin". Suvelavastuse toob välja Põltsamaa Teater Ellunäod koos professionaalsete näitlejatega. Nimiosas mängib näitlejast riigikogulane Indrek Saar
Ellunäod toovad välja "Rasputini" / Riina Mägi
Mägi, Riina, 1957-
2008-01-01
7. aug. Pilistvere vanas rehehoones esietenduvast Ain Saviaugu kirjutatud ja lavastatud suvetükist "Rasputin". Suvelavastuse toob välja Põltsamaa Teater Ellunäod koos professionaalsete näitlejatega. Nimiosas mängib näitlejast riigikogulane Indrek Saar
Pilistveres tegutseb Rasputin / Margus Haav
Haav, Margus, 1969-
2008-01-01
7. aug. Pilistvere vanas rehehoones esietenduvast Ain Saviaugu kirjutatud ja lavastatud suvetükist "Rasputin". Suvelavastuse toob välja Põltsamaa Teater Ellunäod koos professionaalsete näitlejatega. Nimiosas mängib näitlejast riigikogulane Indrek Saar
Rasputin : Rahvakese jaoks on vaja elada / Margus Mikomägi
Mikomägi, Margus, 1956-
2008-01-01
7. aug. Pilistvere vanas rehehoones esietendunud Ain Saviaugu kirjutatud ja lavastatud suvetükist "Rasputin". Suvelavastuse tõi välja Põltsamaa Teater Ellunäod koos professionaalsete näitlejatega. Nimiosas mängib näitlejast riigikogulane Indrek Saar
Naissoo ja Agan - 2 in 1 / Igor Garšnek
Garšnek, Igor, 1958-
2011-01-01
15. mail Tallinnas Mustpeade majas toimunud kontserdist "Naissoo ja Agan 111", kus esinesid Tõnu Naissoo, Ain Agan, Teemu Viinikainen, Raul Sööt, Daniel Aljo, Joel-Rasmus Remmel, Mihkel Mälgand, Toomas Rull ja Tallinna Kammerorkester Jüri-Ruut Kanguri juhatusel
Efficacious Oxime for Organophosphorus Poisoning: A Minireview
African Journals Online (AJOL)
Erah
University, PO Box 17666, AlAin, United Arab Emirate. Abstract ... poisoning is a major health problem all over the world ... contaminated food in a social ceremony in. Magrawa, India [7] .... either gave null effect or possible harm [19]. According ...
Juhász, István; Soukup, Lajos; Szentmiklóssy, Zoltán
2015-01-01
The pinning down number $ {pd}(X)$ of a topological space $X$ is the smallest cardinal $\\kappa$ such that for any neighborhood assignment $U:X\\to \\tau_X$ there is a set $A\\in [X]^\\kappa$ with $A\\cap U(x)\
Sapucaia nuts (Lecythis pisonis) modulate the hepatic inflammatory ...
African Journals Online (AJOL)
Mariella
2016-06-22
Jun 22, 2016 ... antioxidant and anti-inflamatory effects of this nut after its introduction into a control (AIN-93G) or ... fat diets increases the total amount of body lipids, and ..... physical exercise on lipid profile, oxidative stress and antioxidant.
African Journals Online (AJOL)
2017-05-01
May 1, 2017 ... arid climate, it already suffers the problem of flash flooding during the last 100 years .... Location of Ain Sefra watershed in Algeria (ASTER, 30m resolution, Map datum .... Six methods are included fot Routing model (Kinematic ...
Material and Phonon Engineering for Next Generation Acoustic Devices
Kuo, Nai-Kuei
This thesis presents the theoretical and experimental work related to micromachining of low intrinsic loss sapphire and phononic crystals for engineering new classes of electroacoustic devices for frequency control applications. For the first time, a low loss sapphire suspended membrane was fabricated and utilized to form the main body of a piezoelectric lateral overtone bulk acoustic resonator (LOBAR). Since the metalized piezoelectric transducer area in a LOBAR is only a small fraction of the overall resonant cavity (made out of sapphire), high quality factor (Q) overtones are attained. The experiment confirms the low intrinsic mechanical loss of the transferred sapphire thin film, and the resonators exhibit the highest Q of 5,440 at 2.8 GHz ( f·Q of 1.53.1013 Hz). This is also the highest f·Q demonstrated for aluminum-nitride-(AIN)-based Lamb wave devices to date. Beyond demonstrating a low loss device, this experimental work has laid the foundation for the future development of new micromechanical devices based on a high Q, high hardness and chemically resilient material. The search for alternative ways to more efficiently perform frequency control functionalities lead to the exploration of Phononic Crystal (PnC) structures in AIN thin films. Four unit cell designs were theoretically and experimentally investigated to explore the behavior of phononic bandgaps (PBGs) in the ultra high frequency (UHF) range: (i) the conventional square lattice with circular air scatterer, (ii) the inverse acoustic bandgap (IABG) structure, (iii) the fractal PnC, and (iv) the X-shaped PnC. Each unit cell has its unique frequency characteristic that was exploited to synthesize either cavity resonators or improve the performance of acoustic delay lines. The PBGs operate in the range of 770 MHz to 1 GHz and exhibit a maximum acoustic rejection of 40 dB. AIN Lamb wave transducers (LWTs) were employed for the experimental demonstration of the PBGs and cavity resonances. Ultra
Pt-catalyzed ozonation of aqueous phenol solution using high-gravity rotating packed bed
International Nuclear Information System (INIS)
Chang, Chia-Chi; Chiu, Chun-Yu; Chang, Ching-Yuan; Chang, Chiung-Fen; Chen, Yi-Hung; Ji, Dar-Ren; Tseng, Jyi-Yeong; Yu, Yue-Hwa
2009-01-01
In this study, a high-gravity rotating packed bed (HGRPB or HG) was used as a catalytic ozonation (Cat-OZ) reactor to decompose phenol. The operation of HGRPB system was carried out in a semi-batch apparatus which combines two major parts, namely the rotating packed bed (RPB) and photo-reactor (PR). The high rotating speed of RPB can give a high volumetric gas-liquid mass transfer coefficient with one or two orders of magnitude higher than those in the conventional packed beds. The platinum-containing catalyst (Dash 220N, Pt/γ-Al 2 O 3 ) and activated alumina (γ-Al 2 O 3 ) were packed in the RPB respectively to adsorb molecular ozone and the target pollutant of phenol on the surface to catalyze the oxidation of phenol. An ultra violet (UV) lamp (applicable wavelength λ = 200-280 nm) was installed in the PR to enhance the self-decomposition of molecular ozone in water to form high reactive radical species. Different combinations of advanced oxidation processes (AOPs) with the HGRPB for the degradation of phenol were tested. These included high-gravity OZ (HG-OZ), HG catalytic OZ (HG-Cat-OZ), HG photolysis OZ (HG-UV-OZ) and HG-Cat-OZ with UV (HG-Cat-UV-OZ). The decomposition efficiency of total organic compound (η TOC ) of HG-UV-OZ with power of UV (P UV ) of 16 W is 54% at applied dosage of ozone per volume sample m A,in = 1200 mg L -1 (reaction time t = 20 min), while that of HG-OZ without the UV irradiation is 24%. After 80 min oxidation (m A,in = 4800 mg L -1 ), the η TOC of HG-UV-OZ is as high as 94% compared to 82% of HG-OZ process. The values of η TOC for HG-Cat-OZ process with m S = 42 g are 56% and 87% at m A,in = 1200 and 4800 mg L -1 , respectively. By increasing the catalyst mass to 77 g, the η TOC for the HG-Cat-OZ process reaches 71% and 90% at m A,in = 1200 and 4800 mg L -1 , respectively. The introduction of Pt/γ-Al 2 O 3 as well as UV irradiation in the HG-OZ process can enhance the η TOC of phenol significantly, while γ-Al 2 O 3 exhibits
Ciné club
2014-01-01
Thursday 23 October 2014 at 20:00 CERN Council Chamber The Shop on Main Street Directed by Jan Kadar, Elmar Klos Slovakia, 1965, 125 minutes In 1942, in a small town in Czechoslovakia, the poor carpenter Tony Brtko is assigned "Aryanizator" of a small shop on the main street by his fascist brother-in-law. His greedy wife is seduced with the promise of fortune, but Tony finds that the store owned by the deaf and senile seventy eight year-old widow Rozalie Lautmann is bankrupted and the old lady is financially supported by the Jewish community that promises a salary to him to help her. Tony befriends Mrs Lautmann and helps her in the store and repairs her furniture, and lures his wife with his salary. When the Jews are expelled from the town by the fascists, Tony decides to help the old lady. Original version Slovak; English subtitles Thursday 30 October 2014 at 20:00 CERN Council Chamber High Noon Directed by Fred Zinnemann USA, 1952, 85 minutes On the day he gets ...
Energy Technology Data Exchange (ETDEWEB)
Mueller, Monika C.M. (ed.)
2011-07-01
Within the international meeting of the Evangelische Akademie Loccum (Rehburg-Loccum, Federal Republic of Germany) at 13rd to 15th May, 2009 the following lectures were held: (1) Biomass - Energy of the future (Daniela Thraen); (2) Bio energy and cultivation of energy crops in Lower Saxony. State of the art and perspectives (Gerd Carsten Hoeher); (3) Bioenergy and food security project in FAO (Mirella Salvatore); (4) Appetite for hunger and competition in land use (Elmar Altvater); (5) Biodiesel poles in Northeast Brasilia. Efficiencies and experiences of a project for the integration of small farmers into the national Biodiesel program (Stefan Goertz); (6) Bioenergy in Africa: Chance to overcome energy poverty or driver of hunger (Hamimu Hongo); (7) Cultivation of Jatropha for direct utilization of oil: Win-Win situation for small farmers and companies? (Lorenz Kirchner); (8) Energy security by means of sufficient power generation. Energy and fuels from biomass result in renaissance of the agriculture and offer chances for fight against poverty and for avoidance of hunger to developing countries (Nasir El Bassam).
Directory of Open Access Journals (Sweden)
Kelly Lei
2016-08-01
Full Text Available Addiction to alcohol remains a major social and economic problem, in part because of the high motivation for alcohol that humans exhibit and the hazardous binge intake this promotes. Orexin-1-type receptors (OX1Rs promote reward intake under conditions of strong drives for reward, including excessive alcohol intake. While systemic modulation of OX1Rs can alter alcohol drinking, the brain regions that mediate this OX1R enhancement of excessive drinking remain unknown. Given the importance of the nucleus accumbens (NAc and anterior insular cortex (aINS in driving many addictive behaviors, including OX1Rs within these regions, we examined the importance of OX1Rs in these regions on excessive alcohol drinking in C57BL/6 mice during limited-access alcohol drinking in the dark cycle. Inhibition of OX1Rs with the widely used SB-334867 within the medial NAc Shell (mNAsh significantly reduced drinking of alcohol, with no effect on saccharin intake, and no effect on alcohol consumption when infused above the mNAsh. In contrast, intra-mNAsh infusion of the orexin-2 receptor TCS-OX2-29 had no impact on alcohol drinking. In addition, OX1R inhibition within the aINS had no effect on excessive drinking, which was surprising given the importance of aINS-NAc circuits in promoting alcohol consumption and the role for aINS OX1Rs in driving nicotine intake. However, OX1R inhibition within the mPFC did reduce alcohol drinking, indicating cortical OXR involvement in promoting intake. Also, in support of the critical role for mNAsh OX1Rs, SB within the mNAsh also significantly reduced operant alcohol self-administration in rats. Finally, orexin ex vivo enhanced firing in mNAsh neurons from alcohol-drinking mice, with no effect on evoked EPSCs or input resistance; a similar orexin increase in firing without a change in input resistance was observed in alcohol-naïve mice. Taken together, our results strongly suggest that OX1Rs within the mNAsh, but not the aINS, play a
Directory of Open Access Journals (Sweden)
Jian-quan WU
2012-07-01
Full Text Available Objective To investigate the anti-fatigue effect and possible mechanisms of micronutrient compound. Methods One hundred and twenty-five male Kunming mice (SPF were fed following different feeding stuffs: sufficient feed, i.e. AIN-93M feed (corn starch 46.6%, casein 14%, dextrinized corn starch 15.5%, sucrose 10%, soybean oil 4%, fiber 5%, mineral mix 3.5%, vitamin mix 1%, L-cystine 0.18%, choline chloride 0.138% and tert-butylhydroquinone 8 ppm; insufficient feed (composed the same ingredients as the AIN-93M diet, replacing 30%, 50% or 70% of the content of mineral and vitamin mix with corn starch; compound micronutrient-added feed (CMAF, replacing 30% of the content of mineral and vitamin mix of AIN-93M diet with micronutrient compound composed of (g/kg Vit A 0.25, Vit B1 0.3, Vit B2 0.3, Vit B6 0.35, nicotinic acid 1.5, Vit D 0.05, Vit C 50, Vit E 10, calcium carbonate 180, ferrous glycine 1, zinc lactate 1 and corn starch 755.25. The mice were fed for 14 or 28 d, and then subjected to forced swim test with a load on their tails to exhaustion. The maximal swimming time was recorded. In another experiment, the Kunming mice were fed with corresponding feed for 28 d, and then subjected to forced swim test for 60 min, thereafter the samples of blood and liver were collected immediately. The serum contents of glucose, lactate, nonprotein nitrogen, nonesterified fatty acids and hepatic glycogen were measured. Results The dietary intake of 30% nutritional insufficient group (30% group was significantly decreased compared with normal control group (fed with AIN-93M diet, (P 0.05. The serum glucose and hepatic glycogen decreased and serum lactate, nonprotein nitrogen and nonesterified fatty acids increased in the control group, which were aggravated in nutrient insufficient group and reversed in micronutrient supplementation group. Conclusions Insufficient intake of micronutrients has significant influence on swimming endurance in mice and compound
Data of evolutionary structure change: 1CF5B-1RTCA [Confc[Archive
Lifescience Database Archive (English)
Full Text Available 1CF5B-1RTCA 1CF5 1RTC B A --------DVNFDLSTATAKTYTKFIEDFRATL-PFSHK...A 211 1RTC A 1RTCA...ain> 1RTC A 1RTCA SALYYYSTGGTQLPT...pdbChain> 1RTCA MRTRIRYNRRSA HHHHHH 1RTCA AYFFH-PDNQE
Soomlased teevad silma Eesti toidutööstusele / Silva Männik
Männik, Silva, 1974-
2004-01-01
EL-iga liitumise eel plaanivad mitmed Soome ettevõtjad investeerida Eesti toiduainetööstustesse ja viia Eesti tooted Soome turule. Diagrammid: Soomlane sööb üha enam Eesti toitu. Kommenteerivad Joakim Helenius ja Ain Hanschmidt. Lisa: Näiteid soomlaste tehingutest
File list: Oth.YSt.05.DNA-RNA_hybrids.AllCell [Chip-atlas[Archive
Lifescience Database Archive (English)
Full Text Available Oth.YSt.05.DNA-RNA_hybrids.AllCell sacCer3 TFs and others DNA-RNA hybrids Yeast str...ain http://dbarchive.biosciencedbc.jp/kyushu-u/sacCer3/assembled/Oth.YSt.05.DNA-RNA_hybrids.AllCell.bed ...
File list: Oth.YSt.50.DNA-RNA_hybrids.AllCell [Chip-atlas[Archive
Lifescience Database Archive (English)
Full Text Available Oth.YSt.50.DNA-RNA_hybrids.AllCell sacCer3 TFs and others DNA-RNA hybrids Yeast str...ain http://dbarchive.biosciencedbc.jp/kyushu-u/sacCer3/assembled/Oth.YSt.50.DNA-RNA_hybrids.AllCell.bed ...
File list: Oth.YSt.20.DNA-RNA_hybrids.AllCell [Chip-atlas[Archive
Lifescience Database Archive (English)
Full Text Available Oth.YSt.20.DNA-RNA_hybrids.AllCell sacCer3 TFs and others DNA-RNA hybrids Yeast str...ain http://dbarchive.biosciencedbc.jp/kyushu-u/sacCer3/assembled/Oth.YSt.20.DNA-RNA_hybrids.AllCell.bed ...
File list: Oth.YSt.10.DNA-RNA_hybrids.AllCell [Chip-atlas[Archive
Lifescience Database Archive (English)
Full Text Available Oth.YSt.10.DNA-RNA_hybrids.AllCell sacCer3 TFs and others DNA-RNA hybrids Yeast str...ain http://dbarchive.biosciencedbc.jp/kyushu-u/sacCer3/assembled/Oth.YSt.10.DNA-RNA_hybrids.AllCell.bed ...
Eesti Kirjanike Liit praegu : ankeedivastused
1997-01-01
Aut.: Ain Kaalep, Juhan Habicht, Valeria Ränik, Karl Muru, Mart Velsker, Janika Kronberg, Maie Kalda, Hannes Varblane, Toomas Raudam, Priidu Beier, Kati Murutar, Dagmar Normet, Enn Vetemaa, Henn-Kaarel Hellat, Vello Lattik, Kajar Pruul, Kauksi Ülle, Ene Mihkelson, Jüri Ehlvest
Data of evolutionary structure change: 1M3DI-1T60W [Confc[Archive
Lifescience Database Archive (English)
Full Text Available tryIDChain>1M3DI APLPM--MPVAE ...> -- EEE> ATOM 14546 CA ALA I 86 32.542 22.976 78.017 1.00...ain>1T60W EPMPMSMAPITG > EEE> IECHG-RGTCN >EEEE - EEEE.../entryIDChain> IECNGARGTCH >EEEEGGGEEEE>
Viis näitust haaravad eri aastasadu / Margus Haav
Haav, Margus, 1969-
2009-01-01
Viljandi uue kunsti muuseumis avati fotograaf Ain Kimberi aktinäitus "Igavene teema", Johann Christoph Brotze pärandit tutvustav näitus, Belgia fotokunstniku Patavoli "Taevariik", Valgevene kunstniku Valeri Slauki litograafiad ning kunstitudengite Eva Järve ja Liis Dvorjanski kineetilised heinakuhjad
Genetic study of congenital limb anomalies among Egyptian children
African Journals Online (AJOL)
All cases were selected from among patients attending the outpatient medical genetics clinic, faculty of medicine, Ain-Shams university, Cairo-Egypt. Enrolled cases were subjected to a list of investigations including complete history with pedigree construction, anthropometric measurements and full clinical examination.
Experiment list: SRX191034 [Chip-atlas[Archive
Lifescience Database Archive (English)
Full Text Available scription=Adult 8 weeks || strain=C57BL/6 || strain description=C57 black 6, the most common inbred strain of labor...ain description=C57 black 6, the most common inbred strain of laboratory mouse http://dbarchive.biosciencedb
1090-IJBCS-Article-Fatiha Zidane
African Journals Online (AJOL)
DR GATSING
1Laboratoire Science de l'Eau et d'Environnement, Département de Chimie, Faculté des Sciences Ain Chock,. Université ... élevée en divers types de polluants. ... Mots clés: traitement, hydroxyde, coagulation, demande chimique en oxygène.
Energy Technology Data Exchange (ETDEWEB)
Chavez R, R
2000-07-01
The nuclear reaction analysis (NRA) technique is used mainly for detecting the presence and concentration of light elements of great importance such as: carbon, nitrogen and oxygen. This work has the objective to obtain the differential sections of {sup 16} O and {sup 14} N starting from the irradiation with deuterons of TiSrO{sub 3} samples, of AIN and AIN{sub 2} at energies of 2000 KeV and 1800 KeV respectively. The present work have four chapters; chapter 1 is focused to the physical aspects which takes part in the NRA technique. The technical requirements as well as the necessary equipment for developing the techniques are described in the chapter 2. In chapter 3 it is described the algorithm developed for to obtain the differential sections starting from experimental data, and finally, in chapter 4 are given the results and conclusions. (Author)
Advokaadi kutse-eetika reason d’etre / Ain Alvin
Alvin, Ain, 1959-
2014-01-01
Advokaadi kohustus on kutsetegevuses järgida lisaks seadusele kutse-eetika nõudeid, häid kombeid ja südametunnistust. Mida sellised kohustused sisuliselt tähendavad, millest tuleneb vajadus kutse-eetika kutseühendusesisese reguleerimise järele ja milline on kutse-eetika normide sisu?
Invsteeringutoetuste saajate ring väheneb / Ain Lember
Lember, Ain
2009-01-01
Eestimaa talupidajate keskliit ei ole rahul mikropõllumajandusettevõtte arendamise investeeringutoetuse (meede 1.4.1) ja loomakasvatusehitiste investeeringutoetuse (meede 1.4.2) määruses tehtud muudatustega
Kevadelaul : [luuletused] / Federico Garcia Lorca ; tlk. Ain Kaalep
García Lorca, Federico, 1898-1936
2006-01-01
Sisu: Kevadelaul ; Uued laulud ; Unenägu ; Uus süda ; Rõske siseõu ; Risttee : "Oh valu: mu värsid võtnud..." ; Ballaad mereveest ; Huile ; Vaikus ; Risttee : "Tuul puhub läänest..." ; Sevilla ; Kuus keelt ; Memento ; Kolm linna : Malaguena ; Cordoba agul ; Tants ; Kitarrimõistatus ; Poolkuu ; Neli kollast ballaadi ; Aadam ; Tasakaal ; Friis ; Maha raiuti kolm puud ; Teokarp ; Rumal laul ; Õhtu ; Ratsaniku laul ; Debussy ; Kuu tõuseb ; Kaks õhtust kuud ; Serenaad ; Laul lahkuvast päevast ; Kuuba neegrilaul ; Itk Ignacio Sanchez Mejiase surma puhul ; Madrigal Santiago linnale ; Hällilaul surnud Rosalia Castrole ; Kuu tants Santiagos ; Gaseel kohutavast lähedusest ; Gaseel tumedast surmast ; Gaseel põgenemisest ; Gaseel saja-aastasest armastusest ; Kassiida okstest ; Kassiida selili lebavast naisest ; Kassiida unenäost vabas õhus ; Kassiida tumedaist tuvidest ; Vee süit ; Herbaariumid ; Omega ; Ood Salvador Dalile ; "Ma kardan, kas su imet ma ei kaota..." . Eluloolisi andmeid autori kohta lk. 879
The cytometric future: it ain't necessarily flow!
Shapiro, Howard M
2011-01-01
Initial approaches to cytometry for classifying and characterizing cells were based on microscopy; it was necessary to collect relatively high-resolution images of cells because only a few specific reagents usable for cell identification were available. Although flow cytometry, now the dominant cytometric technology, typically utilizes lenses similar to microscope lenses for light collection, improved, more quantitative reagents allow the necessary information to be acquired in the form of whole-cell measurements of the intensities of light transmission, scattering, and/or fluorescence.Much of the cost and complexity of both automated microscopes and flow cytometers arises from the necessity for them to measure one cell at a time. Recent developments in digital camera technology now offer an alternative in which one or more low-magnification, low-resolution images are made of a wide field containing many cells, using inexpensive light-emitting diodes (LEDs) for illumination. Minimalist widefield imaging cytometers can provide a smaller, less complex, and substantially less expensive alternative to flow cytometry, critical in systems intended for in resource-poor areas. Minimalism is, likewise, a good philosophy in developing instrumentation and methodology for both clinical and large-scale research use; it simplifies quality assurance and compliance with regulatory requirements, as well as reduces capital outlays, material costs, and personnel training requirements. Also, importantly, it yields "greener" technology.
Multivariate statistical characterization of groundwater quality in Ain ...
African Journals Online (AJOL)
Administrator
blended water (group 3), based on the similarity of groundwater quality characteristics. Principal component analysis, applied to the data sets of the three different groups obtained from ...... from Butucatu aquifer in Sao Paulo State, Brazil.
Natura 2000 sai tuule tiibadesse Raplamaal / Ain Aivela
Aivela, Ain
2004-01-01
Natura 2000 idee jõudis Eestisse 2000. aastal, mil pilootprojekti raames ning Taani riigi rahalisel toel alustati Natura-võrgustiku eelvalikualade mahamärkimist Lääne- ja Raplamaal. Kommenteerinud Aleksei Lotman
Jõupaberi tootmine tagab Kehra vabriku kasumi / Ain Alvela
Alvela, Ain, 1967-
2015-01-01
Kehra paberivabrik on kodumaa metsaomaniku jaoks oluline okaspuu paberipuidu tarnija, kasutades umbes viiendiku sellise sortimendi aastasest raiemahust. Vabriku toodangust lõviosa moodustab pakendipaber. Selle tootmine tagab ka kasumi
Geniaalne aines, hämmastav film / Tarmo Teder
Teder, Tarmo, 1958-
2006-01-01
Oktoobri algul Kuressaares peetud Saaremaalt pärit ameerika arhitekti Louis Kahni konverentsi raames Kuressaare Linnateatris näidatud dokumentaalfilmist "Minu arhitekt" ("My Architect") : režissöör Nathaniel Kahn : Ameerika Ühendriigid 2003
Eesti ehitusturu kasv tipneb 2006. aastal / Ain Hinsberg
Hinsberg, Ain
2002-01-01
Taanis asuva uuringufirma European Construction Research, mis jälgib ja prognoosib Ida- ja Lääne-Euroopa ning Lähis-Ida, Hiina ja Aasia ehitusturgu, ennustab Eestile jätkuvat kasvu. Diagramm: Eesti ehitusturu areng 1999-2010
Tuuleenergia kasutamisvõimalused Eestis / Ain Kull, Valdur Tiit
Kull, Ain, 1973-
2005-01-01
Autorite hinnangul on seni Eestis ulatuslik tuulejõu kasutamine raskendatud nii finantsprobleemide, kodumaise tootmise puudumise, rannikupiirkondade elektriliinide väikese võimsuse kui ka Narva põlevkivijaamade alakoormatuse tõttu. Tabel
Poliitiline areng / Vello Pettai, Daunis Auers, Aine Ramonaite
Pettai, Vello, 1968-
2011-01-01
Ülevaade demokraatlikust arengust Baltimaades - valitsuste stabiilsus, parlamendi usaldatavus, valimised, erakonnad, kodanikuühiskonna areng, poliitika läbipaistvus, huvi poliitika vastu ühiskonnas. Tabelid, joonised
Political development / Vello Pettai, Daunis Auers, Aine Ramonaite
Pettai, Vello, 1968-
2011-01-01
Ülevaade demokraatlikust arengust Baltimaades - valitsuste stabiilsus, parlamendi usaldatavus, valimised, erakonnad, kodanikuühiskonna areng, poliitika läbipaistvus, huvi poliitika vastu ühiskonnas. Tabelid, joonised
Multivariate statistical characterization of groundwater quality in Ain ...
African Journals Online (AJOL)
Administrator
depends much on the sustainability of the available water resources. Water of .... 18 wells currently in use were selected based on the preliminary field survey carried out to ... In recent times, multivariate statistical methods have been applied ...
Directory of Open Access Journals (Sweden)
E. Riboldi
2012-02-01
Full Text Available Este estudo forneceu subsídios para o melhor entendimento das intoxicações pelos anti-inflamatórios não esteroidais (AINES em humanos e animais de companhia. Os principais focos foram a diferença espécie-específica e os serviços prestados por Centros de Informação Toxicológica. Para tanto, foram utilizados dados referentes às intoxicações por AINES em pessoas, cães e gatos reportadas ao CIT/RS entre 2005 e 2009. Além disso, foram abordados, comparativamente, os dados do American Association of Poison Centers (AAPCC entre 2004 e 2008, bem como as referências na literatura acerca da sensibilidade espécie-específica. Constatou-se que a maioria das intoxicações por AINES, independentemente da espécie, abrangeu o cetoprofeno, o ibuprofeno e o diclofenaco, sendo 54% destes intencionais em humanos, destacando-se o diclofenaco. Em se tratando de animais de companhia, 73% das intoxicações em cães ocorreram pelo diclofenaco, e 60% dos acidentes em gatos foram ocasionados pelo ibuprofeno. Chama-se a atenção para a importância dos Centros de Informação Toxicológica como forma de assistência e prevenção desses acidentes, bem como para a venda indiscriminada desses fármacos, aliados à medicação extraprescrição - que leva, na maioria das vezes, cães e gatos ao óbito.
Dietary fat composition influences tissue lipid profile and gene expression in Fischer-344 rats.
Zhou, Albert L; Hintze, Korry J; Jimenez-Flores, Rafael; Ward, Robert E
2012-12-01
The AIN-76A diet causes fatty liver in rodents when fed for long periods of time. The aim of this study was to utilize fatty acid analysis and transcriptomics to investigate the effects of different fat sources in the AIN-76A diet on tissue lipid profiles and gene expression in male, weanling Fischer-344 rats. Animals were fed isocaloric diets that differed only in the fat source: (1) corn oil (CO) (2) anhydrous milk fat (AMF), and (3) AMF supplemented with 10% phospholipids from the milk fat globule membrane (AMF-MFGM). There were no differences in food intake, body weight, growth rate, or body fat composition among the groups, and the fatty acid compositions of red blood cells (RBC), plasma, muscle, and visceral adipose tissues reflected the dietary fat sources. Modifying the fat source resulted in 293 genes differentially regulated in skeletal muscle, 1,124 in adipose, and 831 in liver as determined by analysis of variance (ANOVA). Although tissue fatty acid profiles mostly reflected the diet, there were several quantitative differences in lipid classes in the liver and plasma. The AMF diet resulted in the highest level of hepatic triacylglycerols, but the lowest level in plasma. The CO diet resulted in significant accumulation of hepatic unesterified fatty acids and decreased DGAT expression and activity, a potential trigger for steatohepatitis. These results indicate that the fatty acid composition and presence of polar lipids in the AIN-76A diets have significant effects on lipid partitioning, gene expression, and potentially the development of liver pathology.
Clinical utility of dabigatran in United Arab Emirates
Shehab, Abdulla; Elnour, Asim A.; Sadik, Adel; Mandil, Mahmoud Abu; AlShamsi, Ali; Suwaidi, Aesha Al; Bhagavathula, AkshayaSrikanth; Erkekoglu, Pinar; Hamad, Farah; Nuaimi, Saif K. Al
2015-01-01
Objectives: To provide early data regarding clinical utility of dabigatran in Al-Ain, United Arab Emirates (UAE). Methods: This was an ethics approved retrospective cross sectional study. We retrieved a total of 76 patients who were using dabigatran from September to December 2014 in the Cardiology Clinic at Al-Ain Hospital, Al-Ain, UAE. The primary analysis was designed to test the frequency of bleeding events (rate) with dabigatran 75, 110, and 150 mg. Results: The mean age ± standard deviation of cohort was 67.9 ± 1.5 years (range; 29-98 years), composed of males (52.6%) with mean age of 66.3 ± 1.7 years, and females (47.4%) with mean age of 69.6 ± 1.1 years. The highest age group was those between 61-80 years (60.5%). Most comprised the age strata of ≤75 years (73.7%). The main indication for dabigatran use was atrial fibrillation. The rate of bleeding with dabigatran was 18/76 (23.7%), and melena was the leading cause of bleeding 8/76 (10.7%). The hospitalization rate was 67.1%, dabigatran withdrawal rate was 0.01%, and mortality rate was 6.5%. The cohort had exhibited incidences of minor bleeding with one fatal major bleeding, high co-morbidities, admission, and readmission, which was not directly linked to dabigatran. We did not identify any relation of death due to dabigatran. Conclusion: Dabigatran is a suitable alternative to warfarin obviating the need for repetitive international normalized ratio monitoring, however, it may need plasma drug monitoring. PMID:26593161
Proceedings – Mathematical Sciences | Indian Academy of Sciences
Indian Academy of Sciences (India)
Department of Mathematics, Faculty of Sciences of Ain Chock, University of Hassan II, Casablanca, Morocco; Department of Mathematics, Keio University at Fujisawa, 5322 Endo, Kanagawa 252-8520, Japan; School of Science and Technology, Kwansei Gakuin University, 2-1 Gakuen, Sanda-City 6691337, Japan ...
Lahkus juhmi Hundi ja kavala Jänese looja / Andri Maimets, Marko Lillemägi
Maimets, Andri, 1979-
2006-01-01
Suri vene animakunstnik, kuulsate tegelaskujude - Hundi ja Jänese looja joonisfilmisarjas (1969-1986) "Oota sa!" ("Nu, pogodi!") Svetozar Russakov (sünd. 3.04.1923). Filmi omaaegset mõju meenutab Rein Raamat. Kommenteerivad Raivo Järvi, Hendrik Normann, Ain Nurmela, Marika Korolev, Evelin Samuel
Hamza, Mohamed Atef; Allam, Lamyaa
2012-01-01
Case report of a 19 year-old female patient with systemic lupus erythematosus (SLE) who was presented to Ain Shams University Hospital complaining of dyspnea on moderate exertion. Echocardiography showed the presence of sterile vegetation on the mitral valve, Libman–Sacks endocarditis (LSE).
Uus silt turul - clean label / Gunnel Koba
Koba, Gunnel
2013-01-01
Suurbritanniast alguse saanud clean labeli toiduainete märgis annab tarbijale kindlustunde, et tegemist on võimalikult puhta lihtsa ja arusaadava koostisega tootega. Samas pole märgisel ametlikku definitsiooni ning pole välistatud, et toiduaine koostises ei ole ka mõni e-aine
Armusuhted tööl - meeleolu tõuseb, töökvaliteet langeb / Ketlin Priilinn
Priilinn, Ketlin, 1982-
2005-01-01
Ilmunud ka: Juhi ideelaegas. - Tallinn, 2006, lk. 77-79. A. Le Coqi juhatuse esimees Tarmo Noop, Alexela Oili tegevjuht Ain Kuusik ja Tööinspektsiooni õigusosakonna juhataja Niina Siitam isiklikest suhetest ja armumisest tööl. Kommenteerib BDA Estonia projektikonsultatsioonide juht Maria Kütt
Mechanisms of Chinese Red Yeast Rice Inhibition of Prostate Cancer Growth
2009-10-01
following treatment with LV and RYR. MATERIALS AND METHODS Extract and standard preparation Chinese RYR powder purchased from Botanica Bio- Science (Ojai...RYR diet contains 5% of RYR powder ( Botanica Bioscience, Ojai, CA) with the modified AIN93G diet. For lovastatin diet, lovastatin (Mylan
Most "Druzhba" priobretajet politisheskoje znatshenije / Konstantin Vikentejev
Vikentejev, Konstantin
2005-01-01
Eesti ja Venemaa välisministrite Urmas Paeti ja Sergei Lavrovi kohtumisest Sloveenias, kus kinnitati ka vajadust Sõpruse sild rekonstrueerida. Arvamust avaldavad: Ago Silde, Sergei Jastrzhembski, Arnold Rüütel, Margus Leivo, Jaanus Õunapuu, Tiit Vähi, Ain Uiga, Vadim Gustov, Riho Sõrmus
Data of evolutionary structure change: 1A5CB-2QUTC [Confc[Archive
Lifescience Database Archive (English)
Full Text Available 8 2QUT C 2QUTC ...ain>C 2QUTC ence>INKCPLLKPWA HH...T C 2QUTC ence>LKIGE--HTPSA...1A5CB-2QUTC 1A5C 2QUT B C ------LPADVAEELATTAQKLVQAGKGILAADESTQTI... 1A5CB LFGTK-GLGKFence> HHH - <
Künnapu, Vilen, 1948-
2000-01-01
Projekteerija Arhitektuuribüroo Künnapu & Padrik. Arhitektid Vilen Künnapu, Ain Padrik. Konstruktsioonide autor Andres Laur. Sisekujundajad Argo ja Katrin Vaikla. Projekt 1994, valmis 2000. Kirik on klaasja pikliku koolitiivaga (teoloogiline seminar). 7 ill.: I korruse plaan, lõige, välis- ja sisevaated
Data of evolutionary structure change: 1CG5A-2ZLWD [Confc[Archive
Lifescience Database Archive (English)
Full Text Available 1CG5A-2ZLWD 1CG5 2ZLW A D -VLSSQNKKAIEELGNLIKANAEAWGADALARLFELHPQ...R VQLSGEEKAAVLALWDKV--NEEEVGGEALGRLLVVYPWTQRFFDSFGDLSNPGAVMGNPKVKAHGKKVLHSFGEGVHHLDNLKGTFAALSEL...ne> GLN CA 254 2ZLW D 2ZLWD...ain> 2ZLW D 2ZLWD AR...fEVID> 2 2ZLW D 2ZLWD
Richel, O.; Wieland, U.; de Vries, H. J. C.; Brockmeyer, N. H.; van Noesel, C.; Potthoff, A.; Prins, J. M.; Kreuter, A.
2010-01-01
Background Anal intraepithelial neoplasia (AIN), a human papillomavirus (HPV) induced potential precursor lesion of anal cancer, is frequent among human immunodeficiency virus (HIV)-positive men who have sex with men (MSM). So far, only a few prospective studies have been performed on the topical
Methionine synthase A2756G and reduced folate carrier1 A80G ...
African Journals Online (AJOL)
Maha Moustafa
2015-10-09
Oct 9, 2015 ... folate carrier (RFC1) A80G gene polymorphisms on the maternal risk for DS. Patients: This ... Peer review under responsibility of Ain Shams University. ... Folate is the general term for a water-soluble B vitamin (vita- min B9) ...
Häda nende meie Vaarikutega! / Andres Mesikäpp
Mesikäpp, Andres
2000-01-01
20. oktoobril algas Kanal 2s uus teleseriaal "Me saame hakkama" : stsenarist Mihkel Ulman : režissöör Ain Prosa : helilooja Ardo-Ran Varres : mängivad Andrus, Maarika ja Marta Vaarik, Ülle Kaljuste, Maria Avdjushko, Hilja Varem jt. : Wireframe Productions
Hakkama võib saada ka koomiliselt / Liivi Šein
Šein, Liivi
2000-01-01
20. oktoobril algab Kanal 2s uus teleseriaal "Me saame hakkama" : stsenarist Mihkel Ulman : režissöör Ain Prosa : helilooja Ardo-Ran Varres : mängivad Andrus, Maarika ja Marta Vaarik, Ülle Kaljuste, Maria Avdjushko, Hilja Varem jt. : Wireframe Productions
Kinnisvaragurude ümarlaud / interv. Jaanika Merilo
2007-01-01
Järg. Profit nr. 3 lk. 18-21. Eesti kinnisvaraturu olukorrast, vestlusringis osalevad investeerimisfirma EE-REIT juhatuse liige Ain Kivisaar, Arco Vara Eesti tegevjuht Kaido Kangur, Hansapanga makromajanduse analüütik Maris Lauri ja ASYIT Ehituse kinnisvaraosakonna müügijuht Tõnu Toompark
Data of evolutionary structure change: 1F3XD-3EOEC [Confc[Archive
Lifescience Database Archive (English)
Full Text Available IQDLK-FGVEQ >HHHHH-HHHH > ATOM 1...bID>3EOE C 3EOEC KHDILNFGIPM ...>HHHIIIII > ATOM 8495 CA LYS C 210 4.419 -1...ETT >E -- E> ATOM 7912 CA ASP C ...ain>D 1F3XD DNAYMEKCDENI > GGG EE E
"Kalevipoeg" ja "Kalevala" / Märt Laarman
Laarman, Märt, 1896-1979
1998-01-01
Varem ilmunud: Tallinn : Kool, 1922. Autori pseudonüüm M. Salak. . Sisu: "Kalevipoja" saamislugu; "Kalevipoeg" ja "Kalevala"; Vead "Kalevipoja" värsitehnikas ja keeles; Eesti ained "Kalevalas"; "Kalevala" mõju "Kalevipojale"; Kalevipoja algupära; "Kalevipoja" kompositsioon ja tegelased; Kaunid kohad "Kalevipojas"; Kokkuvõte.
Iidamast ja Aadamast ehk "Ahvide planeet" / Jaak Lõhmus
Lõhmus, Jaak
2001-01-01
Taas on ekraanile jõudnud Pierre Boulle'i raamatu ainetel "Ahvide planeet" ("Planet of the Apes") : režissöör Tim Burton : Ameerika Ühendriigid 2001. Autor võrdleb seda 1968.a. filmiga ning Ain Kaalepi näidendiga "Iidamast ja Aadamast"
Precision and Purpose: Airpower in the Libyan Civil War
2015-01-01
Civil War Zara after seeing leaflets emblazoned with attacking helicopters descend on the area. In Tripoli, residents recalled hearing a radio program...operational night flight (March 4, 1912); his colleague, Tenente Giulio Gavotti, dropped the first bombs on November 1, 1911, striking Ain Zara and
Type 1 diabetes mellitus and atopic diseases in children.
African Journals Online (AJOL)
Ehab
Nancy S. Elbarbary. Assistant Professor of Pediatrics, Faculty of Medicine, Ain Shams University, Cairo, Egypt. Background. Diabetes mellitus type 1 (T1DM) is a complex disease resulting from the interplay of genetic, epigenetic, and environmental factors.1 Worldwide,. T1DM epidemic represents an increasing global.
African Journals Online (AJOL)
yakoub@AHMED
We may tentatively suggest on the basis oř recent molecular evidence that induced elevation oř .... Ph.D.Thesis Faculty oř Sci. Ain Shams ... 23: 1389. 1395. Kim K N, Cheong YH, Grant JJ, Pandey GK & Luan S (2003) CIPK3, a calcium sensor.
Directory of Open Access Journals (Sweden)
Mohamed Atef Hamza
2012-09-01
Full Text Available Case report of a 19 year-old female patient with systemic lupus erythematosus (SLE who was presented to Ain Shams University Hospital complaining of dyspnea on moderate exertion. Echocardiography showed the presence of sterile vegetation on the mitral valve, Libman–Sacks endocarditis (LSE.
Richel, Olivier; de Vries, Henry J. C.; van Noesel, Carel J. M.; Dijkgraaf, Marcel. G. W.; Prins, Jan M.
2013-01-01
Anal cancer is an increasing issue in HIV-positive men who have sex with men (MSM). Screening for its precursor, anal intraepithelial neoplasia (AIN), is subject of discussion. Current treatment options are suboptimum and have not been compared in a prospective trial. We compared efficacy and
Anal intraepithelial neoplasia in HIV+ men
Richel, O.
2014-01-01
In this thesis we investigated several aspects of anal intraepithelial neoplasia (AIN) in HIV+ men who have sex with men (MSM). This condition has gained clinical interest because of the impressive increase of the anal cancer incidence in HIV+ MSM since the introduction of combination antiretroviral
Suvehooaeg Emajõe Ateenas liidab lugusid mitmest sajandist / Raimu Hanson
Hanson, Raimu, 1957-
2006-01-01
Tartu suvelavastustest : Urmas Lennuki "Koidula" Andres Dvinjaninovi lavastuses (Emajõe Suveteater) ; Jan Rahmani "Sõit" Ain Mäeotsa lavastuses (Hansahoovi Teater), Raivo Adlase lavastus "Vaesed ja patused" August Jakobsoni ainetel Tartu raudteejaamas (Vilde Teater), G. Bizet' "Carmen" Ago-Endrik Kerge lavastuses (Muusikaline loomeühendus KaivConsort)
Suvelavastuste hooaeg Tartus liidab endasse lugusid mitmest sajandist / Raimu Hanson
Hanson, Raimu, 1957-
2006-01-01
Tartu suvelavastustest : Urmas Lennuki "Koidula" Andres Dvinjaninovi lavastuses (Emajõe Suveteater) ; Jan Rahmani "Sõit" Ain Mäeotsa lavastuses (Hansahoovi Teater), Raivo Adlase lavastus "Vaesed ja patused" August Jakobsoni ainetel Tartu raudteejaamas (Vilde Teater), G. Bizet' "Carmen" Ago-Endrik Kerge lavastuses (Muusikaline loomeühendus KaivConsort)
Koputajate kaitseks! / Ivar Tallo
Tallo, Ivar, 1964-
2003-01-01
Politoloog Ivar Tallo arvates võiks Riigikogu välja tulla initsiatiiviga luua ühiskonna esindajate osavõtul vigade ja pettuste paljastajate kaitse seadus. Küsimusele, kust läheb politseiametniku sõnavabaduse piir vastavad Ain Seppik, Tarmo Loodus ja Jaanus Rahumägi. Indrek Sirgi juhtum
Can food addiction replace binge eating assessment in obesity ...
African Journals Online (AJOL)
Alaa Youssef Ahmed
2016-07-26
Jul 26, 2016 ... Peer review under responsibility of Ain Shams University. The Egyptian Journal of ... Studies on eat- ing disorders are relatively scarce particularly in adolescents in ... Preparatory and secondary schools in Cairo were distributed in its eastern ..... DS. Prevalence and treatment of mental disorders among US.
Jõulukuine plaadisadu / Joosep Sang
Sang, Joosep
2005-01-01
Lühidalt eesti heliplaatidest: "Eesti hääled", "Hendrik Sal-Saller & Estonian Dream Big Band", "Ain Agan ja Tallinna Kammerorkester", "The Book's Burning", "Mu süda ärka üles", "Inimene õpib...", "You Stepped Out of a Dream", "Andke tagasi maa", "Jesli ljubish, naidi..."
Hotell Radisson SAS = Radisson SAS Hotel / Inga Raukas
Raukas, Inga, 1967-
2001-01-01
Projekteerija Arhitektuuribüroo Künnapu & Padrik. Arhitektid Vilen Künnapu, Ain Padrik, Eero Palm, Tarmo Maiste. Sisekujundajad Christian Lundwall, Jan Öberg. Konstruktsioonid: Teuvo Meriläinen, Jyrki Rautamäki. Projekt ja hotell valmis 2000. 12 ill.: korruste plaanid, sise- ja välisvaated
ERKI moe ülevaatus pakkus täismajale toreda õhtu / Tiiu Oga
Oga, Tiiu
2007-01-01
Eesti Kunstiakadeemia 13.01.2007 Salme kultuurikesksuses toimunud moeetendusest. Lavastaja Kaarel Väli, graafiline kujundus Eiko Ojala, videokunstnikud Taavi Varm ja Aleks Tenusaar koos RGB-ga, lavaline kujundus Ain Nurmela, valguskunstnik Meelis Lusmägi koos ET Valgusega. Korraldajad Jaanika Terasmaa ja Ester Kannelmäe
Enhanced Wnt/beta-catenin signaling and loss of E-cadherin expression are considered hallmarks of tumorigenesis. We previously showed by microarray gene profiling that dietary intake of soy-based AIN-93G diets altered components of Wnt/beta-catenin signaling in rat mammary epithelial cells. To furth...
2011-10-28
... complaint named the following entities as respondents: MicroJet Technology Co., Ltd. of Hsinchu City, Taiwan (``MicroJet''); ain Asia Pacific Microsystems, Inc. of Hsinchu City, Taiwan (``APM''); Mipo Technology.... Respondent MicroJet defaulted. Respondent PTC did not participate in the hearing and failed to file post...
Data of evolutionary structure change: 1BP2A-3DIHA [Confc[Archive
Lifescience Database Archive (English)
Full Text Available ain> CFSKV--PYNKE >HGGG -- GG> A 3DIHA CFRENLKTYNKK re...yIDChain>3DIHA VCGSS-TPCKK ture... >EEE HHHH> ATOM 640 CA THR A 83...>HHHH GGG GG> ATOM 722 CA CYS A 95 72.245 22.685 6.343 1.00 14.
Epidemiological Pattern and Management of Pediatric Asthma ...
African Journals Online (AJOL)
EL-HAKIM
Egypt J Pediatr Allergy Immunol 2008; 6(2): 51-56. 51. Epidemiological Pattern and Management of Pediatric Asthma. Review of Ain Shams Pediatric Hospital Chest Clinic Data. Cairo, Egypt 1995-2004. INTRODUCTION. Bronchial asthma is a major worldwide health problem, which has received increased attention in.
Cherem, A.D.R.; Tramonte, V.L.C.G.; Fett, R.; Dokkum, W. van
2007-01-01
We investigated the effect of the eggplant core on the plasma concentrations of triglycerides, total- LDL- and HDL-cholesterol, in male guinea pigs, randomly assigned into five groups: 1 (N) - normolipidic diet AIN-93G, 2 (NB) - normolipidic diet, supplemented with eggplant core, halfway of the
Eelarveheitlus sai eile riigikogus vihase avastardi / Kai Kalamees
Kalamees, Kai
2004-01-01
Ilmunud ka: Infopress, 1. okt. 2004, nr. 40, lk. 24. Peaminister Juhan Partsi kõnest Riigikogus 2005. aasta riigieelarve eelnõu üle andes. Riigikogu liikmete hinnanguid eelarve kohta. Diagrammid: Eelarve jõudis riigikokku. Lisa: Riigi tulud tuleval aastal. Kommenteerivad Eiki Nestor, Ain Seppik, Mart Laar
Ainenõukogu tähelepanekuid / Ene Laanes
Laanes, Ene
2003-01-01
Üleriigiline kehalise kasvatuse ainenõukogu peab vajalikuks juhtida haridusametnike, koolijuhtide ja kooli omanike tähelepanu kehalise kasvatuse ainekava läbiviimisel üles kerkinud probleemidele: meditsiinilisse erigruppi kuuluvate õpilaste hindamine kehalise kasvatuse aines, kehalise kasvatuse tunniks vajalikud harjutuspaigad ja vahendid, nädalatundide arv
Remont käib võidu etendustega / Raimu Hanson
Hanson, Raimu, 1957-
2007-01-01
Tartus Küütri tn. 1 asuva hoone ajaloost, sinna rajatavast Athena kultuuri- ja konverentsikeskusest ning Volga restoranist. Kinosaali kipsreljeefide autor on Ferdi Sannamees, restorani ajaloolise vitraažlae autor on Nikolai Willer. Kommenteerivad Margus Kasterpalu, Mart Kivastik, Anne Erm, Ain Mäeots ja projektijuht Maia Kurm
Nanoscale Engineering of Multiferroic Hybrid Composites for Micro- and Nano-scale Devices
2012-09-14
presented in Fig.1. In the case of laminate structures we proposed to use AIN as a piezoelectric phase [publication 4]. Although commonly used Pb...16-19, 2009, Zhengzhou, China. 30)L. Malkinski, "Magnetic heterostructures with convoluted architectures" (invited) 7th Workshop on Multifunction
Melanoides tuberculata as intermediate host of Centrocestus ...
African Journals Online (AJOL)
SAM
2014-07-02
Jul 2, 2014 ... Melanoides tuberculata that naturally harbored trematode larvae were collected at the irrigation system in Ain Soltan's oasis (southwest of Tunisia), during malacological surveys conducted from January to. December 2013. From 2160 specimens of M. tuberculata collected, 31 (1.4%) were infected by the.
Directory of Open Access Journals (Sweden)
Tawfik HA
2015-08-01
Full Text Available Hatem A Tawfik,1 Yousef A Fouad,2 Rashad Hafez3 1Department of Ophthalmology, Oculoplastics Service, Ain Shams University, 2Faculty of Medicine, Ain Shams University, 3Eye Subspecialty Centre, Cairo, Egypt Objective: To introduce and evaluate the safety of a novel dual-sided electrosurgery handpiece design for simultaneous tissue cutting and coagulation. Methods: We designed a prototype double-sided handpiece allowing automatic switching between two electrodes with a simple handpiece flip. The concept of the system as a surgical instrument was assessed by an animal experiment. Results: The skin of 15 Wistar albino white rats could be successfully incised and coagulated using both ends of the handpiece, thereby confirming the prospects and clinical applications of the system. Conclusion: The dual-sided electrosurgery handpiece is a simple and safe alternative to the traditional electrosurgery pencil, allowing the simultaneous use of two electrodes without the hassle of frequent electrode replacement. Keywords: radiosurgery, ablative surgery, laser resurfacing, electrocautery, electrosurgery
Ribbon-cutting ceremony for Building 774
Corinne Pralavorio
2015-01-01
On Friday, 12 June, the brand-new Building 774 on the Prévessin site was officially opened by Rolf Heuer, Director-General of CERN, and Stéphane Donnot, sous-préfet of Gex, together with Serge Moulon, deputy mayor of Saint-Genis-Pouilly, and Aurélie Charillon, mayor of Prévessin-Moëns and a member of the Conseil départemental de l’Ain. Left to right: Serge Moulon, deputy mayor of Saint-Genis-Pouilly, Stéphane Donnot, sous-préfet of Gex, Rolf Heuer, Director-General of CERN, and Aurélie Charillon, mayor of Prévessin-Moëns and a member of the Conseil départemental de l’Ain. “Thanks to its innovative architecture, this iconic building is the jewel in the crown of the French site,” said Heuer. Prior to the ceremony, the Director-General had met the politicians to discuss relations between CERN a...
Toxicity of so-called edible hijiki seaweed (Sargassum fusiforme) containing inorganic arsenic.
Yokoi, Katsuhiko; Konomi, Aki
2012-07-01
The UK Food Standards Agency and its counterparts in other countries have warned consumers not to eat hijiki (Sargassum fusiforme; synonym Hizikia fusiformis), a Sargasso seaweed, because it contains large amounts of inorganic arsenic. We investigated dietary exposure of hijiki in weaning male F344/N rats fed an AIN-93G diet supplemented with 3% (w/w) hijiki powder for 7 weeks, compared with those fed only an AIN-93G diet. Body weight, body temperature, blood and tissue arsenic concentrations, plasma biochemistry and hematological parameters were measured. We found that feeding rats a 3% hijiki diet led to a marked accumulation of arsenic in blood and tissues, and evoked a high body temperature and abnormal blood biochemistry including elevated plasma alkaline phosphatase activity and inorganic phosphorus, consistent with arsenic poisoning. These findings should prompt further investigations to identify the health hazards related to consumption of hijiki and related Sargassum species in humans. Copyright © 2012 Elsevier Inc. All rights reserved.
Thermal conductivities of thin, sputtered optical films
International Nuclear Information System (INIS)
Henager, C.H. Jr.; Pawlewicz, W.T.
1991-05-01
The normal component of the thin film thermal conductivity has been measured for the first time for several advanced sputtered optical materials. Included are data for single layers of boron nitride (BN), aluminum nitride (AIN), silicon aluminum nitride (Si-Al-N), silicon aluminum oxynitride (Si-Al-O-N), silicon carbide (SiC), and for dielectric-enhanced metal reflectors of the form Al(SiO 2 /Si 3 N 4 ) n and Al(Al 2 O 3 /AIN) n . Sputtered films of more conventional materials like SiO 2 , Al 2 O 3 , Ta 2 O 5 , Ti, and Si have also been measured. The data show that thin film thermal conductivities are typically 10 to 100 times lower than conductivities for the same materials in bulk form. Structural disorder in the amorphous or very fine-grained films appears to account for most of the conductivity difference. Conclusive evidence for a film/substrate interface contribution is presented
Technical Work Plan for: Fracture and Lithophysal Studies
International Nuclear Information System (INIS)
2006-01-01
The primary objective of the work scope described in this technical work plan (TWP) is to enhance the descriptions of fracture and lithophysal parameters for the repository host horizon (RHH) over the repository footprint utilizing a predictive model. This work is planned to address U.S. Nuclear Regulatory Commission (NRC) additional information needs (AINs) associated with the Structural Deformation and Seismicity (SDS) Key Technical Issues (KTI) agreement SDS 3.03 (Schlueter 2000 [DIRS 166615]). The results of the planned work are expected to enhance the technical basis and confirm the results of the fracture analyses presented in ''Drift Degradation Analysis'' (BSC 2004 [DIRS 166107], Section 6.1.6). This model is not intended to provide an alternative for the unsaturated zone and saturated zone flow and transport models currently used by the Yucca Mountain Project (YMP). Nor are the outputs of this model intended to address the SDS 3.03 AINs related to the unsaturated zone and saturated zone flow and transport models
Firms not established in France bringing in personnel to work on the French part of the site
Relations with the Host States Service
2005-01-01
In compliance with French legislation, firms not established in France must declare the employees they assign to work on French territory to the competent Labour Inspectorate office. At the request of the French authorities, CERN issues access cards to the employees concerned by the legislation exclusively on presentation of an acknowledgement of receipt relating to the declaration of their secondment. The Labour Inspectorate faxes, or failing that posts, this document bearing the seal of the Direction départementale du Travail, de l'Emploi et de la Formation professionnelle de l'Ain (Departmental Directorate of Labour, Employment and Occupational Training of the Ain) to the firm concerned. The model secondment declaration form and acknowledgement of receipt may be downloaded from the Web site of the Relations with the Host States Service (http://www.cern.ch/relations/). We would like to take the opportunity to remind you of the following: The letter of 31 July 2002, by which the French Labour Inspector...
Technical Work Plan for: Fracture and Lithophysal Studies
Energy Technology Data Exchange (ETDEWEB)
n
2006-09-11
The primary objective of the work scope described in this technical work plan (TWP) is to enhance the descriptions of fracture and lithophysal parameters for the repository host horizon (RHH) over the repository footprint utilizing a predictive model. This work is planned to address U.S. Nuclear Regulatory Commission (NRC) additional information needs (AINs) associated with the Structural Deformation and Seismicity (SDS) Key Technical Issues (KTI) agreement SDS 3.03 (Schlueter 2000 [DIRS 166615]). The results of the planned work are expected to enhance the technical basis and confirm the results of the fracture analyses presented in ''Drift Degradation Analysis'' (BSC 2004 [DIRS 166107], Section 6.1.6). This model is not intended to provide an alternative for the unsaturated zone and saturated zone flow and transport models currently used by the Yucca Mountain Project (YMP). Nor are the outputs of this model intended to address the SDS 3.03 AINs related to the unsaturated zone and saturated zone flow and transport models.
Kaiser, Natalie; Croell, Arne; Szofran, F. R.; Cobb. S. D.; Dold, P.; Benz, K. W.
1999-01-01
During Bridgman growth of semiconductors detachment of the crystal and the melt meniscus has occasionally been observed, mainly under microgravity (microg) conditions. An important factor for detached growth is the wetting angle of the melt with the crucible material. High contact angles are more likely to result in detachment of the growing crystal from the ampoule wall. In order to achieve detached growth of germanium (Ge) and germanium-silicon (GeSi) crystals under 1g and microg conditions, sessile drop measurements were performed to determine the most suitable ampoule material as well as temperature dependence of the surface tension for GeSi. Sapphire, fused quartz, glassy carbon, graphite, SiC, pyrolytic Boron Nitride (pBN), AIN, and diamond were used as substrates. Furthermore, different cleaning procedures and surface treatments (etching, sandblasting, etc.) of the same substrate material and their effect on the wetting behavior were studied during these experiments. pBN and AIN substrates exhibited the highest contact angles with values around 170 deg.
African Journals Online (AJOL)
2012-12-04
Dec 4, 2012 ... postgraduate students) and junior staff. ... Radiation Oncology Department, Ain Shams University Hospital, .... and one providing summary answers to the questions, between 4 - 10 .... no travel or hotel costs. ... more modules or a book with lots of tables and lists (as one ... its determinants in clinical practice.
Grunge kodukujunduses / Ene Vool
Vool, Ene, 1948-
2004-01-01
Low-tech, campi ja grunge ehitus- ja sisustusstiilidest meil ja mujal - kommenteerivad Andro Kööp ja Ain Nurmela. Tutvustatakse ka Mari-Mira projekti Pariisis, mis kujutab endast nn. mutant-küla, putka- ja onnikultuuri koketeriid. Artikli lõpus kommenteerib kunstiteadlane Karin Paulus grungestiili muusikas, riietuses ja sisekujunduses.
Punane moon või kaine mõistus / Ene Läkk
Läkk, Ene, 1957-
2001-01-01
Nukuteatri uue hoone sisekujunduse võistluse I ja II koha töödest. I koha töö autorid Raivo Kotov ja Andrus Kõresaar, II koha töö autorid Ülar Mark, Liina Link, stilist Ain Nurmela ja arvutigraafik Tanel Viks büroost Mark & Tamm Arhitektid
Arupärimine rahandusministrile eurokalkulaatoritest / Jürgen Ligi, Ene Ergma, Helle Kalda...[jt.
2011-01-01
Riigikogu liikmete Helle Kalda, Toomas Vareki, Aivar Riisalu, Lauri Laasi, Mailis Repsi, Enn Eesmaa, Kalle Laaneti, Eldar Efendijevi, Nelli Privalova, Vladimir Velmani, Olga Sõtniku, Kalev Kallo, Toivo Tootseni, Arvo Sarapuu, Nikolai Põdramägi Evelyn Sepa, Ain Seppiku ja Valeri Korbi poolt 17. novembril esitatud arupärimine
CERN PhotoLab
1965-01-01
An example of the integration of CERN staff in the neighbouring communes is provided by the hamlet of Bugnon at St-Genis-Pouilly (Ain), France. The CERN installation on the Swiss site are visible on the left in the background. Behind them the Saleve mountain in Haute-Savoie.
Unilateral proximal focal femoral deficiency, fibular aplasia, tibial ...
African Journals Online (AJOL)
Rabah M. Shawky
2014-04-30
Apr 30, 2014 ... Peer review under responsibility of Ain Shams University. ... The fibular field of the limb bud controls the development of ... The mental and physical developments are ... deficiency, short tibia and absent fibula of the right lower limb compared ... brother has tetrameric transverse defect and a cyanotic con-.
Clinical and molecular findings in eight Egyptian patients with ...
African Journals Online (AJOL)
Ghada M.M. Al-Ettribi
2012-10-05
Oct 5, 2012 ... 2012 Ain Shams University. Production and hosting by Elsevier B.V. All rights reserved. .... tions: EMG revealed myopathy in all cases; MRI brain showed ... gender. Age of onset. Clinical symptoms. Eye manifestation. Blood lactate .... ladder; its fragment lengths are demonstrated left to the figure (in green).
P38 MAPK / beta-catenin canonical wnt signaling mediated bone formation effects of blueberries
Appropriate nutrition is one of the critical factors that influences bone development. We studied the effects of dietary blueberry supplementation on bone growth in weanling rats. Weanling male and female rats were fed AIN-93G semi-purified diets supplemented with 10% whole blueberry powder for 14 a...
Journal of Chemical Sciences | Indian Academy of Sciences
Indian Academy of Sciences (India)
Author Affiliations. Mohamed Abass1 El-Hussain A Mohamed1 Aisha S Mayas2 Akram H Ibrahim3. Department of Chemistry, Faculty of Education, Ain Shams University, Roxy, Heliopolis 11757, Cairo, Egypt; Department of Chemistry, Faculty of Education, Sana'a University, Sana'a, Yemen; Curriculum Development Center ...
Egyptian Journal of Pediatric Allergy and Immunology (The) - Vol 6 ...
African Journals Online (AJOL)
Epidemiological Pattern and Management of Pediatric Asthma Review of Ain Shams Pediatric Hospital Chest Clinic Data Cairo, Egypt 1995-2004 · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. Magda Y El-Saify, Malak A Shaheen, Sahar M Sabbour, Ahmed A Basal ...
computer-aided root aided root aided root aided root-locus
African Journals Online (AJOL)
User
m, stability, transient response, root-locus, iteration he means by which any a machine, mechanism or d or altered in accordance. Introduction of feedback has the advantages of f system performance to in system parameters, ponse and minimizing the ignals. However, feedback of components, increases ain and introduces ...
4TH Marine Division Operation Plan Number 49-44
1944-12-26
Interpretation Squadron TWOC Pt GUAM for processing and inter- pretation. To assist in this work, one photographic interpreter each from Commander Amphibious...Annex "Ain to Division administrativo Order Nio, 43-44, (Reviej)) . (4) Repai~, section to provide 2d, 3d and 4th echelon mainteniaince for Engineer
Effects of feeding cranberry, blueberry, and black raspberry powder on selected parameters of metabolic syndrome were investigated in 40 growing male Sprague Dawley rats. Animals were divided into five dietary treatments of 1) control AIN93G diet, 2) high fructose (65% by weight, HF) diet, and 3-5) ...
Christ-Siemens-Touraine syndrome with cleft palate, absent nipples ...
African Journals Online (AJOL)
Rabah M. Shawky
2015-06-27
Jun 27, 2015 ... Pediatric Department, Genetics Unit, Ain Shams University, Egypt. Received 26 ... Our patient had also gallstones which were not reported previously and .... of bacterial cultures susceptible to dental caries as detected in our patient .... ment of dry eyes to surgical management with its complica- tions [22].
ETS-1 oncoprotein expression is decreased in aggressive papillary ...
African Journals Online (AJOL)
E.A. Ibrahim
2016-10-19
Oct 19, 2016 ... aggressive papillary transitional cell carcinoma of the urinary bladder: An immunohistochemical study. E.A. Ibrahim. ∗. , M.R. Hassan, S.A. Sammour. Pathology Department, Faculty of Medicine, Ain Shams University, Egypt. Received 23 August 2015; received in revised form 11 October 2015; accepted 12 ...
On Thursday 28 February, a ceremony was held to lay the foundation stone of Building 774
2013-01-01
in attendance were Stéphane Donnot, Sub-Prefect of the Ain, Octavio Mestre and Francesco Soppelsa, the building's architects, and Sigurd Lettow, Director of Administration and Infrastructure. The building will be located just opposite the CERN Control Centre (CCC); its construction is to be completed by early 2014.
Ghosh, Shampa; Sinha, Jitendra Kumar; Putcha, Uday Kumar; Raghunath, Manchala
2016-01-01
Vitamin B12 deficiency is widely prevalent in women of childbearing age, especially in developing countries. In the present study, through dietary restriction, we have established mouse models of severe and moderate vitamin B12 deficiencies to elucidate the impact on body composition, biochemical parameters, and reproductive performance. Female weanling C57BL/6 mice were fed for 4 weeks: (a) control AIN-76A diet, (b) vitamin B12-restricted AIN-76A diet with pectin as dietary fiber (severe deficiency group, as pectin inhibits vitamin B12 absorption), or (c) vitamin B12-restricted AIN-76A diet with cellulose as dietary fiber (moderate deficiency group as cellulose does not interfere with vitamin B12 absorption). After confirming deficiency, the mice were mated with male colony mice and maintained on their respective diets throughout pregnancy, lactation, and thereafter till 12 weeks. Severe vitamin B12 deficiency increased body fat% significantly, induced adiposity and altered lipid profile. Pregnant dams of both the deficient groups developed anemia. Severe vitamin B12 deficiency decreased the percentage of conception and litter size, pups were small-for-gestational-age and had significantly lower body weight at birth as well as weaning. Most of the offspring born to severely deficient dams died within 24 h of birth. Stress markers and adipocytokines were elevated in severe deficiency with concomitant decrease in antioxidant defense. The results show that severe but not moderate vitamin B12 restriction had profound impact on the physiology of C57BL/6 mice. Oxidative and corticosteroid stress, inflammation and poor antioxidant defense seem to be the probable underlying mechanisms mediating the deleterious effects.
He, X Y; Huang, K L; Li, X; Qin, W; Delaney, B; Luo, Y B
2008-06-01
DAS-59122-7 (59122) is a transgenic maize (Zea mays L.) that contains genes encoding Cry34Ab1 and Cry35Ab1 proteins from Bacillus thuringiensis Berliner strain 149B1 and phosphinothricin acetyltransferase (PAT) protein from Streptomyces viridochromogenes. Expression of these proteins in planta confers resistance to corn rootworms and other Coleopteran parasites and tolerance to herbicides containing glufosinate ammonium, respectively. In the current study, processed flours from 59122 maize grain or its near isogenic control line (091) were used at two concentrations (50% and 70% wt/wt) to produce diets that were fed to rats for 90 days in accordance with Chinese toxicology guidelines (GB15193.13-2003). A commercial AIN93G diet was used as an additional negative control. No significant differences in body weight and feed utilization were observed between rats consuming diets formulated with 59122 and 091 Control corn. Statistical differences (p<0.05) were observed in certain hematology and serum chemistry response variables between rats consuming diets formulated with 59122 or 091 Control flour compared to AIN93G diet. However, the mean value of these response variables in the 59122 groups were not statistically different from those observed in diets formulated with corresponding high and low concentrations of the flour from the 091 Control maize grain. Therefore, the statistical differences were considered to be related to consumption of diets containing high concentrations of maize flour (compared to AIN93G diets) regardless of source rather than to consumption of flour from 59122 maize grain. The results from this study demonstrated that 59122 maize grain is as safe as non-transgenic maize grain.
Maioli, Tatiani Uceli; Gonçalves, Juliana Lauar; Miranda, Mariana Camila Gonçalves; Martins, Vinícius Dantas; Horta, Laila Sampaio; Moreira, Thais Garcias; Godard, Ana Lucia Brunialti; Santiago, Andrezza Fernanda; Faria, Ana Maria Caetano
2016-02-01
The purpose of the study was to develop a novel diet based on standard AIN93G diet that would be able to induce experimental obesity and impair immune regulation with high concentrations of both carbohydrate and lipids. To compare the effects of this high sugar and butter (HSB) diet with other modified diets, male C57BL/6 mice were fed either mouse chow, or AIN93G diet, or high sugar (HS) diet, or high-fat (HF) diet, or high sugar and butter (HSB) diet for 11 weeks ad libitum. HSB diet induced higher weight gain. Therefore, control AIN93G and HSB groups were chosen for additional analysis. Regulatory T cells were studied by flow cytometry, and cytokine levels were measured by ELISA. Although HF and HSB diets were able to induce a higher weight gain compatible with obesity in treated mice, HSB-fed mice presented the higher levels of serum glucose after fasting and the lowest frequency of regulatory T cells in adipose tissue. In addition, mice that were fed HSB diet presented higher levels of cholesterol and triglycerides, hyperleptinemia, increased resistin and leptin levels as well as reduced adiponectin serum levels. Importantly, we found increased frequency of CD4(+)CD44(+) effector T cells, reduction of CD4(+)CD25(+)Foxp3(+) and Th3 regulatory T cells as well as decreased levels of IL-10 and TGF-β in adipose tissue of HSB-fed mice. Therefore, HSB represents a novel model of obesity-inducing diet that was efficient in triggering alterations compatible with metabolic syndrome as well as impairment in immune regulatory parameters.
Directory of Open Access Journals (Sweden)
Peng Lu
Full Text Available BACKGROUND: Palmitic-acid esterified to the sn-1,3 positions of the glycerol backbone (alpha, alpha'-palmitate, the predominant palmitate conformation in regular infant formula fat, is poorly absorbed and might cause abdominal discomfort. In contrast, palmitic-acid esterified to the sn-2 position (beta-palmitate, the main palmitate conformation in human milk fat, is well absorbed. The aim of the present study was to examine the influence of high alpha, alpha'-palmitate fat (HAPF diet and high beta-palmitate fat (HBPF diet on colitis development in Muc2 deficient (Muc2(-/- mice, a well-described animal model for spontaneous enterocolitis due to the lack of a protective mucus layer. METHODS: Muc2(-/- mice received AIN-93G reference diet, HAPF diet or HBPF diet for 5 weeks after weaning. Clinical symptoms, intestinal morphology and inflammation in the distal colon were analyzed. RESULTS: Both HBPF diet and AIN-93G diet limited the extent of intestinal erosions and morphological damage in Muc2(-/- mice compared with HAPF diet. In addition, the immunosuppressive regulatory T (Treg cell response as demonstrated by the up-regulation of Foxp3, Tgfb1 and Ebi3 gene expression levels was enhanced by HBPF diet compared with AIN-93G and HAPF diets. HBPF diet also increased the gene expression of Pparg and enzymatic antioxidants (Sod1, Sod3 and Gpx1, genes all reported to be involved in promoting an immunosuppressive Treg cell response and to protect against colitis. CONCLUSIONS: This study shows for the first time that HBPF diet limits the intestinal mucosal damage and controls the inflammatory response in Muc2(-/- mice by inducing an immunosuppressive Treg cell response.
Lu, Peng; Bar-Yoseph, Fabiana; Levi, Liora; Lifshitz, Yael; Witte-Bouma, Janneke; de Bruijn, Adrianus C J M; Korteland-van Male, Anita M; van Goudoever, Johannes B; Renes, Ingrid B
2013-01-01
Palmitic-acid esterified to the sn-1,3 positions of the glycerol backbone (alpha, alpha'-palmitate), the predominant palmitate conformation in regular infant formula fat, is poorly absorbed and might cause abdominal discomfort. In contrast, palmitic-acid esterified to the sn-2 position (beta-palmitate), the main palmitate conformation in human milk fat, is well absorbed. The aim of the present study was to examine the influence of high alpha, alpha'-palmitate fat (HAPF) diet and high beta-palmitate fat (HBPF) diet on colitis development in Muc2 deficient (Muc2(-/-)) mice, a well-described animal model for spontaneous enterocolitis due to the lack of a protective mucus layer. Muc2(-/-) mice received AIN-93G reference diet, HAPF diet or HBPF diet for 5 weeks after weaning. Clinical symptoms, intestinal morphology and inflammation in the distal colon were analyzed. Both HBPF diet and AIN-93G diet limited the extent of intestinal erosions and morphological damage in Muc2(-/-) mice compared with HAPF diet. In addition, the immunosuppressive regulatory T (Treg) cell response as demonstrated by the up-regulation of Foxp3, Tgfb1 and Ebi3 gene expression levels was enhanced by HBPF diet compared with AIN-93G and HAPF diets. HBPF diet also increased the gene expression of Pparg and enzymatic antioxidants (Sod1, Sod3 and Gpx1), genes all reported to be involved in promoting an immunosuppressive Treg cell response and to protect against colitis. This study shows for the first time that HBPF diet limits the intestinal mucosal damage and controls the inflammatory response in Muc2(-/-) mice by inducing an immunosuppressive Treg cell response.
Directory of Open Access Journals (Sweden)
Shampa eGhosh
2016-01-01
Full Text Available Vitamin B12 deficiency is widely prevalent in women of childbearing age especially in developing countries. In the present study, through dietary restriction, we have established mouse models of severe and moderate vitamin B12 deficiencies to elucidate the impact on body composition, biochemical parameters and reproductive performance. Female weanling C57BL/6 mice were fed for four weeks, (a control AIN-76A diet, (b vitamin B12 restricted AIN-76A diet with pectin as dietary fiber (severe deficiency group, as pectin inhibits vitamin B12 absorption or (c vitamin B12 restricted AIN-76A diet with cellulose as dietary fiber (moderate deficiency group as cellulose does not interfere with vitamin B12 absorption. After confirming deficiency, the mice were mated with male colony mice and maintained on their respective diets throughout pregnancy, lactation and thereafter till 12 weeks. Severe vitamin B12 deficiency increased body fat % significantly, induced adiposity and altered lipid profile. Pregnant dams of both the deficient groups developed anemia. Severe vitamin B12 deficiency decreased the percentage of conception and litter size, pups were small-for-gestational-age and had significantly lower body weight at birth as well as weaning. Most of the offspring born to severely deficient dams died within 24 hours of birth. Stress markers and adipocytokines were elevated in severe deficiency with concomitant decrease in antioxidant defense. The results show that severe but not moderate vitamin B12 restriction had profound impact on the physiology of C57BL/6 mice. Oxidative and corticosteroid stress, inflammation and poor antioxidant defense seem to be the probable underlying mechanisms mediating the deleterious effects.
Contractions without non-trivial invariant subspaces satisfying a positivity condition
Directory of Open Access Journals (Sweden)
Bhaggy Duggal
2016-04-01
Full Text Available Abstract An operator A ∈ B ( H $A\\in B(\\mathcal{H}$ , the algebra of bounded linear transformations on a complex infinite dimensional Hilbert space H $\\mathcal{H}$ , belongs to class A ( n $\\mathcal{A}(n$ (resp., A ( ∗ − n $\\mathcal{A}(*-n$ if | A | 2 ≤ | A n + 1 | 2 n + 1 $\\vert A\\vert^{2}\\leq\\vert A^{n+1}\\vert^{\\frac{2}{n+1}}$ (resp., | A ∗ | 2 ≤ | A n + 1 | 2 n + 1 $\\vert A^{*}\\vert^{2}\\leq \\vert A^{n+1}\\vert^{\\frac{2}{n+1}}$ for some integer n ≥ 1 $n\\geq1$ , and an operator A ∈ B ( H $A\\in B(\\mathcal{H}$ is called n-paranormal, denoted A ∈ P ( n $A\\in \\mathcal{P}(n$ (resp., ∗ − n $*-n$ -paranormal, denoted A ∈ P ( ∗ − n $A\\in \\mathcal{P}(*-n$ if ∥ A x ∥ n + 1 ≤ ∥ A n + 1 x ∥ ∥ x ∥ n $\\Vert Ax\\Vert ^{n+1}\\leq \\Vert A^{n+1}x\\Vert \\Vert x\\Vert ^{n}$ (resp., ∥ A ∗ x ∥ n + 1 ≤ ∥ A n + 1 x ∥ ∥ x ∥ n $\\Vert A^{*}x\\Vert ^{n+1}\\leq \\Vert A^{n+1}x\\Vert \\Vert x\\Vert ^{n}$ for some integer n ≥ 1 $n\\geq 1$ and all x ∈ H $x \\in\\mathcal{H}$ . In this paper, we prove that if A ∈ { A ( n ∪ P ( n } $A\\in\\{\\mathcal{A}(n\\cup \\mathcal{P}(n\\}$ (resp., A ∈ { A ( ∗ − n ∪ P ( ∗ − n } $A\\in\\{\\mathcal{A}(*-n\\cup \\mathcal{P}(*-n\\}$ is a contraction without a non-trivial invariant subspace, then A, | A n + 1 | 2 n + 1 − | A | 2 $\\vert A^{n+1}\\vert^{\\frac{2}{n+1}}-\\vert A\\vert^{2}$ and | A n + 1 | 2 − n + 1 n | A | 2 + 1 $\\vert A^{n+1}\\vert^{2}- {\\frac{n+1}{n}}\\vert A\\vert^{2}+ 1$ (resp., A, | A n + 1 | 2 n + 1 − | A ∗ | 2 $\\vert A^{n+1}\\vert^{\\frac{2}{n+1}}-\\vert A^{*}\\vert^{2}$ and | A n + 2 | 2 − n + 1 n | A | 2 + 1 ≥ 0 $\\vert A^{n+2}\\vert^{2}- {\\frac{n+1}{n}}\\vert A\\vert^{2}+ 1\\geq0$ are proper contractions.
Journal of Genetics | Indian Academy of Sciences
Indian Academy of Sciences (India)
Articles written in Journal of Genetics. Volume 92 Issue 1 April 2013 pp 81-83 Research Note. New frameshift CF mutation 3729delAinsTCT in a Tunisian cystic fibrosis patient · Sondess Hadj Fredj Monia Boudaya Sabrine Oueslati Safa Sahnoun Chaima Sahli Hajer Siala Khedija Boussetta Amina Bibi Taieb Messaoud.
Finding Innovation and Imagination in a Bag of Loose Parts
Dillon, Anna
2018-01-01
The third annual research symposium at Zakher KG School in Al Ain, United Arab Emirates (UAE), presented an exciting opportunity for the 33 teachers in the school to present their findings from classroom-based action research conducted within their professional learning communities. In this brief article, one attendee describes an unexpected…
Isehakanud klassikute näitus / Margus Kiis
Kiis, Margus
2003-01-01
Fotonäitusest XXL, mis hõlmab peamiselt 1990-2000 a. fotosid, Tartu Kunstnike Majas. Näituse koostajad Peeter Linnap ja Vello Kalamets. Kirjeldatud DeStudio, Peeter Lauritsa, Toomas Kalve, Tarvo Hanno Varrese, Peeter Linnapi, Meelis Lukki, Ain Protsini, Tõnu Tamme, Malev Toomi, Vello Kalametsa ja Madis Palmi töid
24 April 1971 BOOK REVIEWS BOEKBESPREKINGS
African Journals Online (AJOL)
1971-04-24
Apr 24, 1971 ... and methods of treatment including exchange transfusIOns ~md dialysis. The last chapter deals with public ... have shown how actual cases were treated so that the reader could e:ain confidence by seeing how ... sponse to carcinogens, the biological and biophysical aspects of ageing and the inflammatory ...
Quixotic coupling between irrigation system and maize-cowpea ...
African Journals Online (AJOL)
A study was conducted at the Research and Experimental Station, Faculty of Agriculture, Ain Shams University at Shalakan, Kalubia Governorate, Egypt, to evaluate the effect of two irrigation systems (trickle and modified furrow irrigation) and five maize (M)-cowpea (C) intercropping patterns (sole M-30, sole M-15, ridge ...
Khalil, Amjad
2015-06-04
Anoxybacillus flavithermus strain AK1 was isolated from Al-Ain Alhara, a thermal hot spring located 50 km southeast of the city of Gazan, Saudi Arabia (16°56ʹN, 43°15ʹE). The sequenced and annotated genome is 2,630,664 bp and encodes 2,799 genes.
Hispaania romanss / Klaarika Kaldjärv
Kaldjärv, Klaarika
2008-01-01
Ain Kaalepi tõlketeoreetilistest seisukohtadest. Tema Federico GarcÍa Lorca luule tõlgete analüüs (kogud "Kaneelist torn" ja "Mu kätes on tuli") ning F. GarcÍa Lorca luuletuse "Romance son{u00E1mbulo" tõlke analüüs. Bibl. lk. 74
Khalil, Amjad; Neelamegam, Sivakumar; Alqarawi, Sami
2015-01-01
Anoxybacillus flavithermus strain AK1 was isolated from Al-Ain Alhara, a thermal hot spring located 50 km southeast of the city of Gazan, Saudi Arabia (16°56ʹN, 43°15ʹE). The sequenced and annotated genome is 2,630,664 bp and encodes 2,799 genes.
Surve haridusminister Mailis Repsi ametist tagandamiseks kasvab / Kai Kalamees
Kalamees, Kai
2005-01-01
Endine siseminister Ain Seppik nõudis kapolt, et see uuriks haridus- ja teadusminister Mailis Repsi sõnavõtte Marimaal puudutava välisministeeriumi memo jõudmist ajakirjandusse. Opositsioon nõuab ministri tagasiastumist, Toomas Hendrik Ilvese sõnul ei tohi ükski minister lubada endale välismaal oma riigi kritiseerimist
DEFF Research Database (Denmark)
2014-01-01
) with respect to the average surface positions. The position, size, and randomness of the protrusions are arranged so as to provide, at least up to a maximum angle of incidence (A_in) with respect to a normal to the surface, an angle-independent substantially homogeneous structural color perception for a normal...
Therapeutic effects of Laser and L-carnitine against amiodarone ...
African Journals Online (AJOL)
Pulmonary toxicity is considered a life- threatening complication of ... Research Center, Faculty of Medicine, Ain .... Laser therapy restores the balance between oxidants and ... No conflict of interest associated with this work. Contribution of .... Fitness. 2014; 149-159. 21. Lee BJ, Lin JS, Lin YC, Lin PT. Effects of L-carnitine.
Pealinna nullpunktiks pürgivad tornid / Urmas Oja
Oja, Urmas, 1981-2012
2006-01-01
Triumph Plaza Tallinnas Narva mnt. 7 (1978. a. valminud Olga Brunsi ja Mart Kallingu projekteeritud kontorihoone rekonstruktsioon). Arhitektid Vilen Künnapu, Ain Padrik ja Kristi Alamaa, AB Künnapu & Padrik. Ehituse peatöövõtja: AS KMG Ehitus. Tööde lõpp: juuli 2006. 6 värv. ill
V nulevoi totshke stolitsõ ustreemljajutsja vvõs bashni / Urmas Oja
Oja, Urmas, 1981-2012
2006-01-01
Triumph Plaza Tallinnas Narva mnt. 7 (1978. a. valminud Olga Brunsi ja Mart Kallingu projekteeritud kontorihoone rekonstruktsioon). Arhitektid Vilen Künnapu, Ain Padrik ja Kristi Alamaa, AB Künnapu & Padrik. Ehituse peatöövõtja: AS KMG Ehitus. Tööde lõpp: juuli 2006. 3 värv. ill
Tartu Ülikool 375 / interv. Rein Raudvere
2007-01-01
Küsitlus: Mida on teile andnud Tartu Ülikool? Millest oleksite jäänud ilma, kui poleks olnud õnne õppida Tartu Ülikoolis? Vastavad: Tõnis Lukas, Hannes Kaljujärv, Aili Paju, Ain Kallis, Aarne Liiv ja Hans Trass. Vt. samas: EV ministrid TÜ vilistlased; Riigikogu liikmed TÜ vilistlased
foot orthosis in improving the balance in children with spastic
African Journals Online (AJOL)
Khaled A. Olama
2012-11-02
Nov 2, 2012 ... The present study aims to evaluate the effect of the three side ... enabled them to gain more balance control and postural reactions . © 2012 Ain Shams ..... sis on balance board to stimulate the child postural .... plantar-flexion improved gait efficiency by improving stability .... Older adults often adopt a.
Risk factors for autism: An Egyptian study | El-Baz | Egyptian Journal ...
African Journals Online (AJOL)
This study has been conducted to determine the possible risk factors of autism. This case control study was conducted at pediatric hospital, Ain Shams University on, 100 autistic patients who were subjected to the followings tools: Confirmation of diagnosis using DSM-IV-TR criteria, IQ assessment using Stanford–Binrent ...
South of Sahara | Page 154 | IDRC - International Development ...
International Development Research Centre (IDRC) Digital Library (Canada)
Bedouin women weave handmade baskets, hats, and lamps using dried palm leaves. The potential uses of palm trees are endless. IDRC grantee and engineering professor at Ain Shams University, Hamed El-Mously, has taken it to another level, turning palm tree leaves into hardwood and high-quality wooden products, ...
Microstructures of group III-nitrides after implantation with gallium
International Nuclear Information System (INIS)
Kench, P.J.
2001-05-01
High doses of gallium have been implanted into layers of aluminium nitride (AIN), indium nitride (InN) and amorphous silicon nitride (a-SiN x ) in an attempt to bond gallium with nitrogen and form binary or ternary alloys. The microstructure of the resultant layers have been characterised using, principally, transmission electron microscopy and X-ray photoelectron spectroscopy. The implantation of a high dose of Ga ions into AIN was successful in synthesising a GaN/GaAlN compound. The resultant layers were largely uniform but contained aluminium precipitates near the surface. These precipitates were pure Al and were most common in the region associated with the maximum Ga concentration. Deconvolution of X-ray photoelectron spectroscopy peaks indicated that Ga existed in a number of chemical states, including the nitride. Electron diffraction patterns from the implanted layers were closely indexed to both AIN and GaN. A further N implant was used to reduce the concentration of the aluminium precipitates and increase the concentration of GaN bonds. The yield of Ga-N bonds dramatically increased and a reduction in the concentration of Al precipitates was observed. Laser and thermal annealing was performed on the implanted AIN substrates. The near surface regions of the implanted specimens appeared to free of precipitates and bubbles. Laser annealing did have a noticeable effect on the electrical and optical properties of the layers. After laser annealing the conductivity of the Ga implanted layer was lower, indicating that the quality of the material had improved. PL measurements showed that a new PL peak at 2.6 eV appeared after laser annealing. It has been found that implanting InN with gallium can yield Ga-N bonds. However, Ga implants into InN were not as successful at synthesising GaN compounds as those by implanting Ga into AIN, due to the low thermal stability of InN. The implanted InN layers were very irregular and contained large indium precipitates and
African Journals Online (AJOL)
2017-09-01
Sep 1, 2017 ... Prp.Totl (%). 54.59. 10.93. Cumul - %. 54.59. 65.52. The bold values indicate the correlated variables. 5. CONCLUSION. The aim of our study was to determine the influence of urban, agricultural and industrial discharges on Ain Zada's dam waters. The chemical composition of these waters was determined ...
Dzhässikavad toovad linna jõulurõõmu / Silja Joon
Joon, Silja, 1966-
2008-01-01
"Jazzkaare" kolm dzhässiõhtut Pärnus - 3. dets. Eliisabeti kirikus Raivo Tafenau, Ain Agan ja Laura Põldvere, 9. dets. Endla teatris Saksamaa vokaalansambel Berlin Voices (Esther Kaiser, Sarah Kaiser, Marc Secara, Kristofer Benn) ja 11. dets. Ammende villas norra laulja Gine Andressen. Berlin Voices soojendusansamblina esineb Pärnu noorte vokaalansambel Greip
Analytical electron microscopy investigation of the AlN-ZrO2 system
International Nuclear Information System (INIS)
Stoto, T.; Doukhan, J.C.; Mocellin, A.
1989-01-01
A combination of electron microscopy, diffraction, and spectroscopic techniques were used to identify and characterize the quaternary Zr-Al-O-N phase, which forms during reaction sintering of AIN + ZrO 2 mixtures. In this paper it is proposed that this phase has a space group Fd 3 m; several compositions are suggested
Modulation of dopaminergic neurotransmission by morphine in the rat
P. Moleman (Peter)
1977-01-01
textabstractThe pleasant effects of opium were already known 6000 years ago and opium has been used for medical purposes for at least 3500 years. Opium, and its r.1ain constituent morphine, evoke a feeling of well-being and always relieve pain of any origin, in other words, a perfect analgesic and
Tigutorn = The Snail Tower / Margit Mutso
Mutso, Margit, 1966-
2010-01-01
Tartus Väike-Turu 5 asuva Tigutorni arhitektuursest lahendusest. Maja alumisel korrusel on äriruumid, ülemistel korrustel korterid. Arhitektid Vilen Künnapu, Ain Padrik, kaasautorid Kristiina Hussar, Kerli Koolma (AB Künnapu & Padrik). Üldruumide kujundus: Heli Eensalu, Sulev Vahtra. Žürii liikme Kalle Komissarovi hinnang kultuurkapitali aastapreemiale esitatud hoonele
Mööblifirmade trump a la carte-teenuses / Heli Lehtsaar
Lehtsaar, Heli, 1976-
2008-01-01
Mööblitootjad on muutuvas majandusolukorras hakanud seeriatootmise asemel pöörama rohkem tähelepanu eritellimustele. Vt. samas: Aktiivne müük ja likviidne käibevara aitavad madalseisu ajal elus püsida. Ain Alvela. Edule pürgiv mööblitootja peab moevooludega kaasa sörkima
Journal of Earth System Science | Indian Academy of Sciences
Indian Academy of Sciences (India)
The deficit of Ras El Ain spring discharge due to overexploitation factors and drought effects was estimated. Cumulative drought analyses were carried out using SPI10 and SQI10. Finally, the decreasing trends of the spring discharge due to the deficiency in rainfall were analyzed. The main results reveal that the annual ...
Solving unit commitment and economic load dispatch problems ...
African Journals Online (AJOL)
2 Department of Electrical Power and Machines, Faculty of engineering, Ain shams ... intricate basic leadership process and it is hard to build up any thorough ... These pre-committed schedules are optimized by BAT algorithm thus .... and the current best location (solution) is x0 which is situated in the wake of looking at.
Ekspert : klaas Vabadussamba valmistamiseks eriti hästi ei kõlba / Mari Kodres
Kodres, Mari
2008-01-01
Tallinnasse Harjumäele ja Islandi väljakule kavandatavate mälestusmärkide klaaslahendusest. Islandi väljakule on kavas avada vastupanu mälestusmärk "Murtud müür", autorid Kuulo Vahter, Ivo Lill ja Ain Rööpson. Kommenteerivad Meeli Kõiva ja klaasiinsener Aulis Bertin Soomest
Wnt/RANKL-mediated bone growth promoting effects of blueberries in weanling rats
We studied the effects of dietary blueberry supplementation on bone growth in weanling rats. Weanling male and female rats were fed AIN-93G semi-purified diets supplemented with 10% whole blueberry powder for 14 and 30 days beginning on PND 21. In both sexes tibial bone mineral density and content a...
BIG tahab pangaks saada / Annika Matson
Matson, Annika, 1976-
2004-01-01
Ilmunud ka: Delovõje Vedomosti : Finansõ 19. jaan. 2005 lk. 2. Kiirlaenukontorina tegutsev Balti Investeringute Grupp tahab saada pangaks. Kommenteerivad Ain Hanschmidt, Loit Linnupõld, Indrek Neivelt ja Alvar Jõgeva. Vt. samas: Krista Taim. Väikeinvestor kiidab BIG-i soodsat protsenti; Kiirelt saadud laen tänini kukil ja suhted sugulastega sassis
Eesti - Soome turismikaubamaja -5%
2006-01-01
Turismikonverentsil "Eesti - Soome turismikaubamaja -5%" analüüsiti Eesti ja Soome vahelisi turismivõimalusi ning seati sihte edaspidiseks. Ülevaade Reilika Lelovi (Turismimaailm OÜ), Pauli Santala (Finnish Consulting Group), Tarja Vaakanaineni (Tallink Finland Vice Managing), Ain Hinsbergi (Turismimaailm OÜ), Jari Auraneni (Go Finland Oy) ja Mikko Saviko (The Baltic Guide) ettekannetest
The antiproliferative effect of mulberry (Morus alba L.) plant on ...
African Journals Online (AJOL)
Shadia A. Fathy
2013-08-12
Aug 12, 2013 ... cell line HepG2 ... a Faculty of Science, Ain Shams University, Egypt ... Mulberry leaf extracts were prepared using the solvents: water, 50% aqueous ... cused on the search for a potential source rich in biologically ... Materials and methods. 2.1. ... HPLC grade (means high quality) were obtained from Fisher.
2010-12-01
Sommaire ..... Psychologie des conflits violents au sein d’états en déroute: Analyse de publications scientifiques Donald M. Taylor; Michael J. A...in parenthesis at the end of the title) The Psychology of Violent Conflict in Failing States (U) Psychologie des conflits violents au sein d’états en
Analytical calculation of the transition to complete phase ...
Indian Academy of Sciences (India)
Ciências e Humanidades, Universidade de S˜ao Paulo, Av. Arlindo Bettio 1000,. 03828-000 S˜ao Paulo, Brazil. 4Department of Physics, Faculty of Science, Ain Shams University, 11566 Cairo, Egypt. 5Department of Physics, Faculty of Education, University of Riyadh for Women,. P.O. Box 21034, 11942 Alkharj, Kingdom of ...
Non-traumatic perforation of the small bowel | Eid | African Health ...
African Journals Online (AJOL)
... medical records of four patients who have presented with non-traumatic perforation of the small bowel and were treated at Al-Ain Hospital during the last 5 years were studied retrospectively. Results: The presenting symptoms of all patients were similar. Erect chest X-ray has shown free air under diaphragm in 3 patients.
Sotsioloogid räägivad TLÜ suvekoolis hirmust / Kaarel Kressa
Kressa, Kaarel, 1983-
2011-01-01
11. juulil alustab esimesi kursusi Tallinna ülikooli rahvusvaheline suveülikool Tallinn Summer School. Suvekooli peakursus on "Fear: Poetics and Practices", toimub ka sotsiaalturunduse, kommunikatsiooni ning ksenofoobia seoseid analüüsiv kursus. 22.-29 juulil õpetab suveülikoolis loovkirjutamist Kanada krimikirjanik Peter Robinson, kelle teoste aines kattub hirmukultuuri teemaga
Hayward, O. T.; And Others
This publication is one of a series of single-topic problem modules designed for use in undergraduate geology and earth science courses. The first section, "Ain't It Flat? A Series of Experiments in Geodesy," presents various experiments for determining the earth's circumference (historically) and describes the use of satellites in determining the…
2009-01-01
Saksamaa ja Austria ooperiteatrites töötavad muusikud: Bremer Theater'is dirigent Tarmo Vaask, Flensburg Musiktheater der Schleswig-Holsteinishen Landestheater'is dirigent Mihkel Kütson ja laulja Mati Turi, Hamburgische Staatsoper'is laulja Lauri Vasar, Theater Magdeburg'is dirigent Anu Tali, Wiener Staatsoperis laulja Ain Anger, Volksoper Wien'is laulja Annely Peebo
Gadmer, Jean-Claude Robert
2015-01-01
Monsieur Damien Abad, Président du Conseil départemental de l'Ain participe à une réunion du Comité InnoGex avec le Directeur général du CERN R. Heuer et le Directeur des Accélérateur et de la Technologie F. Bordry.
Highlights: Spring Council Meeting
Council members present at the May 24, 1981, meeting were Keiiti Aki, Steven Burges (for Jim Wallis), Peter S. Eagleson, E. R. Engdahl, Charles E. Helsley, James R. Heirtzler, Carl Kisslinger, Leslie H. Meredith, Chris N. K. Mooers, Norman F. Ness, Marcia M. Neugebauer, James J. O'Brien, Richard Rapp, Carl Sagan, James C. Savage, Joseph V. Smith, Fred Spilhaus, Donald L. Turcotte, James A. Van Allen, J. Tuzo Wilson, and Jay Winston (for Elmar R. Reiter until his arrival at 6:50 P.M.). David Strangway, representing the Canadian Geophysical Union, and Peter Steinhauser, representing the European Geophysical Society, were special observers at the meeting. Council meetings are open, and a number of section secretaries, committee chairmen, journal editors, and other members attended. The following major actions were adopted by the Council:The experiment of publishing oceanography and lower-atmosphere papers in JGR Green issues alternate to those containing upper-atmosphere papers will be continued through 1982. From preliminary indications the experiment seems to be working, but a full year of data, including a renewal cycle, is needed to assess the success of the experiment. Final decision will be made prior to the 1983 dues notices.
Directory of Open Access Journals (Sweden)
Mohammed Bahaa Aldeen MD
2014-09-01
to steroids and went home with an improving Cr of 3.5 mg/dL, back to baseline of 1.5 in 8 weeks. Discussion. Internists encounter patients with acute kidney injury (AKI on a daily basis, most of which can be explained by prerenal azotemia, acute tubular necrosis (ATN, obstruction, or rhabdomyolysis among other etiologies. Cocaine is only rarely implicated as an etiology of AKI and if it is, usually the injury is due to ATN or pigment effects. Acute interstitial nephritis (AIN caused by cocaine, on the other hand, has only been described in a handful of cases. AIN is a renal lesion that causes a decline in creatinine clearance and is characterized by an inflammatory infiltrate in the kidney interstitium and is most often associated with drug therapy. AIN can also be seen in autoimmune disorders like systemic lupus erythematosus, Sjögren’s syndrome, or sarcoidosis; or with infections remote to the kidney like Legionella, leptospirosis, and streptococcal disease. Our case was very similar to the other reported cases of AIN due to cocaine in that all have occurred in middle-aged African American males and all have responded to steroids. This case reminds clinicians to consider AIN in patients with AKI and a history of cocaine abuse.