Fabrication of AIN/cU Composites Using Electroless Plating and Evaluation of Their Thermal Properties according to AIN Particle Size

Energy Technology Data Exchange (ETDEWEB)

Cho, Sung Chul; Han, Jun Hyun [Chungnam National University, Daejeon (Korea, Republic of); Ko, Se-Hyun [Korea Institute of Industrial Technology, Incheon (Korea, Republic of); Kim, Hye Sung [Pusan National University, Miryang (Korea, Republic of); Han, Jun Hyun [Korea Institute of Science and Technology, Seoul (Korea, Republic of)

2015-12-15

AIN/Cu composite powders with a core-shell structure were synthesized by a new technique using electroless plating of Cu on AIN particles and consolidated by spark plasma sintering (SPS). Dependence of the thermal conductivity and coefficient of thermal expansion (CTE) of the AIN/Cu composites on the particle size of AIN were studied. The thermal conductivity and coefficient of thermal expansion were significantly dependent on the existence of both boundary pores surrounding the Cu-coated AIN particles and the internal pores of the AIN particles. In order to eliminate the pores, the temperature and pressure of SPS were increased and the AIN particles were heat-treated at high temperature. Adoption of the core-shell AIN/Cu composite powders facilitated the fabrications of AIN/Cu composites with low porosity and uniform distribution in the AIN in Cu matrix.

Terve mõistusega ahnuse vastu / Ain Aaviksoo

Index Scriptorium Estoniae

Aaviksoo, Ain, 1974-

2005-01-01

Dokumentaalfilm "Ülisuur mina" ("Super Size Me") : režissöör Morgan Spurlock : Ameerika Ühendriigid 2004. Turumajandusest, dieedist ja toitumisest, filmi hoiatavast osast eelkõige teistmelistele ja nende kasvatajatele

Meistri kutsumine / Taavi Talve, Indrek Köster ; intervjueerinud Elena Šmakova

Index Scriptorium Estoniae

Talve, Taavi

2009-01-01

Loomingulise ühenduse Johnson ja Johnson - Taavi Talve, Indrek Köster - näitus "Meistri kutsumine" Hobusepea Galeriis 27. aprillini. Autorid 2006. aastal alustatud Paldiski linnaruumi ja selle elanikke kaasavast projektist, mille lõppeesmärk on luua Paldiskisse Amandus Adamsoni skulptuur. Linnaelanike lemmikuks osutus teos "Laeva viimne ohe", mille savist suurenduse modelleerib Mare Mikof

Poliitkommunikatsioon kohalike valimiste eel / Liisa Past, Tarvo Sarmet, Taavi Pukk ... [jt.] ; intervjueerinud Küllike Heide

Index Scriptorium Estoniae

2013-01-01

Lähenevate kohalike valimiste eel poliitilise kommunikatsioonitegevuse korraldusest praegustes parlamendierakondades. Mõtteid jagavad Liisa Past ja Tarvo Sarmet Sotsiaaldemokraatlikust Erakonnast, Taavi Pukk Keskerakonnast, Gerrit Mäesalu IRL-st ning Silver Pukk Reformierakonnast

Kuidas ühiskondlikus leppes lubatud hea tuntavaks tehakse? / Jaak Aaviksoo, Jüri Tamm, Kaul Nurm...[jt.

Index Scriptorium Estoniae

2003-01-01

Küsimusele "missugune oleks nende panus ja plaan esimese aasta jooksul ühiskondlikus leppes fikseeritud eesmärkide saavutamiseks" vastavad Tartu Ülikooli rektor Jaak Aaviksoo, EOK asepresident Jüri Tamm, Eestimaa Talupidajate Keskliidu peadirektor Kaul Nurm, Eesti Kirikute Nõukogu täitevsekretär Eerik Jõks, Eesti Ühistegelise Liidu juhatuse esimees Urmas Laht, Eesti Väike- ja Keskettevõtjate Assotsiatsiooni juhataja Riina Danilson ning Reformierakonna pressinõunik Peep Lillemägi. Samas ka karikatuur

ERKI moe ülevaatus pakkus täismajale toreda õhtu / Tiiu Oga

Index Scriptorium Estoniae

Oga, Tiiu

2007-01-01

Eesti Kunstiakadeemia 13.01.2007 Salme kultuurikesksuses toimunud moeetendusest. Lavastaja Kaarel Väli, graafiline kujundus Eiko Ojala, videokunstnikud Taavi Varm ja Aleks Tenusaar koos RGB-ga, lavaline kujundus Ain Nurmela, valguskunstnik Meelis Lusmägi koos ET Valgusega. Korraldajad Jaanika Terasmaa ja Ester Kannelmäe

Maksuameti võimatu missioon / Lemmi Kann ; kommenteerinud Lasse Lehis, Rait Kaarma, Taavi Veskimägi

Index Scriptorium Estoniae

Kann, Lemmi

2009-01-01

Väljavõte artiklist: Maksude optimeerijad tõmmatakse liistule / Lemmi Kann (aripaev.ee, 17.03.2009). Kommenteerivad Eesti Maksumaksjate Liidu juhatuse esimees Lasse Lehis, Alvin, Rödl & Partner Advokaadibüroo OÜ advokaat Rait Kaarma ja Riigikogu liige Taavi Veskimägi

Mida arvate ideest, et kõrgkoole võiks juhtida ülikoolivälistest inimestest koosnev nõukogu? / Jaak Aaviksoo, Maris Mälzer, Peeter Kreitzberg, Peep Sürje

Index Scriptorium Estoniae

2010-01-01

Küsimusele vastavad Tartu Ülikooli eelmine rektor Jaak Aaviksoo, Eesti Üliõpilaskondade Liidu esimees Maris Mälzer, Riigikogu kultuurikomisjoni esimees Peeter Kreitzberg ja Tallinna Tehnikaülikooli rektor Peep Sürje

Profilaxis de la úlcera gastrointestinal producida por AINES

Directory of Open Access Journals (Sweden)

Carlos Bustamante Rojas

1998-04-01

Full Text Available Como grupo, los AINES son los fármacos más frecuentemente  relacionados con informes acerca de Reacciones Adversas en varios países, se considera que más de 30 millones de personas en el mundo toman a diario AINES por  prescripción médica o por autoprescripción y que un alto porcentaje de dichas personas corresponden al grupo de edad mayor de 60 años. Diversos metaanálisis revelan que el riesgo de presentar eventos gastrointestinales graves en consumidores regulares de AINES puede ser de 3 a 4 veces mayor que en no usuarios al cabo de 30 dias y que dicho riesgo relativo estimado puede elevarse a 5.5 en pacientes ancianos (7 y a valores cercanos a 8.0 cuando se usan altas dosis del AINE (I, 8. También se ha relacionado el empleo crónico de AINES con un aumento en la mortalidad en ancianos.

Baudelaire Eestis : märkmeid. III / Ain Kaalep

Index Scriptorium Estoniae

Kaalep, Ain, 1926-

2004-01-01

Ants Orase loodud eesti aleksandriinist. Artiklis tuuakse välja Charles Baudelaire luuletuse "Correspondances" eri tõlked (Ants Oras, Ain Kaalep) ja luuletuse "Le rêve d'un curieux" tõlked (Ilmar Laaban, Ain Kaalep)

Baudelaire Eestis : märkmeid. III / Ain Kaalep

Index Scriptorium Estoniae

Kaalep, Ain, 1926-

2013-01-01

Ants Orase loodud eesti aleksandriinist. Artiklis tuuakse välja Charles Baudelaire luuletuse "Correspondances" eri tõlked (Ants Oras, Ain Kaalep) ja luuletuse "Le rêve d'un curieux" tõlked (Ilmar Laaban, Ain Kaalep)

Tallinna Merepäevade turismikonverents

Index Scriptorium Estoniae

2012-01-01

13. juulil Lennusadama angaarides toimunud turismikonverentsist "Lennukad ideed Lennusadamas", kus esinesid Tallinna abilinnapea Taavi Aas, Tallinna Sadama ärisuunajuht Ahto Ader, müügijuht Aare Maurer, EHTE arenduse ja uuringute osakonna juhataja Ain Hinsberg, kes rääkis projektist "Cultural Tourism 2011", Tallinna Lennujaama juhatuse esimees Rein Loik, Lennusadama tegevjuht Ott Sarapuu

Taavi Otsuse ja ansambli Ska Faktor laul pääses Eurolaulu rahvusliku eelvooru finaali

Index Scriptorium Estoniae

2007-01-01

Eurolaulu 2008 Eesti rahvusliku eelvooru finaali pääsenud kümne laulu seas ka Põltsamaalt pärit Taavi Otsuse ja Ska Faktori lugu "Real Big Money" (saade eetris 26. jaan., finaal 2. veebr. 2008, kus telefonihääletus selgitab välja Eestit esindava laulu maikuus Belgradis toimuval Eurovisiooni 53. lauluvõistlusel)

ain defla, algeria

African Journals Online (AJOL)

Hamaidi-Chergui F, Brahim Errahmani M, Debib A, Hamaidi M.S

2016-05-01

May 1, 2016 ... Water from boreholes in Arib (Ain Defla) was investigated to ... of 100 ml is drawn through a membrane filter (0.45 μm pore size) using a vacuum pump. The .... boreholes are very important as clean and hygienic environment ...

15. XI kell 17 avatakse EKA galeriis...

Index Scriptorium Estoniae

2004-01-01

Näitus "ERKI moe-show" 10 aastat", mille koostasid Karolin Kuusik, Gerli Liivamägi, Kristina Paju, Külli-Kerttu Siplane ja Agne Talu. Eksponeeritakse ka Jaanus Orgusaare, Vassilissa, Aldo Järvsoo ning Hula noortekollektsiooni esinemiste meeldejäävamaid hetki. 20. XI kinos Kosmos ERKI moeetendus "Go". Lavastuse autorid Taavet Jansen ja Oksana Titova, kunstiline juht Ain Nurmela, videokunstnik Taavi Warm, graafiline kujundus Martin Eelmalt, helikujundus Remi Prualilt

Electronic structure and optical properties of AIN under high pressure

International Nuclear Information System (INIS)

Li Zetao; Dang Suihu; Li Chunxia

2011-01-01

We have calculated the electronic structure and optical properties of Wurtzite structure AIN under different high pressure with generalized gradient approximation (GGA) in this paper. The total energy, density of state, energy band structure and optical absorption and reflection properties under high pressure are calculated. By comparing the changes of the energy band structure, we obtained AIN phase transition pressure for 16.7 GPa, which is a direct band structure transforming to an indirect band structure. Meanwhile, according to the density of states distribution and energy band structure, we analyzed the optical properties of AIN under high-pressure, the results showed that the absorption spectra moved from low-energy to high-energy. (authors)

Teater

Index Scriptorium Estoniae

2006-01-01

Vanemuise teatri draamanäitlejad tunnistasid möödunud aasta parimaks lavastuseks augustis Setumaal Obinitsas etendunud "Taarka", mille lavastas Ain Mäeots. Parimaks naispeaosatäitjaks valiti Merle Jääger, parimaks meespeaosatäitjaks Indrek Taalmaa, parimaks naiskõrvalosatäitjaks Karin Tammaru, parimaks meeskõrvalosatäitjaks Tanel Jonas. Eesti Draamateatri 2005. aasta Antsud ehk kolleegipreemiate laureaadid : Ingomar Vihmar (parim lavastaja), Ervin Õunapuu (parim kunstnik), Ülle Kaljuste (parim naisnäitleja), Ain Lutsepp (parim meesnäitleja), Väikesed Antsud pälvisid Elina Reinold ja Taavi Teplenkov, Abi-Antsuks kuulutati teatri kirjandusala juhataja Ene Paaver. Endla 2005. aasta kolleegipreemiad said Lii Tedre (parim naisnäitleja), Tambet Seling (parim meesnäitleja), Tiit Palu (parim lavastaja) ja Silver Vahtre (parim kunstnik)

Oxidation behaviour of Ti2AIN films composed mainly of nanolaminated MAX phase.

Science.gov (United States)

Wang, Q M; Garkas, W; Renteria, A Flores; Leyens, C; Kim, K H

2011-10-01

In this paper, we reported the oxidation behaviour of Ti2AIN films on polycrystalline Al2O3 substrates. The Ti2AIN films composed mainly of nanolaminated MAX phase was obtained by first depositing Ti-Al-N films using reactive sputtering of two elemental Ti and Al targets in Ar/N2 atmosphere and subsequent vacuum annealing at 800 degrees C for 1 h. The Ti2AIN films exhibited excellent oxidation resistance and thermal stability at 600-900 degrees C in air. Very low mass gain was observed. At low temperature (600 degrees C), no oxide crystals were observed on film surface. Blade-like Theta-Al2O3 fine crystals formed on film surfaces at 700-800 degrees C. At high temperature (900 degrees C), firstly Theta-Al2O3 formed on film surface and then transformed into alpha-Al2O3. At 700-900 degrees C, a continuous Al2O3 layer formed on Ti2AIN films surface, acting as diffusion barrier preventing further oxidation attack. The mechanism of the excellent oxidation resistance of Ti2AIN films was discussed based on the experimental results.

Ain Hanschmidt jättis küsijad vastuseta / Andrus Karnau

Index Scriptorium Estoniae

Karnau, Andrus

2005-01-01

Ühispanga endise juhi Ain Hanschmidti 26. septembri pöördumine ei andnud vastuseid tema äritehingutega seoses esile kerkinud olulistele küsimustele: mille eest ta sai osalused laevakompaniis Tallink Grupp ja Haapsalu HRM-is. Lisa: Ain Hanschmidti argumendid. Küsimusele, kas Hanschmidti seletused olid piisavad vastavad Eesti Investorite Liidu juhatuse liige Heldur Meerits ja Sillamäe Soojuselektrijaama juhataja Väino Sarnet

Põhikooli ainesõnastikud / Heiki Jaan Kaalep, Jaan Mikk

Index Scriptorium Estoniae

Kaalep, Heiki-Jaan, 1962-

2008-01-01

Eesti vene õppekeelega koolidele keskastme ainesõnastike loomise konkursi tulemustest, kirjeldatakse koostatud sõnastike eesmärke ja kirjestruktuuri, samuti loomisprotsessi etappe. Vaadeldakse ka morfoloogiaalase tarkvara kasutamisvõimalusi sõnastiku loomisel

HPV infection, anal intra-epithelial neoplasia (AIN and anal cancer: current issues

Directory of Open Access Journals (Sweden)

Stanley Margaret A

2012-09-01

Full Text Available Abstract Background Human papillomavirus (HPV is well known as the major etiological agent for ano-genital cancer. In contrast to cervical cancer, anal cancer is uncommon, but is increasing steadily in the community over the last few decades. However, it has undergone an exponential rise in the men who have sex with men (MSM and HIV + groups. HIV + MSM in particular, have anal cancer incidences about three times that of the highest worldwide reported cervical cancer incidences. Discussion There has therefore traditionally been a lack of data from studies focused on heterosexual men and non-HIV + women. There is also less evidence reporting on the putative precursor lesion to anal cancer (AIN – anal intraepithelial neoplasia, when compared to cervical cancer and CIN (cervical intraepithelial neoplasia. This review summarises the available biological and epidemiological evidence for HPV in the anal site and the pathogenesis of AIN and anal cancer amongst traditionally non-high risk groups. Summary There is strong evidence to conclude that high-grade AIN is a precursor to anal cancer, and some data on the progression of AIN to invasive cancer.

Fabrication and performance of AIN insulator coatings for application in fusion reactor blankets

International Nuclear Information System (INIS)

Natesan, K.

1995-09-01

The liquid-metal blanket concept for fusion reactors requires an coating on the first-wall structural material to minimize the magnetohydrodynamic pressure drop that occurs during the flow of liquid metal in a magnetic field. Based on the thermodynamics of interactions betwen the coating and the liquid lithium on one side and the structural V-base alloy on the other side, an AIN coating was selected as a candidate. Detailed investigations were conducted on the fabrication, metallurgical microstructure, compatibility in liquid Li, and electrical characteristics of AIN material obtained from several sources. Lithium compatibility was studied in static systems by exposing AIN-coated specimens to liquid Li for several time periods. Electrical resistance was measured at room temperature on the specimens before and after exposure to liquid Li. The results obtained in this study indicate that AIN is a viable coating from the standpoint of chemical compatibility in Li, electrical insulation, and ease of fabrication; for these reasons, the coating should be examined further for fusion reactor applications

Dozhivjom do võborov / Ain Seppik ; interv. Tatjana Opekina

Index Scriptorium Estoniae

Seppik, Ain, 1952-

2007-01-01

Riigikogu liige vastab küsimustele, mis puudutavad Keskerakonna poliitikat, parlamendivalimisi, aprillisündmusi, korruptsiooni, riigieelarvet. Ain Seppik leiab, et Keskerakonna missiooniks on arendada riiki ja kaitsta nõrku

F-type centers in neutron-irradiated AIN

International Nuclear Information System (INIS)

Atobe, Kozo; Honda, Makoto; Fukuoka, Noboru; Okada, Moritami; Nakagawa, Masuo.

1990-01-01

The production of point defects by neutron irradiation and thermal decay in sintered AIN polycrystal are investigated. The absorption band at 370 nm is observed after reactor neutron irradiation to a dose of 10 16 n/cm 2 (E > 0.1 MeV). The defect corresponding to the band is tentatively assigned as an F-type center from the optical absorption and electron spin resonance. (author)

Leaky surface acoustic waves in Z-LiNbO3 substrates with epitaxial AIN overlays

International Nuclear Information System (INIS)

Bu, G.; Ciplys, D.; Shur, M.S.; Namkoong, G.; Doolittle, W.A.; Hunt, W.D.

2004-01-01

The properties of leaky surface acoustic waves (LSAW) in MBE grown AIN layer on Z-cut LiNbO 3 structures have been studied by numerical simulation and experimental measurements and compared with those of Rayleigh waves in the same structure. In the range of AIN layer thicknesses studied (0 3 substrate was essentially constant at around 4400 m/s. The measured electromechanical coupling coefficients (K 2 ) for the LSAW are roughly 1/4 of the predicted values, which might be due to the strong attenuation of the leaky wave unaccounted for during the parameter extraction. The thin AIN film slightly improved the measured temperature coefficient of frequency for the LSAW over that attained for the Z-cut, X-propagating LiNbO 3 substrate alone

Kurja lilled / Charles Baudelaire ; prantsuse k. tlk. Ain Kaalep ja Märt Väljataga

Index Scriptorium Estoniae

Baudelaire, Charles

2000-01-01

Sisu: Õnnistamine ; "Jumaldan Sind ma siin, öist taevavõlvi nägev / tlk. Ain Kaalep ; Palkon / tlk. Märt Väljataga ; Kodukäija ; Kassid / tlk. A. Kaalep ; Armastades valet / tlk. M. Väljataga ; Üksildase vein ; Päeva lõpp / tlk. Ain Kaalep. Orig.: Bénédiction ; "Je t'adore ̉ l'égal de la vo͠te nocturne ; Le balcon ; Les chats ; L'amour du mensonge ; Le vin du solitaire ; La fin de la journée

ISO sertifikaat kuulutab tootja mainet üle maailma / Ain Alvela

Index Scriptorium Estoniae

Alvela, Ain, 1967-

2006-01-01

Ilmunud ka: Delovõje Vedomosti 12. apr. lk. 24-25. ISO standardi rakendamine tagab toodangu kvaliteedi ja annab firmale usaldusväärsuse. Kommenteerib Ain Noormägi. Vt. samas: ISO 9001; ISO 14 001; Universaalne standard kohandub ettevõtte vajadustega

Dietary intake of ain-93 standard diet induces Fatty liver with altered hepatic fatty acid profile in Wistar rats.

Science.gov (United States)

Farias Santos, Juliana; Suruagy Amaral, Monique; Lima Oliveira, Suzana; Porto Barbosa, Júnia; Rego Cabral, Cyro; Sofia Melo, Ingrid; Bezerra Bueno, Nassib; Duarte Freitas, Johnatan; Goulart Sant'ana, Antônio; Rocha Ataíde, Terezinha

2015-05-01

There are several standard diets for animals used in scientific research, usually conceived by scientific institutions. The AIN-93 diet is widely used, but there are some reports of fatty liver in Wistar rats fed this diet. We aimed to evaluate the hepatic repercussions of the AIN-93 diet intake in Wistar rats. Forty newly-weaned 21-day-old male Wistar rats were fed either the AIN-93 diet or a commercial diet for either 1 month or 4 months. Weight gain, serum biochemistry, hepatic histology, and hepatic fatty acid profile were analyzed. Hepatic steatosis was observed, especially in the group fed the AIN-93 diet. Serum blood glucose, absolute and relative liver weight and hepatic levels of oleic, palmitoleic, stearic, and palmitic fatty acids were related to the observed steatosis, while lipidogram and serum markers of liver function and injury were not. AIN-93 diet induced acute hepatic steatosis in Wistar rats, which may compromise its use as a standard diet for experimental studies with rodents. The hepatic fatty acid profile was associated with steatosis, with possible implications for disease prognosis. Copyright AULA MEDICA EDICIONES 2014. Published by AULA MEDICA. All rights reserved.

Keila Tervisekeskus. Ujula = Keila Health Club. Swimming Pool / Ain Padrik

Index Scriptorium Estoniae

Padrik, Ain, 1947-

2001-01-01

Projekteerija: Arhitektuuribüroo Künnapu & Padrik. Arhitektid Ain Padrik ja Kristi Alamaa, sisearhitekt Sirje Männik. Konstruktsioonid: Jaan Laks, A-Grupp. Ujulas on võistlus- ja lastebassein, suvel on avatud välibassein. 5 ill.: I korruse plaan, ristlõige, vaated

Tumedad ained kirjanduses ja päriselt / Mare Müürsepp

Index Scriptorium Estoniae

Müürsepp, Mare

2007-01-01

Analüüsitud on Philip Pullmani triloogiasse "Tema tumedad ained" kuuluvaid romaane : Pullman, Philip. Kuldne kompass. Tallinn : Tiritamm, 2002; Pullman, Philip. Inglite torn. Tallinn : Tiritamm, 2004; Pullman, Philip. Vaigust kiiker. Tallinn : Tiritamm, 2005

Aine y riesgo cardiovascular: los menos posibles, a la menor dosis posible y durante el menor tiempo posible

Directory of Open Access Journals (Sweden)

Ferrán Catalá-López

2014-09-01

Conclusiones: Existe poca evidencia para sugerir que alguno de los AINE estudiados es seguro en términos de riesgo cardiovascular. Naproxeno parece ser menos perjudicial que el resto. El riesgo cardiovascular asociado al uso de AINE debe ser tenido en cuenta en la prescripción de cualquiera de estos medicamentos.

Poolsajandi õnnesoovid Jaak Aaviksoole / Ain Heinaru, Jaak Kangilaski, Tõnu Lehtsaar...[jt.

Index Scriptorium Estoniae

2004-01-01

Mõtteid Tartu Ülikooli rektorist tema 50. sünnipäeva puhul : Ain Heinaru, Jaak Kangilaski, Tõnu Lehtsaar, Indrek Reimand, Toomas Kiho, Leelo Kriisa, Peeter Olesk, Risto Tammelo, Birute Klaas, Peeter Saari, Andrus Ansip, Mait Klaassen, Marika Kullamaa, Kaupo Bend

The Scientific Method Ain't What It Used to Be

Science.gov (United States)

Herreid, Clyde Freeman

2010-01-01

Remember the time when all you had to do was memorize these five steps: ask a question, formulate a hypothesis, perform experiment, collect data, and draw conclusions? And you received full credit for defining the scientific method. Well, those days are gone. This article discusses why the "scientific method ain't what it used to be." (Contains 2…

An activity-based cost analysis of the Honduras community-based, integrated child care (AIN-C) programme.

Science.gov (United States)

Fiedler, John L; Villalobos, Carlos A; De Mattos, Annette C

2008-11-01

The Honduras AIN-C programme is a preventive health and nutrition programme of the Honduras Ministry of Health (MOH) that relies on volunteers to help mothers monitor and maintain the adequate growth of young children. A quasi-experimental, design-based evaluation found that the programme achieved near-universal coverage and was effective in improving mothers' child-rearing knowledge, attitudes and practices, including feeding and appropriate care-giving and care-seeking practices for children with diarrhoea and acute respiratory illness. The programme is widely regarded as a model. This study was undertaken to provide the first comprehensive estimates of the cost of the AIN-C programme, with the goal of providing a programme and financial planning tool for Honduras. An additional comparison of study findings was also undertaken to determine the cost of the AIN-C programme's community-based services relative to a similar facility-based service. Expressed in mid-2005 US dollars, the study found that after the programme is phased-in: (1) the annual, recurrent cost per child under 2 years participating in the programme is $6.43; (2) the annual, incremental budget requirements per child under 2 years participating in the programme are $3.90; (3) the cost of an AIN-C monthly growth monitoring and counselling session per child is 11% of the cost of a traditional MOH, facility-based growth and development consultation per child; and (4) the effect of mothers substituting AIN-C monitor care for MOH facility-based care 'saves' 203 000 outpatient visits a year, with a potential cost saving of $1.66 million, the equivalent of 60% of the recurrent cost of the programme and roughly equal to the annual incremental budget requirements of the programme. Sensitivity analysis of the cost estimates is performed to provide insight, for countries considering introducing a similar programme, into how modifications of key characteristics of the programme affect its costs.

Pamidronato endovenoso en espondilitis anquilosante refractaria a antiinflamatorios no esteroideos (AINES y sulfasalazina

Directory of Open Access Journals (Sweden)

Augusto García-Poma

2007-03-01

Full Text Available Objetivo: Evaluar la terapia con pamidronato, en pacientes con espondilitis anquilosante (EA activa, con respuesta subóptima o falla a los antiinflamatorios no-esteroideos (AINES y sulfasalazina. Diseño: Estudio clínico comparativo. Lugar: Hospital Nacional Edgardo Rebagliati Martins, EsSalud, Lima, Perú. Participantes: Pacientes con espondilitis anquilosante. Intervenciones. Se incluyó 9 pacientes con EA (6 varones, con enfermedad activa (BASDAI > o = 4, actividad axial y falta de respuesta a los Aines y sulfasalazina a dosis de 3g/d. Todos los pacientes recibieron 60 mg de pamidronato mensual, en infusión endovenosa, durante 6 meses, y continuaron tomando AINES y sulfasalazina. La mejoría clínica fue evaluada usando el ASAS 20. En forma secundaria se evaluó el ASAS 40, BASDAI 50, BASDAI, BASFI Y BASMI, a las 24 y 48 semanas (32 a 86 semanas. La diferencia entre el índice de pre y postratamiento fue evaluada usando la prueba de Wilcoxon. Principales medidas de resultados: Evaluación del ASAS 20. Resultados: El 67% alcanzó un Asas 20 a las 24 semanas y 78% a las 48 semanas; 33,3% y 55,6% tuvieron ASAS 40 y 33,3%; y 44,4% alcanzó BASDAI 50 a las 24 y 48 semanas, respectivamente. Un paciente recayó a la semana 20. Tres pacientes (33,3% permanecieron sin cambios. A las 24 y 48 semanas, la media de BASDAI disminuyó en 45,1% (p=0,007 y en 52,1% (p=0,01, la media de BASFI en 38,2% (p=0,007 y en 52,3% (p=0,007, y la media de BASMI en 39,2% (p=0,01 y 39,2% (p=0,01, respectivamente. Los eventos adversos no fueron importantes con esta terapia. Conclusiones: El tratamiento con pamidronato demostró ser efectivo en este grupo de pacientes con EA, refractaria a AINES y a sulfasalazina.

Valik arvamusi läbi aastate / Ain-Elmar Kaasik

Index Scriptorium Estoniae

Kaasik, Ain-Elmar, 1934-

2008-01-01

Valik Eesti Teaduste Akadeemia Aastaraamatus rubriigis "Arvamusi akadeemikutelt" ilmunud kirjutisi, kus vabas vormis käsitletakse mitmesuguseid aktuaalseid küsimusi, eelkõige hariduse, teadustöö ning ühiskonna suhteid. Kokku on rubriigis avaldatud ligi kaks ja poolsada kirjutist. Siinse valiku autoriteks akadeemikud Raimund Hagelberg, Mart Saarma, Boris Tamm, Ene Ergma, Arvo Krikmann, Agu Laisk, Hans-Voldemar Trass, Harald Keres, Anto Raukas, Rein Küttner, Enn Tõugu, Raimund-Johannes Ubar, Ain-Elmar Kaasik

Aineüleste pädevuste koolitus Pestalozzi programmi raames / Tiia Pukk, Tiiu Vaher

Index Scriptorium Estoniae

Pukk, Tiia

2011-01-01

1969 alguse saanud Pestalozzi koolitusprogramm on suunatud Euroopa kultuurikonventsiooniga ühinenud 49 riigi haridustöötajatele. Seekordne üritus toimus Tartus, koolituse teemaks aineülesed pädevused

GarcÍa Lorca luulest ja Ain Kaalepi tõlkest / Jüri Talvet

Index Scriptorium Estoniae

Talvet, Jüri, 1945-

1998-01-01

Arvustus: GarcÍa Lorca, Federico. Mu kätes põleb tuli : valitud luuletused / tlk. ja saateks: Ain Kaalep. 2. tr. Tallinn : Vagabund, 1997. Ilmunud ka kogumikus: Talvet, Jüri. Tõrjumatu äär. Tartu : Ilmamaa, 2005, lk. 442-453

New frameshift CF mutation 3729delAinsTCT in a Tunisian cystic

Indian Academy of Sciences (India)

Home; Journals; Journal of Genetics; Volume 92; Issue 1. New frameshift CF mutation 3729delAinsTCT in a Tunisian cystic fibrosis patient. Sondess Hadj Fredj Monia Boudaya Sabrine Oueslati Safa Sahnoun Chaima Sahli Hajer Siala Khedija Boussetta Amina Bibi Taieb Messaoud. Research Note Volume 92 Issue 1 April ...

COxSwAIN: Compressive Sensing for Advanced Imaging and Navigation

Science.gov (United States)

Kurwitz, Richard; Pulley, Marina; LaFerney, Nathan; Munoz, Carlos

2015-01-01

The COxSwAIN project focuses on building an image and video compression scheme that can be implemented in a small or low-power satellite. To do this, we used Compressive Sensing, where the compression is performed by matrix multiplications on the satellite and reconstructed on the ground. Our paper explains our methodology and demonstrates the results of the scheme, being able to achieve high quality image compression that is robust to noise and corruption.

A retrospective review of the Honduras AIN-C program guided by a community health worker performance logic model.

Science.gov (United States)

Rodríguez, Daniela C; Peterson, Lauren A

2016-05-06

Factors that influence performance of community health workers (CHWs) delivering health services are not well understood. A recent logic model proposed categories of support from both health sector and communities that influence CHW performance and program outcomes. This logic model has been used to review a growth monitoring program delivered by CHWs in Honduras, known as Atención Integral a la Niñez en la Comunidad (AIN-C). A retrospective review of AIN-C was conducted through a document desk review and supplemented with in-depth interviews. Documents were systematically coded using the categories from the logic model, and gaps were addressed through interviews. Authors reviewed coded data for each category to analyze program details and outcomes as well as identify potential issues and gaps in the logic model. Categories from the logic model were inconsistently represented, with more information available for health sector than community. Context and input activities were not well documented. Information on health sector systems-level activities was available for governance but limited for other categories, while not much was found for community systems-level activities. Most available information focused on program-level activities with substantial data on technical support. Output, outcome, and impact data were drawn from various resources and suggest mixed results of AIN-C on indicators of interest. Assessing CHW performance through a desk review left gaps that could not be addressed about the relationship of activities and performance. There were critical characteristics of program design that made it contextually appropriate; however, it was difficult to identify clear links between AIN-C and malnutrition indicators. Regarding the logic model, several categories were too broad (e.g., technical support, context) and some aspects of AIN-C did not fit neatly in logic model categories (e.g., political commitment, equity, flexibility in implementation). The

Monsieur Philippe Galli Préfet de l’Ain France

CERN Multimedia

Maximilien Brice

2011-01-01

Photo 35: Le chef du département Physique P. Bloch, le porte-parole de la Collaboration CMS G. Tonelli,le Sous-Préfet de Gex O. Laurens-Bernard, le chef du département Technologie F. Bordry, le Péfet de l'Ain P. Galli et le Directeur-général R. Heuer. Photo 62: signature du livre d'or avec le Directeur de la recherche et de l'informatique S. Bertolucci.

Application of electrical geophysics to the release of water resources, case of Ain Leuh (Morocco

Directory of Open Access Journals (Sweden)

Zitouni A.

2018-01-01

In the present work, which concerns only the methodology of the electric resistivity, we treat the adopted methodological approach and the study of the case of application in the tray of Ajdir Ain Leuh.

17 September 2013 - Estonian Minister of Education and Research J. Aaviksoo signing the guest book with CERN Director-General R- Heuer; visiting the TOTEM facility with TOTEM Collaboration Spokesperson S. Giani; in the LHC tunnel at Point 5 with International Relations Adviser T. Kurtyka and visiting the CMS cavern with CMS Collaboration Spokesperson J. Incandela. International Relations Adviser R. Voss present.

CERN Multimedia

Anna Pantelia

2013-01-01

17 September 2013 - Estonian Minister of Education and Research J. Aaviksoo signing the guest book with CERN Director-General R- Heuer; visiting the TOTEM facility with TOTEM Collaboration Spokesperson S. Giani; in the LHC tunnel at Point 5 with International Relations Adviser T. Kurtyka and visiting the CMS cavern with CMS Collaboration Spokesperson J. Incandela. International Relations Adviser R. Voss present.

Ain't Gonna Study War No More? Explorations of War through Picture Books

Science.gov (United States)

Crawford, Patricia A.; Roberts, Sherron Killingsworth

2009-01-01

At the height of the Vietnam War, Down by the Riverside was transformed from a traditional folk song to a popular anti-war anthem. The raucous and repetitive chorus, "I ain't gonna study war no more ...," became a rallying cry for those who wanted nothing to do with the war and the pain and controversy that surrounded it. Although it seems…

Modelling rainfall runoff relations using HEC-HMS in a semi-arid region: Case study in Ain Sefra watershed, Ksour Mountains (SW Algeria)

OpenAIRE

Derdour Abdessamed; Bouanani Abderrazak; Babahamed Kamila

2018-01-01

Ain Sefra is one of the Algerian cities that had been experienced several devastating floods during the past 100 years. The purpose of this study is to simulate runoff in the semi-arid region of Ain Sefra watershed through the employing of the Hydrologic Engineering Center – Hydrologic Modelling System (HEC-HMS). In this paper, the frequency storm is used for the meteorological model, the Soil Conservation Service – curve number (SCS-CN) is selected to calculate the loss rate and Soil Conserv...

Contribution to the hydrogeological, geochemical and isotopic study of Ain El Beidha and Merguellil (Kairouan plain) aquifers: Implication for the dam-aquifer relationship

International Nuclear Information System (INIS)

Ben Ammar, Safouan

2007-01-01

In the semiarid central part of Tunisia the water resources are becoming increasingly rare because of the scarcity and irregularity of the precipitation and a steadily growing need for fresh water. This study addresses the use of geochemical and isotopic data to analyze the relationship between the El Haouareb dam and the Ain El Beidha and the Kairouan alluvial plain aquifers systems for durable groundwater management. In the Ain El Beidha basin the hydrogeological and geochemical investigations showed that: - The general direction of the groundwater flow is mainly from the SW to the NE, i.e. towards the hydraulic sill of El Haouareb which allows the connection between the Ain El Beidha basin and the Kairouan plain, - The salinity distribution displays a zonation in apparent relationship with the lithological variation of the aquifer formation, - Mineral exchange between groundwater and the aquifer matrix is the dominant process in determining groundwater salinity. The isotopic data confirm the flow directions of groundwater and shows that the recharge of Ain El Beidha aquifers takes place from the floods of the Khechem and Ben Zitoun wadies and also by preferential infiltration of runoff at the front of hill slopes area. Close to preferential recharge areas, groundwater 3H contents reflect a recent input of surface water, whereas the radiocarbon data indicate a longer residence time downstream. The isotopic characteristics of Ain El Beidha groundwater (small space and temporal changes) authorize the use of averaged values for the dam-aquifer water exchange. Under natural conditions, groundwater recharge of the alluvial aquifer of Kairouan plain occurs by infiltration of the Merguellil floods and from the Ain el Beidha groundwater flow close the karstic hydraulic sills. Since the construction of the El Haouareb dam, these natural mechanisms have been strongly modified: the dam waters infiltrate into the karst, mix with the Ain el Beidha groundwater, and feed the

T his article is m ainly about using sim ple trigonom etric identities ...

Indian Academy of Sciences (India)

T his article is m ainly about using sim ple trigonom etric identities and basic calculus to deduce som e new and interesting series. In particular, I use basic aspects of. G am m a and B eta integrations to deduce these series. T hese lead to interesting series for ¼ or functions of ¼ . O ne form ofbeta integration w hich is often ...

Eestlane tahab tasuta kvaliteetset arstiabi, järjekorras ootamata / Risto Sverdlik ; kommenteerinud Ain Aaviksoo, Eiki Nestor

Index Scriptorium Estoniae

Sverdlik, Risto

2009-01-01

Autori hinnangul on Eesti tervishoiusüsteem sotsialistlik ning suhteliselt sarnase tervishoiusüsteemiga riikides on samad probleemid: ravijärjekorrad ja kulude kasv. Singapuri tervishoiumudelist. Autor leiab, et keskse planeerimisega tervishoiusüsteemi puhul kannatavad kõige rohkem vaesed, turumajanduslikus süsteemis aga ravihinnad järjest väheneksid

Pima Community College Planning Grant for Autonomous Intelligent Network of Systems (AINS) Science, Mathematics and Engineering Education Center

National Research Council Canada - National Science Library

2006-01-01

.... The Center was to be funded by the Department of Defense, Office of Naval Research (ONR). The TDRI AINS Center's objectives were to advance ONR's technologies and to improve exposure and participation in science, math, and engineering (SME...

Isotope hydrological investigation of Moghra and Ain El-Sharip environment, north western desert, Egypt

International Nuclear Information System (INIS)

Aly, A.I.M.; Nada, A.; Awad, M.; Salman, A.B.; Hamza, M.S.

1991-01-01

Groundwater samples collected from some localities in the vicinity of Moghra and Ain El-Sharip in the north western desert were subjected to chemical and to isotopic analyses. The combination of the hydrochemical data with the isotopic compositions of deuterium, oxygen-18 and tritium shows that the groundwater in this region represents a mixture of water recharged from different sources including : Nile, sea and paleo-waters.5 fig.,2 tab

Teaduskeskus Ahhaa = Ahhaa Science Centre / Vilen Künnapu, Ain Padrik, Malle Jürgenson, Tea Tammelaan ; intervjueerinud Margit Mutso

Index Scriptorium Estoniae

2012-01-01

Tartus Sadama 1 auva Ahhaa teaduskeskuse arhitektuurist ja sisearhitektuurist. Arhitektid: Ain Padrik ja Vilen Künnapu, kaasa töötasid Kristjan Tõlk, Kristiin Keernik, Siim Tuksam, Hannes Tilk (Künnapu & Padrik). Sisearhitektid: Tea Tammelaan, Krista Lepland ja Malle Jürgenson (Laika, Belka & Strelka). Infograafika: Alar Pikkorainen

The impact of weathering on the uranium-bearing phosphates of Ain Laylon in the Syrian coast, using radon and gamma ray surveys

International Nuclear Information System (INIS)

Jubeli, Y.; Al-Hilal, M.; Al-Ali, A.

1998-06-01

A combination of several exploration techniques was carried out at the main phosphatic outcrop of Ain Laylon in the Syrian coastal region. The survey was extended along an E-W profile parallel to Wadi Al-Mzeraa over a distance of about 23 km from Ain Laylon site towards the shoreline of the Mediterranean Sea. The techniques used in this survey included soil radon emanometry, gamma ray spectrometry and soil geochemistry, with the purpose of evaluating the effects of weathering and erosion on the uranium-hearing phosphate formations in the study ares. Soil radon concentration and gamma ray total count rates found to be ranging between 115-472 pCi/l and 52-520 cps over the main phosphate deposit of Ain Layton and between 16-241 pCi/l and 15-300 cps along the profile of Wadi Al-Mzeraa - Rwemiyeh respectively. Some suitable elements such as U, Zn, Pb, Cr, Fe and Sr were also analyzed to trace the dispersion pattern of uranium and its controls throughout the area. The results showed that the distribution of both radon emission and gamma ray activity, in accordance with chemical uranium and some associated trace elements, were almost identical over the study area. The anomalously high values in all cases were basically found to be related to the main phosphatic outcrop and to the reprecipitation processes at their vicinity following the alteration of the phosphates. The prevailing topographic conditions of the drainage system has probably played a crucial role in carrying the uraniferous solutions from its phosphatic source down to the nearby sedimentary environment. This appears to be sufficient enough to produce an anomalous halo resulting in the detection of some relatively high radon and gamma values of about 7 and 15 times the background respectively, especially close to the main phosphate outcrop. A notable gradual decrease was then observed at the following sampling sites along the pathway west of Ain Laylon site approaching the background level at a distance of

Eripedagoogid ootavad poliitilisi otsuseid / Plado, Kaja; Karlep, Karl; Ostrat, Ain; Maila, Meelika; Binsol, Hene; Kontor, Ana; küsitlenud Martin Krõlov

Index Scriptorium Estoniae

2007-01-01

Eripedagoogide vestlusringis osalevad: Tartu Ülikooli eripedagoogika osakonna juhataja Kaja Plado, emeriitdotsent pedagoogikadoktor Karl Karlep, Tartu Kroonuaia Kooli direktor Ain Ostrat ja õppealajuhataja Meelike Maila, Tartu Hiie Kooli õppealajuhataja Hene Binsol ning Tartu Nõustamis- ja õpiabi keskuse juhataja Ana Kontor

Use of tritium for estimation of groundwater mean residence time, a case study of the Ain Al-Samak Karst springs (Central Syria)

International Nuclear Information System (INIS)

Kattan, Z.

2003-01-01

This work is an attempt to estimate the mean residence time of groundwater in the Ain Al-Tanour and Ain-Samak, which are the major karst springs in the Upper Orontes Basin (Central Syria). This estimate, which consists on the application of a mathematical modeling approach, was based on the use of tritium, as a natural radioisotope tracer and a tool for ground water age dating. By adopting a completely mixed reservoir model, linked with exponential time distribution function, the mean residence time (turnover time) of these two springs was evaluated to be about 50 years. This result is in good agreement with previous estimation obtained for the Figeh main spring, which belongs to the same aquifer (Cenomanian-Turonian complex) in the Damascus Basin. On the basis of this evaluation, a value of about 800 million m 3 was obtained for the maximum groundwater reservoir size

Kas uus töölepingu seaduse eelnõu on õnnestunud? / Olga Aasav, Arno Arukask, Ain Tammvere...[jt.] ; interv. Martin Pau

Index Scriptorium Estoniae

2008-01-01

Vastavad restoranklubi Atlantis tegevjuht Olga Aasav, ametiühingute keskliidu osakonnajuhataja Arno Arukuusk, AS Estiko Investeeringud juhataja Ain Tammvere, Tartu Ülikooli ametiühingu esimees Aleksander Jakobson, AS Samelin tegevdirektor Leida Kikka, AS Enics Eesti tegevjuht Kalle Kuusik, personalispetsialist Lea Oras ja Tartu Tarbijate Kooperatiivi juhatuse esimees Tarmo Punger

Overexploitation and cumulative drought trend effect on Ras El Ain karstic spring discharge (Khabour Sub-basin, Syria)

Science.gov (United States)

Abou Zakhem, Boulos; Kattaa, Bassam

2017-10-01

The effects of climate change and overexploitation are being strongly perceived in the studied area and the springs discharge is obviously affected. In this paper, Ras El Ain spring discharge and precipitation were analyzed by normalized methods on an yearly timescale. The deficit of Ras El Ain spring discharge due to overexploitation factors and drought effects was estimated. Cumulative drought analyses were carried out using SPI10 and SQI10. Finally, the decreasing trends of the spring discharge due to the deficiency in rainfall were analyzed. The main results reveal that the annual mean deficit of Ras El Ain spring discharge due to overpumping was between 32 and 45%, whereas, annual mean deficit related to drought was between 22 and 35% on average, during the last 30 years (post-1984). The moving averages of SPI and SQI delineate very well the drought periods during last three decades. The cumulative droughts using SPI10 and SQI10 reveal that wet period (pre-1984) with positive values was characterized by high precipitation and spring discharge. Overexploitation period (1984-1989) is distinguished by decreasing SQI10 values whereas, SPI10 is almost stable. The response of the karst system to the precipitation signal has been changed, during the drought period (1990-2000), and the spring behaviour has been modified due to the first overexploitation period. Finally, overexploitation period (2001-2008) is related to the second phase of groundwater intensive pumping for irrigation purposes. Consequently, this period is completely catastrophic causing the drying up of the spring. The decreasing trends analyzed using DPI and DQI showed annual decreasing rates relative to the mean values of -0.268% and -0.105%, respectively. Thus, the results of theoretical model reveal that precipitation will decrease by about DPI = -20.7% and the discharge will decline by about -9.2% by 2050. Consequently, the declining discharge due to climatic variation under natural conditions as

Modelling rainfall runoff relations using HEC-HMS in a semi-arid region: Case study in Ain Sefra watershed, Ksour Mountains (SW Algeria

Directory of Open Access Journals (Sweden)

Derdour Abdessamed

2018-03-01

Full Text Available Ain Sefra is one of the Algerian cities that had been experienced several devastating floods during the past 100 years. The purpose of this study is to simulate runoff in the semi-arid region of Ain Sefra watershed through the employing of the Hydrologic Engineering Center – Hydrologic Modelling System (HEC-HMS. In this paper, the frequency storm is used for the meteorological model, the Soil Conservation Service – curve number (SCS-CN is selected to calculate the loss rate and Soil Conservation Service unit hydrograph method have been applied to simulate the runoff rate. After calibration and validation, the simulated peak discharges were very close with observed values. The Nash–Sutcliffe efficiency coefficient was 0.95, indicates that the hydrological modeling results are satisfactory and accepted for simulation of rainfall-runoff. The peak discharges obtained for the 10, 50, 100 and 1000 year storms are respectively 425.8, 750.5, 904.3 and 1328.3 m3∙s−1.

Analysis of Urban Expansion of the Resort City of Al Ain Using Remote Sensing and GIS

Science.gov (United States)

Issa, S.; Al Shuwaihi, A.

2009-12-01

The urban growth of AL Ain city has been investigated using remote sensing data for three different dates, 1972, 1990 and 2000. We used three Landsat images together with socio-economic data in a post-classification analysis to map the spatial dynamics of land use/cover changes and identify the urbanization process in Al Ain resort city, United Arab Emirates. Land use/cover statistics, extracted from Landsat Multi-spectral Scanner (MSS). Thematic Mapper (TM) and Enhanced Thematic Mapper plus (ETM +) images for 1972. 1990 and 2000 respectively, revealed that the built-up area has expanded by about 170.53km2. The city was found to have a tendency for major expansion in four different directions: along the Abu Dhabi highway, along Dubai highway, Myziad direction and Hafeet recreational area. Expansion in any direction was found to be governed by the availability of road network, suitability for construction, utilities, economic activities, geographical constraints, and legal factors (boundary with Sultanate of Oman). The road network in particular has influenced the spatial patterns and structure of urban development, so that the expansion of the built-up areas has assumed an accretive as well as linear growth along the major roads. The research concludes that the development is based on conservation of agricultural areas (oases) and reclamation of the desert for farming and agricultural activities. The integration of remote sensing and GIS was found to be effective in monitoring LULC changes and providing valuable information necessary for planning and research.

Implementation of TiAIN and CrN coatings and ion implantation in the modern plastics moulding industry

International Nuclear Information System (INIS)

Bienk, E.J.; Mikkelsen, N.J.

1997-01-01

Two methods of surface improvement widely used in the modern plastics industry are compared, with a view to improving productivity and product quality. Ion implantation of plastics and physical vapour deposition coatings both offer surface engineering advantages. Each method is described and evaluated with reference to plastics moulding. TiAIN coatings are used to protect hard bulk materials, subjected to evenly distributed loads. The more ductile CrN coatings are used for softer materials which give less support to the coatings. (UK)

Aine või toote ravimina määratlemine Eestis Euroopa Liidu õiguse valguses : [magistritöö] / Kaili Lellep ; Tartu Ülikool, õigusteaduskond ; juhendaja Ants Nõmper

Index Scriptorium Estoniae

Lellep, Kaili

2010-01-01

Aine või toote määratlemisest toiduna, kosmeetikatootena, meditsiiniseadmena, ravimina. Määratlustest Eestis ja nende vastavusest Euroopa Liidu õigusega, määratluste tagajärgedest, ettepanekutest vastuolulise õigusakti muutmiseks

Evaluation of the clinical maxim: "If it ain't broke, don't fix it".

Science.gov (United States)

Howell-Duffy, Chris; Hrynchak, Patricia K; Irving, Elizabeth L; Mouat, Graham S V; Elliott, David B

2012-01-01

A significant number of patients return to optometric practice dissatisfied with their spectacles. An important question is whether any of these cases are preventable. There are several different clinical maxims that are used to modify the subjective refraction when determining the refractive prescription. These maxims aim to improve patient comfort and adaptation and thereby reduce patient dissatisfaction with new spectacles. They are not based on research evidence, but rather on expert opinion gained from clinical experience. The aim of this study was to retrospectively analyze a large number of case records of dissatisfied patients to assess the possible usefulness of the prescribing maxim "if it ain't broke, don't fix it." Three hundred eighteen non-tolerance cases from a university-based Canadian optometric clinic were categorized by a focus group of optometrists. Three prescribing categories were defined and comprised cases in which application of the proposed maxim may have prevented the recheck eye examination; a more limited application of the maxim for one working distance may have been appropriate; and finally scenarios in which the maxim did not work in that the practitioner was judged to have initially followed the maxim, yet patient dissatisfaction was still reported. The remaining unallocated records comprised prescribing situations outside the scope of this study. Approximately 32% of non-tolerance cases were judged to have been preventable by use of the proposed maxim. Furthermore, an additional 10% reduction in recheck cases may have been possible by a more liberal interpretation of the maxim. Conversely, 4% of cases were deemed to comprise scenarios in which the maxim was followed yet the patient returned later to report problems with their spectacles. The prescribing maxim "if it ain't broke, don't fix it" appears to have a role in reducing recheck eye examinations and improving patient satisfaction with new spectacles.

Impact of Dietary, Socioeconomic, and Physical Factors on Obese and Overweight Schoolchildren Living in Sidi-Bel-Abbes (West of Algeria and Ain Defla (Centre

Directory of Open Access Journals (Sweden)

Didaoui Hayat

2018-03-01

Full Text Available Background and aims: The aim of the current study was to assess the impact of environmental factors; food, socio-economic, and physical activity, on a group of obese children living in Ain-Defla (Center Algeria and Sidi-Bel-Abbes (West Algeria.

Fracaso renal agudo secundario a combinación de inhibidores del sistema renina-angiotensina, diuréticos y AINES. “La Triple Whammy”1

Directory of Open Access Journals (Sweden)

Rosa Maria Garcia Camin

2015-03-01

Conclusiones: El tratamiento con IECA, ARA II, diuréticos y/o AINES presenta elevada incidencia de ingreso por FRA, siendo los diuréticos en monoterapia, doble y triple terapia combinada los que ocasionan la mayor incidencia. El FRAETW supone elevados costes sanitarios y muertes evitables.

TEM and XANES study of MOVPE grown InAIN layers with different indium content

International Nuclear Information System (INIS)

Kret, S; Wolska, A; Klepka, M T; Letrouit, A; Ivaldi, F; Szczepańska, A; Carlin, J-F; Kaufmann, N A K; Grandjean, N

2011-01-01

We present structure and spatially resolved composition studies by TEM (Transmission Electron Microscopy) and XANES (X-ray Absorption Near Edge Structure) of InAIN MOVPE (Metal-Organic Vapor Phase Epitaxy) epilayers containing 16-27 at% of indium. Investigations of the In L 3 edge by synchrotron radiation absorption show a significant change of the post-edge structure depending on the indium content. We attribute this to the solubility limit and phase separation in this system. Our measurements suggest that the critical composition is 18% for our growth conditions. HRTEM cross-sectional and EDX investigations confirm such phase separation as well as the changing of the structure from 2D growth to columnar like growth for the sample with the highest indium content.

Management of toxic cyanobacteria for drinking water production of Ain Zada Dam.

Science.gov (United States)

Saoudi, Amel; Brient, Luc; Boucetta, Sabrine; Ouzrout, Rachid; Bormans, Myriam; Bensouilah, Mourad

2017-07-01

Blooms of toxic cyanobacteria in Algerian reservoirs represent a potential health problem, mainly from drinking water that supplies the local population of Ain Zada (Bordj Bou Arreridj). The objective of this study is to monitor, detect, and identify the existence of cyanobacteria and microcystins during blooming times. Samples were taken in 2013 from eight stations. The results show that three potentially toxic cyanobacterial genera with the species Planktothrix agardhii were dominant. Cyanobacterial biomass, phycocyanin (PC) concentrations, and microcystin (MC) concentrations were high in the surface layer and at 14 m depth; these values were also high in the treated water. On 11 May 2013, MC concentrations were 6.3 μg/L in MC-LR equivalent in the drinking water. This study shows for the first time the presence of cyanotoxins in raw and treated waters, highlighting that regular monitoring of cyanobacteria and cyanotoxins must be undertaken to avoid potential health problems.

Antiinflamatorios no esteroideos (AINES.: Consideraciones para su uso estomatológico

Directory of Open Access Journals (Sweden)

Andrés A. Pérez Ruiz

2002-08-01

Full Text Available Se realiza una revisión extensa y actualizada sobre los antiinflamatorios no esteroideos (AINEs, con el fin de actualizar al estomatólogo en su uso. Para ello se revisan aspectos importantes del proceso inflamatorio en estructuras de la boca que como las pulpitis, presentan sus peculiaridades. Se identifica a una de las 2 familias de autacoides provenientes de los fosfolípidos de membrana celular, es decir, los eicosanoides derivados a partir de algunos ácidos grasos polisaturados, en particular, ácido araquidónico, que tras la acción de enzimas da lugar a la formación de prostaglandinas, prostaciclinas, tromboxeno A2 y leucotrienos. Conocidos estos antecedentes, nos ocupamos de fármacos usados para combatir los síntomas y signos de la inflamación. Casi todos los antiinflamatorios no esteroideos utilizados en la actualidad, casi todos, inhiben las actividades de la ciclooxigenasa 1 constitutiva y la ciclooxigenasa 2, inducida en el sitio de la inflamación y con ello, la síntesis de prostaglandinas y tromboxanos. Se alude a la ventaja terapéutica de los inhibidores de la COX-2 que aparecen hoy en el mercado. Se expone las dosis y frecuencias de los AINEs, sus interacciones, así como las reacciones adversas al medicamento y contraindicaciones, y se proponen aquellos que son de interés en la práctica estomatológica.Non-steroidal anti-inflammatory drugs. Considerations about their dental use. An extensive updated review of non-steroidal anti-inflammatory agents (NSAIN was made to give an updated information to the dentist about their use. To this purpose, important aspects of the inflammatory process in mouth structures like pulpitis that present with their own peculiarities are reviewed. We identified one of the two autacoid families from cell membrane phospholipids, that is, eicosanoids derived from some polysaturated fatty acids, in particular, arachidonic acid, which, after the action of enzymes, give rise to the formation of

Toidutööstus panustab detsembris jõulutoodetele. Pühad toovad käibelisa / Ain Alvela, Ketlin Rauk ; kommenteerinud Ruth Roht, Marek Viilol, Simmo Kruustük, Imre Sokk

Index Scriptorium Estoniae

Alvela, Ain, 1967-

2011-01-01

Spetsiaalsed jõulutooted aitavad aasta lõpul suurendada toiduainetööstuste käivet. ASi Atria Eesti müügi- ja turundusdirektori Margus Masingu, ASi Fazer Eesti juhatuse esimehe Kristjan Kongo ja ASi Salvest turundusdirektori Ain Nõlvaku kommentaare

Ööklubi Club von Überlingen = Club von Überlingen

Index Scriptorium Estoniae

2008-01-01

Ööklubi Club von Überlingen (Madara 22A, Tallinn) sisekujundusest. Sisearhitekt: Taavi Aunre (Boom.ee OÜ). Taavi Aunrest, tema tähtsamad tööd. I-II korruse plaan, 11 värv. vaadet, foto T. Aunrest

Madame Olga Givernet, Députée de la 3ème circonscription de l’Ain, République française, vendredi 16 février 2018

CERN Multimedia

Caraban Gonzalez, Noemi

2018-01-01

Madame Olga Givernet Députée 3ème circonscription de l’Ain. Participants CERN, Signature du livre d’or. M. Frédérick Bordry Directeur des accélérateurs et de la technologie Mme Fabiola Gianotti Directrice générale

Narkootilise ja psühhotroopse aine suures koguses ebaseaduslik käitlemine suure varalise kasu saamise eesmärgil : [magistritöö] / Kerli Lepik ; Tartu Ülikool, õigusteaduskond ; juhendaja: Jaan Ginter

Index Scriptorium Estoniae

Lepik, Kerli, 1989-

2013-01-01

Suures koguses narkootilise ja psühhotroopse aine käsitlemisest, suure varalise kasu saamise eesmärgist, võrdlus teiste Euroopa riikidega (EL, Läti, Leedu, Soome, Norra, Tšehhi), suurest varalisest kasust kui koosseisutunnusest ja alternatiividest

1. VII avati Rael Arteli galerii kaks väljapanekut

Index Scriptorium Estoniae

2004-01-01

Fotogaleriis on väljas Andreas W kureeritud "Puudumise kohalolu", mis koosneb Tartu Kõrgema Kunstikooli fotograafia üliõpilaste Madis Katzi, Taavi Piibemanni, Riho Peikeri, Alan Proosa ja Kaisa Eiche ning Toomas Kalve ja Alan Rossi töödest. Audiogaleriis eksponeerib oma helindeid Taavi Tulev

Application of electrical geophysics to the release of water resources, case of Ain Leuh (Morocco)

Science.gov (United States)

Zitouni, A.; Boukdir, A.; El Fjiji, H.; Baite, W.; Ekouele Mbaki, V. R.; Ben Said, H.; Echakraoui, Z.; Elissami, A.; El Maslouhi, M. R.

2018-05-01

Being seen needs in increasing waters in our contry for fine domestics, manufactures and agricultural, the prospecting of subterranean waters by geologic and hydrogeologic classic method remains inaplicable in the cases of the regions where one does not arrange drillings or polls (soundings) of gratitude (recongnition) in very sufficient (self-important) number. In that case of figure, the method of prospecting geophysics such as the method of nuclear magnetic resonance (NMR) and the method of the geophysics radar are usually used most usually because they showed, worldwide, results very desive in the projects of prospecting and evaluation of the resources in subterranean waters. In the present work, which concerns only the methodology of the electric resistivity, we treat the adopted methodological approach and the study of the case of application in the tray of Ajdir Ain Leuh.

Otvetshajet Taavi Aas, vitse-mer Tallinna / Taavi Aas

Index Scriptorium Estoniae

Aas, Taavi, 1966-

2006-01-01

Tallinna linnavalitsus kuulutas välja konkursi ning valib välja ehitusettevõtted, kes remondivad koolid ja 30 aasta jooksul kannavad remondi- ja ekspluatatsioonikulusid, linn maksab firmadele renditasu. Selgitusi jagab Tallinna abilinnapea

Water-rock interaction and geochemistry of groundwater from the Ain Azel aquifer, Algeria.

Science.gov (United States)

Belkhiri, Lazhar; Mouni, Lotfi; Tiri, Ammar

2012-02-01

Hydrochemical, multivariate statistical, and inverse geochemical modeling techniques were used to investigate the hydrochemical evolution within the Ain Azel aquifer, Algeria. Cluster analysis based on major ion contents defined 3 main chemical water types, reflecting different hydrochemical processes. The first group water, group 1, has low salinity (mean EC = 735 μS/cm). The second group waters are classified as Cl-HCO(3)-alkaline earth type. The third group is made up of water samples, the cation composition of which is dominated by Ca and Mg with anion composition varying from dominantly Cl to dominantly HCO(3) plus SO(4). The varifactors obtained from R-mode FA indicate that the parameters responsible for groundwater quality variations are mainly related to the presence and dissolution of some carbonate, silicate, and evaporite minerals in the aquifer. Inverse geochemical modeling along groundwater flow paths indicates the dominant processes are the consumption of CO(2), the dissolution of dolomite, gypsum, and halite, along with the precipitation of calcite, Ca-montmorillonite, illite, kaolinite, and quartz. © Springer Science+Business Media B.V. 2011

Mis on parem - Zaporozhets või Mercedes? / Andres Langemets

Index Scriptorium Estoniae

Langemets, Andres, 1948-

2007-01-01

Vastukaja Mikko Lagerspetzi artiklile 5. dets. Postimehes, mis oli omakorda vastukaja Jaak Aaviksoo artiklile 19. nov. Postimehes. Sotsioloogiast, sotsiaalteadlastest ja sotsioloogilistest küsitlustest

Jõekääru Jazz täitis eesmärgi nii korraldajate, esinejate kui publiku poolelt / Allan Liik, Hedvig Hanson, Andre Maaker, Ain Agan...[jt.] ; foto ja küsitl. Kaire Tensuda

Index Scriptorium Estoniae

2007-01-01

Jõekääru Jazz'ile järgneval nädalal tõi ürituse peakorraldaja Allan Liik toimetusse seal esinenud muusikud. Vestlusringis olid: Allan Liik, Hedvig Hanson, Andre Maaker, Ain Agan, Raivo Tafenau ja Sergio Bastos

Tallinna Sakala keskuse projekt kütab kirgi / Aivo Vahemets

Index Scriptorium Estoniae

Vahemets, Aivo

2004-01-01

Raine Karbi projekteeritud hoone ümberehituse projekt telliti Inglismaalt büroost Burrow&Cave, OÜ Arhitektuuriagentuuri projektist loobuti. Eesti Arhitektide Liidu esinaise Margit Mutso ja arhitektuurinõukogu esimehe Peep Aaviksoo kommentaar

Dead Men Risen: Estonian defence minister accuses me of 'fiction' and 'does not rule out going to court'

Index Scriptorium Estoniae

Harnden, Toby

2011-01-01

Raamatu "Dead Men Risen" autor räägib oma blogis Eesti kaitseministri Jaak Aaviksoo ja president Toomas Hendrik Ilvese reageeringutest teosele, kus on juttu ka Afganistanis teeninud Eesti kaitseväelastest

Afganistani draama: mida hukkunud Eesti sõdurite kohta varjata püütakse? / Teet Teder, Maarius Suviste

Index Scriptorium Estoniae

Teder, Teet

2011-01-01

Toby Harndeni raamatust "Dead Men Risen", kus on juttu ka Afganistanis teeninud Eesti kaitseväelastest. Kaitseminister Jaak Aaviksoo ja president Toomas Hendrik Ilvese reageeringutest. Vt. ka lk. 10: Uudam, Laur. Eetikapomm

Evaluation of the impact of water harvesting techniques on the evolution of piezometric head of Ain El Bidha groundwater in Kairouan at the Central part of Tunisia

Science.gov (United States)

Mechergui, M. Mohamed; Henda Saoudi, Mme

2016-04-01

This study aims to assess the impact of water harvesting constructed hydraulic structures (big and small dams, terraces, seuils for recharge…) on the evolution of piezometric head of Ain El Beidha groundwater table. The measurements of depth of water table, taken at the end of rain season and at the end of irrigation season, in many piezometers and monitoring wells, for a long period of observation before and after implementation of all the hydraulic structures, were used with the cumulative rain to the highest water table to diagnostic the effect of natural recharge and constructed hydraulic structures. According to the analysis of curves illustrating the evolution of piezometric head and rainfall over time, it was shown that despite the fact that the same amount of rain fall on the total area in the limits of Ain El Beidha groundwater table, the piezometers respond differently. This is because there are many sources of recharge and many factors affecting the recharge. First of all, the aquifer is divided in four compartments (the calcareous formation of Djebel El Houyareb, the plio-quaternary formation, the Miocene formation: Baglia and Saouaf). All those respond differently to the recharge by their capacity of infiltration and their hydrodynamic characteristics. The recharge of the groundwater table was increased by the implementation of small soil and water conservation structures, artificial lakes, El Haouareb Dam, run off in the natural Oued bads and seuils for recharge installed in the bads of oueds. The different piezometric drown maps were used to determine the flow direction and hydraulic gradient in order to identify the recharge areas, while tracking maps for three equal piezometric heads 210 m 300 m and 370 m established over different years made it possible to assess the impact of hydraulic structures, namely the effect of SWC and Ben Zitoun Lake. To illustrate the impact of El Houareb dam on the groundwater, the piezometric maps and local values

Two-state solutions

Index Scriptorium Estoniae

2011-01-01

16. detsembril Tartus toimunud Eesti-Läti koostöökonverentsist võtsid osa ka mõlema riigi peaministrid Andrus Ansip ja Valdis Dombrovskis. Kohal olid ka haridusministrid Jaak Aaviksoo ja Roberts Kilis

Climate change and their consequences on coastal zone of Ain el Turck in Oran

Directory of Open Access Journals (Sweden)

Mohammed Tewfik Bouroumi

2017-12-01

Full Text Available Algeria does not escape the problem of the climate change, its geographical position in zone of transition, and its dry and semi-arid climate, in fact a very vulnerable space. In Algeria, approximately two thirds of the population is concentrated on the coast which represents only 4 % of the territory. The Mediterranean coast, in particular in Algeria, is subjected to pressures: financial stakes, climatic risks, pollutions and conservation of the water. It is on the basis of the critical and objective report with regard to a wild urbanization of the Algerian coast as well as the influence of the demographic pressure that the choice of the search for this article was held. This publication has for objective to raise (to draw up a current situation (inventory of fixtures of the sector of the environment in Algeria and to present through the case of the coastal city of Oran the consequences of climate change. We propose, to review the situation through the case of the municipality of Ain El Türck, by basing itself on data relative to the evolution of the temperatures and the sea level.

Estudio biofarmacéutico de geles antiinflamatorios no esteroideos (AINES

Directory of Open Access Journals (Sweden)

Margarita Restrepo

2000-02-01

Full Text Available

Los antiinflamatorios no esteroideos (AINES son un grupo heterogéneo de compuestos con actividad analgésica, antipirética y antiinflamatoria que comparten efectos secundarios indeseables, tales como: ulceración gástrica e intestinal, anemia, bloqueo de la agregación plaquetaria, inhibición de la motilidad uterina e hipersensibilidad. Los AINES se utilizan por vía tópica con el fin de aliviar lesiones en tejidos blandos a los cuales puede llegarse directamente a través de la piel, evitando así los efectos colaterales indeseables.

Actualmente para la gran mayoría de los medicamentos se exige valorar la Biodisponibilidad como criterio de calidad. Biodisponibilidad se define como la cantidad de fármaco que llega a sangre o plasma después de la administración del medicamento que lo contiene y la velocidad a la cual este proceso ocurre; esta determinación de Biodisponibilidad no resulta útil en el caso de medicamentos que se administran a través de la piel y no alcanzan circulación sistémica; la biodisponibilidad relativa o Bioequivalencia es la comparación de las biodisponibilidades de dos medicamentos para determinar si son similares en su comportamiento farmacocinético dentro del organismo.

El presente trabajo pretende estandarizar y validar un método que permita determinar concentraciones de fármaco en tejidos, en este tipo de medicamentos administrados por vía tópica, que no alcanzan circulación sistémica y por lo tanto no pueden ser cuantificados en sangre o plasma; además pretendemos que esta metodología pueda ser propuesta como una técnica para determinar biodisponibilidad y/o bioequivalencia para este tipo de productos. Para lograr estos objetivos, inicialmente, se induce la inflamación a un grupo

Samaja bolshaja stroiploshtshadka v Estonii / Konstantin Morenko

Index Scriptorium Estoniae

Morenko, Konstantin

2004-01-01

Tallinna linnavalitsus korraldas ümarlaua linna rannaalade hetkeseisu ja arenguvõimaluste hindamiseks, mille töös osalesid ka Euroopa tuntud linnaplaneerimise konsultandid. Arvamust avaldavad Peep Aaviksoo, Lutz Schleich, Giorgio Risicaris ja Stefan Boltz

Vene kriis kukutas Norma juhid / Raul Ranne

Index Scriptorium Estoniae

Ranne, Raul

1998-01-01

AS Norma vallandas ettevõtte tegevjuhi Peep Aaviksoo, sest ei olnud rahul ettevõtte tegevusega Venemaal. Tabelid: Norma aktsia on kukkunud, Norma kuukasum miinuses. Ilmunud ka: Delovõje Vedomosti, 9. sept. 1998, lk. 10

Eestikeelne doktoriõpe ähvardab kaduda / Eva Kübar

Index Scriptorium Estoniae

Kübar, Eva

2005-01-01

Eestikeelse doktoriõppe võimalikku kadumist kommenteerivad Tallinna Tehnikaülikooli õppeprorektor Jakob Kübarsepp, Tartu Ülikooli rektor Jaak Aaviksoo, Eesti Põllumajandusülikooli õppeprorektor Hardi Tullus ja Tallinna Ülikooli rektor Mati Heidmets

Vabadussõja võidusammas valmib Tšehhi klaasitehases / Dannar Leitmaa, Urmas Jaagant

Index Scriptorium Estoniae

Leitmaa, Dannar, 1982-

2008-01-01

Eesti kaitseminister Jaak Aaviksoo ja Tšehhi klaasivabriku Sans Souci esindaja Martin Chab allkirjastasid lepingu, mille kohaselt tšehhid projekteerivad, valmistavad ja püstitavad 15. oktoobriks Tallinna Vabaduse väljakule võidusamba

Vitamin D deficiency among healthy adolescents in Al Ain, United Arab Emirates

Science.gov (United States)

2013-01-01

Background Although vitamin D deficiency has been studied in various adult populations, there are few data on the prevalence of this nutritional deficiency among healthy adolescents in the United Arab Emirates (UAE). This study was conducted to determine the prevalence of vitamin D deficiency and to examine its correlates in adolescents aged 15 to 18 years. Methods This was a cross-sectional study in urban schools. Healthy adolescents (N=315) from a sample of 8 schools were randomly selected from the 142 schools in Al Ain, Abu Dhabi Emirate. Outcomes measured included serum concentrations of 25-hydroxy vitamin D (25OHD), plasma lipids, blood sugar, blood pressure and anthropometric data, nutrition and lifestyle variables. Results Fourty-one participants (19.7%) were vitamin D deficient (serum 25OHD level ≤15 ng/mL [≤37.5 nmol/L]. Using a cutoff level of 25(OH) D of ≤20 ng/ml [≤50 nmol/l] 143 participants (45.4%) were vitamin D insufficient. Overall 65.1% of study participants were either vitamin D deficient or insufficient. The prevalence of vitamin D deficiency varied between boys (10%) and girls (28%). In a final multivariate model, serum 25(OH) D concentrations were inversely correlated with female gender, consumption of fast food per week, and body mass index and positively correlated with physical activity scores after adjustment for age. Conclusions Vitamin D deficiency and insufficiency were highly prevalent in adolescents, and more common in girls. PMID:23311702

Application of a TiAIN coating for the increase wear resistance of a passage floodgate manufactured in steel T9; Aplicacion de un recubrimiento de TiAIN para el incremento de la resistencia al desgaste de una compuerta de paso fabricada en acero T9

Energy Technology Data Exchange (ETDEWEB)

Montes de Oca, J.; Gonzalez, H. J. [Centro de Investigacion en Ciencia Aplicada y Tecnologia Avanzada, IPN, Unidad Altamira, Km. 14.5 Carretera Tampico-Puerto industrial Altamira, 89600 Altamira, Tamaulipas (Mexico); Solis, E. [Hy-Teck Fluid Power, Blvd. A. Lopez Mateos No. 310, Col. Nuevo Aeropuerto, 89337 Tampico, Tamaulipas (Mexico); Moreno, J. [Departamento de Ingenieria Metalurgica, Escuela Superior de Ingenieria Quimica e Industrias Extractivas, IPN, UPALM Unidad Zacatenco, 07730 Mexico D. F. (Mexico); Munoz S, J. [Centro de Investigacion y de Estudios Avanzados, Unidad Queretaro, Libramiento Norponiente No. 2000, Fracc. Real de Juriquilla, 76230 Santiago de Queretaro, Queretaro (Mexico)], e-mail: jmontedeocav@ipn.mx

2009-07-01

The present work reports a study to increase wear resistance of a ball passage floodgate (steel type T9) trough the application of a thick film (coating). This study have included a material and process selection, synthesis of the coating on steel plates as substrates and spherical device, assembling of the coated floodgate on the ball valves, and finally an evaluation of the valves in the process of a thermoelectric power station. Taking into account the different requirements, a TiAIN coating prepared by cathodic arc evaporation was finally retained. The crystal structure, morphology and chemical composition of the coating were evaluated by x-ray diffraction (XRD) and scanning electron microscopy equipped with an energy dispersive spectrometer (SEM-EDS). Finally, mechanical properties such as hardness and Young modulus were determined by nano indentation. (Author)

Application of a TiAIN coating for the increase wear resistance of a passage floodgate manufactured in steel T9

International Nuclear Information System (INIS)

Montes de Oca, J.; Gonzalez, H. J.; Solis, E.; Moreno, J.; Munoz S, J.

2009-01-01

The present work reports a study to increase wear resistance of a ball passage floodgate (steel type T9) trough the application of a thick film (coating). This study have included a material and process selection, synthesis of the coating on steel plates as substrates and spherical device, assembling of the coated floodgate on the ball valves, and finally an evaluation of the valves in the process of a thermoelectric power station. Taking into account the different requirements, a TiAIN coating prepared by cathodic arc evaporation was finally retained. The crystal structure, morphology and chemical composition of the coating were evaluated by x-ray diffraction (XRD) and scanning electron microscopy equipped with an energy dispersive spectrometer (SEM-EDS). Finally, mechanical properties such as hardness and Young modulus were determined by nano indentation. (Author)

Taas teadmusühiskonna infopoliitikast / Silvi Metsar

Index Scriptorium Estoniae

Metsar, Silvi

2004-01-01

RRis toimunud II infopoliitika foorumil "Riiklik infopoliitika - müüt või tegelikkus" arutleti, kas Eestis on infoühiskond, milline on riiklik infopoliitika jne. Teiste seas osalesid Anu Toots, Tiiu Valm, Peeter Tulviste, Jaak Aaviksoo, Raul Malmstein

EXIGENCES TECHNIQUES DANS LA CONSTRUCTION ET REGLEMENTATION : ETUDE D’UN EXEMPLE DE LOGEMENT COLLECTIF A AIN-SMARA (ALGERIE

Directory of Open Access Journals (Sweden)

B BENRACHI

2002-12-01

Full Text Available La construction d’un édifice de qualité standard et répondant aux exigences techniques est   obtenue grâce au développement du savoir-faire et au respect des règles de l’art et de la réglementation en vigueur.  Une étude détaillée sur les  exigences techniques et le respect de la réglementation  d’un logement en collectif  nouvellement construit et inhabité à Ain-Smara, nous a montré  qu’il y a une satisfaction pour certaines d'entre-elles et une non-conformité pour d’autres. Il en résulte que le degré de satisfaction de ce logement est inférieur à celui recommandé dans le cadre de la réglementation, ce qui diminue sa qualité par rapport au standard exigé.

Tartu Ülikooli 86. aastapäeva tähistamine Torontos : "Põhjamaine järjekindlus ja hiinlase kannatus" / Tiina Ann Kirss ; fotod: V. Sarapuu

Index Scriptorium Estoniae

Kirss, Tiina, 1957-

2005-01-01

aktusega Tartu Collegéis 27. novembril 2005. Ülikooli rektor Jaak Aaviksoo analüüsis oma kõnes TÜ arenguvõimalusi ja päevamuresid, Tiina Kirss esitas sissevaate ülikooli ajalukku, muusikalises osas esinesid Kaili ja Riho Maimets

USA moos määrib Eesti naabritest mõjukamaks / Raimo Poom

Index Scriptorium Estoniae

Poom, Raimo

2007-01-01

Sel sügisel on toimunud mitu Eesti ja USA poliitikute kohtumist. Peaminister Andrus Ansipi ja kaitseminister Jaak Aaviksoo USA-visiitide korraldamisega kursis olevad ametnikud ei nõustu, et kohtumiste taga oleks olnud USA lobitöö Iraagi missiooni pikendamiseks

Klaasist võidusammas tuleb kõigi kirgede kiuste

Index Scriptorium Estoniae

2008-01-01

Tallinna Harjumäele kavandatava Vabadussõja võidusamba projekteerib, valmistab ja püstitab Tšehhi klaasifirma Sans Souci oktoobri keskpaigaks. Monument on plaanis avada 28. novembril 2008. Kommenteerib Jaak Aaviksoo. Vaata ka juhtkirja "Ässitajad arhitektid" lk. 2

Eesti rahvusliku tahte triumf? / Tarmo Jüristo

Index Scriptorium Estoniae

Jüristo, Tarmo

2010-01-01

Autor analüüsib kaitseminister Jaak Aaviksoo Tartu rahu aastapäevale pühendatud kõnet, milles kaitseminister viitas tahtmatult 1934. aasta propagandafilmile "Tahte triumf" ("Triumph des Willens"), mis kujutas Adolf Hitleri saabumist natsionaalsotsialistliku partei Nürnbergi konverentsile

Tallinna võim on libastumine?

Index Scriptorium Estoniae

2005-01-01

Elmar Sepp ja Tõnis Palts vastavad küsimusele, mis puudutab Taavi Veskimäe väidet, et Res Publica koostöö Tallinnas on Res Publica suurima poliitilise libastumise tagajärg. Elmar Sepp ei välista sügisestel valimistel Keskerakonna ja Res Publica koostöö jätkumist Tallinnas, tema sõnul ei ole Keskerakond mitte totalitaarne, vaid Eesti üks demokraatlikumaid erakondi. Vt. samas: Katkend Taavi Veskimäe kõnest Res Publica üldkogul

Associations of cardiovascular risk factors in Al Ain- United Arab Emirates

Directory of Open Access Journals (Sweden)

Nazirudeen Mohammad K

2009-04-01

Full Text Available Abstract Background Over the last 30 years the citizens of the United Arab Emirates have experienced major changes in life-style secondary to increased affluence. Currently, 1 in 5 adults have diabetes mellitus, but the associations (clustering among risk factors, as well as the relevance of the concept of the metabolic syndrome, in this population is unknown. Aim To investigate the prevalence and associations among cardiovascular risk factors in this population, and explore to what extent associations can be explained by the metabolic syndrome according to ATP-III criteria. Method A community based survey, of conventional risk factors for cardiovascular disease was conducted among 817 national residents of Al Ain city, UAE. These factors were fasting blood sugar, blood pressure, lipid profile, BMI, waist circumference, smoking, or CHD family history. Odds ratios between risks factors, both unadjusted and adjusted for age and sex as well as adjusted for age, sex, and metabolic syndrome were calculated. Results Various risk factors were positively associated in this population; associations that are mostly unexplained by confounding by age and sex. For example, hypertension and diabetes were still strongly related (OR 2.5; 95% CI 1.7–3.7 after adjustment. An increased waist circumference showed similar relationship with hypertension (OR 2.3; 95% CI 1.5–3.5. Diabetes was related to an increased BMI (OR 1.5; 96% CI 1.0–2.3. Smoking was also associated with diabetes (OR 1.9, 95% CI 1.0–3.3. Further adjustment for metabolic syndrome reduced some associations but several remained. Conclusion In this population risk-factors cluster, but associations do not appear to be explained by the presence/absence of the ATP-III metabolic syndrome. Associations provide valuable information in planning interventions for screening and management.

Associations of cardiovascular risk factors in Al Ain- United Arab Emirates

Science.gov (United States)

Baynouna, Latifa M; Revel, Anthony D; Nagelkerke, Nico JD; Jaber, Tariq M; Omar, Aziza O; Ahmed, Nader M; Nazirudeen, Mohammad K; Al Sayed, Mamdouh F; Nour, Fuad A; Abdouni, Sameh

2009-01-01

Background Over the last 30 years the citizens of the United Arab Emirates have experienced major changes in life-style secondary to increased affluence. Currently, 1 in 5 adults have diabetes mellitus, but the associations (clustering) among risk factors, as well as the relevance of the concept of the metabolic syndrome, in this population is unknown. Aim To investigate the prevalence and associations among cardiovascular risk factors in this population, and explore to what extent associations can be explained by the metabolic syndrome according to ATP-III criteria. Method A community based survey, of conventional risk factors for cardiovascular disease was conducted among 817 national residents of Al Ain city, UAE. These factors were fasting blood sugar, blood pressure, lipid profile, BMI, waist circumference, smoking, or CHD family history. Odds ratios between risks factors, both unadjusted and adjusted for age and sex as well as adjusted for age, sex, and metabolic syndrome were calculated. Results Various risk factors were positively associated in this population; associations that are mostly unexplained by confounding by age and sex. For example, hypertension and diabetes were still strongly related (OR 2.5; 95% CI 1.7–3.7) after adjustment. An increased waist circumference showed similar relationship with hypertension (OR 2.3; 95% CI 1.5–3.5). Diabetes was related to an increased BMI (OR 1.5; 96% CI 1.0–2.3). Smoking was also associated with diabetes (OR 1.9, 95% CI 1.0–3.3). Further adjustment for metabolic syndrome reduced some associations but several remained. Conclusion In this population risk-factors cluster, but associations do not appear to be explained by the presence/absence of the ATP-III metabolic syndrome. Associations provide valuable information in planning interventions for screening and management. PMID:19371412

USA kaitseminister Robert Gates süüdistas liitlasvägesid oskamatuses / Evelyn Kaldoja

Index Scriptorium Estoniae

Kaldoja, Evelyn, 1980-

2008-01-01

USA kaitseminister Robert Gates väitis ajalehes The Los Angeles Times avaldatud intervjuus, et Lõuna-Afganistani olukord on halvenenud seal võitlevate USA liitlasvägede puuduliku väljaõppe tõttu. Liitlasriikide reageeringuid. Arvamust avaldavad Jaak Aaviksoo, Kaarel Kaas

Tagurpidi pööratud poliitika / Ivar Tallo

Index Scriptorium Estoniae

Tallo, Ivar, 1964-

2009-01-01

Autor näeb vastuolu seoses vaidlusega kaitseväelaste õiguse üle määrata enda hukkumishüvitise saaja: konservatiivse IRL-i minister Jaak Aaviksoo kaitseb sõdurite valikuvabadust ning liberaalist Reformierakonna minister Jürgen Ligi tahaks sõdurite eest otsustada

Ilves lennutati käepigistuseks hiiglaslikule sõjalaevale / Rasmus Kagge

Index Scriptorium Estoniae

Kagge, Rasmus, 1977-

2007-01-01

President Toomas Hendrik Ilves, Riigikogu esimees Ene Ergma, kaitseväe juht Ants Laaneots, kaitseminister Jaak Aaviksoo ja mitu parlamendiliiget külastasid Vahemeres seilavat maailma esimest tuumajõu abil liikuvat lennukikandjat USS Enterprise. Vabariigi Presidendi visiit Ameerika Ühendriikide sõjalaevastiku lennukikandjale USS Enterprise

Riigijuhtide riskialdis õhulend / Oliver Rand

Index Scriptorium Estoniae

Rand, Oliver, 1971-

2007-01-01

President Toomas Hendrik Ilves, Riigikogu esimees Ene Ergma, kaitseminister Jaak Aaviksoo, kaitseväe juhataja Ants Laaneots, Riigikogu riigikaitsekomisjoni esimees Mati Raidma koos kaaskonnaga lendasid USA lennukikandjale USS Enterprise ühes lennukis. Riigi võtmeisikute üheskoos reisimisega kaasnevatest turvariskidest. Vt. samas: Mujal karmimad meetmed

Äpardunud sambameistrid said viimaks hundipassi / Urmas Jaagant, Tuuli Aug ; kommenteerinud Rainer Sternfeld

Index Scriptorium Estoniae

Jaagant, Urmas

2009-01-01

Tšehhi firma Sans Souci ei suutnud Vabadussõja võidusamba ristiosa valgustust rahuldaval määral tööle saada. Uue valguslahenduse leidmiseks on kaitseminister Jaak Aaviksoo palunud algatada riigihanke. Vabadussamba autori Rainer Sternfeldi arvamus tšehhide kehva töö kohta

Pediatric and youth traffic-collision injuries in Al Ain, United Arab Emirates: a prospective study.

Science.gov (United States)

Grivna, Michal; Eid, Hani O; Abu-Zidan, Fikri M

2013-01-01

To study the mechanism of road traffic collisions (RTC), use of safety devices, and outcome of hospitalized pediatric and youth RTC injured patients so as to give recommendations regarding prevention of pediatric RTC injuries. All RTC injured children and youth (0-19-year-olds) who were admitted to Al Ain City's two major trauma centers or who died after arrival to these centers were prospectively studied from April 2006 to October 2007. Demography of patients, road-user and vehicle types, crash mechanism, usage of safety devices, injured body regions, injury severity, Revised Trauma Score, Glasgow Coma Scale, intensive care unit admissions, hospital stay and mortality were analyzed. 245 patients were studied, 69% were vehicle occupants, 15% pedestrians, 9% motorcyclists and 5% bicyclists. 79% were males and 67% UAE citizens. The most common mechanism of RTC was rollover of vehicle (37%) followed by front impact collision (32%). 32 (13%) of vehicle occupants were ejected from car. 63% of ejected occupants and 70% of motorcyclists sustained head injuries. Only 2% (3/170) vehicle passengers used seatbelts and 13% (3/23) motorcyclists a helmet. Male drivers and UAE nationals were at high risk of RTC as drivers and as motorcyclists. Ejection rate was high because safety restraint use was extremely low in our community. More education and law enforcement focusing especially on car/booster seat use is needed.

Deformation history of the Neoproterozoic basement complex, Ain Shams area, Western Arabian Shield, Saudi Arabia

Science.gov (United States)

El-Fakharani, Abdelhamid; Hamimi, Zakaria

2013-04-01

Ain Shams area, Western Arabian Shield, Saudi Arabia, is occupied by four main rock units; gneisses, metavolcanics, metasediments and syn- to post-tectonic granitoids. Field and structural studies reveal that the area was subjected to at least three phases of deformation (D1, D2 and D3). The structural features of the D1 are represented by tight to isoclinal and intrafolial folds (F1), axial plane foliation (S1) and stretching lineations (L1). This phase is believed to be resulted from an early NW-SE contractional phase due to the amalgamation between Asir and Jeddah tectonic terranes. D2 deformation phase progressively overprinted D1 structures and was dominated by thrusts, minor and major F2 thrust-related overturned folds. These structures indicate a top-to-the-NW movement direction and compressional regime during the D2 phase. Emplacement of the syn-tectonic granitoids is likely to have occurred during this phase. D3 structures are manifested F3 folds, which are open with steep to subvertical axial planes and axes moderately to steeply plunging towards the E, ENE and ESE directions, L3 is represented by crenulation lineations and kink bands. These structures attest NE-SW contractional phase, concurrent with the accretion of the Arabian-Nubian Shield (ANS) to the Saharan Metacraton (SM) and the final assembly between the continental blocks of East and West Gondwana.

Aaviksoo võistleb Donald Trumpiga

Index Scriptorium Estoniae

2007-01-01

Peep Aaviksoole ja tema äripartneritele kuuluv IPC Investment tegeleb Rumeenias lisaks kinnisvarainvesteeringutele ka ehitusmaterjalide tootmisega. USA kinnisvaramagnaat Donald Trump on otsustanud riiki investeerida miljard eurot

Pediatric and youth traffic-collision injuries in Al Ain, United Arab Emirates: a prospective study.

Directory of Open Access Journals (Sweden)

Michal Grivna

Full Text Available AIM: To study the mechanism of road traffic collisions (RTC, use of safety devices, and outcome of hospitalized pediatric and youth RTC injured patients so as to give recommendations regarding prevention of pediatric RTC injuries. METHODS: All RTC injured children and youth (0-19-year-olds who were admitted to Al Ain City's two major trauma centers or who died after arrival to these centers were prospectively studied from April 2006 to October 2007. Demography of patients, road-user and vehicle types, crash mechanism, usage of safety devices, injured body regions, injury severity, Revised Trauma Score, Glasgow Coma Scale, intensive care unit admissions, hospital stay and mortality were analyzed. RESULTS: 245 patients were studied, 69% were vehicle occupants, 15% pedestrians, 9% motorcyclists and 5% bicyclists. 79% were males and 67% UAE citizens. The most common mechanism of RTC was rollover of vehicle (37% followed by front impact collision (32%. 32 (13% of vehicle occupants were ejected from car. 63% of ejected occupants and 70% of motorcyclists sustained head injuries. Only 2% (3/170 vehicle passengers used seatbelts and 13% (3/23 motorcyclists a helmet. CONCLUSIONS: Male drivers and UAE nationals were at high risk of RTC as drivers and as motorcyclists. Ejection rate was high because safety restraint use was extremely low in our community. More education and law enforcement focusing especially on car/booster seat use is needed.

Estonian living in safest of times / Ella Karapetyan

Index Scriptorium Estoniae

Karapetyan, Ella

2010-01-01

Peaminister Andrus Ansip ütles kevadisi riigikaitsekursuseid avades, et tema hinnangul elab Eesti julgeoleku seisukohalt oma ajaloo ilmselt kõige turvalisemat etappi, olles NATO ja Euroopa Liidu liige. Kursuste avamistseremooniast võtsid osa ka kaitseminister Jaak Aaviksoo, välisminister Urmas Paet, siseminister Marko Pomerants ja kaitseväe juhataja kindralleitnant Ants Laaneots

Ruumiinstallatsioon "Epitsenter" / Taavi Suisalu

Index Scriptorium Estoniae

Suisalu, Taavi

2011-01-01

Lõputöö eesmärgiks oli tekitada ruum, milles oleks võimalik nihestada oma igapäevast ajataju ja tajuda olemise keset. Süstematiseeritakse teadmisi, kuidas ajast on mõeldud ning kuidas suudame seda tajuda. Ka ajakäsitustest eesti ja ameerika installatsioonikunstis. Praktiliseks osaks on ruumiinstallatsioon, mille eesmärgiks on narratiivse ja sensoorse tunnetuse/ajakäsitluse vastanduse läbi tekitada olukord, kus oleks võimalik võimendatult tajuda oleviku mitmetahulisust, aimata/kogeda millegi üldisema kohalolu

Varjamine: samba salalepingud tõid tšehhidele lisamiljoneid / Raimo Poom

Index Scriptorium Estoniae

Poom, Raimo

2010-01-01

Kaitseminister Jaak Aaviksoo ja Tšehhi klaasifirma sõlmisid 2009. a. lepingu muutmise lepingu koos paljude uute lisadega. Lepingu lisas nõudis kaitseminister kollase tooniga risti ringiosa paneelide väljavahetamist, kuid tookord teatas ministeerium, et paneelid vastavad esialgsel hinnangul kokkulepitule. Ministeeriumi avalike suhete osakonna juhataja Martin Jaško ja vandeadvokaat Martin Tamme selgitusi

Elamusi ujuvast linnast / Krister Kivi

Index Scriptorium Estoniae

Kivi, Krister, 1975-

2007-01-01

Reportaaž Eesti presidendi Toomas Hendrik Ilvese külaskäigust maailma pikimale ja maailma esimesele tuumajõul töötavale lennukikandjale USS Enterprise. Delegatsiooni kuulusid veel Riigikogu esimees Ene Ergma, kaitseväe juht Ants Laaneots, kaitseminister Jaak Aaviksoo, Riigikogu liikmed Sven Mikser ja Mati Raidma ning USA suursaadik Eestis Stanley Davis Phillips

Pora li zalezat v stabilizatsionnõi rezerv?

Index Scriptorium Estoniae

2005-01-01

Suhtumise kohta Rahvaliidu ettepanekusse loodusõnnetuste kahjude hüvitamiseks stabilisatsioonireservist avaldavad arvamust Taavi Veskimägi, Teet Kallasvee, Ester Tuiksoo, Mart Opmann ja Silver Vohu

Finance minister resigns amid fraud probe / Aleksei Gunter

Index Scriptorium Estoniae

Gunter, Aleksei, 1979-

2003-01-01

Rahandusminister Tõnis Paltsi tagasiastumisest. Uus kandidaat rahandusministri ametikohale on Res Publica parlamendifraktsiooni esimees ja rahanduskomisjoni liige Taavi Veskimägi. Kommentaarid Pakterminali juhatuse esimehelt Aadu Luukaselt

"Improtest" kui "improbleem" / Tõnis Kahu

Index Scriptorium Estoniae

Kahu, Tõnis, 1962-

2009-01-01

Improvisatsioonilise muusika kontserdisarjast "Improtest", sarja hooaja avakontserdist, kus esines prantsuse kitarrist Jean-Francois Pauvros. "Improtesti" eestvedajad Taavi Kerikmäe ja Mart Soo vastavad küsimustele

Värske uuring: tulumaksutagastus aitab igapäevakulusid kanda / Piret Suitsu

Index Scriptorium Estoniae

Suitsu, Piret

2010-01-01

Swedbanki Eraisikute Rahaasjade Teabekeskuse uuringust selgus, et Eesti elanikud vajavad toimetulekuks tulumaksutagastust. Teabekeskus korraldas ümarlaua, millest võtsid osa ka Eiki Nestor ja Taavi Rõivas. Diagrammid, tabel

Poka ihh petuhh ne kljunet / Irina Kablukova

Index Scriptorium Estoniae

Kablukova, Irina

2008-01-01

Transiidiekspert Raivo Vare arvab, et valitsus peaks planeerima majanduse tulevikku ja kuulama ettevõtjaid. Riigikogu liige Taavi Veskimägi arvab, et majandusolukord paneb ministreid ettevõtjaid kuulama

Teise korruse filmid Kanuti Gildi saalis : Zoova, Säde ja Piibemann

Index Scriptorium Estoniae

2008-01-01

Kanuti Gildi saali teisel korrusel filmiprogrammi "Teise korruse filmid" linastuvad täna Jasper Zoova filmid "Parallel Euro" ja "Armastuse barrikaadidel", Margit Säde "Failing Files", Taavi Piibemanni "Peategelased"

Kaitsevägi pani printerikulu summaga kümme korda mööda

Index Scriptorium Estoniae

2014-01-01

Vastukaja 8. mail Eesti Päevalehes ilmunud artiklile "Tahad rahu, muretse printer". Artiklit kommenteerivad Kaitseväe logistikakeskuse ülem kolonelleitnant Kalev Koidumäe ja peaminister Taavi Rõivas

Riigikogu aseesimeeste valimine tekitas paksu verd : Res Publical riigikogu juhatuses kaks kohta / Katrin Pauts

Index Scriptorium Estoniae

Pauts, Katrin, 1977-

2005-01-01

Riigikogu aseesimeesteks valiti Res Publica liige Taavi Veskimägi ja Keskerakonna liige Toomas Varek. Opositsiooniparteil Res Publica on nüüd juhatuses kaks kohta. Erakondade juhtpoliitikute kommentaare

Too Much Love Will Kill You / Ireene Viktor

Index Scriptorium Estoniae

Viktor, Ireene

2009-01-01

Tartu Uue Teatri lavastusest "Viimased korraldused neile, keda ma kunagi olen armastanud". Kontseptsioon, lavastus, helikujundus ja esitus Taavi Eelmaa ja Taavet Jansen. Esietendus 13. märtsil Kanuti Gildi saalis

Ekspert : mobiil-ID kasutamine valimistel turvariske ei tekita / Holger Roonemaa

Index Scriptorium Estoniae

Roonemaa, Holger

2008-01-01

E-valimiste projektijuhi Taavi Martensi väitel pole põhjust kahelda mobiil-ID turvalisuses. Valimiskomisjoni esimehe Heiki Sibula meelest peaks m-ID kaarte välja andma kodakondsus- ja migratsiooniamet

Sohranitsja li Baltiiskii tranzitnõi koridor? / Eteri Kekelidze

Index Scriptorium Estoniae

Kekelidze, Eteri, 1944-

2004-01-01

Tallinna sadamamaksude tõstmisesse suhtuvad rahandus- ja majandusminister erinevalt, Taavi Veskimägi seisab riigieelarve eest ja Andrus Ansip muretseb riigi tuleviku pärast. Akadeemik Bronshteini prognoosidest, Balti transpordikoridori tulevikust

Raplamaa kutsehariduse saatus pani poliitikud stressipalle mudima / Matis Song

Index Scriptorium Estoniae

Song, Matis, 1978-

2004-01-01

Põllumajandusminister Tiit Tammsaar, rahandusminister Taavi Veskimägi, Riigikogu liikmed Tunne Kelam, Leino Mägi ja Harri Õunapuu külastasid Raplamaad ning tutvusid kutse- ja täiendhariduse probleemidega

Linn ootab Siffi Kopli liinide ehituslepingut sõlmima / Urmas Seaver

Index Scriptorium Estoniae

Seaver, Urmas, 1973-

2007-01-01

Tallinna abilinnapea Taavi Aas räägib ärimees Endel Siffi firma OÜ Primos võimalusest Kopli liinide arendamiseks, toimunud konkursist Kopli liinide hoonestamiseks ning kohtulahendist vaidluses linna ja firma vahel

3,7 miljonit võimalust üksinduseks / Kai Tamm

Index Scriptorium Estoniae

Kutman, Kai, 1972-

2011-01-01

21. aprillil Berliinis Kulturbrauerei Kesselhausis esietendunud Age Veeroosi ooperist "Grid", libreto autor ja lavastaja Korneel Hamers, dirigent Taavi Kull, videokunstnik Julian bergheim, lavakujunduse autor Julia Rommel. Lk. 17 lühiintervjuu heliloojaga

Yoshiko Chuma Tallinnas

Index Scriptorium Estoniae

2001-01-01

17. aprillil Rotermanni Soolalaos tantsu ja muusikat ühendav õhtu, kus esinevad Taavi Kerikmäe, Priit Lehto ja New Yorgi koreograaf, lavastaja ja tantsija Yoshiko Chuma mono-performance'ga "Hurricane Holiday"

"Parlament 95" = "Parliament 95" / Ionel Lehari, Janno Roos ; kommenteerinud Illi Ong

Index Scriptorium Estoniae

Lehari, Ionel, 1967-

2015-01-01

Rändnäitus "Parlament 95" Eesti suuremate linnade kaubanduskeskustes. Autorid Janno Roos, Andres Labi (Ruumilabor), Ionel Lehari, Maret Põldre (Identity), Taavi Rull. Eesti Sisearhitektide Liidu aastapreemia 2014/2015 parima installatsiooni eest

Ruum peaks olema taustaks inimeste mõtetele ja kulgemistele / Mari Koger

Index Scriptorium Estoniae

Koger, Mari

2008-01-01

Autor oma seisukohtadest ja taotlustest sisekujunduses - isikupärast, viimistletusest, avatud voolavast ruumist, stiilide kontrastist ja vanade asjade väärtustamisest. Mari Koger peab koos Taavi Aunrega sisearhitektuuribürood Boom

Spatial and temporal variability in sedimentation rates associated with cutoff channel infill deposits: Ain River, France

Science.gov (United States)

Piégay, H.; Hupp, C.R.; Citterio, A.; Dufour, S.; Moulin, B.; Walling, D.E.

2008-01-01

Floodplain development is associated with lateral accretion along stable channel geometry. Along shifting rivers, the floodplain sedimentation is more complex because of changes in channel position but also cutoff channel presence, which exhibit specific overflow patterns. In this contribution, the spatial and temporal variability of sedimentation rates in cutoff channel infill deposits is related to channel changes of a shifting gravel bed river (Ain River, France). The sedimentation rates estimated from dendrogeomorphic analysis are compared between and within 14 cutoff channel infills. Detailed analyses along a single channel infill are performed to assess changes in the sedimentation rates through time by analyzing activity profiles of the fallout radionuclides 137Cs and unsupported 210Pb. Sedimentation rates are also compared within the channel infills with rates in other plots located in the adjacent floodplain. Sedimentation rates range between 0.65 and 2.4 cm a−1 over a period of 10 to 40 years. The data provide additional information on the role of distance from the bank, overbank flow frequency, and channel geometry in controlling the sedimentation rate. Channel infills, lower than adjacent floodplains, exhibit higher sedimentation rates and convey overbank sediment farther away within the floodplain. Additionally, channel degradation, aggradation, and bank erosion, which reduce or increase the distance between the main channel and the cutoff channel aquatic zone, affect local overbank flow magnitude and frequency and therefore sedimentation rates, thereby creating a complex mosaic of sedimentation zones within the floodplain and along the cutoff channel infills. Last, the dendrogeomorphic and 137Cs approaches are cross validated for estimating the sedimentation rate within a channel infill.

Kodu maamaksust vabaks! / Taavi Madiberk

Index Scriptorium Estoniae

Madiberk, Taavi

2008-01-01

Praeguse maamaksupoliitika mõjust ühiskonnas ja kodu maksustamise seaduslikkusest. Lisatud: Lehis, Lasse. Ceterum censeo - maamaks tuleb kaotada. - Vt.: http://www.maksumaksjad.ee/modules/smartsection/item.php?itemid=572

Näitusele Y-galeriis mahub ära kogu moos / Hanson Raimu

Index Scriptorium Estoniae

Hanson, Raimu, 1957-

2007-01-01

Interdistsiplinaarse avangardkultuuri festivali "Eclectica" raames on Y-galeriis avatud järgmised näitused: Eduard Zentshiku fotonäitus, Andrus Lauringsoni kapaskoop, Draama kavalehed, Ahhaa keskuse hologrammid, Taavi Piibemanni installatsioon "Kogu moos"

Trepp = Stair / Eve Arpo

Index Scriptorium Estoniae

Arpo, Eve

2006-01-01

Rakvere Vallimäe trepist. Laste vestlus trepil. Projekt: Kavakava. Autorid: Heidi Urb, Siiri Vallner. Trepi valem: Taavi Vallner. Insener: Marika Stokkeby. Projekt 2004, valmis 2005. Ill.: joonis, 7 värv. fotot

MR imaging findings of anterior interosseous nerve lesions

Energy Technology Data Exchange (ETDEWEB)

Dunn, Andrew J. [Royal Liverpool University Hospital, Department of Medical Imaging, Liverpool (United Kingdom); Salonen, David C. [University of Toronto, Toronto Western Hospital, Department of Medical Imaging, Toronto, Ontario (Canada); Anastakis, Dimitri J. [University of Toronto, Toronto Western Hospital, Division of Plastic Surgery, Toronto, Ontario (Canada)

2007-12-15

To study and characterise the MR imaging findings of lesions of the anterior interosseous nerve (AIN). Magnetic resonance imaging (MRI) findings of the forearm of ten patients referred to our institution with suspected AIN lesions were retrospectively studied. Five healthy volunteers with normal forearm MRI findings formed a control group. Two musculoskeletal radiologists assessed the forearm musculature for oedema in the distribution of the AIN, median, posterior interosseous and radial nerves on T2-weighted (T2W) fat-saturated sequences. T1-weighted (T1W) images were assessed and graded for the presence of muscle atrophy and fatty involution. Six patients had undergone surgical exploration; five of these had surgically confirmed AIN compression. Four patients had diagnoses other than AIN compression made on imaging features. Of the cases of proven AIN compression, oedema within the pronator quadratus (PQ) muscle was identified in all cases. PQ atrophy and fatty involution were seen in three (43%) surgically confirmed cases. Cases 2 and 3 also demonstrated oedema in the flexor digitorum profundus (FDP)1 and FDP2 muscles. These cases also showed oedema in the flexor-carpi radialis (FCR) and FDP3/FDP4 muscles, respectively. The four cases of non-AIN compression demonstrated muscle oedema patterns that were atypical for the AIN distribution. They included a rupture of the flexor pollicis longus (FPL) tendon, brachial neuritis, amyotrophic lateral sclerosis and compression of the proximal median nerve. MRI is a useful investigation in the diagnostic workup of AIN syndrome. AIN syndrome is likely when there is diffuse oedema of AIN innervated muscles on T2W fat-saturated images. The most reliable sign of an AIN lesion is oedema within the PQ. Oedema in the flexor carpi radialis, FDP3 and FDP4, although not in the classical distribution of the AIN, does not preclude the diagnosis of AIN syndrome. (orig.)

MR imaging findings of anterior interosseous nerve lesions

International Nuclear Information System (INIS)

Dunn, Andrew J.; Salonen, David C.; Anastakis, Dimitri J.

2007-01-01

To study and characterise the MR imaging findings of lesions of the anterior interosseous nerve (AIN). Magnetic resonance imaging (MRI) findings of the forearm of ten patients referred to our institution with suspected AIN lesions were retrospectively studied. Five healthy volunteers with normal forearm MRI findings formed a control group. Two musculoskeletal radiologists assessed the forearm musculature for oedema in the distribution of the AIN, median, posterior interosseous and radial nerves on T2-weighted (T2W) fat-saturated sequences. T1-weighted (T1W) images were assessed and graded for the presence of muscle atrophy and fatty involution. Six patients had undergone surgical exploration; five of these had surgically confirmed AIN compression. Four patients had diagnoses other than AIN compression made on imaging features. Of the cases of proven AIN compression, oedema within the pronator quadratus (PQ) muscle was identified in all cases. PQ atrophy and fatty involution were seen in three (43%) surgically confirmed cases. Cases 2 and 3 also demonstrated oedema in the flexor digitorum profundus (FDP)1 and FDP2 muscles. These cases also showed oedema in the flexor-carpi radialis (FCR) and FDP3/FDP4 muscles, respectively. The four cases of non-AIN compression demonstrated muscle oedema patterns that were atypical for the AIN distribution. They included a rupture of the flexor pollicis longus (FPL) tendon, brachial neuritis, amyotrophic lateral sclerosis and compression of the proximal median nerve. MRI is a useful investigation in the diagnostic workup of AIN syndrome. AIN syndrome is likely when there is diffuse oedema of AIN innervated muscles on T2W fat-saturated images. The most reliable sign of an AIN lesion is oedema within the PQ. Oedema in the flexor carpi radialis, FDP3 and FDP4, although not in the classical distribution of the AIN, does not preclude the diagnosis of AIN syndrome. (orig.)

Eesti luuletaja päris oma prantsuse luuleraamat. August Sanga, Jaan Krossi ja Ain Kaalepi loomingust 1960. aastail / An Estonian Poet’s Own Book of French Poetry. About the Works of August Sang, Jaan Kross and Ain Kaalep in the 1960s

Directory of Open Access Journals (Sweden)

Katre Talviste

2013-12-01

Full Text Available This article positions the translations of French verse works (plays and selected collections of individual poets that August Sang, Jaan Kross and Ain Kaalep made in the 1960s, onto the background of their own original works. At that time, August Sang translated four plays by Molière (The Misanthrope, Tartuffe, The School for Wives in 1961; Amphitryon in 1961, which have already been discussed in relation to the tradition of translating the French syllabic verse into Estonian, because these translations form a considerable part of the body of Estonian translations of French verse poetry. For Jaan Kross and Ain Kaalep, the wider context is created by the so-called free verse battles in the 1950s, to which we can link Kross’ translation of a selected collection of Éluard (Veel enne kostma peab, 1969 and Kaalep’s translation of a selected collection of Prévert (Kuidas portreteerida lindu, 1965. One of the two remaining translations by Kross, (Rostand’s Cyrano de Bergerac, 1964, can also be examined in relation to the problems of translating verse, but the other, (Béranger’s Laulud, 1963, should be discussed in the framework of intellectual and cultural resistance, a part of which was also the struggle put up for the existence of free verse in the 1950s and 1960s. Of August Sang’s original work, the article examines his collection of poems Võileib suudlusega (1963, written simultaneously with his translations of Molière’s plays and published right after them. Both the translations and the collection of original poems have attracted critics’ attention with their remarkable lack of linguistic constraint and simplicity. Although Sang has rarely voiced theoretical ideas about translation or explained his method, both his poetic image, outlined in the collection Võileib suudlusega, and his search for right words, reflected in the drafts of his translations, let us believe that the simplicity of expression and the avoidance of marked

Värske kõrvaga kuuldud uuest Eesti muusikast / Elo Masing

Index Scriptorium Estoniae

Masing, Elo

2011-01-01

Eksperimentaalset Eesti muusikat tutvustava heliplaadi "Estonian Music Now 2011 - Exploratory Music From Estonia" esitluskontserdist 31. oktoobril Londonis Cafe OTOs, kus esinesid duo Taavi Kerikmäe - Mart Soo, Taavo Remmel ning Free Tallinn Trio

Ot "Printsessõ Alissii" k "Hrabromu Rikki-Tikki-Tavi" / Eteri Kekelidze

Index Scriptorium Estoniae

Kekelidze, Eteri, 1944-

2000-01-01

Tallinna muusikateater Väike Ooper jõudis tagasi Moskva külalisetendustelt, kus Eesti Saatkonnas esitati Boriss Kisseljovi lasteooper ""Printsess Alicia". Sügisel valmistub lasteteater lavale tooma helilooja uut ooperit "Julge Rikki-Tikki- Taavi"

Koda = Koda / Ülar Mark, Kariina Kristiina Kaufmann, Kadri Tonto ; kommenteerinud Katrin Koov

Index Scriptorium Estoniae

Mark, Ülar, 1968-

2016-01-01

Minimalistliku vormiga eramu KODA Tallinnas, Järvekalda tee 33. Autorid Ülar Mark, Taavi Jakobson, Hannes Tamjärv, Kalev Ramjalg, Marek Strandberg. Arhitektid Ülar Mark, Kariina Kristiina Kaufmann, Kadri Tonto, Hannes Praks

Põgenemine pealinnast : Maardu, Tabasalu, Jüri / Aivo Vahemets

Index Scriptorium Estoniae

Vahemets, Aivo

2006-01-01

Arhitekt Taavi Kuninga kortermaja Maardus. Andri Kirsima ja Terje Susi korterelamud Jüris. Janno Põldme korruselamud Tabasalus. Põhiplaanid, välisvaated. Kommenteerivad kinnisvaraärimees Üllar Hinno, arhitektid Anne Valing ja Carolina Hunt

Kunstnikukeskne näitus / Heie Treier

Index Scriptorium Estoniae

Treier, Heie, 1963-

2016-01-01

Näitus "Pseudo" EKKMis. Kuraator Marten Esko, kujundaja Allan Appelberg, kunstnikud Dénes Farkas ja Taavi Talve, Dora García, Flo Kasearu, Jevgeni Zolotko, Kristiina Hansen ja Sigrid Viir ning Neeme Külm

Rahvaliit likvideerib Res Publica veeuputust / Janno Reiljan

Index Scriptorium Estoniae

Reiljan, Janno, 1951-2018

2005-01-01

Ilmunud ka: Molodjozh Estonii 1. august lk. 5. Selgitused Res Publica esimehe Taavi Veskimägi artiklile 25. juuli Postimehes "Pärast meid tulgu või veeuputus". Res Publica ja Rahvaliidu poliitika võrdlus

NATO "röövib" Eestilt kogu jõueliidi / Tuuli Koch

Index Scriptorium Estoniae

Koch, Tuuli

2008-01-01

Bukarestis toimuvatel NATO tippkohtumisega seotud üritustel esindavad Eestit president Toomas Hendrik Ilves, peaminister Andrus Ansip, välisminister Urmas Paet, kaitseminister Jaak Aaviksoo ja kaitseväe juhataja kindralmajor Ants Laaneots. Poliitikute päevakavast. President T. H. Ilves esineb NATO temaatikaga tegelevate noorteorganisatsioonide esindajate konverentsil ning mõttekoja German Marshall Fund korraldataval konverentsil "The Bucharest Conference". Vabariigi President töövisiidil Bukarestis 1.-3.04.2008

Tallinn jättis Sifi Kopli liinidest ilma

Index Scriptorium Estoniae

2007-01-01

Tallinna linnavalitsus andis korralduse kuulutada Kopli liinide hoonestusõiguse konkurss kehtetuks ja teha uus konkurss, sest konkursi võitja Endel Sifile kuuluv OÜ Primos Kinnisvara ei ole tulnud linnaga lepingut sõlmima. Taavi Aasa kommentaar

Metsaomanikud seadusterägastikus

Index Scriptorium Estoniae

2005-01-01

Metsaomanike probleemidest arutlevad Rapla keskkonnateenistuse metsanduse peaspetsialist Jüri Ehrpais, Erametsaliidu juhatuse liige Taavi Ehrpais, küttepuudega tegelev Mihkel Viikmaa ja metsaomanik Sirje Mett. Üles kirjut. Kristiina Viiron. Vt. samas: Erametsanduslikud ühendused

Flux in Tallinn

Index Scriptorium Estoniae

2004-01-01

Rahvusvahelise elektroonilise kunsti sümpoosioni ISEA2004 klubiõhtu "Flux in Tallinn" klubis Bon Bon. Eestit esindasid Ropotator, Ars Intel Inc., Urmas Puhkan, Joel Tammik, Taavi Tulev (pseud. Wochtzchee). Klubiõhtu koordinaator Andres Lõo

Pop / Tõnis Kahu

Index Scriptorium Estoniae

Kahu, Tõnis, 1962-

2003-01-01

Heliplaatidest: Tom Jones "Mr. Jones", Alva Noto + Ryuichi Sakamoto "Vrioon", Taavi Tulev "Televiisor on tuksis", Heath Yonaites "Rim of the Sun", Elephant Man "Higher Level", Steffen Basho-Junghans "Waters in Azure", Erasure "Other People's Songs"

Microsoft loob Eestis arenduskeskuse / Lauri Linnamäe

Index Scriptorium Estoniae

Linnamäe, Lauri

2008-01-01

Tarkvaraettevõte Microsoft rajab Eestisse arenduskeskuse, mis peaks koguma Eesti parimad e-lahendused ja tegema need kättesaadavaks Microsofti partneritele. Microsoft Eesti juhi Rain Laane, Wemedia juhi Taavi Kotka ja regionaalminister Siim-Valmar Kiisleri arvamusi

Interjer ofisa otrazhajet litso firmõ / Nelli Pello

Index Scriptorium Estoniae

Pello, Nelli

2008-01-01

Tallinnas Veerenni tänaval asuva MTV Eesti muusikakanali kontori kujundusest. Kujundasid Liina Vaino ja Raivo Raidvee. Tallinnas Kalamajas asuva disainibüroo Velvet tööruumide kujundusest. Kujundas Taavi Aunre. Kommenteerib sisearhitekt Kristiina Voolaid

Prokljatõje filmõ i dveri v nikuda / Dmitri Babitshenko

Index Scriptorium Estoniae

Babitshenko, Dmitri

2007-01-01

Ameerika režissöör ja maalikunstnik David Lynch esineb 7. novembril kinos Kosmos loenguga "Film, Creativity and Consciousness". Ka filmist "Inland Empire". Eestisse kutsujateks olid Veiko Õunpuu, Rain Tolk ja Taavi Eelmaa

Valge terror võistles Vabadussõjas punasega / Alo Lõhmus

Index Scriptorium Estoniae

Lõhmus, Alo

2010-01-01

Tallinna Ülikooli ajaloo instituudis kaitstud Taavi Minniku magistritööst selgub, et sõdiva Eesti Vabariigi repressioonides hukkus vähemalt sama palju või rohkemgi inimesi kui enamlaste korraldatud veretöödes

Eesti interjöörileiud

Index Scriptorium Estoniae

2007-01-01

Kaubamaja Noortemaailm, kus kurjad vanamehed riietuskabiinis - autorid Hannes Praks ja Kristjan Holm, kaasa tegid Hannes Starkopf, Jan Tomson ja Kalle Pruuden ning ööklubi Club von Überblingen Madara tänaval, sisearhitekt Taavi Aunre

Tööjõu maksukoormuse vähendamine parandab riigi konkurentsivõimet / Margit Aedla

Index Scriptorium Estoniae

Aedla, Margit, 1970-

2003-01-01

Res Publica liige, maksuküsimustega tegelev Taavi Veskimägi arvab, et hea maksusüsteem peaks tagama tasakaalu, sotsiaalse õigluse ja majanduskeskkonna atraktiivsuse. Lisad: Maksude kasutamise otstarbekus on tähtis ; Sõber ja vaenlane

Siim Nestor soovitab : Sola Muusika / Siim Nestor

Index Scriptorium Estoniae

Nestor, Siim, 1974-

2005-01-01

Üritusel Sola Muusika 25. veebr. Tallinna vanalinna kohvikus Kehrwieder esinevad austraalia muusik Electroteque, shoti artist Unknown Forces ja soome muusik Good Doc, plaate mängivad Taavi Laasit, Kaarel Kattai ja Kaarel Kirikmäe

Parts ei soovi Res Publica esimehe ametit / Tuuli Koch

Index Scriptorium Estoniae

Koch, Tuuli

2005-01-01

Kõige tõenäolisem kandidaat Res Publica juhi kohale on Taavi Veskimägi, aseesimeesteks kandideerivad Marko Mihkelson ja Henn Pärn. Res Publica fraktsiooni koosolekul leidis Mihhail Lotman, et erakond võiks olla feminiinsem

Res Publica ja Isamaaliit ühendavad jõud / Urmo Kübar, Rauno Veri

Index Scriptorium Estoniae

Kübar, Urmo, 1978-

2006-01-01

Res Publica esimees Taavi Veskimägi ja Isamaaliidu esimees Tõnis Lukas kirjutasid alla ühiste kavatsuste deklaratsioonile, milles nad teevad ettepaneku moodustada ühine erakond. Lisad: Erakonna Eesti Eest deklaratsioon; Lühiülevaade ajaloost

Muljeid rajajoonelt. Tagasivaade / Anneli Viilup

Index Scriptorium Estoniae

Viilup, Anneli

2011-01-01

Taavi Piibemanni ja Toomas Thetloffi võistlusnäitus "For Money, not Love" Tallinnas ArtDepoo galeriis 21.01.-24.02.2011. Võistluse võidab kunstnik, kes on suutnud 24. veebruariks oma loominguga rohkem eurosid teenida

Eesti noordisainerid rahvusvahelises koguteoses

Index Scriptorium Estoniae

2000-01-01

"Graphise" koguteoses "New Talent Design Annual 2000" on esindatud Eesti Kunstiakadeemia graafilise disaini üliõpilased (nüüdseks EKA lõpetanud) Taavi Torim (illustratsioon) ja Maris Lindoja (kaks postmargikavandit). Juhendajaks oli Jüri Hain

31. VIII avati Vaala galeriis...

Index Scriptorium Estoniae

2004-01-01

Näitus "Märkmed maalist. Eesti ja Leedu noor kunst". Kuraatorid Margaret Tali ja Milda Zvirblyte. Osalevad Maarit Murka, Tõnis Saadoja, Kristi Laanemäe, Vilius Vanagas, Agile Mazonaite, Jolanta Kyzikaite, Ieva Baranauskaite. Kõlab Taavi Laatsiti originaalmuusika

Syntheses, structural variants and characterization of AInM′S4 (A=alkali metals, Tl; M′ = Ge, Sn) compounds; facile ion-exchange reactions of layered NaInSnS4 and KInSnS4 compounds

International Nuclear Information System (INIS)

Yohannan, Jinu P.; Vidyasagar, Kanamaluru

2016-01-01

Ten AInM′S 4 (A=alkali metals, Tl; M′= Ge, Sn) compounds with diverse structure types have been synthesized and characterized by single crystal and powder X-ray diffraction and a variety of spectroscopic methods. They are wide band gap semiconductors. KInGeS 4 (1-β), RbInGeS 4 (2), CsInGeS 4 (3-β), TlInGeS 4 (4-β), RbInSnS 4 (8-β) and CsInSnS 4 (9) compounds with three-dimensional BaGa 2 S 4 structure and CsInGeS 4 (3-α) and TlInGeS 4 (4-α) compounds with a layered TlInSiS 4 structure have tetrahedral [InM′S 4 ] − frameworks. On the other hand, LiInSnS 4 (5) with spinel structure and NaInSnS 4 (6), KInSnS 4 (7), RbInSnS 4 (8-α) and TlInSnS 4 (10) compounds with layered structure have octahedral [InM′S 4 ] − frameworks. NaInSnS 4 (6) and KInSnS 4 (7) compounds undergo facile topotactic ion-exchange, at room temperature, with various mono-, di- and tri-valent cations in aqueous medium to give rise to metastable layered phases. - Graphical abstract: NaInSnS 4 and KInSnS 4 compounds undergo, in aqueous medium at room temperature, facile topotactic ion-exchange with mono, di and trivalent cations. Display Omitted - Highlights: • Ten AInM′S 4 compounds with diverse structure types were synthesized. • They are wide band gap semiconductors. • NaInSnS 4 and KInSnS 4 compounds undergo facile topotactic ion-exchange at room temperature.

Ponizhenije reitingovogo prognoza Estonii

Index Scriptorium Estoniae

2006-01-01

Isamaa ja Res Publica Liidu kaasesimehe Taavi Veskimäe sõnul näitab Eesti reitinguväljavaate alandamine, et rahvusvaheline reitinguagentuur Standard & Poor's ei usu Eesti valitsuse soovi ja suutlikkusse teha piisavaid jõupingutusi inflatsiooni alandamiseks

"Keset filmi" Kiasmas

Index Scriptorium Estoniae

2004-01-01

Soome kunstniku Tellervo Kalleineni filmiprojektist "In the middle of a movie'". Eestist esinesid projektis Taavi Eelmaa, Tarrvi Laamann, Silva Lutz, Anders Melts, Anneli Remme, Siiri Salem, Martin Palm, Kaja Prikk, Peeter Ristsoo, filmisid Peeter Maimik ja Marianne Kõrver

Eestlaste loodud südamestimulaator meelitas rikkad jänkid meie meditsiini juurde / Kerli Nõu

Index Scriptorium Estoniae

Nõu, Kerli

2005-01-01

Eesti teadlaste leiutis on nüüdseks mitu korda omanikku vahetanud, praegu arendatakse TTÜ Elektroonikainstituudis südamelihaste isheemiat ja infarkti ennetavat seadet edasi USA meditsiinitehnoloogia firmas St Jude Medicali lipu all. Kommenteerivad Taavi Lepmets ja Allan Martinson

Koda = Koda / Kadri Tonto

Index Scriptorium Estoniae

Tonto, Kadri

2016-01-01

Minimalistliku vormiga eramu KODA. Kontseptsiooni autorid Ülar Mark, Taavi Jakobson, Hannes Tamjärv, Kalev Ramjalg, Marek Strandberg; arhitektid Ülar Mark, Kariina Kristiina Kaufmann, Kadri Tonto, Hannes Praks. Eesti Arhitektide Liidu preemia "Väike 2013-2015" laureaat

Kuulsuste keeruline elu : [anekdoodid] / Toomas Kall ; karikatuur: Rein Lauks

Index Scriptorium Estoniae

Kall, Toomas, 1947-

2014-01-01

Anekdoodid järgmistest kuulsustest: Luisa Värk, Taavi Rõivas, Ardo Hansson, Bill Gates, Nicolas Sarkozy, Dmitri Medvedev, Edgar Savisaar, Vladimir Putin, Anton Vaino, Astrid Kannel, Viktor Janukovitš, Evelin Ilves, Toomas Hendrik Ilves, Jürgen Ligi, Urve Palo, Indrek Tarand

Linn kaalub Kopli liinidele uue arendaja otsimist

Index Scriptorium Estoniae

2007-01-01

Kui Tallinna linnavalitsus ja OÜ Primos Kinnisvara Kopli liinide hoonestamistingimuste osas kokkuleppele ei jõua, võib hoonestusõigusele tulla uus konkurss. Ärimees Endel Sifile kuuluva OÜ Primos Kinnisvara Tallinna linna vastu Tallinna halduskohtusse esitatud hagist. Taavi Aasa kommentaar

Akadeemiast ja "Akadeemiast" / Kati Ilves

Index Scriptorium Estoniae

Ilves, Kati, 1984-

2011-01-01

Tallinnas Märzi projektiruumis detsembris 2010 eksponeeritud Madis Luige kureeritud näitusest "Akadeemia", mis tegeleb Eesti Kunstiakadeemias kunstnike koolituse ja kunstnike tuleviku probleemidega. Nele Aunapi, Alver Linnamäe, Tõnu Tunneli ja Taavi Kübara töödest

Kalev Spa : Aia tn. 18, Tallinn = Kalev Spa : Aia St. 18, Tallinn / Henry Kuningas

Index Scriptorium Estoniae

Kuningas, Henry

2006-01-01

"Kalevi" ujula ümberehitus. Projekteerija: AB Emil Urbel OÜ. Autorid: Emil Urbel, Ivar Lubjak. Sisekujundaja: Taavi Aunre (OÜ Boom.ee). Konstruktor: Margus Allik (MG Inseneribüroo OÜ). Projekt ja valmis: 2005. Ill.: I korruse plaan, 4 värv. vaadet

Askeet ja stoik / Veiko Õunpuu ; interv. Margit Tõnson

Index Scriptorium Estoniae

Õunpuu, Veiko, 1972-

2007-01-01

Režissöör Veiko Õunpuu mängufilm "Sügisball" osaleb Venezia 64. filmifestivali konkursiprogrammis Orizzonti. Režissöör endast. Lisaks CV "Veiko Õunpuu", Rain Tolk "Ambivalentne isiksus" ja Taavi Eelmaa "Ghost Dog"

Värskete kontorite top

Index Scriptorium Estoniae

2007-01-01

"Ruum" valis välja kolm äsjavalminud paremat kontorit: Skype'i kontor, sisearhitekt Tarmo Piirmets, büroo Pink; ajaleht Sakala toimetus, sisearhitektid Liis Lindvere, Raili Paling, KOKO arhitektid; disainibüroo Velvet, sisearhitekt Taavi Aunre, sisearhitektuuribüroo Boom

Res Publica lihtliikmed tõrjuvad Veskimäge / Tuuli Koch

Index Scriptorium Estoniae

Koch, Tuuli

2006-01-01

Ilmunud ka: Pärnu Postimees 17. okt. lk. 6. Isamaa ja Res Publica liidu peaministrikandidaadiks sai Mart Laar, kuid pinged erakondade sees kestavad edasi. Res Publica opositsioon toetab isamaaliitlast Mart Laari ja on Taavi Veskimäe vastu. Lisa: Otsitakse peaministrit

Vaatamisest teateni / Margot Kask

Index Scriptorium Estoniae

Kask, Margot

2006-01-01

Maastiku mõiste arengust läbi kunstiajaloo ning nägemise ja kujutamise vastastikustest seostest. Reimo Võsa Tangsoo (sünd. 1976), Eve Kiileri (sünd. 1962), Ivar Veermäe (sünd. 1982) ja Taavi Suitsu maastikufotodest

High performance W-AIN cermet solar coatings designed by modelling calculations and deposited by DC magnetron sputtering

Energy Technology Data Exchange (ETDEWEB)

Qi-Chu Zhang [The University of Sydney (Australia). School of Physics; Shen, Y.G. [City University of Hong Kong (Hong Kong). Department of Manufacturing Engineering and Engineering Management

2004-01-25

High solar performance W-AIN cermet solar coatings were designed using a numerical computer model and deposited experimentally. In the numerical calculations aluminium oxynitride (AlON) was used as ceramic component. The dielectric functions and then complex refractive index of W-AlON cermet materials were calculated using the Sheng's approximation. The layer thickness and W metal volume fraction were optimised to achieve maximum photo-thermal conversion efficiency for W-AlON cermet solar coatings on an Al reflector with a surface AlON ceramic anti-reflection layer. Optimisation calculations show that the W-AlON cermet solar coatings with two and three cermet layers have nearly identical solar absorptance, emittance and photo-thermal conversion efficiency that are much better than those for films with one cermet layer. The optimised calculated AlON/W-AlON/Al solar coating film with two cermet layers has a high solar absorptance of 0.953 and a low hemispherical emittance of 0.051 at 80{sup o}C for a concentration factor of 2. The AlN/W-AlN/Al solar selective coatings with two cermet layers were deposited using two metal target direct current magnetron sputtering technology. During the deposition of W-AlN cermet layer, both Al and W targets were run simultaneously in a gas mixture of argon and nitrogen. By substrate rotation a multi-sub-layer system consisting of alternating AlN ceramic and W metallic sub-layers was deposited that can be considered as a macro-homogeneous W-AlN cermet layer. A solar absorptance of 0.955 and nearly normal emittance of 0.056 at 80{sup o}C have been achieved for deposited W-AlN cermet solar coatings. (author)

18 octobre 2013 - Le Préfet de l’Ain L. Touvet signe le livre d'or avec le Directeur général du CERN R. Heuer et le Chef du Département Technologie F. Bordry. Photo de groupe, de gauche à droite: T. Kupisz, Secrétaire général de la sous préfecture de Gex; L. Miralles, Chef du Département Infrastructure et services généraux; F. Eder, Délégué aux Relations avec les Etats hôtes; S. Donnot, Sous-préfet de Gex; L. Touvet, Préfet de l'Ain; E. Sches, Sous-préfète de Nantua; E.Gröniger-Voss, Conseiller juridique du CERN; R. Heuer, Directeur général; F. Bordry, Chef du Département Technologie et P. Bloch, Chef du Département Physique.

CERN Multimedia

Anna Pantelia

2013-01-01

18 octobre 2013 - Le Préfet de l’Ain L. Touvet signe le livre d'or avec le Directeur général du CERN R. Heuer et le Chef du Département Technologie F. Bordry. Photo de groupe, de gauche à droite: T. Kupisz,\tSecrétaire général de la sous préfecture de Gex; L. Miralles, Chef du Département Infrastructure et services généraux; F. Eder, Délégué aux Relations avec les Etats hôtes; S. Donnot, Sous-préfet de Gex; L. Touvet, Préfet de l'Ain; E. Sches, Sous-préfète de Nantua; E.Gröniger-Voss, Conseiller juridique du CERN; R. Heuer, Directeur général; F. Bordry, Chef du Département Technologie et P. Bloch, Chef du Département Physique.

Rõivas: õppused tagavad rahu

Index Scriptorium Estoniae

2016-01-01

Rahvusvahelise suurõppuse Saber Strike lõpurivistusel tunnustas peaminister Taavi Rõivas 10 000 liitlasväelase koostööd ning rõhutas, et nende kohalolek ja ühised õppused tähendavad Eesti rahva jaoks rahu tagamist, mitte sõja õhutamist

Tallinn avab Skoone esimese etapi juba tänavu

Index Scriptorium Estoniae

2007-01-01

Taavi Aasa sõnul on eesmärgiks 2007. a. jooksul korraldada ala valgustus, tekitada jalgrajad ning bastion avada. Skoone bastioni kõrval oleva Eesti Raudtee krundi omandamiseks soovib linn alustada läbirääkimisi. Ala detailplaneeringut koostab Salto AB

Performance'i kunst savibraator annab keraamikale uue näo / Sergo Selder

Index Scriptorium Estoniae

Selder, Sergo

2004-01-01

Tallinna Linnagaleriis toimunud performance'ist Savibraator. Idee autoriks on keraamikud Urmas Puhkan ja Lauri Kilusk. Suurele ekraanile näidatakse Urmase filmitud pilti Lauri savivoolimisest muusika saatel. Muusikavalik on Taavi Tulevilt. Esinetakse ka elektroonilise kunsti festivali ISEA üritusel Flux klubis Bon-Bon

Maria Avdjuško väntab Priimäest filmi / Verni Leivak

Index Scriptorium Estoniae

Leivak, Verni, 1966-

2009-01-01

Näitlejanna debüteerib režissöörina, vändates lühimängufilmi, kus Linnar Priimägi peategelasena kehastab iseennast. Operaatoriks on Istvan Borbas Rootsist, näitlejateks veel M. Avdjuško ja Taavi Eelmaa

Ilmaelu läbi irooniaprisma / Ragne Nukk

Index Scriptorium Estoniae

Nukk, Ragne, 1984-

2010-01-01

Kunstnikeduo Johnson ja Johnson (Taavi Talve, Indrek Köster) näitus "Nothing Left to Save" Draakoni galeriis 15. maini 2010. Näitus põhineb saksa režissööri Rainer Werner von Fassbinderi filmil "Petra von Kanti kibedad pisarad"

Res Publica ladvikus hõõgub võimutüli / Tuuli Koch

Index Scriptorium Estoniae

Koch, Tuuli

2006-01-01

22. aprillil kogunenud Res Publica volikogu toetas 60 poolthäälega ühe vastu Res Publica ja Isamaaliidu ühinemist. Tõnis Palts teatas volikogul esinedes, et Taavi Veskimägi ei sobi Res Publica poolseks läbirääkimiste juhiks

Kuidas näitlejad talve kaamerasse püüdsid / Jaanus Kulli

Index Scriptorium Estoniae

Kulli, Jaanus, 1955-

2008-01-01

Looduspildid näitusel "Teatritegemised III - loodusfotod talvest" Eesti Draamateatri Teatri Puhvetis. Piltide autorid on Joon Stuudio juht Ülar Linnuste ja näitlejad Harriet Toompere, Guido Kangur, Pille Lukin Kangur, Jaan Rekkor, Taavi Teplenkov, Mihkel Kabel ja Viiu Härm

Mari Koger : avatud magamistoaga korter pööningukorrusel / Gitte Hint

Index Scriptorium Estoniae

Hint, Gitte

2003-01-01

Korter Nõmmel renoveeritud puumajas (arhitekt Hannes Niineväli). Sisearhitekt Mari Koger, tema kommentaarid. Söögilaua alumiiniumist valatud jalgade autor on Taavi Aunre. Söögilauda valgustab Alberto Meda ja Paolo Rizzatto disainitud lamp Titania. Ill.: plaan, 8 värv. vaadet

Infotankistid ja Puhas Rõõm esitlevad : R.A.I.S.K. / Piret Räni

Index Scriptorium Estoniae

Räni, Piret

2007-01-01

Rühmitustest Infotankistid ja Puhas Rõõm. Näitusel R.A.I.S.K. (Radikaalne Agiteeriv Intrigeeriv Sotsiaalne Kunst) eksponeeritud töödest, autorid Mart Viljus, Katrin Tees, Ivika Kivi, Sulo Kallas, Piret Räni, Erki Kannus, Anu Vahtra, Maris Suits, Taavi Suits

22. X avati Tallinna Linnagaleriis...

Index Scriptorium Estoniae

2003-01-01

Kosmoseteemalisel grupinäitusel "Hallo, Kosmos, siin Maa!" osalevad tekstiilikunstnikud Keret Altpere, Raul Erdel, Monika Järg, Liisa Kallam, Eva-Liisa Kriis, Annike Laigo, Tarmo Mäesalu, Ülle Saatmäe, Liisa Tomasberg, fotograaf Pelle Kalmo, graafik Mari-Liis Laanemaa, muusik Taavi Laatsit

Res Publica soolo rikkus tavasid / Kai Kalamees

Index Scriptorium Estoniae

Kalamees, Kai

2005-01-01

Riigikogu aseesimeheks valiti Res Publica liige Taavi Veskimägi, nüüd on Riigikogu juhatuses kaks ühe partei liiget. Riigikogu aseesimeheks tagasi valitud Toomas Vareki hinnangul näitab see samm nii Res Publica kogenematust kui ka Eesti poliitilise kultuuri kehva taset

Presidendilossis pidutses ka üks Res Publica liige / Kadri Jakobson

Index Scriptorium Estoniae

Jakobson, Kadri, 1970-

2006-01-01

SL Õhtulehele presidendilossis toimunud noortepidudest rääkinud neiu on Res Publica liige, kuid tema sõnul pole tema parteiline kuuluvus pidudega seotud. Arvamust avaldavad Res Publica juhatuse liige Andreas Kaju, erakonna esimees Taavi Veskimägi, ERL-i pressiesindaja Agu Uudelepp jt.

Analüütikud ennustavad Res Publicale mõõnast pääsu / Rasmus Kagge

Index Scriptorium Estoniae

Kagge, Rasmus, 1977-

2005-01-01

Poliitikavaatlejate hinnangul ületab Res Publica mõõna ja saab järgmistel parlamendivalimistel kuni 12 kohta, kui nad loobuvad "uue poliitika" stiilis loosungitest ja kõrkusest. Lisa: Mõõna põhjusi. Vt. samas: Taavi Veskimägi lubas lõpetada Res Publica peataoleku

Eesti Draamateater alustas hooaega piletisabaga / Kristiina Vaarik

Index Scriptorium Estoniae

Vaarik, Kristiina

2004-01-01

Eesti Draamateatri uut hooaega tutvustavast üritusest. Mari Kurismaa ja Peeter Kuutmaa kujundatud teatrimaja uuest ilmest. Koostöös Kunstnike Liiduga avati Teatrigalerii. Teatris olid näha Andres Toltsi näitus "9 maali" ning Harriet Toompere ja Taavi Teplenkovi fotoväljapanekud

Rahvusvaheline fotograafia suvekool Latgales / Taavi Tatsi

Index Scriptorium Estoniae

Tatsi, Taavi

2007-01-01

Augustis 2007 toimus rahvusvaheline fotograafia suvekool (ISSP) Latgales, Lätis. Osavõtjad Lätist, Eestist, Leedust, Venemaalt, Saksamaalt, Poolast, Suurbritanniast ja Hispaaniast. Keskenduti kontseptuaalsele lähenemisele ja maailmamõistmise avardamisele fotograafia vahendite abil

Homefucking is Killing Prostitution / Taavi Eelmaa

Index Scriptorium Estoniae

Eelmaa, Taavi, 1971-

2008-01-01

Mis jääb vaatajale teatrietendusest meelde? Ilmus Kris Moori raamat "Homefucking is Killing Prostitution". Raamat sisaldab tekste ja Erki Lauri fotosid Von Krahli Teatri samanimelisest etendusest, mida kordagi ei mängitud

Download this PDF file

African Journals Online (AJOL)

Professor of Genetics (Cytogenetics), Faculty of Medicine, Ain Shams University, Cairo, Egypt. Hosam A Abdel-Ghany. Consultant of Medical Human Genetics, Medical Genetic Center, Ain Shams University, Cairo, Egypt. Nermin S Elsayed. Consultant of Medical Human Genetics, Medical Genetics Center, Ain Shams ...

Concilier développement agricole et usage pérenne des eaux souterraines : un dialogue multi-acteurs dans la zone d’Ain Timguenay (province de Séfrou

Directory of Open Access Journals (Sweden)

Issam Sellika

2016-10-01

Full Text Available Au Maroc, l’utilisation des eaux souterraines pour l’irrigation a permis un développement agricole rapide dans de nombreuses régions, mais a aussi fait émerger des situations de baisse des niveaux piezométriques des nappes qui menacent la durabilité de cette agriculture irriguée. L’article présente une action de recherche portant sur la conception d’un projet de territoire agricole durable alliant développement agricole et usage pérenne des ressources en eau souterraine. L’étude a eu lieu dans la zone d’Ain Timguenay (province de Séfrou, qui connait un fort développement de la production de pommes et de prunes depuis une quinzaine d’années. Le programme de recherche a impliqué les agriculteurs, la commune rurale d’Ain Timguenay, les institutions du Ministère de l’Agriculture et l’Agence de bassin hydraulique du Sébou. Une analyse des dynamiques agricoles locales et des tendances nationales a servi de support aux discussions. L’étude de l’aquifère et de ses usages a permis d’établir un bilan sommaire et un ordre de grandeur des surfaces qui pourraient encore être plantées sans que les consommations en eau soient supérieures à la recharge de l’aquifère en année pluviométrique moyenne. Une réflexion prospective menée avec les agriculteurs a mis en évidence deux scénarios possibles à l’échelle locale: 1 un scénario où les difficultés économiques que rencontrent actuellement les exploitations de la zone se renforcent, conduisant à un ralentissement des nouvelles plantations, d’où une pression limitée sur la nappe ; 2 un scénario où les exploitations réussissent à faire face aux défis actuels de production et de commercialisation et de ce fait continuent à planter, ce qui conduit à une consommation en eau bien supérieure à la recharge de la nappe. L’ensemble des acteurs impliqués a participé à l’élaboration d’un troisième scénario permettant de concilier d

Tallinn soovib linnahalli Ameerika investoritega ikka edasi minna / Raimo Poom

Index Scriptorium Estoniae

Poom, Raimo

2010-01-01

Tallinna linnavalitsus ootab enne otsustamist, kas pikendada Tallinna linnahalli arendamiseks sõlmitud eellepingut Ameerika ettevõttega Tallinn Entertainment LLC, Ameerika investorite delegatsiooni visiiti Tallinna. Rahandusminister Jürgen Ligi vastusest Tallinna abilinnapea Taavi Aasa kirjale, milles oli ettepanek kaaluda võimalust anda riigi garantii linnahalli arendamise projektile

Eesti asi / Elen Luht

Index Scriptorium Estoniae

Luht, Elen

2013-01-01

Kaili Milki ja Kristiina Joosti disainitud padjapüürid, Sabina Kaukise kruusid, Monika Järgi vildist hoiukorvid, Terje Taltsi käsitöökalender, Mari Kõrgesaare laualamp, Ahto Sibula korterinumbriga vaas, Taavi Kuninga riidepuu Robi, Merilin Liblika sojavahast küünlad, Marko Ala lambid

Siim Nestor soovitab : lack of Eoins / Siim Nestor

Index Scriptorium Estoniae

Nestor, Siim, 1974-

2008-01-01

Väikefirma Seksound annab sel nädalavahetusel välja Viljandi indiebändi Lack of Eoins esikplaadi "Echo Group" (plaadiesitlused 11. dets. Tallinnas Von Krahlis ja 12. dets. Tartus Genialistide klubis, esinevad ka Ans. Andur ja Popidiot, plaate keerutavad Hannes Praks ja Taavi Laatsit)

Monoliitne või amorfne Eesti? / Indrek Grigor

Index Scriptorium Estoniae

Grigor, Indrek

2008-01-01

Eesti Vabariigi 90. sünnipäeva tähistav näitus "Kas me sellist Eestit tahtsime?!" Rael Artel Gallery's Tartus kuni 8. III. Kristina Normani, Flo Kasearu, Merilyn Püssi, Katrin Sarapuu, Eva Labotkini, Taavi Piibemanni ja Tanja Muravskaja töödest

Eestil odava tööjõu eelis kadunud / Liis Kängsepp

Index Scriptorium Estoniae

Kängsepp, Liis, 1981-

2005-01-01

Database Central Europe'i tehtud tööjõu maksumuse uuringu järgi on tööjõukulu Eestis tunduvalt suurem kui Lätis, Leedus ning mitmes Ida-Euroopa riigis. Diagrammid. Kommenteerivad: Peep Siimon, Taavi Veskimägi, Jaak Leimann ja Ilmar Petersen

Personalihaldusprogramm aitab korrastada töötajate andmed / Heiki Koov

Index Scriptorium Estoniae

Koov, Heiki

2005-01-01

Personaliarvestuses kasutatava personalihaldusprogrammi (HRM ehk Human Resourse Management) lühike tutvustus. Lisad: Ekraanipilt. Taavi Personali saab sisestada ka töötaja foto; Leia esimese korraga õige programm; Personaliprogrammi lõplik hind sõltub firma spetsiifikast. Vt. samas: Valdo Praust. Personaliprogrammis kasutatavad isikuandmed vajavad hoolikat kaitset

Tartu Ülikool raamatukogus / Tiina Tammet

Index Scriptorium Estoniae

Tammet, Tiina, 1971-

2005-01-01

Kuni 13 II näitus "R.A.I.S.K." (Radikaalne Agiteeriv Intrigeeriv Sotsiaalne Kunst). Krutskilist ökokunsti teevad Infotankistid, Puhas Rõõm, Piret Räni, Maris Suits, Katrin Tees, Anu Vahtra, Mart Viljus, Ivika Kivi & Sulo Kallas, Taavi Suits, Kai Herkel ja Henry van Noordenburg

Res Publica kogub uut hoogu / Andres Jalak

Index Scriptorium Estoniae

Jalak, Andres, 1953-

2005-01-01

Kommenteerides Res Publica senise esimehe ja endise peaministri Juhan Partsi ning uueks esimeheks valitud Taavi Veskimäe kõnet Res Publica üldkogul, väljendab Res Publica fraktsiooni aseesimees usku, et Res Publica juhtimisel suudetakse 2007. aasta parlamendivalimistel taastada tulevikku suunatud mõtlemisega valitsus

Metal nitride coatings by physical vapor deposition (PVD) for a wear resistant aluminum extrusion die.

Science.gov (United States)

Lee, Su Young; Kim, Sang Ho

2014-12-01

The purpose of this study is to investigate the friction and wear behaviors of CrN, TiN, CrAlN, and TiAIN coated onto SKD61 for application to Al 7000 series extrusion dies. On the wear test, the experimental parameters are the load and the counter material's temperature. The results showed that the friction coefficient increased with load but decreased with the counter material's temperature, and the friction coefficients of CrN and CrAIN were lower than the friction coefficients of TiAIN and TIN, especially at a higher temperature. The wear track with different coatings identified different wear behaviors; the wear behavior of CrAIN was found to be abrasive, but the wear behavior of TiN, CrN, and TiAIN was adhesive. Therefore, CrAIN showed the least wear loss with a lower friction coefficient and less adhesion with counter materials at the highest range of wear load and temperature. This resulted in the easy formation of aluminum oxide in the wear track and less Al adhesion; moreover during the hard second phase, AIN dispersed in the film during deposition.

Salme Reegi nimelise auhinna nominendid

Index Scriptorium Estoniae

2006-01-01

Valiti järgmised nominendid : Taago Tubin - lavastus "Suur kuri hunt" Vanemuises, Marika Vaarik - õpetaja Klamm VAT Teatri lavastuses "Klammi sõda", Finn Poulsen - "Trollpoiss" Eesti Nukuteatris, Leino Rei - lavastused "Kuusepuu", "Karjatüdruk ja korstnapühkija", Taavi Tõnisson - Papageno "Võluflöödis" Eesti Nukuteatri lavastuses

Allergic Interstitial Nephritis Manifesting as a Striated Nephrogram

Directory of Open Access Journals (Sweden)

Irfan Moinuddin

2015-01-01

Full Text Available Allergic interstitial nephritis (AIN is an underdiagnosed cause of acute kidney injury (AKI. Guidelines suggest that AIN should be suspected in a patient who presents with an elevated serum creatinine and a urinalysis that shows white cells, white cell casts, or eosinophiluria. Drug-induced AIN is suspected if AKI is temporally related to the initiation of a new drug. However, patients with bland sediment and normal urinalysis can also have AIN. Currently, a definitive diagnosis of AIN is made by renal biopsy which is invasive and fraught with risks such as bleeding, infection, and hematoma. Additionally, it is frequently unclear when a kidney biopsy should be undertaken. We describe a biopsy proven case of allergic interstitial nephritis which manifested on contrast enhanced Magnetic Resonance Imaging (MRI as a striated nephrogram. Newer and more stable macrocyclic gadolinium contrast agents have a well-demonstrated safety profile. Additionally, in the presentation of AKI, gadolinium contrast agents are safe to administer in patients who demonstrate good urine output and a downtrending creatinine. We propose that the differential for a striated nephrogram may include AIN. In cases in which the suspicion for AIN is high, this diagnostic consideration may be further characterized by contrast enhanced MRI.

Risk Factors for the presence of anal intraepithelial neoplasia in HIV+ men who have sex with men

NARCIS (Netherlands)

Richel, Olivier; de Vries, Henry J. C.; Dijkgraaf, Marcel G. W.; van Noesel, Carel J. M.; Prins, Jan M.

2013-01-01

Anal Intraepithelial Neoplasia (AIN) is present in the majority of HIV+ men who have sex with men (MSM) and routine AIN-screening is subject of discussion. In this study we analysed a wide range of potential risk factors for AIN in order to target screening programs. We screened 311 HIV+ MSM by high

Anterior interosseous nerve syndrome diagnosis and intraoperative findings: A case report

Directory of Open Access Journals (Sweden)

Abdulla Aljawder

2016-01-01

Conclusion: Clinical suspicion should arise in the presence of isolated paralysis of the AIN-supplied muscles. MRI and electrodiagnostic studies will confirm the diagnosis and identify the etiology. The optimal treatment of AIN syndrome has not been established. We recommend surgical intervention in confirmed AIN syndrome from compression neuropathy, refractive to conservative therapy.

Festival "Maailmafilm" sobib hästi akadeemilise vaimuga linna / Kadri Rannamäe

Index Scriptorium Estoniae

Rannamäe, Kadri

2008-01-01

V festivali "Maailmafilm", mis algab 24. märtsil Eesti Rahva Muuseumi näitusemajas Tartus, tutvustavad muuseumi direktor Kristjan Raba ja festivali tegevjuht Taavi Tatsi. Esilinastub Liivo Niglase, Diane Perlovi ja Frode Storaasi "Kalarahvas". Kavas on ka eriprogrammid: kirjanikud filmis, klassiku Timothy Aschi filmid Amazonase indiaanlastest ja filmid inimesest linnas

Autentsuse ihalus ja strateegiad tänases Eesti teatris / Anneli Saro

Index Scriptorium Estoniae

Saro, Anneli, 1968-

2007-01-01

Aluseks võetud lavastused "Rätsep" (lav. Mart Koldits) ja "Nii see on kui teile nii näib" (lav. Adolf Shapiro) Tallinna Linnateatris, "Hamletid" (lav. Sasha Pepeljajev) ja "Faust" (lav. Taavi Eelmaa) Von Krahli Teatris, Tiit Ojasoo ja Ene-Liis Semperi lavastus "Nafta!" NO99 teatris. Kasut. kirjandus lk. 126

NYYDi vabastav hingamine / Margit Tõnson

Index Scriptorium Estoniae

Tõnson, Margit, 1978-

2009-01-01

Uue muusika festivalil NYYD`09 raames 20. oktoobril Von Krahli Teatris etendunud Märt-Matis Lille kammerooperist "Indiate uurimine", 23. oktoobril Kanuti Gildi saalis Mart Kangro, Taavi Kerikmäe ja Ansambli U koostöös valminud lavastusest "Harmoonia" ja 25. oktoobril Salme Kultuurikeskuses etendunud Heiner Goebbelsi lavastusest "Eraritjaritjaka"

Kodumaise ruladisaini uuestisünd / Anna-Liisa Villmann

Index Scriptorium Estoniae

Villmann, Anna-Liisa

2010-01-01

Elukutselise rulasõitja, neljakordse Soome meistri Kristel Orasmäe loodud kaubamärgist High Fly, mille kujunduse tegi Eesti Kunstiakadeemias graafilise disaini osakonnas õppiv Taavi Drell. Toodang tellitakse välismaisest tehasest. High Fly rulakomplekti rahvusvahelisele turule viimise plaanidest, kevadel avatud rulakoolist, mille tulu läheb uue rulapargi rajamiseks

Eesti Raudtee juht : valitsus tahab meie äri hävitada / Edward A. Burkhardt ; interv. Priit Rajalo

Index Scriptorium Estoniae

Burkhardt, Edward A.

2005-01-01

Ilmunud ka: Postimees : na russkom jazõke 22. dets., lk 2. Eesti Raudtee omanikud (Baltic Rail Service) kaaluvad ettevõtte mahamüümist valitsusepoolse käitumise tõttu. Tallinna Sadama võimalik osalus. Kommenteerivad Villu Reiljan, Taavi Veskimägi, Ivari Padar, Tõnis Lukas, Andrus Ansip ja Edgar Savisaar

Üheksa aastat Redmondis, Microsoftis / Raigo Neudorf

Index Scriptorium Estoniae

Neudorf, Raigo

2008-01-01

Ühe esimese eestlasena Microsofti peakontoris Redmondis töötanud tarkvaraspetsialist Targo Tennisberg asus Eestis tööle Webmedia arendusjuhina. Vt. samas: Microsoft kui suur rahvaste katel; Taavi Kotka: tegu on üliandeka inimesega. Webmedia juhatuse esimehe kommentaar; Panus Microsoft Office'i väljatöötamisse

10 teesi Res Publica valitsemisprogrammist aastani 2007

Index Scriptorium Estoniae

2004-01-01

Ilmunud ka: Ottshjot narodu Estonii. Res Publica 2003, 2004, lk. 4-5, 8-9. Res Publica valitsemisprogrammi lubadustest ja täitmisest. Vt. lk. 8-9 Res Publica ministrite olulisemad tegevused 2004. aastal - lühiülevaate teevad Ken-Marti Vaher, Taavi Veskimägi, Marko Pomerants, Toivo Maimets

Res Publica toetus pole aastaga üle viie protsendi tõusnud / Tuuli Koch

Index Scriptorium Estoniae

Koch, Tuuli

2006-01-01

Emori jaanuarikuu küsitluse põhjal on 22 protsendiga suurim toetajaskond Keskerakonnal, Res Publica reiting on aasta aega püsinud viie ja kolme toetusprotsendi vahel. Vt. samas: Taavi Veskimägi. 2 küsimust. Diagrammid: Res Publica valiks riigikogusse tagasi vaid kolm protsenti valijaist; Toetus Res Publicale

Piduöö 5 nägu / Monica Raud

Index Scriptorium Estoniae

Raud, Monica, 1981-

2007-01-01

Viie ööklubi interjöörist. Tallinnas Club von Überblingen endises Polümeeri hoones, sisearhitekt Taavi Aunre; Club Prive, sisearhitekt Priit Roosna; Tartus Maasikas, sisekujundajad Riin Pettai ja Kerli Lepp; Club Illusion, sisekujundaja Jaanis Ilves; Pärnus klubi Str&, sisekujundajad Hannes Praks, Kristjan Holm ja Kadri Tamme

Kontsert

Index Scriptorium Estoniae

2007-01-01

II rahvusvahelisest noortekooride festivalist 1.-3. veebr. TÜ aulas. Gustav Mahleri "Poisi võlusarv" esitusest 1. veebr. TÜ Ajaloo Muuseumis (esitajad Annaliisa Pillak, Taavi Tampuu ja Kadri-Ann Sumera). Cyprien Katsarise kontserdist 30. jaan. Vanemuise kontserdimajas. Kontserdil "Vocalissimo 2007. Vajatakse Muusat!" 28. jaan. Tartu Linnamuuseumis (esinejad Mati Turi ja Martti Raide)

Eesti väärib paremat / Jaak Aaviksoo

Index Scriptorium Estoniae

Aaviksoo, Jaak, 1954-

2006-01-01

Ilmunud ka: Virumaa Teataja, Põhjarannik, Severnoje Poberezhje, Meie Maa, Vooremaa 3. okt. lk. 11,2,2,2,2, Sakala, Pärnu Postimees, Sõnumitooja 4. okt. lk. 2,15,2, Lõunaleht 5. okt. lk. 2, Kuulutaja, Vali Uudised 6. okt. lk. 6,2, Järva Teataja 7. okt. lk. 2. Autori sõnul on Eestis tajutav usalduskriis, mille põhjuseks on eetiliste piiride kadumine meie poliitilistest otsustest. Ta toob välja kolm arenguprioriteeti riigi edasiseks arenguks

Jebel Hafit and the Al Ain oases (Eastern Abu Dhabi, United Arab Emirates): an integrative approach of a cultural landscape through the scope of geodiversity

Science.gov (United States)

Giusti, Christian; Louchet, André; Beuzen-Waller, Tara; Ragala, Rachid; Pavlopoulos, Kosmas; Fouache, Éric; Cohen, Marianne; Desruelles, Stéphane; Gramond, Delphine

2015-04-01

human settlements and occupation, it is possible to characterize a threefold transition: first, the former transition between the pre-Islamic prehistoric societies and the development of Muslim societies; second, the more recent transition between the traditional historical society (farmers) and the contemporary society, characterized by the growth of urbanization, the creation of modern transport infrastructure and the concomitant growth of tourist flows; third, the current transition between the yesterday and tomorrow Al Ain City, due to the transformation of a local town centred on national economics all along the second half of the twentieth century, into an international town more open to the wider world with the management of a possible increased 20 % of tourist flow because of the inscription of Cultural Sites of Al Ain on the UNESCO's World Heritage List. It is not possible to completely ignore the fact that the Jebel Hafit and its foothills are partly crossed by an international boundary. In case of political tensions, this may cause some difficulties for the management of this territory, with contradictory requirements between security, tourism, traditional land use, and scientific research.

Acute interstitial nephritis with acetaminophen and alcohol intoxication

Directory of Open Access Journals (Sweden)

Alexopoulou Iakovina

2011-04-01

Full Text Available Abstract Drug-induced acute interstitial nephritis (AIN represents a growing cause of renal failure in current medical practice. While antimicrobials and non-steroidal anti-inflammatory drugs are typically associated with drug-induced AIN, few reports have been made on the involvement of other analgesics. We report our experience in managing a 17-year-old female with AIN and subsequent renal injury following an acetaminophen overdose in conjunction with acute alcohol intoxication. It is well established that acetaminophen metabolism, particularly at high doses, produces reactive metabolites that may induce renal and hepatic toxicity. It is also plausible however, that such reactive species could instead alter renal peptide immunogenicity, thereby inducing AIN. In the following report, we review a possible mechanism for the acetaminophen-induced AIN observed in our patient and also discuss the potential involvement of acute alcohol ingestion in disease onset. The objective of our report is to increase awareness of healthcare professionals to the potential involvement of these commonly used agents in AIN pathogenesis.

Syntheses, structural variants and characterization of AInM′S{sub 4} (A=alkali metals, Tl; M′ = Ge, Sn) compounds; facile ion-exchange reactions of layered NaInSnS{sub 4} and KInSnS{sub 4} compounds

Energy Technology Data Exchange (ETDEWEB)

Yohannan, Jinu P.; Vidyasagar, Kanamaluru, E-mail: kvsagar@iitm.ac.in

2016-06-15

Ten AInM′S{sub 4} (A=alkali metals, Tl; M′= Ge, Sn) compounds with diverse structure types have been synthesized and characterized by single crystal and powder X-ray diffraction and a variety of spectroscopic methods. They are wide band gap semiconductors. KInGeS{sub 4}(1-β), RbInGeS{sub 4}(2), CsInGeS{sub 4}(3-β), TlInGeS{sub 4}(4-β), RbInSnS{sub 4}(8-β) and CsInSnS{sub 4}(9) compounds with three-dimensional BaGa{sub 2}S{sub 4} structure and CsInGeS{sub 4}(3-α) and TlInGeS{sub 4}(4-α) compounds with a layered TlInSiS{sub 4} structure have tetrahedral [InM′S{sub 4}]{sup −} frameworks. On the other hand, LiInSnS{sub 4}(5) with spinel structure and NaInSnS{sub 4}(6), KInSnS{sub 4}(7), RbInSnS{sub 4}(8-α) and TlInSnS{sub 4}(10) compounds with layered structure have octahedral [InM′S{sub 4}]{sup −} frameworks. NaInSnS{sub 4}(6) and KInSnS{sub 4}(7) compounds undergo facile topotactic ion-exchange, at room temperature, with various mono-, di- and tri-valent cations in aqueous medium to give rise to metastable layered phases. - Graphical abstract: NaInSnS{sub 4} and KInSnS{sub 4} compounds undergo, in aqueous medium at room temperature, facile topotactic ion-exchange with mono, di and trivalent cations. Display Omitted - Highlights: • Ten AInM′S{sub 4} compounds with diverse structure types were synthesized. • They are wide band gap semiconductors. • NaInSnS{sub 4} and KInSnS{sub 4} compounds undergo facile topotactic ion-exchange at room temperature.

Eestisse tuleb filmimaailma suurnimi

Index Scriptorium Estoniae

2007-01-01

Ameerika režissöör ja maalikunstnik David Lynch esineb 7. novembril kinos Kosmos loenguga, külastab Von Krahli teatrit ja võibolla kohtub ka president Toomas Hendrik Ilvesega. Siia kutsujateks olid Veiko Õunpuu, Rain Tolk ja Taavi Eelmaa. Kohtumiseks Eesti presidendiga on legendaarne lavastaja ise soovi avaldanud

[Economic impact of etanercept and adalimumab biosimilars on hospitals scale covered by PharmAlp'Ain, a hospitals grouping of orders for health products].

Science.gov (United States)

Berreur, B; Guerin, F; Christophe, B; Limido, G; Paubel, P

2018-01-01

To evaluate the economic impact of future prescriptions of etanercept and adalimumab biosimilars at the territorial scale covered by PharmAlp'Ain, a hospitals grouping of orders for health products. Determination of the number and status of patients (naive or in continuation of treatment) from the National Database "Datamart de Consommation Inter-Régimes" of health insurance, concerned by a dispensation in a pharmacy of etanercept or adalimumab in 2015. Calculation of potential savings in case of biosimilar requirements according to 3 hypotheses: 63% (rate observed in a previous study) of initiations are treated with biosimiliaries and the others by princeps (H 1 ); all initiations under biosimilars and continuation therapy with the princeps (H 2 ) or all patients are treated with biosimilars (H 3 ). The annual savings are estimated at 237,000 € with the H 1 hypothesis. In the case of H 2 , the expected savings would be 376,200 € per year. In the case of H 3 , savings for the community could reach almost 1,282,800 € per year. The arrival of biosimilars allows significant savings for medicines market. According to the French recommendations in 2016, the expected savings are between the H 1 and H 2 hypothesis. The rate of penetration of biosimilars depends on many factors such as the involvement of health professionals, patient adherence, or health authority recommendations. Copyright © 2017 Académie Nationale de Pharmacie. Published by Elsevier Masson SAS. All rights reserved.

Trimethoprim-sulfamethoxazole induced acute interstitial nephritis in renal allografts; clinical course and outcome.

LENUS (Irish Health Repository)

Garvey, J P

2009-11-01

Acute interstitial nephritis (AIN) secondary to trimethoprim-sulfamethoxazole (TMP-SMX) is well documented as a cause of acute renal failure in native kidneys. TMP-SMX is the standard prophylactic agent against pneumocystis carinii (PCP) used in the early post-transplant period, however, it has to date only been indirectly associated with AIN in renal allografts. DESIGN, SETTING, PARTICIPANTS AND MEASUREMENTS: We describe eleven renal transplant patients with acute allograft dysfunction in whom a transplant biopsy demonstrated primary histopathologic features of allergic AIN, all of whom were receiving TMP-SMX in addition to other medications known to cause AIN.

Non-native acylated homoserine lactones reveal that LuxIR quorum sensing promotes symbiont stability

Science.gov (United States)

Ho, Jessica S.; Geske, Grant D.; Blackwell, Helen E.; Ruby, Edward G.

2014-01-01

SUMMARY Quorum sensing, a group behavior coordinated by a diffusible pheromone signal and a cognate receptor, is typical of bacteria that form symbioses with plants and animals. LuxIR-type acyl homoserine-lactone (AHL) quorum sensing is common in Gram-negative proteobacteria, and many members of this group have additional quorum-sensing networks. The bioluminescent symbiont Vibrio fischeri encodes two AHL signal synthases: AinS and LuxI. AinS-dependent quorum sensing converges with LuxI-dependent quorum sensing at the LuxR regulatory element. Both AinS- and LuxI-mediated signaling are required for efficient and persistent colonization of the squid host, Euprymna scolopes. The basis of the mutualism is symbiont bioluminescence, which is regulated by both LuxI- and AinS-dependent quorum sensing, and is essential for maintaining a colonization of the host. Here, we used chemical and genetic approaches to probe the dynamics of LuxI- and AinS-mediated regulation of bioluminescence during symbiosis. We demonstrate that both native AHLs and non-native AHL analogs can be used to non-invasively and specifically modulate induction of symbiotic bioluminescence via LuxI-dependent quorum sensing. Our data suggest that the first day of colonization, during which symbiont bioluminescence is induced by LuxIR, is a critical period that determines the stability of the V. fischeri population once symbiosis is established. PMID:24191970

Views and experiences of mental health nurses working with undergraduate assistants in nursing in an acute mental health setting.

Science.gov (United States)

Cleary, Michelle; Horsfall, Jan; O'Hara-Aarons, Maureen; Mannix, Judy; Jackson, Debra; Hunt, Glenn E

2012-04-01

Undergraduate nurses are employed as assistants in nursing (AIN) in inpatient mental health settings; however, there is a paucity of published research exploring registered nurses' (RN) views about the AIN role in these settings. This qualitative study documents the views and experiences of RN working with undergraduate AIN. Fifty structured face-to-face interviews were analysed, and the results are discussed in three sections. The first section outlines RN perceptions of qualities and skills required of AIN in mental health, and the responses primarily focus on communication skills, initiative, and willingness to learn. The second section targets factors in the workplace that might enhance the interest of AIN in a mental health nursing career; the responses emphasize their need to work with experienced staff. The last section outlines RN expectations of AIN, most of which are met and involve physical observations and technical tasks; less fulfilled activities primarily cluster around interactions with patients. Findings highlight the advantages and disadvantages of drawing on undergraduate nursing students as AIN in mental health settings. Communication skills, personal initiative, safety training to prevent violence, and education to increase knowledge and awareness about mental illness, diagnosis, and mental status-related skills were all important concerns articulated by RN. © 2011 The Authors. International Journal of Mental Health Nursing © 2011 Australian College of Mental Health Nurses Inc.

Epidemiology of acute poisoning in children presenting to the poisoning treatment center at Ain Shams University in Cairo, Egypt, 2009-2013.

Science.gov (United States)

Azab, Sonya M S; Hirshon, Jon Mark; Hirshon, John Mark; Hayes, Bryan D; El-Setouhy, Maged; Smith, Gordon S; Sakr, Mahmoud Lotfy; Tawfik, Hany; Klein-Schwartz, Wendy

2016-01-01

Pediatric poisonings represent a major and preventable cause of morbidity and mortality throughout the world. Epidemiologic information about poisoning among children in many lower- and middle-income countries is scarce. This study describes the epidemiology of acute poisonings in children presenting to Ain Shams University's Poisoning Treatment Center (ASU-PTC) in Cairo and determines the causative agents and characteristics of acute poisoning in several pediatric age groups. This retrospective study involved acutely poisoned patients, 0-18 years of age, who presented to the ASU-PTC between 1 January 2009 and 31 December 2013. Data were extracted from electronic records maintained by the ASU-PTC. Collected data included demographics, substance of exposure, circumstances of the poisoning, patient disposition, and outcome. During the 5-year study period, 38 470 patients meeting our criteria were treated by the ASU-PTC; 19 987 (52%) were younger than 6 years of age; 4196 (11%) were 6-12 years; and 14 287 (37%) were >12 years. Unintentional poisoning accounted for 68.5% of the ingestions, though among adolescents 84.1% of ingestions were with self-harm intent. In all age groups, the most frequent causative drugs were non-opioid analgesics, antipyretics, and antirheumatics. The most common nonpharmaceutical agents were corrosives in preschool children and pesticides in adolescents. Most patients had no/minor effects (29 174 [75.8%]); hospitalization rates were highest among adolescents. There were 119 deaths (case fatality rate of 0.3), primarily from pesticide ingestion. Poisoning in preschool children is mainly unintentional and commonly due to nonpharmaceutical agents whereas poisoning in adolescents is mainly intentional (self-harm). Pesticides, mainly organophosphorous compounds and carbamates, were the most frequent agents leading to morbidity and mortality.

Pravitelstvo stupilo na skolzkii put povõshenija nalogov / Virkko Lepassalu

Index Scriptorium Estoniae

Lepassalu, Virkko, 1971-

2008-01-01

2009. aasta riigieelarves on 13 miljardi suurune puudujääk, mille täitmiseks peab valitsus tõstma makse, koondama töötajaid, loobuma mitmetest toetustest, tulumaksu alandamisest ning maksuvaba miinimumi tõstmisest. Poliitikute ja Eesti Panga juhtide arvamusi riigieelarve tasakaalu kohta. Kommenteerivad: Taavi Veskimägi, Tarmo Mänd, Aivar Sõerd

Tark urbanism = Smart urbanism / Inga Raukas

Index Scriptorium Estoniae

Raukas, Inga, 1967-

2008-01-01

Tallinna Ülemiste City kvartalist, mille projekteerijad on Mattias Agabus, Eero Endjärv, Illimar Truverk, hoonete arhitektuurse osa autor E. Endjärv, sisearhitektid Kristi Lents, Hannelore Kääramees ja Taavi Aunre (restoran Mercado), maastikuarhitektid Ülle Grišakov, M. Agabus, E. Endjärv. Projekt 2006, valmis 2008 (1. ehitusetapp)

Eesti Draamateater tähistas maja 100. sünnipäeva / Tiiu Laks

Index Scriptorium Estoniae

Laks, Tiiu, 1984-

2010-01-01

18. septembril tähistati avatud uste päevaga Eesti Draamateater hoone 100. sünnipäeva. Õhtul sai teatrihoone fassaadilt vaadata Taavet Janseni, Taavi Varmi ja Andres Tenusaare videoinstallatsiooni. Esitleti raamatut "Eesti Draamateatri maja 100" (autorid Karin Hallas-Murula, Kristel Pappel, Haldja Jalajas). Avati Peeter Lauritsa fotonäitus "Pahempidi"

2008. aastal tõuseb pension 22% / Karin Kalda

Index Scriptorium Estoniae

Kalda, Karin

2007-01-01

Ilmunud ka: Tallinna Teataja : Kesklinn, Lasnamäe, Pirita, okt., 2007, lk. 3; Tallinna Teataja : Haabersti, Kristiine, Põhja-Tallinn, okt., 2007, lk. 3; Tallinnskii Vestnik, okt., 2007, lk. 3. Tallinnskii Vestnik autorita. Valitsusliit on saanud valmis uue pensioniarvestuse süsteemi, mille alusel võetakse aastahinde arvutamisel senisest enam arvesse sotsiaalmaksu laekumist. Kommenteerib Taavi Rõivas

15. juunini on tarbekunstimuuseumi galeriis...

Index Scriptorium Estoniae

2003-01-01

Ühisnäitusel "Ruum ei ole tühi" osalevad tekstiilikunstnikud Eva-Liisa Kriis, Monika Järg, Liisa Kallam, Liisa Tomasberg, Tarmo Mäesalu, Keret Altpere, Ülle Saatmäe, Annike Laigo, tootedisainerid Raul Erdel, Kelly Kert, arhitekt Urmas Luure, sisearhitekt Terje Kallast, fotograaf Pelle Kalmo, graafik Mari-Liis Laanemaa, muusik Taavi Laatsit

Ettevõtja: miks müügimaksu õigel ajal ei peatatud? / Kadri Bank, Anne Oja

Index Scriptorium Estoniae

Bank, Kadri

2010-01-01

Selver katab müügimaksu kaubandusketi kasumi arvel, müügimaksule üleminekuks on Selver kulutanud mõnisada tuhat krooni. Maksumaksjate liidu juhi Lasse Lehise hinnangul käitus riik paadi- ja müügimaksu ära keelates õigesti, kuid seda oleks pidanud tegema varem. Riigikogu rahanduskomisjoni esimehe Taavi Rõivase selgitus

Piiramine, populism ja näidispoomine ehk Tallinna kasiino sõda / Koit Brinkmann

Index Scriptorium Estoniae

Brinkmann, Koit

2008-01-01

Tallinna keskerakondliku linnavalitsuse uus poliitika on kasiinode arvu kontrolli all hoidmine, kasiinode esindajad näevad otsuste taga poliitilist populismi. Küsimustele vastavad Tallinna linnapea Edgar Savisaar ja abilinnapea Taavi Aas. Vt. samas: Trahv veel avamata kasiino eest; Mitu meetrit on vahetu lähedus; Sel aastal lõpevad hasartmängu korraldusload Tallinnas

Time Management and Its Relation To Students’ Stress, Gender and Academic Achievement Among Sample of Students at Al Ain University of Science and Technology, UAE

Directory of Open Access Journals (Sweden)

Ahmad Saleh Al Khatib

2014-05-01

Full Text Available The objective of the present study was to investigate the relationship between time management, perceived stress, gender and academic achievement among United Arab Emirates college students. The respondents were 352 college students from Al Ain University of Science and Technology. The sample was stratified by sex. Among the respondents, 52.5% were female students and 47.5% were male students. The mean age of the sample was 23.4 years ranging from 18 to 39. Time management was measured by Time Management Questionnaire” developed by Britton and Tesser (1991, while perceived stress was measured by The Perceived Stress Scale developed by Cohen (1985. The findings of the study showed that there was statistically significant negative relationship between time management and perceived stress. Females reported higher time management compared to their males counter mates. Higher time management and lower perceived stress were associated with high levels of academic achievement. However, time management was the most significant predictor of academic achievement accounting for 26 % of the variance while perceived stress accounted for an additional 11.2% of the variance in academic achievement. All three predictors explained 29.4% (R = .543 of total variance. The implications and limitations are reviewed as are the suggestions for future research.   Keywords: Time management, perceived stress, academic achievement, college students.

Colonic aberrant crypt formation accompanies an increase of opportunistic pathogenic bacteria in C57BL/6 mice fed a high-fat diet.

Science.gov (United States)

Zeng, Huawei; Ishaq, Suzanne L; Liu, Zhenhua; Bukowski, Michael R

2018-04-01

The increasing worldwide incidence of colon cancer has been linked to obesity and consumption of a high-fat Western diet. To test the hypothesis that a high-fat diet (HFD) promotes colonic aberrant crypt (AC) formation in a manner associated with gut bacterial dysbiosis, we examined the susceptibility to azoxymethane (AOM)-induced colonic AC and microbiome composition in C57/BL6 mice fed a modified AIN93G diet (AIN, 16% fat, energy) or an HFD (45% fat, energy) for 14 weeks. Mice receiving the HFD exhibited increased plasma leptin, body weight, body fat composition and inflammatory cell infiltration in the ileum compared with those in the AIN group. Consistent with the gut inflammatory phenotype, we observed an increase in colonic AC, plasma interleukin-6, tumor necrosis factor-α, monocyte chemoattractant protein-1 and inducible nitric oxide synthase in the ileum of the HFD-AOM group compared with the AIN-AOM group. Although the HFD and AIN groups did not differ in bacterial species number, the HFD and AIN diets resulted in different bacterial community structures in the colon. The abundance of certain short-chain fatty acid (SCFA) producing bacteria (e.g., Barnesiella) and fecal SCFA (e.g., acetic acid) content were lower in the HFD-AOM group compared with the AIN and AIN-AOM groups. Furthermore, we identified a high abundance of Anaeroplasma bacteria, an opportunistic pathogen in the HFD-AOM group. Collectively, we demonstrate that an HFD promotes AC formation concurrent with an increase of opportunistic pathogenic bacteria in the colon of C57BL/6 mice. Published by Elsevier Inc.

"Kurja lillede" kuus ärakeelatud luuletust / Charles Baudelaire ; saatesõna: Marek Tamm

Index Scriptorium Estoniae

Baudelaire, Charles

2000-01-01

Sisu: Kalliskivid / tlk. Ain Kaalep ; Lethe / tlk. Märt Väljataga ; Temale, kes on liiga rõõmus / tlk. Ain Kaalep ; Lesbos / tlk. Ilmar Laaban ; Äraneetud naised (Delphine ja Hyppolyte) / tlk. Ain Kaalep ; Vampiiri metamorfoosid / tlk. August Sang. Orig.: Les Bijoux ; Le Léthé ; A celle qui est trop gaie ; Lesbos ; Femmes damnées. Delphine et Hippolyte ; Les Métamorphoses du vampire

Elektrimajanduse piiratud valikud / Taavi Veskimägi

Index Scriptorium Estoniae

Veskimägi, Taavi, 1974-

2007-01-01

Ilmunud ka: Virumaa Teataja, 17. aug. 2007, lk. 15; Hiiu Leht, 17. aug. 2007, lk. 2; Harju Ekspress, 17. aug. 2007, lk. 6; Põhjarannik, 17. aug. 2007, lk. 2; Severnoje Poberezhje, 17. aug. 2007, lk. 2; Meie Maa, 17. aug. 2007, lk. 2; Elva Postipoiss, 18. aug. 2007, lk. 4; Oma Saar, 22. aug. 2007, lk. 5; Vali Uudised, 22. aug. 2007, lk. 2; Vooremaa, 28. aug. 2007, lk. 2; Sakala, 6. sept. 2007, lk. 2. Eesti energiapoliitikast. Autor leiab, et kuna tulevikus on Eesti elektrimajanduses valikute hulk üsna kasin, on praegu kõik uued lahendused elektrimajanduses kaalumist väärt ning parimaks lahenduseks on Eestile energiaallikate ja tootjate mitmekesisus

Robin Hood tuleb / Taavi Veskimägi

Index Scriptorium Estoniae

Veskimägi, Taavi, 1974-

2002-01-01

Ilmunud ka: Põhjarannik, Severnoje Poberezhje 24. august lk. 2, Estonija 25. august lk. 2, Nädaline 24. august lk. 4, Valgamaalane 24. august lk. 2, Hiiumaa 24. august lk. 3, Lääne-Harju Ekspress 31. august lk. 4, Järva Teataja 3. september lk. 2, Vooremaa 3. september lk. 7, Virumaa Teataja 6. september lk. 7, Koit 5. september lk. 6. Autori arvates võiks üksikisiku tulumaksust 100% jääda kohalikele omavalitsustele. Autor: Res Publica

Kohalike omavalitsuste tuludest / Taavi Veskimägi

Index Scriptorium Estoniae

Veskimägi, Taavi, 1974-

2004-01-01

Ilmunud ka: Meie Maa, 20. juuli 2004, lk. 2; Koit, 20. juuli 2004, lk. 6; Võrumaa Teataja, 20. juuli 2004, lk. 2; Sõnumitooja, 21. juuli 2004, lk. 6; Vali Uudised, 21. juuli 2004, lk. 2; Vooremaa, 22. juuli 2004, lk 2; Pärnu Postimees, 23. juuli 2004, lk. 11; Hiiu Leht, 23. juuli 2004, lk. 2; Lääne Elu, 24. juuli 2004, lk. 2; Virumaa Teataja, 27. juuli 2004, lk. 2; Järva Teataja, 3. aug. 2004, lk. 2. Kohalike omavalitsuste eelarveprobleemidest

Eesti Maanteemuuseumi välialad : avalik maastikuarhitektuuri ideekonkurss = Public Landscape Architectural Idea Competition "Outdoor Spaces of the Estonian Highway Museum" / Toomas Muru

Index Scriptorium Estoniae

Muru, Toomas, 1970-

2004-01-01

Põlvamaal, endises Varbuse hobupostijaamas avatava Eesti Maanteemuuseumi välialade konkursi eesmärgist, tingimustest, žürii koosseisust, premeeritud töödest. Preemiad: I - Margit Kärner, II - Karli Luik, Ralf Lõoke ja Maarja Kask, III - Taavi Kuningas, Andrus Padu ja Martin Prommik, ergutuspreemiad - Piret Looveer ja Remi Kübar ning Maria Pukk ja Ivar Lubjak

Soolopartiid Von Krahli katuse all / Kristi Eberhart

Index Scriptorium Estoniae

Eberhart, Kristi

2007-01-01

Von Krahli Teatri kolmest lavastusest: "Erki ja Tiina" (lavastaja Mart Kangro, tantsivad Erki Laur ja Tiina Tauraite), "Faust" (J. W. Goethe ainetel tekst ja lavastus Taavi Eelmaa, muusika ja laulud Chalice, osades Jarek Kasar ja Rein Pakk), "Hamletid" (William Shakespeare'i ainetel kontseptsiooni, lavastuse, koreograafia, kujunduse, valguse autor Sasha Pepeljajev, video- ja helikunstnik Taavet Jansen. Esitaja Juhan Ulfsak)

Näitleja teeb vahekokkuvõtte ehk Kuidas lavastatakse aega / Katrin Ruus

Index Scriptorium Estoniae

Ruus, Katrin

2006-01-01

Von Krahli Teatri kolmest lavastusest: "Erki ja Tiina" (lavastaja Mart Kangro, tantsivad Erki Laur ja Tiina Tauraite), "Faust" (J. W. Goethe ainetel tekst ja lavastus Taavi Eelmaa, muusika ja laulud Chalice, osades Jarek Kasar ja Rein Pakk), "Hamletid" (William Shakespeare'i ainetel kontseptsiooni, lavastuse, koreograafia, kujunduse, valguse autor Sasha Pepeljajev, video- ja helikunstnik Taavet Jansen. Esitaja Juhan Ulfsak)

Õunpuu ränk heitlus elu ja kunsti nimel / Jaan Ruus

Index Scriptorium Estoniae

Ruus, Jaan, 1938-2017

2009-01-01

Eesti mängufilm "Püha Tõnu kiusamine", režissöör Veiko Õunpuu. Lisaks "Räägitakse: Püha Tõnu eri", milles tsiteeritakse eri väljaannetes ilmunut. Oma paarilauselise arvamuse ütlevad Valle-Sten Maiste, Kristiina Davidjants, Lauri Kärk, Taavi Eelmaa, Andres Laasik, Maris Meiessaar, Veiko Õunpuu, Berk Vaher, Trash

Von Krahli teater kolib mõneks ajaks Saksamaale / Rain Tolk

Index Scriptorium Estoniae

Tolk, Rain, 1977-

2006-01-01

Von Krahli Teatri selle hooaja eelviimane esietendus "Europiraadid" on 17. mail Düsseldorfis, koostöös Saksamaa teatrirühmaga Showcase Beat Le Mot. Eesti poole pealt teevad kaasa Juhan Ulfsak, Taavi Eelmaa, Maarja Jakobson ja üllatusmängijana filmimees Rain Tolk, kes räägib oma suhtumisest teatrisse ja suhetest Von Krahli Teatriga

Isamaaliidu ühinemisjutt ajas Res Publica keema / Toomas Sildam

Index Scriptorium Estoniae

Sildam, Toomas, 1961-

2005-01-01

Ilmunud ka: Postimees : na russkom jazõke 14. nov., lk 3. Isamaaliidu esimehe Tõnis Lukase ettepanekut Isamaaliidu ja Res Publica ühinemiseks pooldavad ka Res Publica eestseisuse liikmed Juhan Parts ja Tõnis Palts, kuid Res Publica esimehe Taavi Veskimäe kinnitusel läheb Res Publica 2007. aasta parlamendivalimistele vastu iseseisvalt. Lisa: Isamaaliit ja Res Publica

IMF toetab Eesti maksureformi / Andris Feldmanis, Kertu Ruus

Index Scriptorium Estoniae

Feldmanis, Andris, 1982-

2004-01-01

Rahvusvahelise Valuutafondi (IMF) Eesti missiooni juht Richard Haas tutvustab äsjailmunud IMF-i raportis esitatud hinnangut Eesti majanduse hetkeseisu kohta ja võimalikke järgneva 15 aasta makroohtusid, sh jooksevkonto puudujääki ja laenamise kiiret kasvu. Rahandusminister Taavi Veskimägi ja Eesti Panga presidendi Vahur Krafti kommentaarid. Diagramm: Eesti laenukoormuse kasv kiireim

Tühirand ja maailma äär / Donald Tomberg

Index Scriptorium Estoniae

Tomberg, Donald

2006-01-01

Mati Undi jutustuse "Tühirand" (1972) ainetel valminud samanimeline lühimängufilm (2006). Filmi režissöör on Veiko Õunpuu, peaosades Rain Tolk, Maarja Jakobson, Mirtel Pohla ja Taavi Eelmaa. Paralleel samuti M. Undi novelli ainetel 1966.a. aastal valminud telefilmiga "Võlg" (režissöör Valdur Himbek, operaator Anton Mutt)

Rahandusministeerium : Eestit ootab ees galopeeriv hinnatõus / Kai Kalamees

Index Scriptorium Estoniae

Kalamees, Kai

2007-01-01

Ilmunud ka: Postimees : na russkom jazõke, 23. aug. 2007, lk. 2. Rahandusministeeriumi prognoosi järgi ootab Eestit 8,1%-line majanduskasv, 2008. aastal 7,4%-line hinnatõus. Rahandusminister Ivari Padari ja üle-eelmise rahandusministri parlamendiliikme Taavi Veskimäe arvamusi palgakasvu, inflatsiooni ja lisaeelarve kohta. Vt. samas: Käes on poliitiliste valikute aeg

Fractal dimension and image statistics of anal intraepithelial neoplasia

International Nuclear Information System (INIS)

Ahammer, H.; Kroepfl, J.M.; Hackl, Ch.; Sedivy, R.

2011-01-01

Research Highlights: → Human papillomaviruses cause anal intraepithelial neoplasia (AIN). → Digital image processing was carried out to classify the grades of AIN quantitatively. → The fractal dimension as well as grey value statistics was calculated. → Higher grades of AIN yielded higher values of the fractal dimension. → An automatic detection system is feasible. - Abstract: It is well known that human papillomaviruses (HPV) induce a variety of tumorous lesions of the skin. HPV-subtypes also cause premalignant lesions which are termed anal intraepithelial neoplasia (AIN). The clinical classification of AIN is of growing interest in clinical practice, due to increasing HPV infection rates throughout human population. The common classification approach is based on subjective inspections of histological slices of anal tissues with all the drawbacks of depending on the status and individual variances of the trained pathologists. Therefore, a nonlinear quantitative classification method including the calculation of the fractal dimension and first order as well as second order image statistical parameters was developed. The absolute values of these quantitative parameters reflected the distinct grades of AIN very well. The quantitative approach has the potential to decrease classification errors significantly and it could be used as a widely applied screening technique.

[Määramised

Index Scriptorium Estoniae

2006-01-01

Ametisse määramised: Kaitseliidu ülem major Raivo Lumiste; Maaväe staabi ülem kolonelleitnant Indrek Sirel; Kaitsejõudude peastaabi personaliosakonna ülem kolonelleitnant Vahur Väljamäe; 1. jalaväebrigaadi ülem kolonelleitnant Artur Tiganik; Scoutspataljoni ülem major Aivar Kokka; Kaitseväe peakaplan major Taavi Laanepere. Haridus, sõjaline kvalifikatsioon, teenistuskäik, auastmed, autasud

Ülemiste järve esitlev elegantne hotell : Lennujaama tee 2, Tallinn = An Elegant Hotel that Presents Lake Ülemiste : Lennujaama tee 2, Tallinn / Urmas Oja

Index Scriptorium Estoniae

Oja, Urmas, 1981-2012

2004-01-01

Aerofloti hotelli kohale ja osalt vana maja konstruktsioonidele ehitatud Ülemiste hotellist. Hotelli ees on parkla ja purskkaevuga väljak. Projekteerija: EA Reng, projektijuht Taavi Turvas. Arhitekt Martin Aunin. Sisekujundus: Meelis Press, Hillar Mänd (M. Pressi Arhitektuuribüroo). Konstruktsioonid: Inseneribüroo Pike. Ehitaja: FKSM. I, II ja III korruse plaan, 3 välis- ja 5 sisevaadet

Influência de frações da parede celular de levedura (Saccharomyces cerevisiae sobre os índices séricos de glicose e lipídios, microbiota intestinal e produção de ácidos graxos voláteis (AGV de cadeias curtas de ratos em crescimento Influence of yeast (Saccharomyces cerevisiae cell wall fractions on serum indexes of glucose and lipids, intestinal microbiota and production of short-chain volatile fatty acids (VFA in growing rats

Directory of Open Access Journals (Sweden)

Saula Goulart Chaud

2007-06-01

Full Text Available Os índices séricos de glicose e lipídios, a microbiota intestinal e a produção de ácidos graxos voláteis de cadeias curtas (AGV foram determinados em ratos Wistar submetidos às dietas: padrão (AIN-P, padrão modificada (AIN-M e às dietas contendo frações de parede celular de levedura: glicana insolúvel (GI, manana (M e glicana mais manana (G+M, como única fonte de fibra alimentar. O fracionamento da parede celular (PC foi realizado por processos físicos e químicos de extração, centrifugação e secagem em "spray dryer". Os índices séricos foram dosados através de "kits" comerciais. A microbiota e a produção de AGV foram determinadas nos conteúdos intestinais, incluindo cólon, ceco e reto. Considerando os níveis de colesterol no tempo (T0 e no tempo 28 (T28, as dietas AIN-P, AIN-M e M apresentaram efeito hipocolesterolêmico, tendo em vista que a composição das dietas eram de natureza hipercolesterolêmica. Em relação à glicose sérica, no tempo (T0 observou-se uma elevação geral da glicemia, sugerindo um efeito hiperglicêmico das dietas estudadas. A dieta G+M foi a que apresentou valores significantemente mais elevados de lipídios séricos no tempo T14, e os níveis mais baixos foram observados na dieta M e na dieta GI no T14 e nas dietas AIN-M e AIN-P. A dieta AIN-P foi a que apresentou valor significantemente mais elevado de triacilgliceróis nos tempos T14 e T28. Os níveis mais baixos nos tempos T14 foram constatados para as dietas G+M e GI e no tempo T28 para as dietas AIN-M e M. De um modo geral, não houve modificações significativas na microbiota intestinal dos animais em nenhuma das dietas. Dentre os AGV, o ácido acético foi o predominante, seguido do propiônico e do butírico, em todas as dietas estudadas.The blood serum indexes of glucose and lipids, the intestinal microbiota and the production of volatile fatty acids (VFA were determined in Wistar rats which were fed a standard (AIN-P diet, a

Production of biosurfactant on crude date syrup under saline conditions by entrapped cells of Natrialba sp. strain E21, an extremely halophilic bacterium isolated from a solar saltern (Ain Salah, Algeria).

Science.gov (United States)

Kebbouche-Gana, Salima; Gana, Mohamed Lamine; Ferrioune, Imen; Khemili, Souad; Lenchi, Nesrine; Akmouci-Toumi, Sihem; Bouanane-Darenfed, Nabila Amel; Djelali, Nacer-Eddine

2013-11-01

A bacterial strain E21 was isolated from a sample of water collected in the salt lake located close to Ain Salah, Algeria. The analysis of 16S rRNA gene sequence had indicated that the strain had 93 % sequence similarity with the genus Natrialba sp. strain E21 (GenBank, FR750525.1) and was considered extremely halophilic. Production of biosurfactant by the strain E21 with free and entrapped cells was investigated using soluble starch in the saline conditions. Biosurfactant synthesis was followed by measuring the surface tension and emulsifying index 9 days under optimal conditions (40 °C, pH 7). Some diffusional limitations in alginate and agar beads affected the kinetics of biosurfactant production when compared to that obtained with free cells culture. The minimum values of surface tension were 27 and 30 mN m(-1) achieved after 9 days with free and immobilized cells, respectively, while the corresponding maximum E24 values were 65.3 and 62.3 %, respectively. The re-use of bacterial cells along with the limited cell losses provided by the immobilized system might lead to significant reduction of the biosurfactant production cost.

Microstructure of Nitrided Aluminum Alloys Using an Electron-Beam-Excited-Plasma (EBEP)

Institute of Scientific and Technical Information of China (English)

L. Liu; A. Yamamoto; T. Hishida; H. Shoyama; T. Hara; T. Hara

2004-01-01

Nitriding of surface of aluminum alloys was carried out with using an electron-beam-excited-plasma (EBEP)technique. The EBEP is sustained by electron impact ionization with energetic electron beam. Two kinds of substrates,aluminum alloys AA5052 and AA5083, were exposed to the down flow of EBEP source at 843 K for 45min. The specimens were characterized with respect to following properties: crystallographic structure (XRD), morphology (SEM) and the cross sectional microstructures of the nitrided layer was observed using a scanning electron microscopy (SEM). There are some Al2O3 particles on the surface of the nitrided AA5052 and AA5083. The AIN layers were formed on the substrates with the thickness of 4.5 μ m for AA5052 and 0.5 μ m for AA5083. A relatively uniform nitrided surface layer composed of AIN can be observed on the AA5052 substrate. The grains size near the interfaces between the substrate and AIN layer were smaller than that near the surface. On the surface of AIN layer, the concentration of nitrogen was high and in the middle of AIN layer it had a constant concentration like the aluminum and the concentration was decreased with approaching to the interface. On the surface of nitrided AA5083, a uniform AIN layer was not formed as the reason for the high nitriding temperature.

Epidemiology of acute poisoning in children presenting to the poisoning treatment center at Ain Shams University in Cairo, Egypt, 2009–2013

Science.gov (United States)

Azab, Sonya M. S.; Hirshon, Jon Mark; Hayes, Bryan D.; El-Setouhy, Maged; Smith, Gordon S.; Sakr, Mahmoud Lotfy; Tawfik, Hany; Klein-Schwartz, Wendy

2016-01-01

Introduction Pediatric poisonings represent a major and preventable cause of morbidity and mortality throughout the world. Epidemiologic information about poisoning among children in many lower- and middle-income countries is scarce. This study describes the epidemiology of acute poisonings in children presenting to Ain Shams University's Poisoning Treatment Center (ASU-PTC) in Cairo and determines the causative agents and characteristics of acute poisoning in several pediatric age groups. Methods This retrospective study involved acutely poisoned patients, 0 to 18 years of age, who presented to the ASU-PTC between 1/1/2009 and 12/31/2013. Data were extracted from electronic records maintained by the ASU-PTC. Collected data included demographics, substance of exposure, circumstances of the poisoning, patient disposition, and outcome. Results During the 5-year study period, 38,470 patients meeting our criteria were treated by the ASU-PTC; 19,987 (52%) were younger than 6 years of age; 4,196 (11%) were 6 to 12 years; and 14,287 (37%) were >12 years. Unintentional poisoning accounted for 68.5% of the ingestions, though among adolescents 84.1% of ingestions were with self-harm intent. In all age groups, the most frequent causative drugs were non-opioid analgesics, antipyretics, and antirheumatics. The most common nonpharmaceutical agents were corrosives in preschool children and pesticides in adolescents. Most patients had no/minor effects (29,174 [75.8%]); hospitalization rates were highest among adolescents. There were 119 deaths (case fatality rate of 0.3), primarily from pesticide ingestion. Conclusion Poisoning in preschool children is mainly unintentional and commonly due to nonpharmaceutical agents while poisoning in adolescents is mainly intentional (self-harm). Pesticides, mainly organophosphorous compounds and carbamates, were the most frequent agent leading to morbidity and mortality. PMID:26653953

Eesti Vabariigi põhiseadus : kommenteeritud väljaanne / toimetuskolleegium: Eerik-Juhan Truuväli, Oliver Kask, Lasse Lehis, Heiki Lindpere, Uno Lõhmus, Ülle Madise, Kalle Merusk, Raul Narits, Vallo Olle, Jüri Põld, Heinrich Schneider

Index Scriptorium Estoniae

2002-01-01

Kommentaaride autorid ja sisu: Sissejuhatus / Raul Narits, Heinrich Schneider, Lauri Madise. [Preambul] / Heinrich Schneider. I ptk. / Kalle Merusk, Taavi Annus, Madis Ernits, Heiki Lindpere, Lauri Madise. II ptk. / Uno Lõhmus, Taavi Annus, Madis Ernits, Oliver Kask, Eerik Kergandberg, Rait Maruste, Peeter Roosma. III ptk. / Oliver Kask. IV ptk. / Jüri Põld, Lauri Madise, Aaro Mõttus. V ptk. / Eerik-Juhan Truuväli, Ülle Madise, Jüri Põld, Urmas Reinsalu. VI ptk. / Kalle Merusk, Jüri Põld. VII ptk. / Eerik-Juhan Truuväli, Jüri Põld. VIII ptk. / Lasse Lehis. IX ptk. / Heiki Lindpere, Kristi Land, Lauri Madise, Heiki Pisuke. X ptk. / Oliver Kask, Enn Markvart, Jüri Põld. XI ptk. / Heinrich Schneider. XII ptk. / Raul Narits, Aare Reenumägi, Peeter Roosma, Enn Markvart. XIII ptk. / Uno Lõhmus, Madis Ernits, Jüri Põld. XIV ptk. / Vallo Olle, Arno Almann, Ülle Madise, Jüri Liventaal. XV ptk. / Eerik-Juhan Truuväli, Aaro Mõttus. Eesti Vabariigi põhiseaduse rakendamise seadus / Raul Narits, Peeter Roosma, Oliver Kask. Märksõnastik / koost. Ülle Madise, Peep Pruks. Kasutatud õigusaktide lühendid / koost. Virgo Saarmets. Eesti Vabariigi põhiseadus 1990-2002 : bibliograafia / koost. Maia Ruttu

In situ EELS and TEM observation of Al implanted with nitrogen ions

International Nuclear Information System (INIS)

Hojou, K.; Furuno, S.; Kushita, K.N.; Otsu, H.; Izui, K.

1995-01-01

Formation processes of Aluminum nitride (AIN) in Aluminum (AI) implanted with nitrogen were examined by in situ EELS and TEM observations during nitrogen ion implantation in an electron microscope at room temperature and 400 deg C. AIN phase was identified both by EDP and EELS after nitrogen ion implantation to 6 x 10 20 (N + )/m 2 . The observed peak (20.8 eV) in EELS spectra was identified as plasmon loss peak of AIN formed in AI. The binding energy of N ls in AI was found to shift by about 4 eV to the lower side with increasing nitrogen-ion fluence. Unreacted AI was also found to remain in the AIN films after high fluence implantation both at room temperature and 400 deg C. (authors). 11 refs., 5 figs., 2 tabs

Teatrilugu nendest, kes teatris ei käi / Tuuli Koch

Index Scriptorium Estoniae

Koch, Tuuli

2000-01-01

Nr. 52/1999. Martin McDonaghi "Mägede iluduskuninganna" Vanemuises, lavastaja Ain Mäeots. Esietendus oli 5. nov. Ka Ain Mäeotsa ja näitlejate Liina Tennosaare ning Margus Jaanovitsi arvamusi näidendist

Uus Tants 7 / Mikko Orpana

Index Scriptorium Estoniae

Orpana, Mikko

2005-01-01

Tallinnas 2005. aasta märtsikuus toimunud tantsufestifalist "Uus tants 7". Pikemalt peatutakse Mart Kangro lavastusel "Out of Functions" ning Oksana Titova ja Taavet Janseni lavastusel "The Last Hairy", aga juttu on ka Renate Valme teosest "Mesta", samuti Tiina Olleski ja Rene Nõmmiku "Body Experience Time", Katrin Essensoni ja Taavi Eelmaa "The Thoughts with Manus" ja Krõõt Juuraku "Artistic Approach 3. I"

Teadusraha jagajad sunnitud toetama iseenda projekte / Siim Sepper

Index Scriptorium Estoniae

Sepper, Siim, 1979-

2004-01-01

Ilmunud ka: Infopress, 9. apr., nr. 15, 2004, lk. 131. Eesti Teadusfond rahastab oma nõukogu ja ekspertkomisjonide liikmete teadustöid üle 1,5 miljoni krooni ulatuses. Rahandusminister Taavi Veskimäe sõnul tuleb luua huvide konflikte välistav rahajagamise süsteem. Skeem: Valitsus eraldas ETF-ile 91 miljonit. Vt. samas: Huvide konflikti välistamine; Teadusfond plaanib professor Lotmani kohtusse kaevata

Comparison of imiquimod, topical fluorouracil, and electrocautery for the treatment of anal intraepithelial neoplasia in HIV-positive men who have sex with men: an open-label, randomised controlled trial.

Science.gov (United States)

Richel, Olivier; de Vries, Henry J C; van Noesel, Carel J M; Dijkgraaf, Marcel G W; Prins, Jan M

2013-04-01

Anal cancer is an increasing issue in HIV-positive men who have sex with men (MSM). Screening for its precursor, anal intraepithelial neoplasia (AIN), is subject of discussion. Current treatment options are suboptimum and have not been compared in a prospective trial. We compared efficacy and side-effects of imiquimod, topical fluorouracil, and electrocautery for the treatment of AIN. In this open-label randomised trial, we included HIV-positive MSM older than 18 years visiting the HIV outpatient clinic of the Academic Medical Center, Amsterdam, Netherlands. Patients with histologically confirmed AIN were randomly assigned to receive either 16 weeks of imiquimod (three times a week), 16 weeks of topical fluorouracil (twice a week), or monthly electrocautery for 4 months. Randomisation was done with random block sizes of three and six, stratified for AIN grade (AIN grades 1, 2, or 3) and AIN location (peri-anal or intra-anal). Participants were assessed by high-resolution anoscopy 4 weeks after treatment. Responding patients returned for follow-up 24 weeks, 48 weeks, and 72 weeks after treatment. The primary endpoint was histological resolution of AIN measured 4 weeks after treatment and AIN recurrence at week 24, week 48, and week 72 after treatment. The primary analysis was done in a modified intention-to-treat population, including all patients who had received their assigned treatment at least once. The trial is registered at the Netherlands Trial Register, number NTR1236. Between Aug 12, 2008, and Dec 1, 2010, we screened 388 HIV-positive MSM for AIN by high resolution anoscopy. Of the 246 (63%) patients who had AIN, 156 (63%) were randomly assigned to either receive imiquimod (54 patients), topical fluorouracil (48 patients), or electrocautery (46 patients) following withdrawing of consent by eight patients. Modified intention-to-treat analysis showed a complete response in 13 (24%, 95% CI 15-37) patients in the imiquimod group, eight (17%, 8-30) of patients

Prosthesis-patient mismatch after transcatheter aortic valve implantation using the Edwards SAPIEN™ prosthesis.

Science.gov (United States)

Van Linden, Arnaud; Kempfert, Jörg; Blumenstein, Johannes; Rastan, Ardawan; Holzhey, David; Lehmann, Sven; Mohr, Friedrich W; Walther, Thomas

2013-08-01

Prosthesis-patient mismatch (PPM) is defined as a too small effective orifice area (EOA) of the prosthetic valve in relation to the patient's body size and has been documented to be related to adverse outcomes after conventional aortic valve replacement (AVR). Aim of this study was to analyze the incidence of PPM after transcatheter aortic valve implantation (T-AVI) using the Edwards SAPIEN prosthesis and its relation to postoperative outcome. 200 consecutive high-risk patients underwent transapical aortic valve implantation (TA-AVI) between February 2006 and January 2009 and fulfilled 1 year follow-up were included. Severe PPM was defined as indexed EOA (EOAi) <0.65 cm2/m2 and moderate PPM as EOAi = 0.65-0.85 cm2/m2, EOA was calculated from transthoracic echocardiographic (TTE) measurements using the continuity equation. Total 112 patients with sufficient postoperative TTE image quality formed the study group. EOAi increased from 0.3 ± 0.1 cm2/m2 (preoperatively) to 1.1 ± 0.4 cm2/m2 after TA-AVI (p < 0.001). According to the standard definitions, PPM was seen in 38.4% of the patients and 9.8% presented with severe PPM. The occurrence of PPM had neither an effect on clinical outcome in terms of NYHA class nor on survival. Patients with PPM had significantly higher postoperative transprosthetic gradients (mean gradient 10.4 ± 4.1 versus 7.1 ± 3.0 mm Hg, p < 0.001). Based on the in vitro EOA data obtained from pulse duplicator measurements, however, none of the patients was judged to have PPM. Transcatheter AVI provides good antegrade hemodynamic function and EOAi improves significantly. According to standardized evaluations PPM occurs after TA-AVI, but it is not associated with adverse outcomes. Thus use of the continuity equation may not adequately reflect the situation after T-AVI or the current definition of PPM is not suitable for T-AVI prostheses. Georg Thieme Verlag KG Stuttgart · New York.

Determination of aluminium nitride or free nitrogen in low carbon steel

International Nuclear Information System (INIS)

Guetaz, V.; Soler, M.; Massardier, V.; Merlin, J.; Ravaine, D.

2001-01-01

As the aluminium nitrides play an important role in the manufacturing of steel sheets, a specific methodology was developed based on the thermoelectric power (TEP) technique, in order to determine the AIN nitrogen by an indirect method. The free nitrogen was determined and then the AIN nitrogen was calculated by the difference between the total nitrogen and the free nitrogen. Indeed, it is easier to determine the dissolved nitrogen, the content of which gradually decreases during the AIN precipitation, than the AIN nitrogen. A low carbon aluminium killed steel was employed with 580 ppm of aluminium and 50 ppm of nitrogen. A comparison of the results obtained by TEP with those obtained by other techniques (hot hydrogen extraction, electrochemical dissolution followed by a mineralization, electrochemical dissolution followed by a sodic decomposition and the Beeghly method) was conducted, in order to determine a reliable technique likely to quantify the amount of aluminium nitrides in aluminium killed steels. With these techniques, it is possible to determine either free nitrogen or precipitated nitrogen. From an experimental point of view, the precipitation kinetics of AIN was followed during an annealing performed at 973 K (700 C) by TEP and then different precipitation states of AIN were investigated to compare the different techniques: three annealing states (when no nitrogen, half the nitrogen and the total nitrogen has precipitated) and two soaking states (1403 and 1523 K). Thus, it was possible to compare states where the AIN precipitates are in various forms (different shapes, crystallographic structures, sizes, distributions in the matrix). This work showed that the quantification by TEP, hot hydrogen extraction and electrochemical dissolution followed by a mineralization seem reliable whereas the Beeghly method gives good results only for the precipitates formed at high temperatures. In contrast, the quantification by electrochemical dissolution followed by

GW182-Free microRNA Silencing Complex Controls Post-transcriptional Gene Expression during Caenorhabditis elegans Embryogenesis.

Directory of Open Access Journals (Sweden)

Guillaume Jannot

2016-12-01

Full Text Available MicroRNAs and Argonaute form the microRNA induced silencing complex or miRISC that recruits GW182, causing mRNA degradation and/or translational repression. Despite the clear conservation and molecular significance, it is unknown if miRISC-GW182 interaction is essential for gene silencing during animal development. Using Caenorhabditis elegans to explore this question, we examined the relationship and effect on gene silencing between the GW182 orthologs, AIN-1 and AIN-2, and the microRNA-specific Argonaute, ALG-1. Homology modeling based on human Argonaute structures indicated that ALG-1 possesses conserved Tryptophan-binding Pockets required for GW182 binding. We show in vitro and in vivo that their mutations severely altered the association with AIN-1 and AIN-2. ALG-1 tryptophan-binding pockets mutant animals retained microRNA-binding and processing ability, but were deficient in reporter silencing activity. Interestingly, the ALG-1 tryptophan-binding pockets mutant phenocopied the loss of alg-1 in worms during larval stages, yet was sufficient to rescue embryonic lethality, indicating the dispensability of AINs association with the miRISC at this developmental stage. The dispensability of AINs in miRNA regulation is further demonstrated by the capacity of ALG-1 tryptophan-binding pockets mutant to regulate a target of the embryonic mir-35 microRNA family. Thus, our results demonstrate that the microRNA pathway can act independently of GW182 proteins during C. elegans embryogenesis.

Wireless intelligent network: infrastructure before services?

Science.gov (United States)

Chu, Narisa N.

1996-01-01

The Wireless Intelligent Network (WIN) intends to take advantage of the Advanced Intelligent Network (AIN) concepts and products developed from wireline communications. However, progress of the AIN deployment has been slow due to the many barriers that exist in the traditional wireline carriers' deployment procedures and infrastructure. The success of AIN has not been truly demonstrated. The AIN objectives and directions are applicable to the wireless industry although the plans and implementations could be significantly different. This paper points out WIN characteristics in architecture, flexibility, deployment, and value to customers. In order to succeed, the technology driven AIN concept has to be reinforced by the market driven WIN services. An infrastructure suitable for the WIN will contain elements that are foreign to the wireline network. The deployment process is expected to seed with the revenue generated services. Standardization will be achieved by simplifying and incorporating the IS-41C, AIN, and Intelligent Network CS-1 recommendations. Integration of the existing and future systems impose the biggest challenge of all. Service creation has to be complemented with service deployment process which heavily impact the carriers' infrastructure. WIN deployment will likely start from an Intelligent Peripheral, a Service Control Point and migrate to a Service Node when sufficient triggers are implemented in the mobile switch for distributed call control. The struggle to move forward will not be based on technology, but rather on the impact to existing infrastructure.

Asociación entre el consumo de antiinflamatorios no esteroideos y la aparición o descompensación de insuficiencia cardíaca congestiva : estudio de casos y controles

OpenAIRE

Rodríguez Bernardino, Ángel

2003-01-01

La insuficiencia cardiaca congestiva (ICC) es una patología con una alta prevalencia en nuestro medio. Se ha establecido una posible relación entre la acción de los antiinflamatorios no esteroideos (AINEs) sobre la síntesis de prostaglandinas y la aparición de ICC en individuos susceptibles. Nuestro objetivo fue evaluar la asociación entre el ingreso hospitalario por ICC y el consumo previo de AINEs, estimado la contribución individual de los distintos de AINEs. Se realizó un estudio multicén...

Resonance April Cover Pg TP

Indian Academy of Sciences (India)

Admin

word possibly having its origin in Sanskrit). W hat is ... History and Some Perspectives on Intermolecular Forces. E Arunan. Keywords van der Waals forces, hydrogen bonding. ... A tom s have rem ained a dom ain of physics, rather than.

Pärast kõike / intervjueerinud Veiko Märka

Index Scriptorium Estoniae

1998-01-01

Vestlusring: Ain Mäeots, Merle Jääger, Helena Merzin, Margus Jaanovits, Riho Kütsar. Madis Kõivu võrukeelse näidendi 'Omavahelisi jutuajamisi tädi Elliga' lavastamisest Vanemuise teatris, lavastaja Ain Mäeots. Ka Kauksi Ülle kommentaar

Eeslid / Ain Kaalep

Index Scriptorium Estoniae

Kaalep, Ain, 1926-

2003-01-01

Sisu: Eeslid ; Luuletaja Koghazi ; Elav kuningas ; Neli legendi : Mungasuudlus ; Dorzhiin ; Legend meister Albrechtist ; Aafrika muld. Ballaad kombaini armastusest ; Kuningakatse ; Rapsoodiad : Draakoni talveuni ; Klaassepa poeg. Kaks indiaani metamorfoosi : Roti metamorfoos ; Ahvnaine. Paani surm ; Valgjärve legend ; Katsikõsõ'

Turundusteenistus / Ain Kaljurand

Index Scriptorium Estoniae

Kaljurand, Ain, 1965-

2004-01-01

Ilmunud ka: 2003 : annual report : [Eesti Raudtee]. - Tallinn, 2004, lk. 15-20; 2003 : godovoi ottshjot : [Eesti Raudtee]. - Tallinn, 2004, lk. 15-20. Ülevaade AS-i Eesti Raudtee 2003. a. kaubaveost veomahtude ja kaubagruppide järgi, turundusteenistusest, hinnapoliitikast

GILD Bankers, kas ainult ajutised raskused? / Taavi Raudne

Index Scriptorium Estoniae

Raudne, Taavi

2010-01-01

GILD nõustas ühte Bakuu kinnisvarasse suunatud võlakirjaemissiooni ja on andnud OÜ-le Daria Invest laenu, mis on maksmata. Asjaga on seotud ka Seaside Residence Baku OÜ, Delta Investment Group, Rain Tamm ja Tõnis Haavel. Eesti presidendi Toomas Hendrik Ilvese Azerbaidžaani visiidi üks mitteametlikke teemasid olevat olnud see sama kinnisvaraarendusprojekt

Kelle pension vajab enim tõstmist? / Taavi Rõivas

Index Scriptorium Estoniae

Rõivas, Taavi, 1979-

2007-01-01

Riigikogu liikme sõnul näeb Reformierakond vajadust tõsta eeskätt praeguste vanemate pensionäride pensioni, Keskerakonna esitatud pensioniseaduse muudatus aga viiks praegu töötavate inimeste tulevikupensioni tõusule. Ta selgitab pensioni kujunemist ning kutsub inimesi oma arvamust avaldama, kelle pension peaks praegu olema esikohal

Pensionide maksustamine muutub lihtsamaks / Taavi Veskimägi

Index Scriptorium Estoniae

Veskimägi, Taavi, 1974-

2005-01-01

Tulumaksuseaduse muutmise eelnõust, mis puudutab pensionide maksustamist. Sama ka Vali Uudised 4. veeb. 2005, lk. 4 ; Põhjarannik 3. veeb. 2005, lk. 4 ; Hiiu Leht 4. veeb. 2005, lk. 7 ; Võrumaa Teataja 5. veeb. 2005, lk. 2 ; Lääne Elu 5. veeb. 2005, lk. 2 ; Koit 3. veeb. 2005, lk. 4 ; Elva Postipoiss 5. veeb. 2005, lk. 2 ; Türi Rahvaleht 4. veeb. 2005, lk. 4 ; Meie Maa 5. veeb. 2005, lk. 5 ; Pärnu Postimees 5. veeb. 2005, lk. 15 ; Sõnumitooja 9. veeb. 2005, lk. 6 ; Virumaa Teataja 8. veeb. 2005, lk. 7 ; Valgamaalane 8. veeb. 2005, lk. 2 ; Vooremaa 19. veeb. 2005, lk. 2 ; Sakala 17. veeb. 2005, lk. 5

GILD Bankers, kas ainult ajutised raskused? / Taavi Raudne

Index Scriptorium Estoniae

Raudne, Taavi

2010-01-01

GILD Bankers nõustas ühte Bakuu kinnisvarasse suunatud võlakirjaemissiooni. 2009. a. jaanuaris toimunud president Toomas Hendrik Ilvese visiidi ajal Azerbaidzhaani oli see kinnisvaraarendusprojekt üks arutlusel olnud mitteametlikke teemasid. Vabariigi President töövisiidil Aserbaidzhaanis 12.-15.01.2009

Rohkem head metsa / Taavi Ehrpais ; interv. Heiki Raudla

Index Scriptorium Estoniae

Ehrpais, Taavi, 1976-

2005-01-01

Vardi erametsaseltsi esimees põllumaa metsastamise põhjustest, looduslikust metsastumisest, istutatud puude valikust, metsastustoetustest. Lisad: Enamlevinud metsataimede hinnad tänavu kevadel; Pange tähele! Vt. samas: Istikutest tuli puudu; Siret Tappo. Põllumaade metsastamise toetus

Exegi monumentum ehk palee Tallinnas / Siim Sultson

Index Scriptorium Estoniae

Sultson, Siim

2007-01-01

Tallinnas Narva mnt. 7 endisest Tsentrosojuzprojektist ümber ehitatud Triumph Plazast (arhitektid Vilen Künnapu ja Ain Padrik). Maja kavandati 1981. a. büroohooneks (arhitektid Olga Bruns ja Mart Kalling). Kommenteerivad Mart Port, Dmitri Bruns, Kristiina Möldre ja Ain Padrik

Automating the AFROTC Four-Year Scholarship Program.

Science.gov (United States)

1986-04-01

ATCH 2 b1 C -d C4 4" %C N 0" cl4 es C4 CN 1 onin %DG C1 06 0 -0 40 V 44-4 LIU-4- c4 A: U. -4 La 4 E vt a-’ iv El "l 04 0 0.I t b U El 4 V do v 0 CoU. -4...CEEB CLAS~S BOARD 1ST 2ND DCF QEP/ STRT,"’ HWFADC CfI3; PEL SCORES SCORE COMP SCOPE STAND RAMK".,H~DC ’ PREF PREF RACE PREY" rTL B1 = 46/1 C hiroms...A/N 88 Fencing 4 AIN 89 La Crosse 4 AIN 90 Rifle/Pistol 4 AIN 91 Rugby 4 AIN 92 Track 4 A/N 93 Wrestling 4 A/N 94 Others (Name and Codes) 15 A/N 95

Riskikapital vajab riigi kehtestatud mängureegleid / Peeter Saks

Index Scriptorium Estoniae

Saks, Peeter

2004-01-01

AS-i Suprema Securities juhatuse esimehe sõnul on Euroopa riskikapitali turul selge nõudlus sobiva seadusliku raamistiku ja hea mainega riigi või piirkonna järele, Eestil on praegu võimalus kujuneda Euroopa üheks riskikapitali keskuseks. Autori arvates peaks esimeseks sammuks olema eraldi riskikapitali seaduse loomine. Vt. samas: Andrus Ansip, Taavi Veskimägi ja Linnar Viik vastavad küsimusele, kas Eesti vajab riiklikku riskikapitali fondi

Perekond on kolmes kohas / Ave Randviir

Index Scriptorium Estoniae

Randviir, Ave, 1981-

2006-01-01

Tallinn Pride 2006 kultuurinädala raames Viru keskuses samasooliste paaride suhteid kujutav maalinäitus "Meie oleme perekond". Esinevad Tiina Tammetalu, Lilian Mosolainen ja Pille Neeve. Samanimeline näitus Cafe Angel'is Chintis Lundgreni ja Heikki-Erich Merila töödest ning kinos Sõprus kunstnike ühenduse Infotankistid (Anu Vahtra, Reimo Võsa-Tangsoo, Katrin Tees, Maris Mändel, Taavi Suits, Sulo Kallas, Piret Räni) fotonäitus

Põlvkondade triloogia Von Krahli teatris / Hedi-Liis Toome

Index Scriptorium Estoniae

Toome, Hedi-Liis

2010-01-01

Von Krahli teatri lavastustest: William Shakespeare "Kuningas Lear", mängib Viljandi Kultuuriakadeemia 8. lend, lavastaja Peeter Jalakas (esietendus 30. jaan. 2010); "The End" - autorid, lavastajad ja näitlejad: Mari Abel, Tiina Tauraite, Riina Maidre, Erki Laur, Taavi Eelmaa, Juhan Ulfsak (esietendus 19. märts 2010); "Mehed lumes" Peter Freucheni jutustuse "Olavi lugu" ainetel lavastanud Mart Koldits ja Kristjan Sarv, kes ka ise mängivad (17. aprill 2010)

Secretory leukocyte protease inhibitor expression and high-risk HPV infection in anal lesions of HIV positive patients

Science.gov (United States)

NUOVO, Gerard J.; GRINSZTEJN, Beatriz; FRIEDMAN, Ruth K.; VELOSO, Valdiléa G.; CUNHA, Cynthia B.; COUTINHO, José R.; VIANNA-ANDRADE, Cecilia; OLIVEIRA, Nathalia S.; WOODHAM, Andrew W.; DA SILVA, Diane M.; KAST, W. Martin

2016-01-01

Objective The aim of the current study was to evaluate secretory leukocyte protease inhibitor (SLPI) expression in anal biopsies from HIV-positive (HIV+) individuals, and compare that to anal intraepithelial neoplasia (AIN) diagnoses and human papillomavirus (HPV) status. Design This is a cross-sectional study of a cohort of 54 HIV+ (31 males and 23 females) from an AIDS clinic in Rio de Janeiro, Brazil. Methods The study material consisted of anorectal tissue biopsies obtained from HIV+ subjects, which were used to construct tissue microarray paraffin blocks for immunohistochemical analysis of SLPI expression. Biopsies were evaluated by an expert pathologist and classified as low-grade anal intraepithelial neoplasia (AIN1), high-grade anal intraepithelial neoplasia (AIN2/3), or normal squamous epithelium. Additionally, DNA from the biopsies was extracted and analyzed for the presence of low- or high-risk HPV DNA. Results Histologically normal squamous epithelium from the anorectal region showed strong positive SLPI staining in 17/20 (85%) samples. In comparison, 9/17 (53%) dysplastic squamous epithelial samples from AIN1 patients showed strong SLPI staining, and only 5/17 (29%) samples from AIN2-3 patients exhibited strong SPLI staining, which both were significantly fewer than those from normal tissue (p=0.005). Furthermore, there was a significantly higher proportion of samples in which oncogenic high-risk HPV genotypes were detected in low SLPI expressing tissues than that in tissues with high SLPI expression (p=0.040). Conclusion Taken together these results suggest that low SLPI expression is associated with high-risk HPV infections in the development of AIN. PMID:27149102

One lesion, one virus: individual components of high-grade anal intraepithelial neoplasia in HIV-positive men contain a single HPV type

NARCIS (Netherlands)

Richel, Olivier; Quint, Koen D.; Lindeman, Jan; van Noesel, Carel J. M.; de Koning, Maurits N. C.; van den Munckhof, Henk A. M.; de Vries, Henry J. C.; Prins, Jan M.; Quint, Wim G. V.

2014-01-01

High-grade anal intraepithelial neoplasia (AIN) is present in many human immunodeficiency virus (HIV)-positive men who have sex with men. The major etiologic factor is infection with an oncogenic human papillomavirus (HPV) genotype. We investigated whether individual components of high-grade AIN are

Avaliação do perfil antiinflamatório e analgésico, e dos efeitos colaterais da administração oral de meloxicam em equinos: avaliação física, laboratorial e gastroscópica

OpenAIRE

Veronezi, Regina de Cássia [UNESP

2007-01-01

Os antiinflamatórios não esteroidais (AINEs) são rotineiramente usados na medicina eqüina como analgésicos e antiinflamatórios, sendo potentes controladores da dor. Entretanto, estes fármacos provocam alguns efeitos indesejáveis, como por exemplo, lesões renais e gastrointestinais. Os efeitos adversos dos AINEs ocorrem com a inibição da COX-1, enquanto os efeitos benéficos são observados com a inibição da enzima COX-2. Com o surgimento dos AINEs seletivos para COX-2, os efeitos adversos são c...

Graphene–poly(5-aminoindole) composite film as Pt catalyst support for methanol electrooxidation in alkaline medium

International Nuclear Information System (INIS)

Yue, Ruirui; Zhang, Qiang; Wang, Caiqin; Du, Yukou; Yang, Ping; Xu, Jingkun

2013-01-01

Highlights: • Electropolymerization of 5-aminoindole (AIn) in the presence of graphene (GE). • Significant catalytic effect of GE on the polymerization of AIn. • PAIn/GE/GC used as Pt catalyst support. • The enhanced catalytic activity of Pt/PAIn/GE/GC for methanol electrooxidation. -- Abstract: 5-Aminoindole (AIn) was electropolymerized on graphene (GE) modified glass carbon (GC) electrode in 0.5 M H 2 SO 4 aqueous solution containing 0.01 M AIn. Because of the catalytic effect of GE, the polymerization efficiency of AIn and the electrochemical activity of as-formed poly(5-aminoindole) (PAIn) were significantly improved on GE/GC electrode as compared to that on the bare GC electrode. The prepared PAIn/GE/GC electrode was used as substrate for Pt particle electrodeposition. SEM, EDX and Raman spectral were used to characterize the prepared electrodes. Electrocatalytic experiments demonstrate that the Pt/PAIn/GE/GC electrode possesses high catalytic activity toward methanol electrooxidation in alkaline medium, due to the good dispersion of Pt particles on PAIn/GE/GC and the electronic interactions between the metal particles and the polymer matrixes. Thus, PAIn can be a promising alternative for polymeric catalyst support in direct alcohol fuel cells

Trends in incidence of anal cancer and high-grade anal intraepithelial neoplasia in Denmark, 1978-2008

DEFF Research Database (Denmark)

Nielsen, Ann; Plum, Christian Edinger Munk; Kjaer, Susanne K

2012-01-01

The aim of the study was to determine the incidences of anal cancer and high-grade anal intraepithelial neoplasia (AIN2/3) over time in Danish women and men. Describing the burden of anal cancer and AIN may be valuable in future evaluations of the human papillomavirus (HPV) vaccine. We included all...... anal cancers in the Danish Cancer Register in the period 1978-2008 and all cases of AIN2/3 in the Danish Registry of Pathology. Overall and age-, period- and histology-specific incidence rates were estimated. During the 30-year period, 2187 anal cancers were identified, two thirds of which were...... in women. Between 1978-1982 and 2003-2008, the age-standardized incidence rate of anal cancer increased from 0.68 to 1.48 per 100 000 person-years in women and from 0.45 to 0.80 per 100 000 person-years in men. Although there is no systematic screening for AIN in Denmark, we nevertheless identified 608...

Surface morphology of Al0.3Ga0.7N/Al2O3-high electron mobility transistor structure.

Science.gov (United States)

Cörekçi, S; Usanmaz, D; Tekeli, Z; Cakmak, M; Ozçelik, S; Ozbay, E

2008-02-01

We present surface properties of buffer films (AIN and GaN) and Al0.3Gao.zN/Al2O3-High Electron Mobility Transistor (HEMT) structures with/without AIN interlayer grown on High Temperature (HT)-AIN buffer/Al2O3 substrate and Al2O3 substrate. We have found that the GaN surface morphology is step-flow in character and the density of dislocations was about 10(8)-10(9) cm(-2). The AFM measurements also exhibited that the presence of atomic steps with large lateral step dimension and the surface of samples was smooth. The lateral step sizes are in the range of 100-250 nm. The typical rms values of HEMT structures were found as 0.27, 0.30, and 0.70 nm. HT-AIN buffer layer can have a significant impact on the surface morphology of Al0.3Ga0.7N/Al2O3-HEMT structures.

Tunable magnetic properties by interfacial manipulation of L1(0)-FePt perpendicular ultrathin film with island-like structures.

Science.gov (United States)

Feng, C; Wang, S G; Yang, M Y; Zhang, E; Zhan, Q; Jiang, Y; Li, B H; Yu, G H

2012-02-01

Based on interfacial manipulation of the MgO single crystal substrate and non-magnetic AIN compound, a L1(0)-FePt perpendicular ultrathin film with the structure of MgO/FePt-AIN/Ta was designed, prepared, and investigated. The film is comprised of L1(0)-FePt "magnetic islands," which exhibits a perpendicular magnetic anisotropy (PMA), tunable coercivity (Hc), and interparticle exchange coupling (IEC). The MgO substrate promotes PMA of the film because of interfacial control of the FePt lattice orientation. The AIN compound is doped to increase the difference of surface energy between FePt layer and MgO substrate and to suppress the growth of FePt grains, which takes control of island growth mode of FePt atoms. The AIN compound also acts as isolator of L1(0)-FePt islands to pin the sites of FePt domains, resulting in the tunability of Hc and IEC of the films.

Pap smears for men: a vision of the future?

LENUS (Irish Health Repository)

Oon, S F

2012-02-01

BACKGROUND: Anal intraepithelial neoplasia (AIN) rarely receives as much publicity as its neighbouring orifice, the cervix. As in the cervix, intraepithelial neoplasias are precursors to cancer in the anal canal. AIN and cervical interstitial neoplasia (CIN) undergo dysplasia as a consequence of human papillomavirus (HPV) infection. Since the advent of screening with the Pap smear in CIN, cervical cancer has plummeted to a fifth of its initial incidence. Anal cancer, however, has been rising, with a predilection for human immunodeficiency virus-infected men. HPV causes a squamous epithelial dysplasia and converts healthy tissue into AINs of increasing severity until anal cancer manifests. CLINICAL CASE: This article describes a clinical case of anogenital HPV infection refractory to medical and surgical therapy. It also describes an effective surgical excision technique associated with a good cosmetic outcome. CONCLUSIONS: The paper concludes by briefly discussing the implications of a national screening programme against AIN in the future.

Hypothyroidism could be the only manifestation of mitochondrial ...

African Journals Online (AJOL)

Hoda Tomoum

2012-11-24

Nov 24, 2012 ... Hypothyroidism could be the only manifestation of mitochondrial T8993C mutation in Leigh syndrome. Hoda Tomoum a. , Solaf M. Elsayed b,. *, Elizabeth Berry-Kravis c a Department of Pediatrics, Ain Shams University, Cairo, Egypt b Genetics Unit, Department of Pediatrics, Ain Shams University, Cairo, ...

AVALIAÇÃO DA DISPENSAÇÃO DE FÁRMACOS PARCIALMENTE SELETIVOS PARA COX-2

Directory of Open Access Journals (Sweden)

Cícero Cardoso VALLE FILHO

2015-12-01

Full Text Available Uma pesquisa foi realizada com o objetivo de avaliar um potencial aumento na venda de fármacos anti-inflamatórios não esteroidais (AINEs parcialmente seletivos para a COX-2 durante o período de julho de 2009 a junho de 2011, em uma drogaria localizada no município de Itaperuna, estado do Rio de Janeiro. Durante o período estudado foi dispensado um total de 802 AINEs parcialmente seletivos para a COX-2, dentre os quais 59,85% foram de nimesulida, 5,74% de etodolaco e 34,41% de meloxicam.   No primeiro semestre avaliado a dispensação total de AINEs parcialmente seletivos foi equivalente a 92, no segundo semestre a dispensação total foi equivalente a 159, no terceiro semestre a dispensação total foi de 219 AINEs parcialmente seletivos para COX-2 e no quarto semestre foram dispensados 332.  Os resultados indicaram maior dispensação dos medicamentos desta classe no mês de abril de 2011 sendo que tanto a nimesulida, quanto o meloxicam e o etodolaco foram mais dispensados no último semestre do estudo. De acordo com a metodologia utilizada pode-se concluir que a dispensação dos AINEs parcialmente seletivos vem crescendo a cada ano e que a nimesulida apresenta o maior índice de crescimento; a maior indicação da nimesulida tem sido para crianças; os meses correspondentes ao período de inverno apresentam maior dispensação de AINEs parcialmente seletivos para a COX-2.

Kultuuritehas : masinad, naised, muusika / Rednar Annus

Index Scriptorium Estoniae

Annus, Rednar, 1970-

2006-01-01

Kultuuritehase festival 18.-27.augustini 2006 a. Kultuuritehases Polymer. Lähemalt Erik Alalooga tööst "Väga mõnusad masinad", Inna Joosti töödest "Orkaan Katrina" ja "Maakera", Taavi Piibemanni fotoseeriast "Morbiid lendas üle", Kadri Metstaki, Edith Karlsoni, Marje Mee ja Delina Reissi kipsskulptuurist "Linda", Raul Viitungi fotonäitusest "Aborigeenid", Maiu Kurvitsa fotoseeriast "Kollanemees - kangelane, kes võidab naeratusega maailma", Ed Labetski ja Agu Visaku installatsioonist "Korrektne?"

Eestlased rabelevad 52 miljardi krooni jagamise pärast / Erik Aru

Index Scriptorium Estoniae

Aru, Erik

2006-01-01

Eesti saab aastatel 2007-2013 EL-i struktuurifondidelt 52 miljardit krooni, rahandusministeerium koostab riiklikku struktuurivahendite kasutamise strateegiat. Res Publica esimees Taavi Veskimägi kavatseb esitada seaduseparanduse, mille kohaselt peaks struktuurivahendite strateegia kinnitama Riigikogu. Struktuurivahendite jagamine loob EAS-i juhataja Alar Kolgi sõnul Eestis seniolematu majandusharu: projektijuhtimissektori. Lisa: EL-i raha loob uue majandussektori. Vt. samas: Andrus Ansip, Valdo Kalm, Heido Vitsur, Leev Kuum ja Linnar Viik vastavad küsimusele, mis on innovatsioon

Von Krahl klaarib piraadina asju euroliidus / Andres Laasik

Index Scriptorium Estoniae

Laasik, Andres, 1960-2016

2006-01-01

Von Krahli Teatri selle hooaja eelviimane esietendus "Europiraadid" on 17. mail Düsseldorfis, koostöös Saksamaa teatrirühmaga Showcase Beat Le Mot. (Varem on tehtud sama teatrirühmaga koostöös "Piraadid", mida mängiti nii Eestis kui Saksamaal). Eesti poole pealt teevad kaasa Juhan Ulfsak, Taavi Eelmaa, Maarja Jakobson ja Rain Tolk. Sakslaste poole pealt on tegijad Nikola Duric, Thorsten Eibler, Dariusz Kostyra ja Veit Spengler

Velvet Creative Alliance

Index Scriptorium Estoniae

2007-01-01

Tallinnas Niine t. 11 asuva disainibüroo Velvet Creative Alliance sisekujundus, mille eest sisearhitekt Taavi Aunre (Boom) pälvis Eesti Sisearhitektide Liidu 2006. a. büroointerjööri preemia. Osa mööblist on valmistatud T. Aunre jooniste järgi. Graafilise disaini osa kavandas disainibüroo ise. T. Aunrest, tema tähtsamad tööd. Plaan, 9 värv. vaadet, foto T. Aunrest

Hydrogeological and isotopic studies for selected springs in Sinai Peninsula

Energy Technology Data Exchange (ETDEWEB)

Hamza, M S; Awad, M A; El-gamal, S A [Atomic Energy Authority, Cairo Egypt and Middle Eastern Regional Radioisotope Center for The Arab Countries, Dokki, 12311, Cairo (Egypt); Hammad, F A [Desert Research Centre, Materia, Cairo, (Egypt)

1995-10-01

This paper deals with the hydrogeology and isotopic composition of water samples collected from selected spring in sinai (e.g. Algudierate, Alqusiema, qidis and Isram) in order to identify their genesis, their interaction with the host rocks and mixing trend. Results of isotopic composition have indicated the similarity in the hydrogeologic situation of Ain qidis and Ain-al-gudierate, while Ain Isram has shown a marked difference in its stable isotope and this could be due to evaporation effect. The isotopic and hydrochemical constituents of the studied springs reflect eater of a meteoric origin with a possible contamination from surficial materials (evaporates) and deeper aquifers. 6 figs., 2 tabs.

Ressources et partage de l'eau dans l'oasis de Kenadsa (Sud-Ouest Algerien; approche historique et constat

Directory of Open Access Journals (Sweden)

YOUCEF BENMOUSSA

2015-07-01

Full Text Available Resources And Water Sharing In The Oasis Of Kenadsa (Southwest Algeria; Historical Approach And Findings. Kenadsa, a peaceable oasis in southwestern Algeria, with the discovery and exploitation of coal (1917 - 1956, underwent graft of Western models for its development. That has cleared the oasis of the spatial dimension and tr ansformed into a mining village by excellence. These networks of foggaras draining groundwater, enclosed in a multilayer aquifer, which becomes free on the northern border of the Ksar. There were 25 foggaras of sources (Ain, each of which had its own drai nage channels to downstream gardens of Ksar. The distribution of water from these sources was ensured by a complex network, fed by drainage galleries that meander the alleys of Ksar and gives place to access points for domestic uses. The right to water is generally private property; one could dispose of according to modes of transmission of a property. It’s sharing for irrigation is governed by the volume and time. Currently, only some ten foggaras of sources that are still alive (Ain Sidi Mbarek, Ain Dir, Belkaid Ain, Ain Sheikh ..... These waters are characterized by mediocre quality (pH 7.31, CE: 4.88 ms / cm, RS 2420 mg / l Ca ++: 288.2 mg / l, SO4 -- : 468 83 mg / l..

Bulletin of Materials Science | Indian Academy of Sciences

Indian Academy of Sciences (India)

Laboratoire de Physique Fondamentale et Applique (LPFA), Faculté des Sciences Ain Chock, Université Hassan II, B.P. 5366 Mâarif, Casablanca, Maroc; Laboratoire de Physique des Matériaux, Micro-électronique, Automatique et Thermique (LPMMAT), Faculté des Sciences Ain Chock, Université Hassan II, B.P. 5366 ...

A Strong Impact of Genetic Background on Gut Microflora in Mice

Directory of Open Access Journals (Sweden)

R. Steven Esworthy

2010-01-01

Full Text Available Genetic background affects susceptibility to ileocolitis in mice deficient in two intracellular glutathione peroxidases, GPx1 and GPx2. The C57BL/6 (B6 GPx1/2 double-knockout (DKO mice have mild ileocolitis, and 129S1/Sv (129 DKO mice have severe inflammation. We used diet to modulate ileocolitis; a casein-based defined diet with AIN76A micronutrients (AIN attenuates inflammation compared to conventional LabDiets. Because luminal microbiota induce DKO ileocolitis, we assessed bacterial composition with automated ribosomal intergenic-spacer analysis (ARISA on cecal DNA. We found that mouse strain had the strongest impact on the composition of microbiota than diet and GPx genotypes. In comparing AIN and LabDiet, DKO mice were more resistant to change than the non-DKO or WT mice. However, supplementing yeast and inulin to AIN diet greatly altered microflora profiles in the DKO mice. From 129 DKO strictly, we found overgrowth of Escherichia coli. We conclude that genetic background predisposes mice to colonization of potentially pathogenic E. coli.

Tony Blair ei saanud Balti riikidelt loodetud järeleandmisi / Andris Feldmanis

Index Scriptorium Estoniae

Feldmanis, Andris, 1982-

2005-01-01

Balti riigid ei olnud nõus loobuma kümnendikust eurotoetustest. Tallinnas viibinud Suurbritannia peaministri Tony Blairi väitel on EL-i uue finantsperspektiivi vastuvõtmine just uute liikmesriikide huvides. Vt. samas: Tiiu Laks. Riigijuhi visiit põhjustas Tallinnas vaid lühiajalisi liiklusseisakuid; Lisa: Blairi esinemine ei reetnud ebaedu; Kaivo Kopli. Uusliikmed andsid tuld juba enne ettepanekute saamist; Lisa: Toetus vanadelt liikmesmaadelt; Märt Kivine. EL-i eelarve: lahjem kui kunagi varem. Kommenteerib Taavi Veskimägi

Análisis coste-efectividad del empleo de celecoxib en el tratamiento de la artrosis

Directory of Open Access Journals (Sweden)

Moreno A.

2003-01-01

Full Text Available Antecedentes: Los antiinflamatorios no esteroideos (AINE, utilizados en el tratamiento de la artrosis, pueden producir reacciones adversas gastrointestinales (GI graves. Celecoxib, un inhibidor específico de la ciclooxigenasa 2 (COX-2, ha demostrado una eficacia equivalente a los AINE convencionales con un mejor perfil de tolerabilidad y seguridad. Objetivo: La finalidad de este estudio ha sido realizar un análisis coste-efectividad sobre el uso de celecoxib frente a los AINE clásicos en el tratamiento de la artrosis. Material y métodos: El análisis coste-efectividad se ha diseñado mediante un modelo farmacoeconómico, definiéndose como unidad de efectividad a cada año de vida ganado tras la toma de celecoxib o AINE. La probabilidad de que aparezcan los diferentes resultados clínicos se ha obtenido de artículos publicados y de asunciones incorporadas. Sólo se han valorado los costes directos médicos (medicación, hospitalización, pruebas complementarias, analíticas, visitas extras, etc., sin haberse incluido otros costes. La perspectiva del estudio ha sido la del Sistema Nacional de Salud y el horizonte temporal elegido ha sido de 6 meses. Resultados: El coste adicional por cada año de vida ganado secundario al uso de celecoxib frente a los AINE clásicos asciende a 8.017 ? (1.333.834 ptas.. El análisis de sensibilidad muestra cómo estos valores son sensibles a la modificación del coste de AINE y gastroprotector, así como a la inclusión de grupos poblacionales con edades más bajas. Conclusiones: Celecoxib puede ser considerado como una opción coste-efectiva en el tratamiento de la artrosis, ya que va a evitar muertes y a ganar años de vida para los pacientes con un coste adicional razonable y moderado, cuando se compara con los AINE. Su eficiencia aumenta a medida que se utiliza en poblaciones con menor edad media y, probablemente, en aquellas con mayor riesgo de desarrollar complicaciones GI.

Há uma associação entre anti-inflamatórios não-esteroides e nefropatia induzida por contraste?

Directory of Open Access Journals (Sweden)

Luciano Passamani Diogo

Full Text Available FUNDAMENTO: A associação entre o uso de anti-inflamatórios não-esteroides (AINEs e insuficiência renal aguda ou crônica é bem documentada, mas evidências sobre a associação entre AINEs e nefropatia induzida por contraste (NIC não são encontradas na literatura. OBJETIVO: Avaliar uma possível associação entre AINEs e NIC. MÉTODOS: Em um estudo de coorte, através da entrevista clínica de pacientes que foram submetidos à cateterização cardíaca, analisamos o uso de AINEs e sua associação com desenvolvimento de NIC, através da alteração dos níveis de creatinina sérica ou taxa de filtração glomerular em 48 ou 72 horas. RESULTADOS: No período de julho de 2005 a julho de 2006, 236 pacientes foram incluídos no estudo, dos quais 29 foram posteriormente excluídos. A incidência de NIC foi 10,37% (20 de 207 e 42% dos pacientes estavam recebendo AINEs até o momento da avaliação. Não houve associação entre o uso de AINEs e o desenvolvimento de NIC com OR de 1,293; IC95% (0,46-4,2. O estudo detectou fatores de risco conhecidos para o desenvolvimento de NIC, tais como diabete, com OR de 2,77; IC95% (1,05-7,47 e insuficiência renal crônica com OR de 3,48; IC95% (1,1-11,07 e também sugeriu uma ação protetora da hidratação com solução salina com OR de 0,166; IC95% (0,03-0,92. CONCLUSÃO: Com base nos dados obtidos, concluímos que não houve associação entre NIC e uso prévio de AINEs, pelo menos com um OR > 2,85, o qual nossa amostra detectou.

Jah koostööle! / Taavi Veskimägi

Index Scriptorium Estoniae

Veskimägi, Taavi, 1974-

2005-01-01

Ilmunud ka: Türi Rahvaleht 2. dets., lk. 2, Kuulutaja 2. dets., lk. 4, Põhjarannik 2. dets., lk. 2, Severnoje Poberezhje 2. dets., lk. 2, Pärnu Postimees 3. dets., lk. 19, Lääne Elu 3. dets., lk. 2, Võrumaa Teataja 3. dets., lk. 2, Koit 3. dets., lk. 6, Vooremaa 3. dets. lk. 2, Sakala 6. dets. lk. 2, Meie Maa 7. dets. lk. 2, Nädaline 8. dets. lk. 2. Res Publica esimehe sõnul vajab erakond 2007. aasta valimisteks tugevat koostöölepet Reformierakonna, sotsiaaldemokraatide ja Isamaaliidu vahel

Siili teavituskampaania tagas ajaloo suurima õppuse toimumise / Taavi Karotamm

Index Scriptorium Estoniae

Karotamm, Taavi

2016-01-01

2015. a. mais toimunud Kaitseväe suurõppuse "Siil" teavituskampaaniast. Eesti Kaitsevägi pälvis "Kaitseväe ja Eesti vabariigi ajaloo suurima sõjalise õppuse Siil 2015 mainekampaania" eest konkursil Suhtekorralduse auhind 2015 eripreemia

Hirm taevas ning võit infosõjas / Taavi Minnik

Index Scriptorium Estoniae

Minnik, Taavi, 1986-

2015-01-01

Venemaa ja Egiptus soovivad Siinai poolsaare lennuõnnetuse põhjusena välistada terrorirünnaku võimaluse, samas kui välismeedias ning Venemaa opositsioonilistes kanalites selle üle aina valjemini arutletakse

Kuidas üheskoos ajalugu mäletada? / Taavi Arus

Index Scriptorium Estoniae

Arus, Taavi

2007-01-01

Tallinna Ülikoolis 26. ja 27. juulil toimuvast loengusarjast, kus astuvad loengutega üles ajaloolased Peter Burke, Leonidas Donskis ja Maurice Bloch. Tallinna Ülikooli rektori professor Rein Raua sõnul on nimetatud loengusari üks selle suve intellektuaalseid kõrghetki. Loengutele järgnevad arutelud, mida juhivad vastavalt Tallinna Ülikooli Eesti Humanitaarinstituudi lektor Marek Tamm, filosoofiaprofessor Tõnu Viik ning antropoloogiadotsent Lorenzo Canas

Indrek Saar kehastub Pilistveres Rasputiniks / Aarne Mäe

Index Scriptorium Estoniae

Mäe, Aarne, 1967-

2008-01-01

7. aug. esietendub Pilistvere vanas rehehoones Ain Saviaugu kirjutatud ja lavastatud suvetükk "Rasputin". Suvelavastuse tõi välja Põltsamaa Teater Ellunäod koos professionaalsete näitlejatega. Nimiosas mängib näitlejast riigikogulane Indrek Saar. Lisaks lühike intervjuu lavastajaga "Lavastaja Ain Saviauk : "Ajalugu on karm" ja fakte Rasputinist - "Grigori Jefimovitsh Rasputin-Novõhh"

Pose de la première pierre du bâtiment SMA18 du Cern

CERN Multimedia

CERN Press Office. Geneva

1999-01-01

On 30 April 1999, Jean Pépin, Sénateur for the Department of the Ain and President of the Conseil Général, and Professor Luciano Maiani the Director-General of CERN will lay the foundation stone of Building SMA18, financed by the Department of the Ain in the framework of France's special contribution to CERN's Large Hadron Collider (LHC) project.

Hirm, raha ja armastus / Margot Visnap, Kadi Herkül, Immo Mihkelson

Index Scriptorium Estoniae

Visnap, Margot, 1959-

1999-01-01

Teleteatri aastaringist - ETV kaheksa lavastust seitsmelt lavastajalt : Toomas Hussar/Ervin Õunapuu "Linnapea ehk Hirmu põhivormid". Rezh. T. Hussar. Eetris 1. jaan. 1998; A.H. Tammsaare/Ain Prosa "Ma armastasin sakslast". Rezh. A. Prosa. Eetris 24. veebr. 1998; Dennis Potter "Sa oled koor minu kohvis". Rezh. Vilja Palm. Eetris 1. jaan. 1999; Ain Prosa/Karl Ristikivi "lihtne lugu, lõpuga". Rezh. Ain Prosa. Eetris 28. nov. 1998; Betti Alver/Margus Kasterpalu "Tuulearmuke". Rezh. Elo Selirand. Eetris 23. mail 1998; Faama Filmi ja ETV teleteatri koostöö "Isa", sts. ja rezh. Mart Kivastik. Eetris 28. märtsil 1998; "Lilled Leale", sts. ja rezh. Olle Mirme Toomas Vindi novelli põhjal; Rein Saluri "Andke neile andeks", lav. Talvo Pabut. Eetris 19. okt. 1998

Rahvusvaheline turismikonverents / Ain Hinsberg

Index Scriptorium Estoniae

Hinsberg, Ain

2011-01-01

Radisson Blu Hotel Olümpias 28. aprillil korraldatud konverentsist "Läänemere regiooni turismiteadmuse toetus turismimajandusele ja -ettevõtlusele 2011-2026", millega tähistati Eesti Hotelli- ja Turismikõrgkooli EHTE 15. sünnipäeva. Thomas Mielke, Maritta Hiltuneni, Kristian Sieversi, Pauli Santala, Inese Šīrava, Maija Rozite ja Kestutis Ambrozaitise konverentsil peetud ettekannetest ja paneeldiskussioonist

Consent ain't anything

DEFF Research Database (Denmark)

Di Nucci, Ezio

2016-01-01

I argue against various versions of the 'attitude' view of consent and of the 'action' view of consent: I show that neither an attitude nor an action is either necessary or sufficient for consent. I then put forward a different view of consent based on the idea that, given a legitimate epistemic ...

Keelatud ained / Ave Oit

Index Scriptorium Estoniae

Oit, Ave

2012-01-01

Öko- ja looduskosmeetikas keelatud või piirangutega lubatud koostisainetest: silikoonid, etoksüleeritud emulgaatorained (PEG-ühendid), toorõli baasil valmistatud rasvained ja emulgaatorid s.h mineraalõlid ja -vahad

Estudio farmacoepidemiológico de uso de antiinflamatorios no esteroideos en pacientes de alto riesgo cardiovascular

Directory of Open Access Journals (Sweden)

Jorge Enrique Machado-Alba

Full Text Available Con el objetivo de determinar la frecuencia de uso prolongado de antiinflamatorios no esteroideos (AINES en pacientes colombianos de alto riesgo cardiovascular (ARC se desarrolló un estudio retrospectivo en el cual se identificaron pacientes de ARC que usaron AINES por más de cinco meses continuos entre enero de 2011 y marzo de 2013. Se identificó a los pacientes que recibían crónicamente nitratos, digitálicos, y clopidogrel y ácido acetil salicílico (ASA, quienes fueron identificados como de ARC. Se realizó un análisis de frecuencias de uso según la comedicación recibida. Se encontró uso concomitante de AINES en el 0,35% de los consumidores de nitratos (tiempo promedio: 9,5 ± 4,4 meses, en el 0,36% de los consumidores de clopidogrel y ASA (tiempo promedio: 9,3 ± 3,4 meses, y en el 0,4% de los consumidores de digitálicos (10,2 ± 4,6 meses. Se concluye que existe una baja proporción de uso de AINES de manera crónica en pacientes de alto riesgo cardiovascular.

Immune profile and Epstein-Barr virus infection in acute interstitial nephritis: an immunohistochemical study in 78 patients.

LENUS (Irish Health Repository)

Mansur, Abdurrezagh

2011-01-01

Acute interstitial nephritis (AIN) is a common cause of acute kidney injury and is characterised by a dense interstitial cellular infiltrate, which has not been well defined. Previous studies have demonstrated a correlation between Epstein-Barr virus (EBV) infection and AIN. The purpose of our study was to define the nature of the interstitial immune infiltrate and to investigate the possibility of renal infection with EBV.

Efecto de la precipitación de nitruros de aluminio en la recristalización de aceros de bajo carbono recocidos convencionalmente

Directory of Open Access Journals (Sweden)

Monsalve, A.

2005-10-01

Full Text Available An important feature of aluminium killed steels is the strong influence that aluminium nitride precipitates produce in both the mechanical properties and the final microstructural characteristics of the steel. This influence is related to the different stages of the fabrication process. This paper deals with a study of the effects of aluminium nitrides on the kinetics of recrystallisation. Different heat treatments were carried out, in one case to dissolve AIN, and in the other in order to precipitate AIN. These steels were subjected to cold rolling, followed by a batch annealing process. The recrystallised fraction was measured, thus obtaining the kinetic curves. The activation energy for recrystallisation was computed in each case. The results showed that AIN precipitation during recrystallisation produces a delay in recrystallisation kinetics through a change in the activation energy value.

Los aceros calmados con aluminio presentan como característica importante, la gran influencia que ejercen los nitruros de aluminio en las propiedades mecánicas y características microestructurales finales. Esta influencia está, a su vez, relacionada con cada una de la etapas del proceso de fabricación. En el presente trabajo se ha abordado el estudio del efecto de los nitruros de aluminio sobre la cinética de recristalización. Para ello, se han llevado a cabo diversos tipos de tratamientos térmicos, con el objeto de disolver todo el AIN y, en el otro caso, de precipitar todo el AIN. A continuación, los aceros estudiados se deformaron en frío y se les realizó un recocido convencional. Se midió la fracción recristalizada evaluando la energía de activación para la recristalización. Los resultados mostraron que la precipitación de AIN durante la recristalización produce un retraso en la cinética de recristalización, a través del cambio en el valor de la energía de activación

Eesti vajab terasemat valitsust / tõlk. Marek Laane

Index Scriptorium Estoniae

2007-01-01

Briti mõjukas majandusajakiri Economist kirjutas oma veebiväljaandes Eesti edust 1990. aastatel. Kuid parlamendivalimised näitasid, et Eestis nagu teistes endistes kommunistlikes maades puudub reformialdis valitsus. Kiitust pälvib Eesti president Toomas Hendrik Ilves, kes pani veto pronkssõduri seadusele ja taunis Eesti iseseisvuspäeva pidustustel peetud kõnes korruptsiooni, enesega rahulolu ja takerdunud reforme. Kommenteerivad Eesti Konjunktuuriinstituudi juhtiv teadur Leev Kuum, SEB Ühispanga analüütik Hardo Pajula, majandusministri nõunik Heido Vitsur ja peaministri nõunik Taavi Rõivas

Teatriekspressiga Äksist Põltsamaale / Riina Mägi

Index Scriptorium Estoniae

Mägi, Riina, 1957-

2007-01-01

Jõgevamaa harrastus- ja projektitruppide vabaõhulavastuste esietendustest 2006. aastal : Priit Aimla "Saadjärve saamise lugu" (Tabivere Harrastusteater, lavastaja Tõnis Lepp), Oskar Lutsu loomingust inspireeritud Veiko Märka "Sabani sõlmes Luts" (Palamuse Amatöörteater, lavastaja Raivo Adlas), Marina Carri "Kassirabal" projektitrupi esituses, lavastaja Ain Saviauk, Mati Tiku "Legend" (Saare Valla Metsateater, lavastaja autor), Ain Saviaugu "Ulm ehk Unistus Liivimaast" (Põltsamaa teater Ellunäod, lavastaja autor)

AnAnalytical Study of Chinese Salt (MSG: Is it Halal or Haram (Urdu

Directory of Open Access Journals (Sweden)

Dr. Junaid Akbar

2017-01-01

Full Text Available Monosodium Glutamate is the scientific name of Chinese salt, which also called Ajinomoto. Monosodium Glutamate was first discovered by the Japanese chemist Ikeda Kibunae in 1908. The MSG was firstly derived from seaweed. Later on MSG was got from meat, gluten,and vegetables etc. It can be derived from Najasul‘ain and GherNajasul‘ain things. If it was got from Najasul ‘ain, then there is a question about MSG that is it Halal(permissible/ lawful or Haram(non-permissible/unlawful. This research in this article is concluded that if the culture of MSG is Halal or the properIsti Halah has been done in Najas; MSG will be Halal(permissible/ lawful. However, where no such details are available about the culture of MSG, it should be avoid, although it cannot be declared Haram as per Islamic Jurisprudence rules

Dual-sided electrosurgery handpiece for simultaneous tissue cutting and coagulation: first report on a conceptual design validated by an animal experiment

OpenAIRE

Tawfik, Hatem A; Fouad, Yousef A; Hafez, Rashad

2015-01-01

Hatem A Tawfik,1 Yousef A Fouad,2 Rashad Hafez3 1Department of Ophthalmology, Oculoplastics Service, Ain Shams University, 2Faculty of Medicine, Ain Shams University, 3Eye Subspecialty Centre, Cairo, Egypt Objective: To introduce and evaluate the safety of a novel dual-sided electrosurgery handpiece design for simultaneous tissue cutting and coagulation. Methods: We designed a prototype double-sided handpiece allowing automatic switching between two electrodes with a simple handpiece flip. T...

Relevancia clínica de las interacciones medicamentosas entre antiinflamatorios no esteroideos y antihipertensivos

Directory of Open Access Journals (Sweden)

Juan Villa

2014-11-01

Conclusiones: Algunos AINE pueden disminuir la efectividad del tratamiento antihipertensivo cuando se utilizan simultáneamente con antihipertensivos, en especial con inhibidores de la enzima conversora de angiotensina, diuréticos, bloqueadores beta y antagonistas de los receptores de angiotensina. No se encontró evidencia de la modificación del efecto de los antagonistas de los canales de calcio, especialmente dihidropiridínicos, por el uso simultáneo con AINE.

Rohkem iseseisvust ja vabadust kohalikele omavalitsustele / Taavi Veskimägi

Index Scriptorium Estoniae

Veskimägi, Taavi, 1974-

2004-01-01

Ilmunud ka: Lääne Elu, 16. sept. 2004, lk. 2; Sakala, 16. sept. 2004, lk. 2; Pärnu Postimees, 16. sept. 2004, lk. 15; Põhjarannik, 17. sept. 2004, lk. 2; Severnoje Poberezhje, 17. sept. 2004, lk. 2; Võrumaa Teataja, 18. sept. 2004, lk. 2; Koit, 18. sept. 2004, lk. 6; Meie Maa, 18. sept. 2004, lk. 2; Sõnumitooja, 22. sept. 2004, lk. 6. Rahandusministri artikkel kohalike omavalitsuste maksupoliitikast

Balcas Eesti saeveski otsib uusi lahendusi / Taavi Linnamäe

Index Scriptorium Estoniae

Linnamäe, Taavi

2004-01-01

Balcas Eesti direktori Indrek Palumaa sõnul hakkab ettevõte tegelema tegevussorteeritud konstruktsioonimaterjalide tootmisega. Vt. samas: Indrek Palumaa. Ülikõrgele kerkinud toorme hind sunnib ettevõtjaid arvutama

Teraviljatoodete tootmine, tarbimine ja kaubandus : [1994-2004 Eestis] / Taavi Kuntu

Index Scriptorium Estoniae

Kuntu, Taavi

2005-01-01

Ilmunud ka: Agriculture and the development of rural life : overview 2004/2005. - Tallinn, 2005, lk. 34-41. Teravilja, teraviljasaadusi ja muid toiduaineid töötlev tööstus annab väärtuseliselt ligikaudu 18% Eesti toiduainetööstuse kogutoodangust. Diagrammid. Tabel

Obshtshejevropeiskoje roditelskoje possobije - horoshii primer, podannõi Estoniei / Taavi Rõivas

Index Scriptorium Estoniae

Rõivas, Taavi, 1979-

2008-01-01

Euroopa Komisjon tegi liikmesriikidele ettepaneku rakendada vähemalt 18 nädala pikkust vanemahüvitist. Riigikogu liige viitab, et Eestis on hüvitise-aastatel kasvanud sündimus 20,7%. ilmunud ka Vesti Estonii okt. lk. 4

Synthesis of TiCuAg thick film inks for glass frit free metallization of aluminium nitride

International Nuclear Information System (INIS)

Adlassnig, A.; Schuster, J. C.; Smetana, W.; Reicher, R.

1997-01-01

A glas frit free screen printing ink for metallization of AIN was developed. Bonding to the substrate is achieved by active metal additives. The metallic component consists of Cu and Ag powder synthesized from inorganic salts by the polyol process, and Cu-Ti powder synthesized by arc melting, milling and ultracentrifugation. This ternary powder mixture was introduced to a specifically developed organic vehicle and screen printed onto AIN. The detailed development process and the results will be presented. (author)

P-type doping of GaN

International Nuclear Information System (INIS)

Wong, R.K.

2000-01-01

After implantation of As, As + Be, and As + Ga into GaN and annealing for short durations at temperatures as high as 1500 C, the GaN films remained highly resistive. It was apparent from c-RBS studies that although implantation damage did not create an amorphous layer in the GaN film, annealing at 1500 C did not provide enough energy to completely recover the radiation damage. Disorder recovered significantly after annealing at temperatures up to 1500 C, but not completely. From SIMS analysis, oxygen contamination in the AIN capping layer causes oxygen diffusion into the GaN film above 1400 C. The sapphire substrate (A1203) also decomposed and oxygen penetrated into the backside of the GaN layer above 1400 C. To prevent donor-like oxygen impurities from the capping layer and the substrate from contaminating the GaN film and compensating acceptors, post-implantation annealing should be done at temperatures below 1500 C. Oxygen in the cap could be reduced by growing the AIN cap on the GaN layer after the GaN growth run or by depositing the AIN layer in a ultra high vacuum (UHV) system post-growth to minimize residual oxygen and water contamination. With longer annealing times at 1400 C or at higher temperatures with a higher quality AIN, the implantation drainage may fully recover

P-type doping of GaN

Energy Technology Data Exchange (ETDEWEB)

Wong, Raechelle Kimberly [Univ. of California, Berkeley, CA (United States)

2000-04-01

After implantation of As, As + Be, and As + Ga into GaN and annealing for short durations at temperatures as high as 1500 C, the GaN films remained highly resistive. It was apparent from c-RBS studies that although implantation damage did not create an amorphous layer in the GaN film, annealing at 1500 C did not provide enough energy to completely recover the radiation damage. Disorder recovered significantly after annealing at temperatures up to 1500 C, but not completely. From SIMS analysis, oxygen contamination in the AIN capping layer causes oxygen diffusion into the GaN film above 1400 C. The sapphire substrate (A1203) also decomposed and oxygen penetrated into the backside of the GaN layer above 1400 C. To prevent donor-like oxygen impurities from the capping layer and the substrate from contaminating the GaN film and compensating acceptors, post-implantation annealing should be done at temperatures below 1500 C. Oxygen in the cap could be reduced by growing the AIN cap on the GaN layer after the GaN growth run or by depositing the AIN layer in a ultra high vacuum (UHV) system post-growth to minimize residual oxygen and water contamination. With longer annealing times at 1400 C or at higher temperatures with a higher quality AIN, the implantation drainage may fully recover.

Há uma associação entre anti-inflamatórios não-esteroides e nefropatia induzida por contraste? ¿Hay una asociación entre antiinflamatorios no esteroides y nefropatía inducida por contraste? Is there an association between non-steroidal anti-inflammatory drugs and contrast nephropathy?

Directory of Open Access Journals (Sweden)

Luciano Passamani Diogo

2010-12-01

Full Text Available FUNDAMENTO: A associação entre o uso de anti-inflamatórios não-esteroides (AINEs e insuficiência renal aguda ou crônica é bem documentada, mas evidências sobre a associação entre AINEs e nefropatia induzida por contraste (NIC não são encontradas na literatura. OBJETIVO: Avaliar uma possível associação entre AINEs e NIC. MÉTODOS: Em um estudo de coorte, através da entrevista clínica de pacientes que foram submetidos à cateterização cardíaca, analisamos o uso de AINEs e sua associação com desenvolvimento de NIC, através da alteração dos níveis de creatinina sérica ou taxa de filtração glomerular em 48 ou 72 horas. RESULTADOS: No período de julho de 2005 a julho de 2006, 236 pacientes foram incluídos no estudo, dos quais 29 foram posteriormente excluídos. A incidência de NIC foi 10,37% (20 de 207 e 42% dos pacientes estavam recebendo AINEs até o momento da avaliação. Não houve associação entre o uso de AINEs e o desenvolvimento de NIC com OR de 1,293; IC95% (0,46-4,2. O estudo detectou fatores de risco conhecidos para o desenvolvimento de NIC, tais como diabete, com OR de 2,77; IC95% (1,05-7,47 e insuficiência renal crônica com OR de 3,48; IC95% (1,1-11,07 e também sugeriu uma ação protetora da hidratação com solução salina com OR de 0,166; IC95% (0,03-0,92. CONCLUSÃO: Com base nos dados obtidos, concluímos que não houve associação entre NIC e uso prévio de AINEs, pelo menos com um OR > 2,85, o qual nossa amostra detectou.FUNDAMENTO: La asociación entre el uso de antiinflamatorios no esteroides (AINEs e insuficiencia renal aguda o crónica está bien documentada, pero evidencias sobre la asociación entre AINEs y nefropatía inducida por contraste (NIC no son encontradas en la literatura. OBJETIVO: Evaluar una posible asociación entre AINEs y NIC. MÉTODOS: En un estudio de cohorte, a través de la entrevista clínica de pacientes que fueron sometidos a cateterismo cardíaco, analizamos el

Impôts Français : CRDS - French version only

CERN Document Server

2003-01-01

Avis de dégrèvements IMPORTANT : Cette note d'information concerne uniquement : - les membres du personnel de nationalité française ou résidents permanents1 , domiciliés en France dans le département de l'Ain et rémunérés par le CERN (titulaires, boursiers, attachés payés et de projet) ; - Les anciens membres du personnel de l'Organisation, bénéficiaires de la Caisse de Pensions du CERN, domiciliés ou ayant été domiciliés en France dans le département de l'Ain. Ces personnes ont récemment reçu, ou sont sur le point de recevoir, un avis de dégrèvement émanant de la Direction des Services Fiscaux de l'Ain (DSFA) et portant sur la Contribution au Remboursement de la Dette Sociale (CRDS). I. Informations général...

Lahesõjas viik / Ain Hinsberg

Index Scriptorium Estoniae

Hinsberg, Ain

2001-01-01

Helsingi ja Tallinna vahel liikuvate laevafirmade konkurents: Silja Line, Nordic Jet Line, Tallink ja Linda Line. Tabelid: reisijad laevaliinil Helsingi-Tallinn 1998-2001; Helsingi-Tallinna liinil kiirlaevade turuosad 1999-2000

Piperazine side-effects in a patient with pre-existing renal insufficiency

Directory of Open Access Journals (Sweden)

Majid Malaki

2014-01-01

Full Text Available Piperazine as an antihelminth has many adverse effects, especially on patients with renal insufficiency. We report the use of piperazine in a girl with a moderately severe kidney disease due to Biedl Bardet syndrome. She developed coma and acute kidney injury due to acute interstitial nephritis (AIN, anemia and thrombocytopenia. The presence of fever, proteinuria, acidosis, anemia, sterile pyuria and non-oliguric renal failure strongly suggested AIN. Her problems abated mostly by discontinuing of piperazine and supportive therapy, except anemia and thrombocytopenia.

Arhitektuurikonkursid 2004

Index Scriptorium Estoniae

2004-01-01

Tulemused: Pärnu kergejõustikumaneezh: I preemia - Ralf Lõoke ja Karli Luik; Tartus Raatuse, Pika, Fortuuna ja Põigu tänava vahelise ala hoonestuskava: I - Kai Kuusik ja Taavi Kuri; Aasta betoonehitis 2003: peapreemia - Emil Urbel; Veneetsia IX rahvusvahelise arhitektuuribiennaali "Metamorfoosid" raames eksponeeritava eesti kaasaegse arhitektuuri näituse ideekonkurss: I - Kristjan Holm; äri- ja elumaja Pärnus Aida t. 5: I - Andres Lember; Eesti parim puitehitis 2003-2004: I - Aivo Schults; Eesti parim tellishoone 2003-2004: I- Tiit Trummal; Sõmeru keskusehoone: I - Ralf Lõoke ja Maarja Kask; Eesti Maanteemuuseumi välialade maastikuarhitektuurne ideekonkurss: I - Margit Kärner

ESL aastapreemia 2006 žürii koosoleku protokoll : 4. aprill 2007 = ESL annual prize 2006 official minutes of the meeting of the jury : April 4th 2007

Index Scriptorium Estoniae

2007-01-01

2006. a. ühiskondliku interjööri preemia Hannelore Pihlakule ja Kristi Lentsile Viimsi koolimaja interjööride eest, ajaloolise interjööri preemia Lembit Andres Torgile firma Koger & Partnerid kontori interjööride eest Fahle majas, näitusekujunduse preemia Mari Kurismaale ja Mari Kaljustele Kumu Kunstimuuseumis eksponeeritud Felicie Ropsi loomingu näituse "Eros ja Surm" kujunduse ja graafilise kujunduse eest, büroo interjööri preemia Taavi Aunrele Velvet Creative Alliance bürooruumide interjööride eest, esemepreemia Tiina Mangile diivanikomplekti Black eest. Žürii koosseis lk. 8

Siivsalt lahendatud Skoone bastion / Karin Paulus

Index Scriptorium Estoniae

Paulus, Karin, 1975-

2005-01-01

Tallinna vanalinnas asuva Skoone bastioni ja sellega külgneva staadioni arendamiseks väljakuulutatud ideekonkursi võidutöödest. Peapreemia sai töö "Glassii" (autorid Maarja Kask, Ralf Lõoke, Karli Luik arhitektuuribüroost Salto). Teise preemia pälvis töö "SK-one" (autorid Timo Subbi, Mihkel Urmet, Taavi Kaldaru arhitektuuribüroost Suburb OÜ). Kolmanda preemia sai töö "Karl XI" (autorid Ott Kadarik, Villem Tomiste, Mihkel Tüür, Paco-Ernest Ulman arhitektuuribüroost Kosmos). Võistlustöödega saab tutvuda Arhitektuuri- ja Disainigaleriis. Harry Liivranna lühike ülevaade Skone bastioni ajaloost

Gene : CBRC-GGOR-01-1448 [SEVENS

Lifescience Database Archive (English)

Full Text Available ain Friedlin] 1e-79 49% MCLALGSAGTADDVKLHPVACADTARSTPGTSAPSTPGTSAPSTPGTSAPSTSGISAPSTSGTSAPSTLGTSAPSKPGTSAPSKPGISAPSTSGISAPSTSGTSA...PSTSGTSAPSTPGTSAPSKPGTSAPSKPGISAPYTPGTSAPSTLGTSAPSTPGTSAPSTPGTSAPSKPGTSAPSKPGTSA...PSTPGTSAPSTLGTSAPSTPGTTAPSTAGTSAPSTSGTSAPSTSGTSAPSKPTTSAPYTPGTSAPSIPGTSAPSTTGTSAPSTPGTSAPSTPGTSAPSKPGTSAPSTPGTSA...PSTLGTSAPSTPGTSAPSTPGTSAPSKPGTSAPSMSGTSAPSTPGTSVPSKAGTSAPVDPGVLWGLERPLTDTEGRWLPPYVLL

Aluminium nitrate ceramics: A potential UV dosemeter material

DEFF Research Database (Denmark)

Trinkler, L.; Bøtter-Jensen, L.; Berzina, B.

2002-01-01

The ceramic material AIN-Y2O3 is proposed as a potential ultraviolet radiation (UVR) dosemeter using optically stimulated luminescence (OSL) and thermally stimulated luminescence (TL). Experimental studies have shown that AIN ceramics exhibit attractive characteristics suitable for practical UV...... dosimetry applications. The features are: (1) the spectral sensitivity covers the 200-350 nm range, in the UV-B region it is similar to that of human skin: (2) the angular dependence of the incident radiation follows the cosine law; (3) high yields of both UVR-induced OSL and TL signals compared to those...

Effect of reproductive tract scoring on reproductive efficiency in beef heifers bred by timed insemination and natural service versus only natural service.

Science.gov (United States)

Gutierrez, K; Kasimanickam, R; Tibary, A; Gay, J M; Kastelic, J P; Hall, J B; Whittier, W D

2014-04-15

The objective was to determine the effects of reproductive tract score (RTS) on reproductive performance in beef heifers bred by timed artificial insemination followed by natural service (AI-NS) or by natural service only (NSO). Angus cross beef heifers (n = 2660) in the AI-NS group were artificially inseminated at a fixed time (5- or 7-day CO-Synch + controlled internal drug release protocol) once, then exposed to bulls 2 weeks later (bull-to-heifer ratio = 1:40-1:50) for the reminder of the 85-day breeding season. Angus cross beef heifers (n = 1381) in NSO group were submitted to bulls (bull-to-heifer ratio = 1:20-1:25) for the entire 85-day breeding season. Heifers were reproductive tract scored from 1 (prepubertal) to 5 (cyclic) 4 weeks before, and were body condition scored (BCS) from 1 (emaciated) to 9 (obese) at the beginning of breeding season. Pregnancy diagnosis was performed 70 days after AI for AI-NS group and 2 months after the end of breeding season for both groups. Heifers in both groups were well managed and of similar age (14.9 ± 0.4 [AI-NS] and 14.7 ± 0.8 [NSO] months). Pregnancy rates (PRs) and number of days to become pregnant were calculated using PROC GLIMMIX and PROC LIFETEST procedures of SAS. Adjusting for BCS (P = 0.07), expressed estrus (P < 0.05), year (P < 0.05), and BCS by year interaction (P < 0.05), the AI-PR was greater for heifers in AI-NS group with higher RTS (P < 0.0001; 40.7%, 48.3%, 57.6%, and 64.6% for RTS of 2 or less, 3, 4, and 5, respectively). Controlling for BCS (P < 0.05), year (P < 0.05) and the breeding season pregnancy rates (BS-PRs) were greater for heifers in the AI-NS group with higher RTS (P < 0.01; 81.2%, 86.5%, 90.4%, and 95.2% for RTS of 2 or less, 3, 4, and 5, respectively). Similarly, adjusting for BCS, year (P < 0.05), the BS-PR was greater for heifers in NSO group with higher RTS (P < 0.01; 79.7%, 84.3%, 88.4%, and 90.2% for RTS of 2 or less, 3, 4, and 5, respectively). Heifers with higher RTS

Low Median Nerve Palsy as Initial Manifestation of Churg-Strauss Syndrome.

Science.gov (United States)

Roh, Young Hak; Koh, Young Do; Noh, Jung Ho; Gong, Hyun Sik; Baek, Goo Hyun

2017-06-01

Anterior interosseous nerve (AIN) syndrome is typically characterized by forearm pain and partial or complete dysfunction of the AIN-innervated muscles. Although the exact etiology and pathophysiology of the disorder remain unclear, AIN syndrome is increasingly thought to be an inflammatory condition of the nerve rather than a compressive neuropathy because the symptoms often resolve spontaneously following prolonged observation. However, peripheral neuropathy can be 1 of the first symptoms of systemic vasculitis that needs early systemic immunotherapy to prevent extensive nerve damage. Churg-Strauss syndrome (CSS; eosinophilic granulomatosis with polyangiitis) is 1 type of primary systemic vasculitis that frequently damages the peripheral nervous system. CSS-associated neuropathy usually involves nerves of the lower limb, and few studies have reported on the involvement of the upper limb alone. We report on a rare case of low median nerve palsy as the initial manifestation of CSS. The patient recovered well with early steroid treatment for primary systemic vasculitis. Copyright © 2017 American Society for Surgery of the Hand. Published by Elsevier Inc. All rights reserved.

Piimatööstus : [1990-ndad, 2000-2003 Eestis] / Taavi Kuntu

Index Scriptorium Estoniae

Kuntu, Taavi

2004-01-01

Ilmunud ka: Agriculture and rural development : overview 2003/2004. - Tallinn, 2004, lk. 59-69. 2003. a. moodustas piima tootmine põllumajanduse kogutoodangust hinnanguliselt 28%, toiduainetööstuses oli piimatööstuse osakaal 26%. Diagrammid. Tabelid. Graafikud

ORF Alignment: NC_003212 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available ain Clip11262) ... Length = 200 ... Query: 88 ... NAGLIKIGISEPSASLVLPQILKQFLTDFP...KLMVNVSVDDANTCSQKLIDGEIDFAICGE 147 ... NAGLIKIGISEPSASLVLPQILKQFLTDFPKLMVNVSVDDANTCSQKLIDGEIDFAICGE Sbjct: 1 ... NAGLIKIGISEPS

Anti-inflamatórios não esteroides: Efeitos cardiovasculares, cérebro-vasculares e renais Antiinflamatorios no esteroides: efectos cardiovasculares, cerebrovasculares y renales Nonsteroidal anti-inflammatory drugs: cardiovascular, cerebrovascular and renal effects

Directory of Open Access Journals (Sweden)

Michel Batlouni

2010-04-01

Full Text Available Os anti-inflamatórios não esteroides (AINEs encontram-se entre os medicamentos mais prescritos em todo o mundo. Essa classe heterogênea de fármacos inclui a aspirina e vários outros agentes inibidores da ciclo-oxigenase (COX, seletivos ou não. Os AINEs não seletivos são os mais antigos, e designados como tradicionais ou convencionais. Os AINEs seletivos para a COX-2 são designados COXIBEs. Nos últimos anos, tem sido questionada a segurança do uso dos AINEs na prática clínica, particularmente dos inibidores seletivos da COX-2. As evidências sobre o aumento do risco cardiovascular com o uso de AINEs são ainda incompletos, pela ausência de ensaios randomizados e controlados com poder para avaliar desfechos cardiovasculares relevantes. Entretanto, os resultados de estudos clínicos prospectivos e de meta-análises indicam que os inibidores seletivos da COX-2 exercem importantes efeitos cardiovasculares adversos, que incluem aumento do risco de infarto do miocárdio, acidente vascular cerebral, insuficiência cardíaca, insuficiência renal e hipertensão arterial. O risco desses efeitos adversos é maior em pacientes com história prévia de doença cardiovascular ou com alto risco para desenvolvê-la. Nesses pacientes, o uso de inibidores da COX-2 deve ser limitado àqueles para os quais não há alternativa apropriada e, mesmo assim, somente em doses baixas e pelo menor tempo necessário. Embora os efeitos adversos mais frequentes tenham sido relacionados à inibição seletiva da COX-2, a ausência de seletividade para essa isoenzima não elimina completamente o risco de eventos cardiovasculares, de modo que todos os fármacos do largo espectro dos AINEs somente devem ser prescritos após consideração do balanço risco/benefício.Los antiinflamatorios no esteroides (AINEs se encuentran entre los medicamentos más prescriptos en todo el mundo. Esta clase heterogénea de fármacos incluye la aspirina y varios otros agentes

High Prevalence of Anal Human Papillomavirus-Associated Cancer Precursors in a Contemporary Cohort of Asymptomatic HIV-Infected Women.

Science.gov (United States)

Heard, Isabelle; Etienney, Isabelle; Potard, Valérie; Poizot-Martin, Isabelle; Moore, Catherine; Lesage, Anne-Carole; Ressiot, Emmanuelle; Crenn-Hebert, Catherine; Fléjou, Jean-François; Cubie, Heather; Costagliola, Dominique; Darragh, Teresa M

2015-05-15

Although human immunodeficiency virus (HIV)-infected women are at high risk for anal cancer, few data have been published on prevalence of and risk factors for anal precancer and potential screening strategies in this risk group. A cross-sectional anal screening study was nested in a gynecological cohort of HIV-infected women. Anal swab specimens were collected for cytology and human papillomavirus (HPV) testing. High-resolution anoscopy, with biopsy when indicated, was systematically performed. Among the 171 enrolled women, median age was 47.3 years and 98% were receiving combination antiretroviral therapy. Median CD4(+) count was 655 cells/µL and HIV load was associated with increased risk of HG-AIN+. Abnormal anal cytology and HPV-16 infection performed best as a screening strategy for HG-AIN+ histology, with positive likelihood ratios of 3.4 (95% CI, 2.3-5.1) and 4.7 (95% CI, 2.5-8.7) and negative likelihood ratios of 0.2 (95% CI, .07-.8) and 0.4 (95% CI, .2-.9), respectively. HIV-infected women with a history of HPV-associated cervical disease are at increased risk for HG-AIN+ and should be offered anal cancer screening. Anal cytology and HPV-16 genotyping had the best screening performance. Anal cytology is easy to perform routinely; it may be the best candidate for screening for HG-AIN among HIV-infected women. © The Author 2015. Published by Oxford University Press on behalf of the Infectious Diseases Society of America. All rights reserved. For Permissions, please e-mail: journals.permissions@oup.com.

Abnormal structure and functional connectivity of the anterior insula at pain-free periovulation is associated with perceived pain during menstruation.

Science.gov (United States)

Dun, Wang-Huan; Yang, Jing; Yang, Ling; Ding, Dun; Ma, Xue-Ying; Liang, Feng-Li; von Deneen, Karen M; Ma, Shao-Hui; Xu, Xiao-Ling; Liu, Jixin; Zhang, Ming

2017-12-01

Neuroimaging studies have demonstrated the critical role of the insula in pain pathways and its close relation with the perceived intensity of nociceptive stimuli. We aimed to identify the structural and functional characteristics of the insula during periovulatory phase in women with primary dysmenorrhea (PDM), and further investigate its association with the intensity of perceived pain during menstruation. Optimized voxel-based morphometry and functional connectivity (FC) analyses were applied by using 3-dimensional T1-weighted and resting functional magnetic resonance imaging (fMRI) in 36 patients at the peri-ovulation phase and 29 age-, education-, and gender-matched healthy controls (HC). A visual analogue scale (VAS) was used to examine the intensity of the abdominal pain at periovulation and menstruation. In our results, PDM patients had significant higher VAS-rating during menstruaion than periovulation. Compared with the HC, PDM patients had lower gray matter density in the left anterior insula (aINS). Taken the left aINS as a seed region, we further found hypoconnectivity between aINS and medial prefrontal cortex (mPFC), which showed negative relation with the VAS during menstruation. As the aINS is a key site of the salience network (SN) and the mPFC is a critical region in the default mode network (DMN), it's implicated a trait-related central-alteration that communications between pain attention and perception networks were disrupted without the ongoing menstrual pain. Moreover, result of correlation analysis, at least in part, suggested a possible role of altered FC (pain-free period) in predicting pain perception (menstruation).

One-year multicentre outcomes of transapical aortic valve implantation using the SAPIEN XT™ valve: the PREVAIL transapical study.

Science.gov (United States)

Walther, Thomas; Thielmann, Matthias; Kempfert, Joerg; Schroefel, Holger; Wimmer-Greinecker, Gerhard; Treede, Hendrik; Wahlers, Thorsten; Wendler, Olaf

2013-05-01

The study aimed to evaluate 1-year outcomes of the multicentre PREVAIL transapical (TA) study of TA-aortic valve implantation (AVI) in high-risk patients. From September 2009 to August 2010, a total of 150 patients, aged 81.6 ± 5.8 years, 40.7% female, were included at 12 European TA-AVI experienced sites. Patients received 23 (n = 36), 26 (n = 57) and 29 mm (n = 57) second-generation SAPIEN XT™ (Edwards Lifesciences, Irvine, CA, USA) valves. The mean logistic EuroSCORE was 24.3 ± 7.0, and mean Society Thoracic Surgeons score was 7.5 ± 4.4%. Survival was 91.3% at 30 days and 77.9% at 1 year. Subgroup analysis revealed survivals of 91.7/88.9, 86.0/70.2, 96.55/91.2% for patients receiving 23-, 26- and 29-mm valves at 30 days and at 1 year, respectively. Transthoracic echocardiography revealed preserved left ventricular ejection fraction and low gradients. Aortic incompetence was none in 41/48, trace 30/36, mild 22/12 and moderate in 7/4% at discharge and 1 year. Walking distance increased from 221 (postimplant) to 284 m (at 1 year, P = 0.0004). Three patients required reoperation due to increasing aortic incompetence during follow-up. Causes of mortality at 1 year were cardiac (n = 7), stroke (n = 1) and others (n = 5). The European PREVAIL multicentre trial demonstrates good functionality and good outcomes for TA-AVI using the second-generation SAPIEN XT prosthesis and the ASCENDRA-II delivery system. The 29-mm SAPIEN XT valve was successfully introduced and showed excellent results.

Clonixinato de lisina injetável intravenoso para o tratamento agudo das enxaquecas: um estudo piloto aberto

OpenAIRE

KRYMCHANTOWSKI, ABOUCH V.; BARBOSA, JACKELINE

1999-01-01

Alguns antinflamatórios não esteroidais (AINE) orais são eficientes para o tratamento dos ataques de migrânea ou enxaqueca. A despeito de sua eficiência para o tratamento destas cefaléias e de outras dores, existem comercialmente poucos antinflamatórios não esteroidais disponíveis para administração parenteral. O clonixinato de lisina (CL) é um AINE derivado do ácido nicotínico que foi comprovadamente eficiente em vários tipos de síndromes álgicas como cólica renal, dor de compressão nervosa,...

[Acute severe colitis with recto-vaginal fistula during treatment with non-steroidal anti-inflammatory agents].

Science.gov (United States)

Tissot, B; Lamy, A; Perraudeau, F; Manouvrier, J L; Imbert, Y

2002-07-13

We report the case of severe colitis occurring during treatment with non-steroid anti-inflammatories (NSAI). A 57 year-old woman was hospitalized for lumbar pain that had not been relieved by AINS, tramadol and then morphine. The patient presented with septic shock and peritonitis by rectal perforation, followed by acute rectorrhagia. The endoscopic aspect evoked Crohn's disease with a recto-vaginal fistula. Progression was further complicated by two episodes of collapse because of acute rectorrhagia, requiring hemostasis colectomy and abdominal-perineal amputation. The diagnosis retained was AINS-induced colitis complicated by acute colectasia on a fecaloma with recto-vaginal fistula.

ORF Alignment: NC_003212 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available ain ... Clip11262) ... Length = 73 ... Query: 8 ... ASALLELIGGKENISSVTHCATRMRFV...LLDPDNADVEAIEDIPAVKGTFTQAGQFQVIIG 67 ... ASALLELIGGKENISSVTHCATRMRFVLLDPDNADVEAIEDIPAVKGTFTQAGQFQ...VIIG Sbjct: 1 ... ASALLELIGGKENISSVTHCATRMRFVLLDPDNADVEAIEDIPAVKGTFTQAGQFQVIIG 60 ...

Sisearhitektide Liit premeeris / Triin Ojari

Index Scriptorium Estoniae

Ojari, Triin, 1974-

2004-01-01

ESL aastapreemiad 2003: parima ajaloolise interjööri ja parima kodu preemia - Leila Pärtelpoja ja Karl-Erik Tarbe kujundatud Villa Tannenrode Lükati teel Tallinnas, parim ühiskondlik interjöör - 3+1 arhitektide (Markus Kaasik, Andres Ojari, Ilmar Valdur, kaasautorid Ralf Lõoke, Kalle Komissarov; söögikoha tegi Taavi Aunre ja ühiskondliku mööbli Gert Sarv) kujundatud Mustamäe keskus, publitsistikapreemia - EKA sisearhitektuuri kateedri kataloog "Eesti Kunstiakadeemia sisearhitektuuri osakond 2002-2003". Ära märgiti kaks tooteseeriat: EGO garderoobid (EGO Mööbel OÜ) ning Jan J. Grapsi loodud "Incognito" mööblisari

EFFETS D’UN ALIMENT EXTRUDE SUR LES PERFORMANCES DE CROISSANCE DE LA TRUITE ARC-EN-CIEL (ONCORHYNCHUS MYKISS WALBAUM, 1792 ET SUR LA QUALITE DE L’EAU DE L’OUED OUM ER-RBIA (STATION AIN AGHBAL, AZROU-MAROC

Directory of Open Access Journals (Sweden)

Khadija OUAISSA

2017-05-01

Full Text Available The objective of our study is to test the efficacy of an extruded food on the growth performance of rainbow trout (Oncorhynchus mykiss Walbaum, 1792 at the fish farm Ain Aghbal in Azrou (Morocco. Generally, only the biochemical composition (percentages of moisture, proteins, lipids and carbohydrates and the (digestible and crude energies of the food are previously known, which is insufficient for the choice of the food in terms of growth performance and quality/environment. The rainbow trout breeding tanks used for this test are 222 days (15 June 2015 - 28 February 2016 are fed with water directly taken from the water of the Oum Er-Rbia sources according to an open circuit with a Renewal of water every half hour. The flow rate is 11.04m3/h. The initial breeding conditions, the density (Kg per volume 1.58kg/m3 and the initial charge with respect to the flow rate is 1.05 m3 / h. Fish are fed by ratios two to three times per day depending on the rearing stage. The frequency of sampling is biweekly where we measured the zootechnical performances of the fish and taken water samples for physicochemical analyzes in order to assess the quality of the waters of exit of the basins before their rejection in the Oum-Er-Rbia river. The results show that the test food shows a better growth of the rainbow trout and a conversion index not exceeding 0.9 for a size of 1043 g of trout.

Anterior Interosseous Nerve Neuropraxia Secondary to Shoulder Arthroscopy and Open Subpectoral Long Head Biceps Tenodesis

Directory of Open Access Journals (Sweden)

Jeremiah T. Steed

2017-01-01

Full Text Available Arthroscopic rotator cuff tendon repair is a common elective procedure performed by trained orthopaedic surgeons with a relatively low complication rate. Specifically, isolated neuropraxia of the anterior interosseous nerve (AIN is a very rare complication of shoulder arthroscopy. An analysis of peer-reviewed published literature revealed only three articles reporting a total of seven cases that describe this specific complication following standard shoulder arthroscopic procedures. This article reports on three patients diagnosed with AIN neuropraxia following routine shoulder arthroscopy done by a single surgeon within a three-year period. All three patients also underwent open biceps tenodesis immediately following completion of the arthroscopic procedures. The exact causal mechanism of AIN neuropraxia following shoulder arthroscopy with biceps tenodesis is not known. This case report reviews possible mechanisms with emphasis on specific factors that make a traction injury the most likely etiology in these cases. We critically analyze our operating room setup and patient positioning practices in light of the existing biomechanical and cadaveric research to propose changes to our standard practices that may help to reduce the incidence of this specific postoperative complication in patients undergoing elective shoulder arthroscopy with biceps tenodesis.

Non-nitric oxide based metallovasodilators: synthesis, reactivity and biological studies.

Science.gov (United States)

Sá, Denise S; Fernandes, André F; Silva, Carlos D S; Costa, Paula P C; Fonteles, Manassés C; Nascimento, Nilberto R F; Lopes, Luiz G F; Sousa, Eduardo H S

2015-08-14

There is an increasing number of compounds developed to target one or more pathways involved in vasodilation. Some studies conducted with azaindole and indazole derivatives showed cardiovascular activity associated with these compounds. Fast and easy structural modification of these organic molecules can be achieved using metal complexes promoting a much larger spatial change than organic strategies, potentially leading to novel drugs. Here, we have prepared a series of complexes with a formula cis-[RuCl(L)(bpy)(2)]PF(6), where L = 7-azaindole (ain), 5-azaindole (5-ain), 4-azaindole (4-ain), indazole (indz), benzimidazole (bzim) or quinoline (qui), which were characterized by spectroscopic and electrochemical techniques (CV, DPV). These compounds showed reasonable stability exhibiting photoreactivity only at low wavelength along with superoxide scavenger activity. Cytotoxicity assays indicated their low activity preliminarily supporting in vivo application. Interestingly, vasodilation assays conducted in rat aorta exhibited great activity that largely improved compared to free ligands and even better than the well-studied organic compound (BAY 41-42272), with IC(50) reaching 55 nM. These results have validated this strategy opening new opportunities to further develop cardiovascular agents based on metallo-bicyclic rings.

Investorid on dilemma ees / Ain Kivisaar

Index Scriptorium Estoniae

Kivisaar, Ain, 1978-

2007-01-01

Keskmise kuupalga eest ei saa enam ruutmeetritki elamispinda ei meil ega mujal. Aktiivsel investoril pole muud teha, kui heita kõrvale tavatarkus ja usaldada enda sisetunnet. Diagramm: Keskmise kuupalga ja korteri ruutmeetri hinna suhe

Euroopa abiraha igatseb taotlejaid / Ain Alvela

Index Scriptorium Estoniae

Alvela, Ain, 1967-

2008-01-01

Aastatel 2007-2013 saab Eesti Euroopa Liidult toetusi 78 miljardit krooni, millele toetudes on võimalik rasked ajad üle elada. Vt. samas: Tuhahoidlast asula jäätmepunktini; Suurima toetuse saab keskkond. Kommenteerivad Antti Tooming ja Kai Niels Willadsen

Teacher Tenure "Ain't" the Problem.

Science.gov (United States)

Hansen, Kenneth; Ellena, William J.

The concept of "tenure," with all its clumsy and confusing burden of historic and current misinterpretation, will probably soon disappear. However, what tenure laws intended, and have failed to do, will almost surely be preserved in other forms of administrative procedure. To be effective, administrative procedures must be (1) clear and detailed,…

Makita kalmistu antropoloogiline aines / Luule Heapost

Index Scriptorium Estoniae

Heapost, Luule

1993-01-01

Tabel : Makita koljude keskmised mõõtmed ; Tabel : 13.-15. sajandi Makita koljud ja võrdlusmaterjalid Eestist ; Tabel 3 : 13. -15. sajandi Makita koljud ning võrdlusandmeid soome-ugri hõimude asualadelt ; Tabel 4 : 15.- 17. sajandi Makita koljud ja võrdlusandmed ; Tabel 5 : Makita koljude võrdlusandmed (Pernose'i meetodil) ; Tabel 6 : Makita luustike pikkade luude keskmine pikkus ; Tabel 7 : Kehapikkuse võrdlusandmed

Globaalsus + lennundus = Star Alliance? / Ain Hinsberg

Index Scriptorium Estoniae

Hinsberg, Ain

2002-01-01

Erinevad koostöövormid lennufirmade vahel, alliansside teke ja areng maailmas. Maailma juhtivad lennundusalliansid ja nende poolt kaetud riigid ja sihtkohad. Kommenteerib Estonian Airi president Erki Urva

You ain't seen nothing yet

NARCIS (Netherlands)

Walhof, Gert

Omtrent technologiebedrijven konden we in december 2016 veel lezen over wat artificial intelligence, virtual reality, machine-to-machine automation, machine-to-machine learning en chatbots ons de komende jaren gaan brengen. Als inkoper zou je kunnen wachten tot duidelijk wordt wat de blijvertjes

Brain damage associated with apraxia of speech: evidence from case studies.

Science.gov (United States)

Moser, Dana; Basilakos, Alexandra; Fillmore, Paul; Fridriksson, Julius

2016-08-01

The site of crucial damage that causes acquired apraxia of speech (AOS) has been debated in the literature. This study presents five in-depth cases that offer insight into the role of brain areas involved in AOS. Four of the examined participants had a primary impairment of AOS either with (n = 2) or without concomitant mild aphasia (n = 2). The fifth participant presented with a lesion relatively isolated to the left anterior insula (AIns-L), damage that is rarely reported in the literature, but without AOS. Taken together, these cases challenge the role of the AIns-L and implicate the left motor regions in AOS.

Data of evolutionary structure change: 1ONAD-2GDFC [Confc[Archive

Lifescience Database Archive (English)

Full Text Available 1ONAD-2GDFC 1ONA 2GDF D C ADTIVAVELDTYPNTDIGDPSYPHIGIDIKSVRSKKTAK...WNMQNGKVGTAHIIYNSVDKRLSAVVSYPNADSATVSYDVDLDNVLPEWVRVGLSASTGLYKETNTILSWSFTSKLKT-NALHFMFNQFSKDQKDLILQGDATTGTDG...ain> 1ONA D 1ONAD

Data of evolutionary structure change: 1ONAD-2GDFA [Confc[Archive

Lifescience Database Archive (English)

Full Text Available 1ONAD-2GDFA 1ONA 2GDF D A ADTIVAVELDTYPNTDIGDPSYPHIGIDIKSVRSKKTAK...WNMQNGKVGTAHIIYNSVDKRLSAVVSYPNADSATVSYDVDLDNVLPEWVRVGLSASTGLYKETNTILSWSFTSKLKT-NALHFMFNQFSKDQKDLILQGDATTGTDG...ain> 1ONA D 1ONAD

PREVAIL TRANSAPICAL: multicentre trial of transcatheter aortic valve implantation using the newly designed bioprosthesis (SAPIEN-XT) and delivery system (ASCENDRA-II).

Science.gov (United States)

Walther, Thomas; Thielmann, Matthias; Kempfert, Joerg; Schroefel, Holger; Wimmer-Greinecker, Gerhard; Treede, Hendrik; Wahlers, Thorsten; Wendler, Olaf

2012-08-01

Transapical (TA) aortic valve implantation (AVI) has evolved as an alternative procedure for high-risk patients. We evaluated the second-generation SAPIEN XT™ prosthesis in a prospective multicentre clinical trial. A total of 150 patients (age: 81.6 ± 5.8 years; 40.7% female) were included. Prosthetic valves (diameter: 23 mm (n = 36), 26 mm (n = 57) and 29 mm (n = 57)) were implanted. The ASCENDRA-II™ modified delivery system was used in the smaller sizes. Mean logistic EuroSCORE was 24.3 ± 7.0%, and mean STS score 7.5 ± 4.4%. All patients gave written informed consent. Off-pump AVI was performed using femoral arterial and venous access wires as a safety net. All but two patients received TA-AVI, as planned. The 29-mm valve showed similar function as the values of two other diameters did. Three patients (2%) required temporary cardiopulmonary bypass support. Postoperative complications included renal failure requiring long-term dialysis in four, bleeding requiring rethoracotomy in four, respiratory complication requiring reintubation in eight and sepsis in four patients, respectively. Thirty-day mortality was 13 (8.7%) for the total cohort and 2/57 (3.5%) for patients receiving the 29-mm valve, respectively. Echocardiography at discharge showed none or trivial aortic incompetence (AI) in 71% and mild-AI in 22% of the patients. Post-implantation AI was predominantly paravalvular and ≥ 2+ in 7% of patients. One patient required reoperation for AI within 30 days. The PREVAIL TA multicentre trial demonstrates good functionality and good outcomes for TA-AVI, using the SAPIEN XT™ prosthesis and its second-generation ASCENDRA-II™ delivery system, as well successful introduction of the 29-mm SAPIEN XT™ valve for the benefit of high-risk elderly patients.

Tratamento com antiinflamatórios tópicos na osteoartrite de joelho Topical anti-inflammatory drugs in osteoarthritis of the knee

Directory of Open Access Journals (Sweden)

Helena Lúcia Alves Pereira

2006-06-01

Full Text Available Os antiinflamatórios não-esteroidais (AINEs orais são eficazes no alívio da dor na osteoartrite (OA, porém têm o risco de efeitos adversos sistêmicos. Para diminuir a toxicidade é necessário reduzir a concentração plasmática uma vez que os efeitos adversos são dose-dependentes. Os AINEs de uso tópico, em teoria, alcançam altas concentrações nos tecidos-alvo com concentrações plasmáticas baixas, sendo portanto uma alternativa terapêutica, especialmente para pacientes de risco. Nossa revisão dos ensaios clínicos randomizados mostrou que os AINEs tópicos foram mais efetivos que o placebo e tão eficazes quanto os AINEs orais. Porém, o pequeno número de ensaios e falhas na metodologia nos impossibilita de fazer conclusões definitivas, sendo necessários estudos bem desenhados e de maior duração.Oral non-steroidal anti-inflammatories drugs (NSAIDs are effective in pain relief in osteoarthritis (OA, but are also associated with risks of adverse systemic side effects. In order to reduce its toxicity, it would be desirable to decrease the plasmatic levels of NSAIDs since those side effects are dose-dependent. Topical NSAIDs would be a therapeutic alternative in theory, because while they reach high levels in local tissues, they also produce low plasmatic levels. Our review analyzed clinical randomized and shown that topical NSAIDs were superior to placebo and have similar efficacy to oral NSAIDs, but due a few number of trials and methodological weaknesses we can't make definitive conclusions. Further well designed, long term studies are required.

Anti-human neutrophil antigen-1a, -1b, and -2 antibodies in neonates and children with immune neutropenias analyzed by extracted granulocyte antigen immunofluorescence assay.

Science.gov (United States)

Onodera, Rie; Kurita, Emi; Taniguchi, Kikuyo; Karakawa, Shuhei; Okada, Satoshi; Kihara, Hirotaka; Fujii, Teruhisa; Kobayashi, Masao

2017-11-01

Anti-human neutrophil antigen (HNA) antibodies have been implicated in the development of neonatal alloimmune neutropenia (NAN) and autoimmune neutropenia (AIN). There are many conventional assay methods that detect anti-HNA antibodies. However, a method to measure multiple samples and detect several anti-HNA antibodies simultaneously is needed. We developed a new method, the extracted granulocyte antigen immunofluorescence assay (EGIFA), to analyze anti-HNA-1a, -1b, and -2 antibodies in sera. The results obtained by EGIFA were evaluated in comparison with those from several standard assay methods. Anti-HNA antibodies in serum samples from nine familial cases with suspected NAN (n = 19) and children with suspected AIN (n = 88) were also measured by EGIFA. The evaluation of nine serum samples with anti-HNA antibodies suggested that EGIFA demonstrated equivalent specificity and superior sensitivity to monoclonal antibody-specific immobilization of granulocyte antigens and had comparable sensitivity to the granulocyte indirect immunofluorescence test. EGIFA successfully detected anti-HNA-1a or -1b antibodies in seven of nine familial cases with suspected NAN. EGIFA detected anti-HNA antibodies in 40.9% of children with suspected AIN. Among them, isolated anti-HNA-1a or -1b antibody was detected in 4.5 or 12.5% of children, respectively, and anti-HNA-2 antibody was identified in 3.4% of children. The 30.8% (16 of 52) of children negative for anti-HNA antibody by EGIFA were positive for anti-HLA antibody. EGIFA facilitated the measurement of anti-HNA-1a, -1b, and/or -2 antibodies in sera. The prompt measurement of anti-HNA antibodies will improve the diagnosis and clinical management of patients with suspected NAN or AIN. © 2017 AABB.

Influence of diet with kale on lipid peroxides and malondialdehyde levels in blood serum of laboratory rats over intoxication with paraquat.

Science.gov (United States)

Sikora, Elżbieta; Bodziarczyk, Izabela

2013-01-01

Organism's lipid peroxidation is one of the most often examined and known physiological process evoked by free radicals. It concerns oxidation reaction of unsaturated fatty acid and/or other lipids leading to lipid oxidation products (LOP), which as a result of further changes generate among others the malondialdehyde molecules. The aim of the work was an estimation if raw or cooked kale addition to rat's diet influences antioxidant defense efficiency in their organisms in comparison to rats fed with standard AIN-93G diet. The experiment was conducted with 36 Wistar strain, male rats over 21 days. The rats were divided into 3 groups (each 12 stuck) which were fed with: standard diet AIN-93G (2 groups), AIN-93G diet with 10% addition of raw kale (2 groups), and AIN-93G with 10% addition of cooked lyophilised kale. The total content of polyphenols (FC method) and antioxidant activity (ABTS+•) were previously determined in raw and then in cooked kale. On the 20th day of experiment, half of rats (6 stuck) of each kind of the diet were injected intraperitoneally by the solution of paraquat (PQ) in physiological salt to evoke the oxidative stress. The next day animals were stunned and blood from their hearts was sampled. In the obtained serum, the levels of lipid oxidation products (LOP) and malondialdehyde (MDA) were assessed. It was observed that in blood serum of rats fed with modified diet with raw and cooked lyophilised kale addition the lipid oxides level was lower in comparison to control group fed with standard diet (p kale addition. Diet with kale, both raw and cooked, efficiently inhibited the lipid peroxidation process in rats' organisms, ongoing during natural metabolism and during evoked oxidative stress.

Drug-induced acute interstitial nephritis: A clinicopathological study and comparative trial of steroid regimens

Directory of Open Access Journals (Sweden)

R Ramachandran

2015-01-01

Full Text Available Steroids are used in the management of drug-induced acute interstitial nephritis (AIN. The present study was undertaken to compare the efficacy of pulse methyl prednisolone with oral prednisolone in the treatment of drug-induced AIN. Patients with biopsy-proven AIN with a history of drug intake were randomized to oral prednisolone (Group 1 1 mg/kg for 3 weeks or a pulse methyl prednisolone (Group II 30 mg/kg for 3 days followed by oral prednisolone 1 mg/kg for 2 weeks, tapered over 3 weeks. Kidney biopsy scoring was done for interstitial edema, infiltration and tubular damage. The response was reported as complete remission (CR (improvement in estimated glomerular filtration rate [eGFR] to ≥60 ml/min/1.73 m 2 , partial remission (PR (improvement but eGFR <60 ml/min/1.73 m 2 or resistance (no CR/PR. A total of 29 patients, Group I: 16 and Group II: 13 were studied. Offending drugs included nonsteroidal anti-inflammatory drugs, herbal drugs, antibiotics, diuretic, rifampicin and omeprazole. There was no difference in the baseline parameters between the two groups. The biopsy score in Groups I and II was 5.9 ΁ 1.1 and 5.1 ΁ 1.2, respectively. At 3 months in Group I, eight patients each (50% achieved CR and PR. In Group II, 8 (61% achieved CR and 5 (39% PR. This was not significantly different. Percentage fall in serum creatinine at 1 week (56% was higher in CR as compared to (42% those with PR. ( P = 0.14. Patients with neutrophil infiltration had higher CR compared to patients with no neutrophil infiltration ( P = 0.01. Early steroid therapy, both oral and pulse steroid, is equally effective in achieving remission in drug-induced AIN.

Kaks debüüti / Lilian Vellerand

Index Scriptorium Estoniae

Vellerand, Lilian, 1932-

1997-01-01

"Shakespeare'i kogutud teosed" ("The Complete Works of William Shakespeare") Rakvere Teatris, lavastaja Ain Prosa ja Friedebert Tuglase - Ingomar Vihmari "Hei, Luciani!" Ugalas, lavastaja Ingomar Vihmar

Physical and mental health: from youth to age in Ohio prisons.

Science.gov (United States)

Lynd, Alice

2014-01-01

Who cares about health care in prisons? You do if you have a son or a granddaughter in prison. Maybe you care anyway if you have had to wait a long time to see a doctor or if you could not have the treatment you needed because it cost too much. Maybe you have run into the attitude, "You ain't bleedin', you ain't needin'." Maybe you have found it hard to face the future with little or no hope that you could ever be in a better place. Or maybe you, like some older prisoners, have been able to develop new interests, new skills, to review your life and review it, and to redefine what matters.

Data of evolutionary structure change: 1ONAD-2D3PB [Confc[Archive

Lifescience Database Archive (English)

Full Text Available 1ONAD-2D3PB 1ONA 2D3P D B ADTIVAVELDTYPNTDIGDPSYPHIGIDIKSVRSKKTAK...WNMQNGKVGTAHIIYNSVDKRLSAVVSYPNADSATVSYDVDLDNVLPEWVRVGLSASTGLYKETNTILSWSFTSKLKT------NALHFMFNQFSKDQKDLILQGDAT...ain> 1ONA D 1ONAD TR

Keratosis reduces sensitivity of anal cytology in detecting anal intraepithelial neoplasia.

Science.gov (United States)

ElNaggar, Adam C; Santoso, Joseph T; Xie, Huiwen Bill

2012-02-01

To identify factors that may contribute to poor sensitivity of anal cytology in contrast to the sensitivity of anoscopy in heterosexual women. We analyzed 324 patients with biopsy confirmed diagnosis of genital intraepithelial neoplasia (either vulva, vaginal, or cervical) from 2006 to 2011 who underwent both anal cytology and anoscopy. Cytology, anoscopy, and biopsy results were recorded. Biopsy specimens underwent independent analysis for quality of specimen. Also, biopsy specimens were analyzed for characteristics that may contribute to correlation, or lack thereof, between anal cytology and anoscopic directed biopsy. 133 (41%) patients had abnormal anoscopy and underwent directed biopsy. 120 patients with normal anal cytology had anoscopy directed biopsies, resulting in 58 cases of AIN (sensitivity 9.4%; 0.039-0.199). This cohort was noted to have extensive keratosis covering the entire dysplastic anal lesion. 18 patients yielded abnormal anal cytology. Of these patients, 13 had anoscopic directed biopsies revealing 6 with AIN and absent keratosis (specificity 88.6%; 0.78-0.95). The κ statistic for anal cytology and anoscopy was -0.0213 (95% CI=-0.128-0.086). Keratosis reduces the sensitivity of anal cytology. Furthermore, anal cytology poorly correlates with anoscopy in the detection of AIN (κ statistic=-0.0213). Copyright © 2011 Elsevier Inc. All rights reserved.

Impact of Diet Composition in Adult Offspring is Dependent on Maternal Diet during Pregnancy and Lactation in Rats

Directory of Open Access Journals (Sweden)

Megan C. Hallam

2016-01-01

Full Text Available The Thrifty Phenotype Hypothesis proposes that the fetus takes cues from the maternal environment to predict its postnatal environment. A mismatch between the predicted and actual environments precipitates an increased risk of chronic disease. Our objective was to determine if, following a high fat, high sucrose (HFS diet challenge in adulthood, re-matching offspring to their maternal gestational diet would improve metabolic health more so than if there was no previous exposure to that diet. Animals re-matched to a high prebiotic fiber diet (HF had lower body weight and adiposity than animals re-matched to a high protein (HP or control (C diet and also had increased levels of the satiety hormones GLP-1 and PYY (p < 0.05. Control animals, whether maintained throughout the study on AIN-93M, or continued on HFS rather than reverting back to AIN-93M, did not differ from each other in body weight or adiposity. Overall, the HF diet was associated with the most beneficial metabolic phenotype (body fat, glucose control, satiety hormones. The HP diet, as per our previous work, had detrimental effects on body weight and adiposity. Findings in control rats suggest that the obesogenic potential of the powdered AIN-93 diet warrants investigation.

Heat Transfer Characteristics in High Power LED Packaging

Directory of Open Access Journals (Sweden)

Chi-Hung Chung

2014-03-01

Full Text Available This study uses the T3Ster transient thermal resistance measuring device to investigate the effects to heat transfer performances from different LED crystal grains, packaging methods and heat-sink substrates through the experimental method. The experimental parameters are six different types of LED modules that are made alternatively with the crystal grain structure, the die attach method and the carrying substrate. The crystal grain structure includes the lateral type, flip chip type and vertical type. The die attach method includes silver paste and the eutectic structure. The carrying substrates are aluminum oxide (Alumina and aluminum nitride (AIN ceramic substrates and metal core PCB (MCPCB. The experimental results show that, under the conditions of the same crystal grain and die attach method, the thermal resistance values for the AIN substrate and the Alumina substrate are 2.1K/W and 5.1K/W, respectively and the total thermal resistance values are 7.3K/W and 10.8K/W. Compared to the Alumina substrate, the AIN substrate can effectively lower the total thermal resistance value by 32.4%. This is because the heat transfer coefficient of the AIN substrate is higher than that of the Alumina substrate, thus effectively increasing its thermal conductivity. In addition, under the conditions of the same crystal grain and the same substrate, the packaging methods are using silver paste and the eutectic structure for die attach. Their thermal resistance values are 5.7K/W and 2.7K/W, respectively, with a variance of 3K/W. Comparisons of the crystal grain structure show that the thermal resistance for the flip chip type is lower than that of the traditional lateral type by 0.9K/W. This is because the light emitting layer of the flip chip crystal grain is closer to the heat-sink substrate, shortening the heat dissipation route, and thus lowering the thermal resistance value. For the total thermal resistance, the crystal grain structure has a lesser

Prügiveo hind hakkab olenema inimesest endast / Peep Aaviksoo ; interv. Jaan Rõõmussaar

Index Scriptorium Estoniae

Aaviksoo, Peep, 1956-

2004-01-01

Ilmunud ka: Stolitsa, 5. nov. 2004, lk. 3. AS-i Tallinna Prügila taotles prügi ladestamishinna tõstmist, ettevõtlusameti hinna ja tarbijakaitse osakond pidas taotletavat hinda liiga kõrgeks. Tallinna abilinnapea vastab küsimustele prügimajanduse kota

(Konstitutsiooniline) renvoi: kas põhiseaduslik nõue või kaera Trooja hobusele? / Berit Aaviksoo

Index Scriptorium Estoniae

Aaviksoo, Berit, 1978-

2015-01-01

Võrdsuspõhiõiguse ning pöörddiskrimineerimise kaotamise nõude mõjust Eesti õiguskorras. Artikkel põhineb 3. oktoobril 2014 Tartus 33. Eesti õigusteadlaste päevadel „Kümme aastat õiguslõimet“ peetud ettekandel

Sõjaraamatu hävitamisel on seos Eestiga / Hendrik Vosman, Tuuli Koch ; kommenteerinud Jaak Aaviksoo

Index Scriptorium Estoniae

Vosman, Hendrik

2011-01-01

Suurbritannia ajakirjaniku Toby Harndeni Afganistani sõda käsitlevast raamatust "Dead Men Risen: The Welsh Guards and the Real Story of Britain's War in Afganistan" ("Ülestõusnud surnud: Walesi kaardivägi ja tegelik lugu brittide sõjast Afganistanis"). Briti kaitseministeerium lükkab ümber Harndeni väite raamatu ümber puhkenud skandaali poliitilisest tagamaast, autori arvates kartis kaitseministeerium, et raamatus leiduv info võiks Eestit ärritada

Meie igapäevane paanika / Ott Karulin

Index Scriptorium Estoniae

Karulin, Ott, 1980-

2007-01-01

Kahest Vanemuise teatri lavastusest Tartus - Saksa Kultuuri Instituudis etendunud Ingvar Ambjornseni-Axel Hellsteniuse "Elling" Ain Mäeotsa lavastuses ja Laura Cunninghami "Beautiful Bodies" Vanemuises, lavastaja Jüri Lumiste

Case C-182/15, Proceedings Relating to the Extradition of Aleksei Petruhhin / Filippo Fontanelli

Index Scriptorium Estoniae

Fontanelli, Fillippo

2017-01-01

Euroopa Kohtu lahendist, mis puudutab Venemaa ametiasutuste poolt Läti ametiasutustele saadetud Eesti kodaniku Aleksei Petruhhini väljaandmise taotlust seoses narkootilise aine turustamise süüteoga

Õpetaja professionaalse rolli internaliseerimise hindamine õpetajakoolituse esmaõppe üliõpilaste hulgas / Äli Leijen, Katrin Kullasepp, Aivar Ots

Index Scriptorium Estoniae

Leijen, Äli, 1979-

2013-01-01

Aineõpetaja magistriõppe üliõpilaste seas läbi viidud uurimusest, milles vaadeldakse, kuidas üliõpilased koordineerivad personaalset ja professionaalset mina-positsiooni erialaste ambivalentsete olukordade kontekstis

Professional preparation of teachers - problems and possibilities. The Estonian case / Katrin Poom-Valickis, Ülle Saarits, Helle Sikka... [jt.

Index Scriptorium Estoniae

2008-01-01

Artikkel kirjeldab õpetajakoolituse olukorda Eestis aastal 2003. Aineõpetajate, klassiõpetajate ja koolieelsete lasteasutuste õpetajate ettevalmistusest Tallinna Ülikoolis ning nende karjääriperspektiive tööturul

Esteet Hartshenko contra mehed punases / Heili Vaus-Tamm

Index Scriptorium Estoniae

Vaus-Tamm, Heili, 1961-

2007-01-01

Tantsuetendustest Kumu Kunstimuuseumis: "Red ain't dead", koreograaf - lavastajad Kaarel Väli, Kristjan Rohioja; tantsuteatri Zick esituses "Piaf", koreograaf - lavastaja Dmitri Harchenko. Dominiiklaste kloostri klausuuris "Reisijuht", koreograaf - lavastaja Dmitri Harchenko

Stirlitzi leitmotiivist rõõmsalt süüdimatu jäneste lauluni / Jüri Aarma

Index Scriptorium Estoniae

Aarma, Jüri, 1951-

2010-01-01

Vene filmimuusika kontserdist "Seitseteist kevadist hetke", mis toimub Vanemuise kontserdimajas 2. aprillil, Jõhvi kontserdimajas 4. aprillil ja Estonia kontserdisaalis 6. aprillil, lavastaja Ain Mäeots. Näidatakse vastavaid filmilõike

Plaadid / Aivo Vahemets

Index Scriptorium Estoniae

Vahemets, Aivo

2006-01-01

Uutest heliplaatidest Waltari "Blood Sample", Anthony Hamilton "Ain't Nobody Worrying", Kismabande "Polüpale", Siiri Sisask "Kuu lõhn", Les Diamants "Fortune Fools", "The Voice Clubbin", Nits "Les Nuits"

Politicians spin attacks against methadone, syringe replacement / Milda Seputyte

Index Scriptorium Estoniae

Seputyte, Milda

2005-01-01

Leedu parlamendiliikmed osalevad kampaanias, millega võideldakse narkomaanidele tasuta süstalde jagamise ja sõltuvuse vastase aine metadooni vastu, kuna nende arvates need meetmed pigem süvendavad narkomaaniat

Kõnnivad köiel ja hoiavad kätt / Iir Hermeliin, Jaanus Vahtra ; intervju Sven Karja

Index Scriptorium Estoniae

Iir Hermeliin, pseud., 1973-

2000-01-01

Teatrikunstnikud Iir Hermeliin ja Jaanus Vahtra ning nende looming. Kunstnikud lavastajatest ja lavastajad Mati Unt ja Ain Mäeots koostööst kunstnikega lavastustes "Jacques ja tema isand"; "Laulatus"

CERN firemen share their expertise

CERN Multimedia

Maximilien Brice

2002-01-01

Firemen from local fire brigades have been coming to CERN to learn modern fire-fighting techniques. The CERN fire brigade has some unique training equipment for two particularly dangerous fire hazards, flashover and backdraft. Flashover occurs when a room that is on fire reaches a temperature of 400 to 500°. Beyond this point, a fully developed fire breaks out. This series of photos shows recruits from the fire services of Ain (Service Départemental Incendie et Secours (SDIS)) taking part in a flashover training exercise at CERN. Photo 01: Christopher Griggs, Chief Instructor of the CERN fire brigade (seated in the centre), explains the technique of using a fire-hose during a flashover to the recruits from the Ain SDIS.

Kummitusmaja ja fusion-köök = Haunted House and Fusion Cuisine / Kai Lobjakas

Index Scriptorium Estoniae

Lobjakas, Kai, 1975-

2003-01-01

Tallinnas Rataskaevu 16 asuva jaapani toitu pakkuva restorani "Sushihouse" kujundus, ruumide restaureermine. Sisekujundajad Ain Nurmela ja Liina Link. Projekt 2001-2003, valmis 2003. Kõige muinsusteadlikumalt restaureeritud maja 2002. a. 3 ill

Materjalide jagamisest võidavad kõik / Maarja Soone

Index Scriptorium Estoniae

Soone, Maarja

2011-01-01

Koolitusest Colchesteris - Content and Language Integrated Learning, mis tähendab võõrkeelset aineõpet, kus vajadusel võetakse kasutusele ka emakeel, mistõttu viidatakse sellele tihti kui kakskeelsele õppele

Märkmeid uusima Preisi tsensuuriinstruktsiooni kohta / Karl Marx

Index Scriptorium Estoniae

Marx, Karl

2000-01-01

Preisi uue (1841. aasta) tsensuuriinstruktsiooni tõusikliku vaimu vastuolust vana (1818. aasta) tsensuurimääruse ratsionalismiga. Moraali ja religiooni vastuolust. Vt. ka Ain Kaalepi artiklit "Veel Karl Marxist ja tsensuurist

Tallinn pokupajet zemlju dlja prokladki shosse Põhjaväil

Index Scriptorium Estoniae

2007-01-01

Seoses Russalkast Ahtri tänavani ulatuva tee-ehitusega seisab linnal ees 16 maaküsimuse lahendamine. Probleemidest seoses väila osaliselt merre ehitamisega. Kommenteerivad Alo Brandt ja Ain Valdmann

Disease: H00536 [KEGG MEDICUS

Lifescience Database Archive (English)

Full Text Available oencephalopathy (CADASIL) CADASIL is a chronic cerebrovascular disorder characterized by recurrent ischemic attacks and frequent migr...aines associated with diffuse white-matter abnormalities. CADASIL is caused by muta

AHHAA keskus Tartus = The Ahhaa Science Centre in Tartu / Triin Ojari

Index Scriptorium Estoniae

Ojari, Triin, 1974-

2011-01-01

2011. a. valminud AHHAA teaduskeskuse arhitektid on Ain Padrik ja Vilen Künnapu (AB Künnapu & Padrik), sisearhitektid Tea Tammelaan, Krista Lepland ja Malle Jürgenson (Laika, Belka & Strelka). Projekt: 2008

Vene elu hõng Pilistvere rehealuses / Margot Visnap

Index Scriptorium Estoniae

Visnap, Margot, 1959-

2008-01-01

Pilistvere rehehoones etendunud Ain Saviaugu kirjutatud ja lavastatud suvetükist "Rasputin". Suvelavastuse tõi välja Põltsamaa Teater Ellunäod koos professionaalsete näitlejatega. Nimiosas Indrek Saar

Vek lovi - vek utshis / Hillar Jõõts ; interv. Kalju Hook

Index Scriptorium Estoniae

Jõõts, Hillar

2005-01-01

Keskkonnainspektsiooni Pärnumaa osakonna juhtivspetsialist Hillar Jõõts keskkonnaministeeriumi kalavarude osakonna juhataja Ain Soome, Eesti Kalurite Liidu juhatuse esimehe Andres Variku ja Eesti Mereinstituudi direktori Toomas Saati kohtumisest Pärnumaa kaluritega

Teatri aastaauhindade laureaadid 2008

Index Scriptorium Estoniae

2008-01-01

Tiit Ojasoo - lavastajaauhind, Silver Vahtre, Krista Tool ja Margus Vaigur - kunstniku auhind, Piret Laurimaa - naisnäitleja auhind, Üllar Saaremäe - meesnäitleja auhind, Tiina Tauraite - naiskõrvalosa auhind, Taavi Teplenkov - meeskõrvalosa auhind, Mart Koldits - sõnalavastuse eriauhind, Dmitri Bertman ja Mart Madiste - muusikalavastuse auhind, Vitali Nikolajev - muusikalavastuse eriauhind, Marina Kesler - balletilavastuse auhind, Oksana Titova - tantsulavastuse auhind, Ivika Sillar - kriitikaauhind, Külli Teetamm ja Tambet Tuisk - Ants Lauteri näitlejaauhind, Heli Veskus - Georg Otsa auhind, Finn Poulsen - Salme Reegi auhind, Elo Soode - Natalie Mei auhind, Aarne Üksküla - Priit Põldroosi auhind, Maimu Berg - Aleksander Kurtna auhind, Laura Peterson - Kristallkingakese auhind, Liina Laigu, Kaido Päästel ja Juhan Rumm - teatritöötaja auhind

Eesti teatri aastaauhinnad 2007

Index Scriptorium Estoniae

2008-01-01

Tiit Ojasoo - lavastajaauhind, Silver Vahtre, Krista Tool ja Margus Vaigur - kunstniku auhind, Piret Laurimaa - naisnäitleja auhind, Üllar Saaremäe - meesnäitleja auhind, Tiina Tauraite - naiskõrvalosa auhind, Taavi Teplenkov - meeskõrvalosa auhind, Mart Koldits - sõnalavastuse eriauhind, Dmitri Bertman ja Mart Madiste - muusikalavastuse auhind, Vitali Nikolajev - muusikalavastuse eriauhind, Marina Kesler - balletilavastuse auhind, Oksana Titova - tantsulavastuse auhind, Ivika Sillar - kriitikaauhind, Külli Teetamm ja Tambet Tuisk - Ants Lauteri näitlejaauhind, Heli Veskus - Georg Otsa auhind, Finn Poulsen - Salme Reegi auhind, Elo Soode - Natalie Mei auhind, Aarne Üksküla - Priit Põldroosi auhind, Maimu Berg - Aleksander Kurtna auhind, Laura Peterson - Kristallkingakese auhind, Liina Laigu, Kaido Päästel ja Juhan Rumm - teatritöötaja auhind

Yeast Interacting Proteins Database: YOR171C, YOR034C [Yeast Interacting Proteins Database

Lifescience Database Archive (English)

Full Text Available ain base phosphates, which function as signaling molecules, regulates synthesis of ceramide from exogenous l...chain base phosphates, which function as signaling molecules, regulates synthesis of ceramide from exogenous

Bez kota mõsham razdolje / Jevgeni Kapov

Index Scriptorium Estoniae

Kapov, Jevgeni

2004-01-01

Sillamäe linnapea Ain Kiviorgi ja Vaivara vallavanema Veiko Luhalaidi kohtumisest Politseiameti peadirektori Robert Antropovi ja Ida politseiprefekti Kalev Prillopiga, kus arutati seoses politseireformiga Sillamäe regioonis tekkinud korrakaitse probleeme

President Meri annetas aumärke

Index Scriptorium Estoniae

1996-01-01

Riigivapi I klassi orden Jaan Krossile ja Kalju Lepikule; Riigivapi III klassi orden Ain Kaalepile, Hilja Rüütlile (Aili Helm); Riigivapi IV klassi orden Voldemar Millerile, Juhan Peeglile ja Ants Viiresele

Partii Reform ne bezrazlitshna sudba russkogo obrazovanija / Sergei Ivanov

Index Scriptorium Estoniae

Ivanov, Sergei, 1958-

2005-01-01

Riigikogu liige vastab küsimustele, mis puudutavad Tallinna Pedagoogikaülikoolis algavat vene koolide jaoks aineõpetajate ettevalmistamist ja selleks ettenähtud rahasummat, vene akadeemilise keskuse loomiseks eraldatud raha kulutamist

Dgroup: DG01675 [KEGG MEDICUS

Lifescience Database Archive (English)

Full Text Available aine ... D01152 ... Oxethazaine (JP17/USAN); Oxetacaine (INN) ... D08311 ... Oxetacaine hydrochloride ... DG00801 ... Bupivacaine ... D07552 ... Bupiva...caine (USAN/INN) ... D01450 ... Bupivacaine hydrochloride (USP); Bupivacaine hydrochl

Biznes i obshtshestvo : Sillamäe võhodit iz desjatiletnei spjatshki / Artur Tooman

Index Scriptorium Estoniae

Tooman, Artur, 1971-

2006-01-01

Sillamäe linna eluolu, sadama mõju linna arengule. Arvamust avaldavad linnavolikogu liige Sergei Rjabkov, linnapea Ain Kiviorg ja kohalikud ettevõtjad. Lisa: diagrammid linna eelarve ja ettevõtluse kasvu kohta

Pop / Erkki Luuk

Index Scriptorium Estoniae

Luuk, Erkki, 1971-

2004-01-01

Heliplaatidest: Current 909 "The price for existence is eternal warfare", Aapo Ilves "Pilpaküla kontsert", Yello "The Eye", Maian Kärmas, Ain Agan, Riho Sibul, Arvo Haasma "Tuigutuled", Manatark "Chaos Engine"

Üliohtliku laadungiga rongid plaanitakse Tallinnast välja saata / Signe Kalberg

Index Scriptorium Estoniae

Kalberg, Signe, 1959-

2006-01-01

Valitsusele esitatakse kolm Tallinna raudteeümbersõidu varianti, analüüsi koostamisse kaasati AS Deloitte&Touche Eesti. Kaart: Tallinna raudteeümbersõit. Kommenteerivad: Raivo Uukkivi, Ain Kaljurand, Toomas Vitsut

Moroz i rozõ / Lev Livshits

Index Scriptorium Estoniae

Лившиц, Лев, 1924-2013

2006-01-01

Ain Järvega Kadrioru pargist. Kadrioru Lastepargi tekkimise ajaloost ja uue Lastepargi rajamisest. Ehitatakse uus Lastemuuseumi hoone kuhu kolib Kotzebue tänavalt Tallinna Nukumuuseum. Nukumuuseumist ja muuseumidest Kadriorus, ka KUMU hoonest

Toodangu maht sõltub impordist / Ain Alvela

Index Scriptorium Estoniae

Alvela, Ain, 1967-

2002-01-01

Saematerjali tootjate TOP 30. Käibe TOP 10. Käibe kasvu TOP 10. Kasumi TOP 10. Kasumi kasvu TOP 10. Rentaabluse TOP 10. Varade tootlikkuse TOP 10. Kahjumi TOP 5. Saematerjali tootjate finantsnäitajad. Saematerjali tootjate üldandmed. Tabelid

Rumsfeldi ei ole kunagi unustatud / Ain Lember

Index Scriptorium Estoniae

Lember, Ain

2004-01-01

Väljaandes Teheran Times ilmunud Kian Mokhtari artiklist, milles käsitletakse USA kaitseministri Donald Rumsfeldi poliitikukarjääri, tema süüdistamist Iraagile massihävitusrelvade ja nendega seotud tehnoloogia müümise soodustamises 1980-ndatel aastatel, Iraagi-poolset keemiarelva kasutamist Iraani vastu

Puti povõshenija effektivnosti proizvodstva / Ain Alvela

Index Scriptorium Estoniae

Alvela, Ain, 1967-

2008-01-01

Kulude kokkuhoid aitab saavutada kõrgemat tootlikkust. Vt. samas: Indeks rosta proizvoditelnosti za period 2000-2007gg., %. Kommenteerivad: Aleksandr Miina, Ants Pak, Kaul Aulasmägi, Veljo Haube ja Kuido Kuntro

Norma Maja astub kindlalt tulevikku / Ain Alvela

Index Scriptorium Estoniae

Alvela, Ain, 1967-

2000-01-01

AS Norma Maja saavutas kõrged kasumi ja kasumi kasvu näitajad töötajate koondamisega. Tabel: Norma Maja valdused, AS Norma Maja areng, AS ETK Majad areng. Arvamused: Ero Toom, Ivar Lahi ja Rein Loo

Extensive Degradation and Low Bioavailability of Orally Consumed Corn miRNAs in Mice

Directory of Open Access Journals (Sweden)

Haiqiu Huang

2018-02-01

Full Text Available The current study seeks to resolve the discrepancy in the literature regarding the cross-kingdom transfer of plant microRNAs (miRNAs into mammals using an improved miRNA processing and detection method. Two studies utilizing C57BL/6 mice were performed. In the first study, mice were fed an AIN-93M diet and gavaged with water, random deoxynucleotide triphosphates (dNTP or isolated corn miRNAs for two weeks (n = 10 per group. In the second study, mice were fed an AIN-93M diet, or the diet supplemented with 3% fresh or autoclaved corn powder for two weeks (n = 10 per group. Corn miRNA levels were analyzed in blood and tissue samples by real-time PCR (RT-PCR following periodate oxidation and β elimination treatments to eliminate artifacts. After removing false positive detections, there were no differences in corn miRNA levels between control and treated groups in cecal, fecal, liver and blood samples. Using an in vitro digestion system, corn miRNAs in AIN-93M diet or in the extracts were found to be extensively degraded. Less than 1% was recovered in the gastrointestinal tract after oral and gastric phases. In conclusion, no evidence of increased levels of corn miRNAs in whole blood or tissues after supplementation of corn miRNAs in the diet was observed in a mouse model.

Interpersonal violence in the United Arab Emirates.

Science.gov (United States)

Osman, Ossama T; Abbas, Alaa K; Eid, Hani O; Salem, Mohamed O; Abu-Zidan, Fikri M

2014-01-01

We aimed to study the anatomical distribution, severity and outcome of hospitalised interpersonal violence-related injured patients in Al-Ain, United Arab Emirates so as to give recommendations regarding the magnitude of this problem, its causes and priorities of prevention. Data were retrieved from Al-Ain Hospital Trauma Registry, which was prospectively collected over three years. There were 75 patients (males = 85.3%) having a mean age of 30 years. Eighty-one percent had blunt trauma. The estimated annual injury hospitalisation of interpersonal violence in Al-Ain city was 6.7 per 100,000 population. Females were significantly more injured by a family member (p = 0.02), at home (p = 0.005), and had more severe injuries (p = 0.003). There was a trend for children less than 18 years old to have more penetrating trauma (p = 0.06) and to be injured by a family member (p = 0.09). There was only one case of woman sexual assault and two cases of child abuse. The mean (SD) hospital stay was 7.87 (14.1) days. Less than 3% (n = 2) were admitted to the intensive care unit with no deaths. In conclusion, the majority of patients in our study had minor injuries. Nevertheless, the psychological impact may be major. This highlights the need to develop suitable mental health services in support of victims of interpersonal violence.

Structural and frequency dependencies of a.c. and dielectric ...

Indian Academy of Sciences (India)

6Thin Film Laboratory, Department of Physics, Faculty of Education, Ain Shams ... conductivity and its frequency exponents were interpreted in terms of correlated barrier hopping ... cations in high-electron-mobility and heterostructure bipolar.

Drug Allergy

African Journals Online (AJOL)

EL-HAKIM

Immunology Unit, Department of Pediatrics, Ain Shams University, Cairo ... the case with food allergies).7,8 The parentral route ..... molecular-weight agents. ... and lack positive controls. ..... Immunology; Joint Council of Allergy, Asthma and.

Ainevaldkond "Kehakultuur" / Leila Oja

Index Scriptorium Estoniae

Oja, Leila, 1966-

2006-01-01

Ainevaldkonnast "Kehakultuur" Tartu Ülikooli õppekava arenduskeskuses väljatöötatud põhikooli ja gümnaasiumi riiklikus õppekavas - ainevaldkonna kirjeldus, läbivad teemad, aineõpetuse struktuur ning vajalikud ressursid

R102G polymorphism of the complement component 3 gene in ...

African Journals Online (AJOL)

Nur Afiqah Mohamad

a Malaysian Research Institute on Ageing, Universiti Putra Malaysia, Serdang 43400, Selangor ... Peer review under responsibility of Ain Shams University. ..... b Student t-test, P < 0.01. ... The International ARM Epidemiological Study Group.

Analytical solutions for one-dimensional advection– dispersion ...

Indian Academy of Sciences (India)

Department of Mathematics, AinShams University, Cairo 0020, Egypt. ∗. Corresponding author. .... Applying Laplace transformation to equations (1 and 2) gives: D d2. ∼ ...... Land, Water & Environmental Management: Integrated. Systems for ...

ETV uus seriaal "Vistrik" kavatseb nime muuta / Anne Vetik

Index Scriptorium Estoniae

Vetik, Anne

2006-01-01

Toimuvad ETV uue krimisarja "Vistrik" võtted, stsenarist Mihkel Ulman, režissöör Ain Prosa, produtsent Raivo Suviste, kesksetes rollides Marko Matvere, Jaan Rekkor, Elisabet Tamm, tootjaks OÜ Balti Video

[Kirjandusetendusest "Meri kümnele häälele"] / Kätlin Kaldmaa ; küsinud D. K. [Doris Kareva

Index Scriptorium Estoniae

Kaldmaa, Kätlin, 1970-

2011-01-01

Luulelavastus sisaldab Álvaro de Campose (Fernando Pessoa) "Mereoodi" ning Ain Kaalepi, Kalju Kruusa, fs-i jt. eesti luuletajate tekste. Lavastaja Anne Türnpu, etendused toimuvad kinos Sõprus. Vt. ka kuulutust lk. 30

Ohtlikud lennud / Simo Meinert

Index Scriptorium Estoniae

Meinert, Simo

2006-01-01

ETV uus algupärane krimisari "Ohtlik lend" : stsenarist Mihkel Ulman : lavastaja Ain Prosa : produtsent Raivo Suviste : peaosades Elisabet Tamm, Marko Matvere : Balti Video. Sama ka : Teleleht nr. 38, lk. 6-7 : ill

Anal high-risk human papillomavirus infection and high-grade anal intraepithelial neoplasia detected in women and heterosexual men infected with human immunodeficiency virus

Directory of Open Access Journals (Sweden)

Gandra S

2015-01-01

Full Text Available Sumanth Gandra, Aline Azar, Mireya WessolosskyDivision of Infectious Disease and Immunology, University of Massachusetts Medical School, Worcester, MA, USABackground: Although anal high-risk human papillomavirus (HR-HPV infection and anal cytological abnormalities are highly prevalent among human immunodeficiency virus (HIV-infected men who have sex with men (MSM, there are insufficient data on these abnormalities among HIV-infected heterosexual men (HSM and women. In this study, we evaluated the prevalence of anal HR-HPV, cytological abnormalities, and performance of these screening tests in detecting high-grade anal intraepithelial neoplasia (AIN2+ among our cohort of HIV-infected MSM and non-MSM (HSM and women.Methods: A single-center, retrospective cohort study was conducted with HIV-infected individuals who underwent anal cancer screening with anal cytology and HR-HPV testing from January 2011 to January 31, 2013.Results: Screening of 221 HIV-infected individuals for both HR-HPV and anal cytology showed the presence of HR-HPV in 54% (abnormal anal cytology 48% of MSM, 28% (abnormal anal cytology 28% of HSM, and 27% (abnormal anal cytology 34% of women. Among 117 (53% individuals with abnormal results (HR-HPV-positive and/or cytology was atypical squamous cells of undetermined significance or above, 67 underwent high resolution anoscopy. Of these 67 individuals, 22 individuals had AIN2+ (17 MSM, four women, and one HSM. HR-HPV correlated better with AIN2+ than with anal cytology on biopsy in both MSM (r=0.29 versus r=0.10; P=0.05 versus P=0.49 and non-MSM (r=0.36 versus r=-0.34; P=0.08 versus P=0.09.Conclusion: Given the presence of AIN2+ in screened HIV-infected HSM and women, routine anal cancer screening in all HIV-infected individuals should be considered. HR-HPV merits further evaluation for anal cancer screening among non-MSM.Keywords: human immunodeficiency virus, anal human papillomavirus, heterosexual men, women, anal cancer

Evaluación in vitro de tabletas orales de complejos de cobre con antiinflamatorios no esteroideos

Directory of Open Access Journals (Sweden)

Julie Fernanda Benavides Arévalo

Full Text Available Introducción: los antiinflamatorios no esteroideos (AINES, son un grupo diverso y químicamente heterogéneo de fármacos analgésicos, antipiréticos y antiinflamatorios; sin embargo, su funcionamiento se ve afectado por su baja solubilidad acuosa y por la incidencia de efectos secundarios gastrointestinales. Como una alternativa a este problema, la formulación de tabletas orales con complejos de cobre con AINES muestra un adecuado comportamiento in vitro y podría tener efectos secundarios reducidos comparados con el fármaco antiinflamatorio no complejado. Objetivo: evaluar los procesos de desintegración y de disolución de tabletas orales de complejos de cobre con AINES. Métodos: luego de la síntesis y la caracterización instrumental de los complejos, se evaluó por microscopia óptica el efecto de la morfología, el tamaño de partícula y las características superficiales en el proceso de disolución; estos resultados fueron considerados para la formulación de los complejos y permitieron junto con la adecuada elección de un desintegrarte, un modificador de flujo, un lubricante y un aglutinante, la obtención de tabletas por compresión directa. Finalmente, en los comprimidos se evaluaron propiedades fisicomecánicas y los procesos de desintegración y disolución. Resultados: las tabletas de los complejos mostraron tiempos de desintegración entre 5 y 15 min y una liberación in vitro del 75 al 93 %. Conclusiones: la disolución de los AINES se vio favorecida por la formación de complejos, el menor tamaño de partícula, la presencia de poros y grietas en la superficie de las partículas y la inclusión de excipientes para la formulación de tabletas orales.

Kolhoosikeskus - oma ja võõras = Collective farm centre - familiar and alien / Liina Jänes ; tõlk. Liisi Ojamaa

Index Scriptorium Estoniae

Jänes, Liina, 1977-

2000-01-01

Eesti kolhoosikeskuste arhitektuurist. Vaadeldakse aastail 1957-1990 ehitatud 24 keskusehoonet. Arhitektid Nikolai Kusmin, Harri Kingo, Toomas Rein, Vilen Künnapu, Ain Padrik, Maara Metsal, Meeli Truu jt. 17 välisvaadet, 3 joon., kaart

Mis saab maaärist? / Ester Šank

Index Scriptorium Estoniae

Šank, Ester, 1956-

2000-01-01

Maaostu piirava seaduseelnõu Riigikogu menetlusest välja arvamist kommenteerib Vootele Hansen. Lisatud ka eelnõu autorite Jaanus Marrandi, Harri Õunapuu ja töörühma liikme Ain Kendra seisukohad

Intel Corporation osaleb Eesti koolitusprogrammis / Raivo Juurak

Index Scriptorium Estoniae

Juurak, Raivo, 1949-

2001-01-01

Haridusministeeriumis tutvustati infotehnoloogiaalast koolitusprogrammi, milles osaleb maailma suuremaid arvutifirmasid Intel Corporation. Koolituskursuse käigus õpetatakse aineõpetajaid oma ainetundides interneti võimalusi kasutama. 50-tunnised kursused viiakse läbi kõigis maakondades

Plaat

Index Scriptorium Estoniae

2008-01-01

Laseringi kauplustes müügilolevatest heliplaatidest: Compromise Blue "Loomad on lahti", Mari Boine "Remixed vol. 2 - It Ain't Necessarily Evil", Me, Myself and I "Aastaajad", Whitesnake "Good To Be Bad", Estelle "Shine"

Download this PDF file

African Journals Online (AJOL)

Pediatrics Department, Faculty of Medicine, Ain Shams University corresponding author: ..... imaging studies: The diagnosis of CMV pneumonia can be suggested by chest radiograph find- ... dictive value and can aid in identifying children who ...

Lugedes Pilve ja Pazi / Mathura

Index Scriptorium Estoniae

Mathura, pseud., 1973-

2007-01-01

Võrdlevalt Aare Pilve luulekogust "Näoline" (kirj. Tuum, 2007) ja Octavio Pazi luulekogust "Alati on olevik" (hispaania k. tlk. Ain Kaalep, Jaan Kaplinski, Asta Põldmäe ja Jüri Talvet, kirj. Perioodika, 1984)

Euroopa tulevikuvisiooni näeme Ceutas ja Melillas / Daniel Pipes ; intervjueerinud Taavi Minnik

Index Scriptorium Estoniae

Pipes, Daniel

2016-01-01

Intervjuu Lähis-Ida Foorumi presidendi Daniel Pipesiga Euroopa migratsioonikriisist ja vigadest migratsioonipoliitikas. Probleemidest, mida massiimmigratsioon Kolmandast Maailmast Euroopale kaasa toob ning radikaalse islami ohtudest

Meediaekspert: vene inimesed väsivad infosõjast / Valeri Solovei ; intervjueerinud Taavi Minnik

Index Scriptorium Estoniae

Solovei, Valeri

2015-01-01

Intervjuu Venemaa Välisministeeriumi Moskva Riikliku Rahvusvaheliste Suhete Instituudi avalike suhete kateedri juhataja professor Valeri Soloveiga, kellelt ilmus raamat "Fake - absoluutne relv", mis keskendub meediamanipulatsioonidele ja propagandale. Nendel teemadel räägib ta ka intervjuus

Avatud pilguga suletud ruumis / Klavdij Sluban ; interv. Jean Pascal Ollivry ja Taavi Tatsi

Index Scriptorium Estoniae

Sluban, Klavdij

2006-01-01

1963. a. Pariisis sündinud Klavdij Sluban alustas pikaajalist projekti 1995. aastal, pildistades ise ja organiseerides sissejuhatavaid fotokursusi noorte kinnipidamisasutustes Prantsusmaal, Balkanimaades ja mitmetes endise Nõukogude Liidu maades

The effects of composition and firing cycle on sintering of aluminium nitride

International Nuclear Information System (INIS)

Hewett, C.; Trigg, M.B.

1992-01-01

A central composite design was used to evaluate the relative effects of temperature, time and Y 2 O 3 content on the densification behaviour of a commercial aluminium nitride (AIN). Over the range of the independent variables studied, temperature was found to exert the dominate influence. Low levels of Y 2 O 3 were found to be effective for the densification of AIN. After firing, cubic 3Y 2 O 3.5 Al 2O3 (YAG) was detected for the lower levels of Y 2 O 3 addition. At the higher levels both YAG and 2Y 2 O 3 .Al 2 O 3 were detected. For a dense sample the values obtained for hardness and fracture toughness were comparable to those reported in the literature. 11 refs., 1 tab

Análisis coste-efectividad del empleo de celecoxib en el tratamiento de la artrosis Cost-effectiveness analysis of the use of celecoxib for the treatment of osteoarthritis

Directory of Open Access Journals (Sweden)

A. Moreno

2003-02-01

Full Text Available Antecedentes: Los antiinflamatorios no esteroideos (AINE, utilizados en el tratamiento de la artrosis, pueden producir reacciones adversas gastrointestinales (GI graves. Celecoxib, un inhibidor específico de la ciclooxigenasa 2 (COX-2, ha demostrado una eficacia equivalente a los AINE convencionales con un mejor perfil de tolerabilidad y seguridad. Objetivo: La finalidad de este estudio ha sido realizar un análisis coste-efectividad sobre el uso de celecoxib frente a los AINE clásicos en el tratamiento de la artrosis. Material y métodos: El análisis coste-efectividad se ha diseñado mediante un modelo farmacoeconómico, definiéndose como unidad de efectividad a cada año de vida ganado tras la toma de celecoxib o AINE. La probabilidad de que aparezcan los diferentes resultados clínicos se ha obtenido de artículos publicados y de asunciones incorporadas. Sólo se han valorado los costes directos médicos (medicación, hospitalización, pruebas complementarias, analíticas, visitas extras, etc., sin haberse incluido otros costes. La perspectiva del estudio ha sido la del Sistema Nacional de Salud y el horizonte temporal elegido ha sido de 6 meses. Resultados: El coste adicional por cada año de vida ganado secundario al uso de celecoxib frente a los AINE clásicos asciende a 8.017 € (1.333.834 ptas.. El análisis de sensibilidad muestra cómo estos valores son sensibles a la modificación del coste de AINE y gastroprotector, así como a la inclusión de grupos poblacionales con edades más bajas. Conclusiones: Celecoxib puede ser considerado como una opción coste-efectiva en el tratamiento de la artrosis, ya que va a evitar muertes y a ganar años de vida para los pacientes con un coste adicional razonable y moderado, cuando se compara con los AINE. Su eficiencia aumenta a medida que se utiliza en poblaciones con menor edad media y, probablemente, en aquellas con mayor riesgo de desarrollar complicaciones GI.Background: Non

Technical Progress Report for "Optical and Electrical Properties of III-Nitrides and Related Materials"

Energy Technology Data Exchange (ETDEWEB)

Jiang, Hongxing

2008-10-31

Investigations have been conducted focused on the fundamental material properties of AIN and high AI-content AIGaN alloys and further developed MOCVD growth technologies for obtaining these materials with improved crystalline quality and conductivities.

Sekulariseeruv sakraalarhitektuur / Piret Lindpere

Index Scriptorium Estoniae

Lindpere, Piret, 1963-

2002-01-01

Moodsatest kirikutest, sajandilõpu eesti sakraalarhitektuurist. Pikemalt Tallinna metodisti kirikust (Vilen Künnapu, Ain Padrik), Püha Brigitta keskusest (projekteerimist juhtis Ra Luhse) ja ehitama hakatavast Viimsi Püha Jaakobi kirikust (Erkki Ristoja, Martin Aunin)

Popmuusika / Valner Valme

Index Scriptorium Estoniae

Valme, Valner, 1970-

2006-01-01

Uutest heliplaatidest Graham Coxon "Love Travels At Illegal Speeds", Gabriel Rios "Ghostboy", "Sounds Of India", John Hughes "Wild Ocean", Ain Agan & Tallinn Chamber Orchestra/Toomas Vavilov, Ashanti "Collectables By Ashanti", Liv Kristine "Enter My Religion"

Itaalia seadustab ainuõige pitsa / Kaivo Kopli

Index Scriptorium Estoniae

Kopli, Kaivo

2004-01-01

Pizza Napolitana ained, valmistusviis ja tulemus peavad vastama nõuetele. Itaalia põllumajandusministeeriumis välja töötatud pitsareeglid on osa Itaalia pingutustest kaitsta oma kuulsat kööki. Lisaks: Pitsavalmistamise reeglid

Sumerki klassitsizma / Iosef Kats

Index Scriptorium Estoniae

Kats, Iosef

2004-01-01

Tallinna Viru Keskuse juurde püstitatud Mare Mikofi kavandatud hiigelskulptuurist. Kuju on Mikofi versioon Weizenbergi "Hämarikust". Viru Keskuse arhitektide Vilen Künnapu ja Ain Padriku arvates peaks naiseskulptuur mahendama kaubakeskuse kubistlikku ja maskuliinset arhitektuuri

Plaadid / Aivo Vahemets

Index Scriptorium Estoniae

Vahemets, Aivo

2005-01-01

Uutest heliplaatidest The All-American Rejects "Move Along", Devendra Banhart "Criple Crow", Rod Stewart "Thank For The Memory", Him "Dark Light", Status Quo "the Party Ain't Over Yet", Ricky Martin "Life", Barbara Streisand "Guilty Pleasures"

Emajõe äärde kerkib Tartu tulevane sümbol : Kroodo-Tower / Nils Niitra

Index Scriptorium Estoniae

Niitra, Nils, 1975-

2005-01-01

ASi Linnaehitus nõukogu liige Alar Kroodo plaanib Emajõe äärde 23-korruselise kõrghoone ehitamist, mille ehitusmaksumuseks kujuneb 100 kuni 200 miljonit krooni. Kõrghoone on projekteerinud arhitektid Ain Padrik ja Vilen Künnapu

"Arvuti koolis" ja arvutiõpetus õppekavas / Helen Vanganen, Jevgeni Košelev

Index Scriptorium Estoniae

Vanganen, Helen

2002-01-01

Ligi 1500 aineõpetajat osales 2001/2002 õppeaastal kursusel "Arvuti koolis". Õpetajad tutvusid Oxfordi Ülikooli jätkukursusega - originaalprogramm kannab nime "Intelʼ Teach to the Future", mis on otseselt seotud infotehnoloogia rakendamisega õppekavas

Kes kaitseks Eesti ohvitsere NKVD-KGB laimu eest? / Peep Varju

Index Scriptorium Estoniae

Varju, Peep

2008-01-01

Autor polemiseerib Eesti Ekspressis ilmunud artiklitega Eesti endiste ohvitseride kohta, kus käsitletakse nende väidetavat koostööd KGBga. Vaatluse all on ohvitserid Ain Mere, Harald Nugiseks, Alfons Rebane ja Harald Riipalu

Nigel saak ähvardab kalureid pankrotiga / Jüri E Kukk

Index Scriptorium Estoniae

Kukk, Jüri E., 1961-

2004-01-01

Tänavune kalasaak Võrtsjärvest on jäänud väga kesiseks. Võrtsjärve Limnologiajaama juhataja Ain Järvalt peab kalade vähesuse põhjuseks heitlikke ilmastikuolusid. Lisa: Kalasaagid [1999-2003

Spordipreemiad leidsid omaniku / Anne Põder

Index Scriptorium Estoniae

Põder, Anne, 1973-

2007-01-01

Järvamaa omavalitsuste liit ja spordiliit tunnustasid maakonna parimaid sportlasi, kelleks osutusid Ain-Alar Juhanson, Mikko Vanaisak, Viktoria Leks ja Grit Shadeiko. Spordiedendaja preemia sai Tiit Kavak, spordi elutöö preemia pälvis Enn Sõmeri

Teatrid murravad päid ja piike / Dea Martinjonis

Index Scriptorium Estoniae

Martinjonis, Dea

2000-01-01

Eesti Televisiooni ekraanile jõuab teatriteemaline teleturniir "Bläkkpoks" : stsenarist Villu Kangur : režissöör Ain Prosa : saatejuht Sepo Seeman : toimetaja Anne Tuuling : produtsent Priit Vaher. Ka : Teleleht nr. 50, lk. 36-37

Download this PDF file

African Journals Online (AJOL)

rme

1Medical Genetic Center, Faculty of Medicine, Ain Shams University,. 2Community ... indications for amniocentesis in 60.8% were history of having previous child .... best location for placing the needle ..... leukemia, 8.5% for neural tube defects.

Geochemistry of dark coastal heavy-mineral beaches sand (Annaba ...

African Journals Online (AJOL)

Acer

3 Institute of Earth and Environmental Science, University of Potsdam, ... Some beaches are characterized by a red-brownish sand colour, the Ain Achir and the ... The occurrence of clays has been determined using the methyl-blue method.

9. II avati taas von Krahli Akna galerii

Index Scriptorium Estoniae

2004-01-01

Näitusel "Mute - a Register of Dreams" on vaadata Aine Phillipsi (Iirimaa), Avangardi, Diane Dwyer & Tillamook Cheddari (USA), Evelin Urmi, Kiwa, Lee Adamsi (Inglismaa), Marcello Mercado (Saksamaa), Miguel Rodriguez Sepulveda (Mehhiko) ja Renato Meneghetti (Itaalia) töid

Алексий II 1929-2008

Index Scriptorium Estoniae

2008-01-01

Aleksius II meenutavad: Kornelius, Tallinna ja kogu Eesti metropoliit ; Karin Jaani ; Marina Kaljurand ; Dmitri Medvedev, Venemaa president ; Helene Kamzol, Aleksius II sugulane ; Ain Seppik ; Vladimir Illjashevitsh ; Edgar Savisaar ; Jevgeni Tomberg ; Ene Ergma ; Toomas Hendrik Ilves, Eesti Vabariigi president

Dgroup: DG00804 [KEGG MEDICUS

Lifescience Database Archive (English)

Full Text Available aine hydrochloride Neuropsychiatric agent ... DG02030 ... Anesthetics ... DG01675 ... Local anesthetic ... DG01673 ... Amide type local anesthetic... ... DG01675 ... Local anesthetic ... DG01673 ... Amide type local anesthetic ATC code: N01BB07 Local anesthetic

deletion polymorphism of ACE gene and Alzheimerв€™s disease

African Journals Online (AJOL)

Omayma M. Hassanin

2014-06-27

Jun 27, 2014 ... ease, 45 males and 39 females aged 65 ± 7 years from the Geriatric Department at Ain-Shams Uni- ..... alternative therapy provided by the ACE protein. .... enzyme (ACE) gene polymorphism in relation to physical perfor-.

Egyptian Journal of Pediatric Allergy and Immunology (The): Journal ...

African Journals Online (AJOL)

Publisher. Contact: Professor Ihab Z. El-Hakim. Email ihab.elhakim@gmail.com. Phone +201111224974. Fax … +202 33045060. Children's Hospital, Ain Shams University, Ramses Street, Abbassiya, Cairo 11566, Egypt. The Egyptian Society of Pediatric Allergy and Immunology ...

Ahhaa teaduskeskus Tartus = The Ahhaa Science Centre in Tartu

Index Scriptorium Estoniae

2012-01-01

Arhitektide Ain Padriku ja Vilen Künnaou projekteeritud Ahhaa teaduskeskuse (Sadama 1) ekspositsiooni ja sisekujundusest. Sisearhitektid Tea Tammelaan, Krista Lepland ja Malle Jürgenson (Laika, Belka & Strelka), loetletud nende ühiselt tehtud töid. Infograafika: Alar Pikkorainen

Keskerakonna nõrk PR-käik / Aivar Hundimägi

Index Scriptorium Estoniae

Hundimägi, Aivar, 1975-

2008-01-01

Seoses keskerakondlastest ettevõtjate Richard Siku ja Heldur Undi sattumisega bordelliskandaali on Keskerakonna aukohtu esimees Ain Seppik pöördunud järelpärimisega politseiameti peadirektori Raivo Aegi ja riigi peaprokuröri Norman Aasa poole

Data of evolutionary structure change: 1WPWB-1XAAA [Confc[Archive

Lifescience Database Archive (English)

Full Text Available 1WPWB-1XAAA 1WPW 1XAA B A GFTVALIQGDGIGPEIVSKSKRILAKINELYSLPIEYIE...SDGVAVGMKIITRFASERIAKVGLNFALRRRKKVTCVHKANVMRITDGLFAEACRSVLKG--KVEYSEMYVDAAAANLVRNPQMFDVIVTENVYGDILSDEASQIAGS...LEU CA 502 1XAA A 1XAAA...R CA 306 1XAA A 1XAAA...ain>A 1XAAA KANVL-EVGEF -

Tornkorteritega maja otse tulevikust / Ave Randviir

Index Scriptorium Estoniae

Randviir, Ave, 1981-

2006-01-01

Vilen Künnapu, Ain Padriku ja Kristi Alamaa ümberehitusprojekti järgi valminud modernsest kolme torniga elumajast Triumph Plaza Tallinnas Narva mnt. 7. Rekonstrueeriti Olga Brunsi ja Mart Kallingu 1981. a. valminud konterihoone. Kommenteerib Vilen Künnapu

Uus eksamikord tõi 13 tudengi eksmati / Inga Uusmaa

Index Scriptorium Estoniae

Uusmaa, Inga

2001-01-01

Eesti Sisekaitseakadeemias kehtestatud vaheeksami süsteemist, mille järgi tuleb igas aines sooritada kaks eksamit, teine eksam ei anna küll ainepunkte, kuid selles läbikukkumine tähendab seniste ainetulemuste tühistamist

Browse Title Index

African Journals Online (AJOL)

Items 51 - 100 of 149 ... ... of Pediatric Asthma Review of Ain Shams Pediatric Hospital Chest Clinic ... Vol 15, No 1 (2017), Gastrointestinal manifestations in children ... Vol 6, No 1 (2008), Immunogenetics of type 1 diabetes mellitus, Abstract PDF.

Rein Sillar : Kui argumente ei jätku, on hea KGB kaart välja tõmmata / Rein Sillar ; interv. Toomas Sildam

Index Scriptorium Estoniae

Sillar, Rein

2001-01-01

Eesti NSV KGB viimane esimees ei usu, et eestlased sooviksid minevikuhaavu lahti rebida. Vare-Shironini kokkuleppest KGB tegevuse lõpemisest Eestis, süümevandest, ENSV Riiklikust Julgeolekukomiteest. Kommenteerivad: Ain Kaalep, Peeter Olesk, Heinz Valk. Parlamendisaadik (P. Olesk)

90-aastane Tallinna Polütehnikum - ainus omataoline / Sirje Tohver

Index Scriptorium Estoniae

Tohver, Sirje

2005-01-01

Polütehnikumi vilistlastest õpetajate (Heiki Tähis, Andres Ojalill, Jüri Jakubovitš, Hugo Tartlan, Hergi Kruusimaa, Tiina Karja, Priit Kalman, Ardi Priks, Jaan Kuus, Jüri Puhang, Vello Vanem, Rein Kask, Kalle Sammal, Ain Saaret) meenutusi

Obtention of differential sections in nuclear reactions using a thick target

International Nuclear Information System (INIS)

Chavez R, R.

2000-01-01

The nuclear reaction analysis (NRA) technique is used mainly for detecting the presence and concentration of light elements of great importance such as: carbon, nitrogen and oxygen. This work has the objective to obtain the differential sections of 16 O and 14 N starting from the irradiation with deuterons of TiSrO 3 samples, of AIN and AIN 2 at energies of 2000 KeV and 1800 KeV respectively. The present work have four chapters; chapter 1 is focused to the physical aspects which takes part in the NRA technique. The technical requirements as well as the necessary equipment for developing the techniques are described in the chapter 2. In chapter 3 it is described the algorithm developed for to obtain the differential sections starting from experimental data, and finally, in chapter 4 are given the results and conclusions. (Author)

Fibre optique à la maison en Pays de Gex et de Bellegarde

CERN Multimedia

CERN. Geneva; Goy, Jean Paul

2010-01-01

Le Syndicat Intercommunal d’Electricité de l’Ain(SIEA) déploie un réseau FTTH (Fiber To The Home) de fibres optiques dans le département de l’Ain vers l’ensemble des habitations. Le déploiement sur la zone pilote du Pays de Gex et du Bassin Bellegardien arrive dans la phase terminale vers les habitations. Le SIEA présentera ses activités, l’état du développement du réseau, les implications d’une connexion fibre optique et les procédures d’abonnement. La présentation sera donnée en Français. -------------------------------------------------------------------------------------------------------------------------------Public conference "Optical fiber To The Home in Pays de Gex et de Bellegarde" Michel Chanel et Jean Paul Goy (SIEA) Wednesday, 19th May at 11.30 hrs., Counc...

Portugalikeelse kirjanduse retseptsioon Eestis / Mele Pesti

Index Scriptorium Estoniae

Pesti, Mele, 1979-

2011-01-01

Portugalikeelse kirjanduse tõlgetest ja nende vastuvõtust alates esimese tõlke ilmumisest 1890. aastal kuni 2005. aastani ning retseptsiooni pärssinud teguritest. Ülevaade kahe olulisema tõlkija Aita Kurfeldti ja Ain Kaalepi tööst

Neurofibromatosis type 1 and multiple sclerosis: Genetically related ...

African Journals Online (AJOL)

Solaf M. Elsayed

2016-10-25

Oct 25, 2016 ... a Genetics Unit, Children's Hospital, Ain Shams University, Egypt b Neurology Department ... Through the past 6 months, she started to develop short term memory loss with intact long term memory. There was no other motor ...

Veel vene koolist ja krokodillipisaratest / Yana Toom

Index Scriptorium Estoniae

Toom, Yana, 1966-

2011-01-01

Artikli autori arvates ei ole eesti keele õpetamise kvaliteet piisav, et seada eesmärgiks eestikeelne aineõpe vene koolide gümnaasiumiastmes. Vastukaja artiklile: Priit Simson. Venekeelne kool ja krokodillipisarad. Eesti Päevaleht (2011) 9. sept., lk. 2

Uurija Rita ja näitleja Elisabet / Jüri Laulik

Index Scriptorium Estoniae

Laulik, Jüri, 1959-

2006-01-01

ETV uues algupärases krimisarjas "Ohtlik lend" teeb kaasa ka Tallinna Linnateatri näitlejanna Elisabet Tamm. Sarja stsenarist on Mihkel Ulman, lavastaja Ain Prosa. Näitlejannast lähemalt. Sama : Teleleht, nr. 41, lk. 6-7 : ill

Spielpläne

Index Scriptorium Estoniae

2007-01-01

Laulja Annely Peebo ooperis "Jenufa" 2., 4., 6., 9., 11., 13. ja 15. mail Mailandis. Eesti Filharmoonia Kammerkoor esinemas 27. ja 28. mail Bergenis. Laulja Ain Anger 19. mail Placido-Domingo Galal ja 31. mail ooperis "Othello" Viini Riigiooperis

Parts : ministrite minevik olgu avalik / Juhan Parts ; interv. Toomas Sildam

Index Scriptorium Estoniae

Parts, Juhan, 1966-

2003-01-01

Peaminister Juhan Parts vastab küsimustele, mis on seotud politseinike altkäemaksu andmise avalikuks tulekuga, komissar Indrek Sirgi ametist lahkumisega ja ministrite seadusrikkumiste avalikustamisega. Kommenteerivad: Margus Leivo, Tarmo Loodus, Ain Seppik. Vt. samas: Valik saladuses peetavast teabest

City Plaza büroohoone edu üllatas asjatundjaid / Aivo Vahemets

Index Scriptorium Estoniae

Vahemets, Aivo

2004-01-01

Kuigi kinnisvaraspetsialistid olid City Plaza büroohoonesse äripindade rentnike leidmise suhtes skeptilised, on Tallinnas asuvas City Plaza kõrghoones 31 äripinnast rentimata veel vaid kaks. Vt. samas intervjuud Ain Kivisaarega. Lisa: City Plaza büroohoone

Challenges in diagnosis and counseling of a family with two ...

African Journals Online (AJOL)

Heba S. Abd-Elkhalek

2015-12-29

Dec 29, 2015 ... Genetics Unit, Childrens' Hospital, Ain Shams University, Cairo, Egypt. Available online 29 ... normal milestones of development in the first 6 months of life .... most important clue in family history that indicated the pres- ence of ...

Hepatoadrenal syndrome in Egyptian children with liver cirrhosis ...

African Journals Online (AJOL)

Amel A.M. Elfaramawy

2012-08-03

Aug 3, 2012 ... E-mail address: amelhome4@gmail.com. Peer review under responsibility of Ain Shams University. Production and hosting by ..... [23] Ho JT, Al-Musalhi H, Chapman MJ, Quach T, Thomas PD, Bagley. CJ, et al. Septic shock ...

Risk factors for autism: An Egyptian study

African Journals Online (AJOL)

Farida El-Baz

IQ assessment using Stanford–Binrent intelligence scale, and assessment of severity ... All studied developmental milestones were delayed among autistic children than ... Peer review under responsibility of Ain Shams University. ..... Treatment and educa- ..... communication in people with autism and intellectual disability. J.

Determination of thorium and uranium contents in soil samples ...

Indian Academy of Sciences (India)

Experimental Nuclear Physics Department, Atomic Energy Authority, Nuclear Research Center, Abu Zabaal, 13759 Cairo, Egyp; Experimental Nuclear Physics Department, Atomic Energy Authority, Nuclear Research Center, Abu Zabaal, 13759 Cairo, Egypt; Faculty of Girls for Art, Science and Education, Ain-Shams ...

Naised Ilvesenahkades / Agnes Nõu

Index Scriptorium Estoniae

Nõu, Agnes

2006-01-01

Jahtlaeva Santa Maria kapteni Ain Roosma soovist kogu jahtlaeva naiskond ühtsesse vormi riietada sündis tuntud Eesti spordiriiete tootjal AS-il Ilves-Extra uus tootegrupp - purjetamisrõivad. Vt. samas: Ilves-Extra valmistab nüüd purjetamisrõivaid

3 + 2 = 450 : 3+2 õppesüsteem tõi kaasa kuni 450 tudengiga hiigelloengud / Anu Mõistlik, Jüri Saar

Index Scriptorium Estoniae

Mõistlik, Anu, 1980-

2002-01-01

Vastne õppekord pakib loengusaali sadu noori. 3+2 tuleku otsustas kuue inimese hääletus. Vanade õppekavade ained kaovad järjestikku tunniplaanidest. Teadusmagistreid enam ei tule. Ainepunktide ülekandmiseks peab üliõpilane ise vaeva nägema

Musta pesu pesemine / Ivar Tallo

Index Scriptorium Estoniae

Tallo, Ivar, 1964-

2005-01-01

Valitsuse korruptsioonivastase asjatundjate komisjoni juht aastatel 2002-2003 on seisukohal, et ajakirjandus on ainult üks võimalikest vahenditest tõe tuvastamisel ning lõpliku tõe Edgar Savisaare ja Ain Hanschmidti jt seotud skandaalide kohta peavad selgitama võimuinstitutsioonid

Antibacterial, antioxidant and cytotoxic activities of extracts from the ...

African Journals Online (AJOL)

Unicellular green algal strains, identified as Cosmarium (Chlorophyta), were isolated from Ain-Echeffa hot spring in north Tunisia. Different extracts (methanol, hexane, acetone, acetone: methanol and water) obtained from both biomass and extracellular polysaccharides (EPS) were evaluated for their antibacterial, ...

Väikesed inimesed kodumaises seebivahus / Margot Visnap

Index Scriptorium Estoniae

Visnap, Margot, 1959-

2000-01-01

Kanal 2 uus teleseriaal "Me saame hakkama" : stsenarist Mihkel Ulman : režissöör Ain Prosa : helilooja Ardo-Ran Varres : mängivad Andrus, Maarika ja Marta Vaarik, Ülle Kaljuste, Maria Avdjushko, Hilja Varem jt. : Wireframe Productions

Nad saidki hakkama / Jüri Laulik

Index Scriptorium Estoniae

Laulik, Jüri, 1959-

2000-01-01

Kanal 2 uus teleseriaal "Me saame hakkama" : stsenarist Mihkel Ulman : režissöör Ain Prosa : helilooja Ardo-Ran Varres : mängivad Andrus, Maarika ja Marta Vaarik, Ülle Kaljuste, Maria Avdjushko, Hilja Varem jt. : Wireframe Productions

Tallinn hakkab Põhjaväila tarvis maid ostma

Index Scriptorium Estoniae

2007-01-01

Seoses Russalkast Ahtri tänavani ulatuva tee-ehitusega seisab linnal ees 16 maaküsimuse lahendamine. Probleemidest seoses väila osaliselt merre ehitamisega ja väila lõpuniehitamiseks lammutada tulevad hooned. Kommenteerivad Alo Brandt ja Ain Valdmann

Reiljan, Savisaar show who's in charge / Joel Alas

Index Scriptorium Estoniae

Alas, Joel

2006-01-01

Eestimaa Rahvaliidu esimees Villu Reiljan ja Eesti Keskerakonna esimees Edgar Savisaar otsustavad uue presidendi üle. Villu Reiljan toetab Arnold Rüütlit. Edgar Savisaare, Ene Ergma, Toomas Hendrik Ilvese ja Riigikogu liikme Ain Seppiku väljaütlemised

Pilistvere rehehoones tapetakse Rasputin / Kaarel Aluoja

Index Scriptorium Estoniae

Aluoja, Kaarel

2008-01-01

7. aug. Pilistvere vanas rehehoones esietendunud Ain Saviaugu kirjutatud ja lavastatud suvetükist "Rasputin". Suvelavastuse tõi välja Põltsamaa Teater Ellunäod koos professionaalsete näitlejatega. Nimiosas mängib näitlejast riigikogulane Indrek Saar

Rasputin - lugu rahva latvade juurimisest / Kati Murutar

Index Scriptorium Estoniae

Murutar, Kati, 1967-

2008-01-01

7. aug. Pilistvere vanas rehehoones esietendunud Ain Saviaugu kirjutatud ja lavastatud suvetükist "Rasputin". Suvelavastuse tõi välja Põltsamaa Teater Ellunäod koos professionaalsete näitlejatega. Nimiosas mängib näitlejast riigikogulane Indrek Saar

Pilistvere vana rehe all päästetakse Venemaad / Krista Valdvee

Index Scriptorium Estoniae

Valdvee, Krista, 1978-

2008-01-01

7. aug. Pilistvere vanas rehehoones esietendunud Ain Saviaugu kirjutatud ja lavastatud suvetükist "Rasputin". Suvelavastuse tõi välja Põltsamaa Teater Ellunäod koos professionaalsete näitlejatega. Nimiosas mängib näitlejast riigikogulane Indrek Saar