WorldWideScience

Sample records for ain aaviksoo taavi

  1. Ain Aaviksoo : arengukava jännis selgete vastuste andmisega / Ain Aaviksoo ; interv. Violetta Riidas

    Index Scriptorium Estoniae

    Aaviksoo, Ain, 1974-

    2008-01-01

    Sügisel sotsiaalministrile kinnitamiseks saadetav esmatasandi tervishoiu arengukava on praegu veel olukorras, kus olulised sõlmkohad on lahendamata. Selleteemalistele küsimustele vastab poliitikauuringute keskuse PRAXIS juhatuse esimees Ain Aaviksoo, kelle sõnul võib arengukavas planeeritud tegevuste realiseerimiseks kuluda kaks korda enam raha kui praegu. Vt. samas: Traditsioonilisest patsiendirollist tuleb loobuda

  2. Kui tervis streigib / Ain Aaviksoo

    Index Scriptorium Estoniae

    Aaviksoo, Ain, 1974-

    2007-01-01

    Poliitikauuringute keskuse Praxis tervishoiupoliitika programmi direktor analüüsib streikida kavatsevate tervishoiutöötajate väiteid ning avaldab arvamust kavandatava streigi kohta. Ta peab tõenäoliseks, et streikijatele antakse järele teatud ulatuses, eesmärk suurendada tervishoiukulutusi jääb aga uue koalitsiooni lahendada

  3. Männik ohverdas Aaviksoo

    Index Scriptorium Estoniae

    2003-01-01

    Eesti Telekomi nõukogu otsusest vabastada ametist EMT juhatuse esimees Peep Aaviksoo, uuest kandidaadist Valdo Kalmust ning EMT ja Elioni võimalikust ühinemisest. Diagramm: EMT turuosa libiseb Tele2-le. Vt. samas: EMT lahkuva juhi Peep Aaviksoo avalik kiri. Kommenteerivad Sami Seppänen, Üllar Jaaksoo, Monika Salu, Jaak Aaviksoo, Toomas Tamsar

  4. Kaitseminister Aaviksoo kohtub Saksa kolleegiga

    Index Scriptorium Estoniae

    2011-01-01

    Kaitseminister Jaak Aaviksoo alustab visiiti Saksamaale, kus kohtub ka Saksa kaitseministri Karl-Theodor zu Guttenbergiga, kellega arutatakse kahe riigi vahelise kaitsekoostöö edasise arenguga seotud küsimusi. Kohtutakse ka Saksa parlamendi kaitsekomisjoni liikmetega

  5. Aaviksoo askeldab Bukarestis / Paavo Kangur

    Index Scriptorium Estoniae

    Kangur, Paavo, 1966-

    2006-01-01

    Endine Tallinna aselinnapea, ärimees Peep Aaviksoo tegeleb kinnisvaraäriga Rumeenias: koostöös partneritega firmast IPC Real Estate on käsil projekt kolme tornelamu rajamiseks Bukaresti. Vt. samas: Eesti ärimehi välismaal; Fotod: Rumeenia päevad Kaubandus-Tööstuskojas, lk. 41

  6. Eesti Rahvusteater esitab : Norman Krasna "Kättemaks on magus" : Taavi Söödori Teatristuudios 118 Dundas St. West, Juuni 4, 5 ja 6, kell 3 p.l. / Ain Söödor

    Index Scriptorium Estoniae

    Söödor, Ain, 1935-2016

    2004-01-01

    eeltutvustus 2004. a. juunis Torontos mängitavale Eesti Rahvusteater Kanadas etendusele - romantilise komöödia lavastas Asta Söödor, lisaks temale mängivad Ain Söödor, Ester Mandra, Ernst Vähi

  7. Terve mõistusega ahnuse vastu / Ain Aaviksoo

    Index Scriptorium Estoniae

    Aaviksoo, Ain, 1974-

    2005-01-01

    Dokumentaalfilm "Ülisuur mina" ("Super Size Me") : režissöör Morgan Spurlock : Ameerika Ühendriigid 2004. Turumajandusest, dieedist ja toitumisest, filmi hoiatavast osast eelkõige teistmelistele ja nende kasvatajatele

  8. Terve mõistusega ahnuse vastu / Ain Aaviksoo

    Index Scriptorium Estoniae

    Aaviksoo, Ain, 1974-

    2005-01-01

    Dokumentaalfilm "Ülisuur mina" ("Super Size Me") : režissöör Morgan Spurlock : Ameerika Ühendriigid 2004. Turumajandusest, dieedist ja toitumisest, filmi hoiatavast osast eelkõige teistmelistele ja nende kasvatajatele

  9. Aaviksoo : Ja ishozhu iz etnitsheskihh printsipov / Jaak Aaviksoo ; interv. Ksenia Repson

    Index Scriptorium Estoniae

    Aaviksoo, Jaak, 1954-

    2007-01-01

    Kaitseminister Jaak Aaviksoo vastab küsimustele, mis puudutavad kaevamisi Tõnismäel pronkssõduri juures, maetute omaste ja linnavõimude kohtusse pöördumist, mälestusmärgi üleviimist, kaitseministri ametit, oma armeeteenistust, Venemaa ja Eesti kaitsealast koostööd. Lisa: Jaak Aaviksoo

  10. Peep Aaviksoo : Minu äri 10 käsku / Peep Aaviksoo

    Index Scriptorium Estoniae

    Aaviksoo, Peep, 1956-

    2008-01-01

    Paljudes suurfirmades töötanud ja sellega hindamatu kogemuse saanud ärimees jagab kogemusi, kuidas olla ettevõtluses edukas. Hetkel tegeleb Peep Aaviksoo Eesti investorite raha paigutamisega IPC Investmenti kaudu Rumeenia kinnisvarasse. Lisa: Peep Aaviksoo (tegevus). Vahendanud Kaileen Mägi

  11. Jaak Aaviksoo : Oborona i obrazovanije tak pohhozhi... / Jaak Aaviksoo ; interv. Jevgenija Garanzha

    Index Scriptorium Estoniae

    Aaviksoo, Jaak, 1954-

    2007-01-01

    Kaitseminister Jaak Aaviksoo vastab küsimustele, mis puudutavad riigi kaitsepoliitikat, uut riigikaitse plaani, Eesti-Vene suhteid, rahuvalve missioone, Kaitseliidu tegevust, ministeeriumi ja kaitseväe suhteid

  12. Estonia - a provider of security / Jaak Aaviksoo

    Index Scriptorium Estoniae

    Aaviksoo, Jaak, 1954-

    2007-01-01

    Kaitseminister Jaak Aaviksoo Eesti liitumisest NATO-ga, kaitseväeteenistusest, Kaitseliidu osast julgeoleku ja turvalisuse tagamisel ning Eesti kaitsepoliitika eesmärkidest. Juuresolevatel fotodel kaitseminister koos president Toomas Hendrik Ilvesega külastamas kaitseväe suurõppust Kevadtorm

  13. Aaviksoo dal Ukraine pjat let / Ilja Gromov

    Index Scriptorium Estoniae

    Gromov, Ilja

    2008-01-01

    Kaitseminister Jaak Aaviksoo arvab, et Ukraina võetakse NATOsse 5-10 aasta pärast. Eesti rahuvalvajad saavad jääda järgmisel aastal Iraaki ÜRO Julgeolekunõukogu resolutsiooni alusel või Iraagi valitsuse kutsel

  14. Estonia - a provider of security / Jaak Aaviksoo

    Index Scriptorium Estoniae

    Aaviksoo, Jaak, 1954-

    2007-01-01

    Kaitseminister Jaak Aaviksoo Eesti liitumisest NATO-ga, kaitseväeteenistusest, Kaitseliidu osast julgeoleku ja turvalisuse tagamisel ning Eesti kaitsepoliitika eesmärkidest. Juuresolevatel fotodel kaitseminister koos president Toomas Hendrik Ilvesega külastamas kaitseväe suurõppust Kevadtorm

  15. Aaviksoo suunab Rumeeniasse üle poole miljardi / Raigo Neudorf

    Index Scriptorium Estoniae

    Neudorf, Raigo

    2005-01-01

    OÜ IPC Investment president, endine EMT juht Peep Aaviksoo ärikontaktide tekkimisest Rumeeniaga, ettevõtte plaanidest sealsel turul ning kohalikust ärikeskkonnast. Vt. samas: Abilinnapea amet on tulnud äritegemisel kasuks; Aaviksoo: olen globaliseerumise vastane. Lisa: CV

  16. Jaak Aaviksoo : eestlastel on kaitsetahtega probleeme / Jaak Aaviksoo ; interv. Peeter Kuimet

    Index Scriptorium Estoniae

    Aaviksoo, Jaak, 1954-

    2007-01-01

    Tulevane kaitseminister vastab küsimustele, mis puudutavad kaitseministri ametit, riigikaitset, ajateenistust, kaitseväe missioone, põhiseaduse muutmist seoses kaitseväe juhataja allutamisega täitevvõimule, kaitseväe arengut, pronkssõdurit, IRL-i juhtimist ja oma seisukohtade väljendamist valitsuses. Lisa: Jaak Aaviksoo

  17. Miks tekkis uute kommunikatsioonibüroode pisibuum? / Ain Parmas, Daniel Vaarik, Kristina Seimann ... [jt.] ; intervjueerinud Annela Laaneots

    Index Scriptorium Estoniae

    2016-01-01

    Möödunud aastal teatasid paljud pikaajalise staažiga kommunikatsioonieksperdid, et lõid uue kommunikatsioonibüroo. Mis niisuguse pisibuumi tekitas ja kuidas see meie kommunikatsioonimaastikku mõjutab. Küsimustele vastavad uute büroode omanikud Ain Parmas, Daniel Vaarik, Kristina Seimann, Karin Väljamäe, Merlis Nõgene ja Taavi Linnamäe

  18. Jaak Aaviksoo : presidendi kaudu inimlikustatakse ja isikustatakse riiki / Jaak Aaviksoo ; interv. Märt Kivine

    Index Scriptorium Estoniae

    Aaviksoo, Jaak, 1954-

    2006-01-01

    Presidendikandidaat vastab küsimustele, mis puudutavad tema kandideerimist presidendiks ja maailmavaadet, teadmistepõhist majandust, arenguid Eesti päevapoliitikas, kokkupuuteid KGB-ga, Venemaad. Ta on seisukohal, et presidendi institutsiooni on vaja teatud emotsionaalse tähendusega märgina ning et riigi poliitiliste otsuste tegemisel peaks tuginema enam ekspertarvamustele. Läbi viimase kahe valitsuse süvenenud lõhenemine kommunistide ja vabadusvõitlejate vahel on teema, mis vajaks teistsugust käsitlemist. Vt. samas: Jaak Aaviksoo pöördumine ajalehes Universitas Tartuensis

  19. Peep Aaviksoo kukutas EMT-kesksus / Jaan Männik ; interv. Vallo Toomet

    Index Scriptorium Estoniae

    Männik, Jaan, 1945-

    2003-01-01

    EMT nõukogu esimees ja Eesti Telekomi juhatuse esimees Jaan Männik vastab küsimustele, mis on seotud Peep Aaviksoo lahkumisega Eesti Mobiiltelefoni juhi kohalt. Vt. samas: Aaviksoo selgitab lahkumise põhjusi. Peep Aaviksoo kiri. Kommenteerivad Radiolinja Eesti juhatuse esimees Sami Seppänen, Tele2 Eesti juhatuse esimees Üllar Jaaksoo, Ühispanga analüütik Sven Kunsing

  20. Eesti Vabariigi põhiseadus : kommenteeritud väljaanne / toimetuskolleegium: Eerik-Juhan Truuväli, Berit Aaviksoo, Oliver Kask, Lasse Lehis, Lauri Madise, Ülle Madise, Kalle Merusk, Lauri Mälksoo, Raul Narits, Vallo Olle, Peep Pruks

    Index Scriptorium Estoniae

    2008-01-01

    Kommentaaride autorid ja sisu: Sissejuhatus / Raul Narits, Lauri Madise, Heinrich Schneider. Preambul / Raul Narits, Heinrich Schneider. I ptk. / Kalle Merusk, Taavi Annus, Madis Ernits, Heiki Lindpere, Lauri Madise. II ptk. / Oliver Kask, Madis Ernits, Taavi Annus, Peeter Roosma, Rait Maruste, Eerik Kergandberg, Ivo Pilving, Uno Lõhmus, Merilin Kiviorg, Einar Vene, Ülle Madise. III ptk. / Oliver Kask. IV ptk. / Lauri Madise, Aaro Mõttus, Jüri Põld, Tiina Runthal. V ptk. / Eerik-Juhan Truuväli, Ülle Madise, Jüri Põld, Urmas Reinsalu. VI ptk. / Kalle Merusk, Jüri Põld. VII ptk. / Eerik-Juhan Truuväli, Jüri Liventaal, Jüri Põld. VIII ptk. / Lasse Lehis. IX ptk. / Kristi Land, Heiki Lindpere, Lauri Madise, Heiki Pisuke. X ptk. / Oliver Kask, Enn Markvart, Jüri Põld. XI ptk. / Ülle Madise, Janek Laidvee, Heinrich Schneider. XII ptk. / Berit Aaviksoo, Mihkel Allik, Enn Markvart, Raul Narits, Aare Reenumägi, Peeter Roosma. XIII ptk. / Raul Narits, Uno Lõhmus, Madis Ernits, Jüri Põld. XIV ptk. / Vallo Olle, Arno Almann, Jüri Liventaal, Ülle Madise. XV ptk. / Eerik-Juhan Truuväli, Aaro Mõttus. Eesti Vabariigi põhiseaduse rakendamise seadus / Oliver Kask, Raul Narits, Peeter Roosma. Eesti Vabariigi põhiseaduse täiendamise seadus / Berit Aaviksoo, Julia Laffranque, Ülle Madise, Jüri Põld. Eesti Vabariigi põhiseadus 1990-2008 : bibliograafia (seisuga september 2008) / koost. Maia Ruttu

  1. Eesti Vabariigi põhiseadus : kommenteeritud väljaanne / toimetuskolleegium: Eerik-Juhan Truuväli, Berit Aaviksoo, Oliver Kask, Lasse Lehis, Lauri Madise, Ülle Madise, Kalle Merusk, Lauri Mälksoo, Raul Narits, Vallo Olle, Peep Pruks

    Index Scriptorium Estoniae

    2008-01-01

    Kommentaaride autorid ja sisu: Sissejuhatus / Raul Narits, Lauri Madise, Heinrich Schneider. Preambul / Raul Narits, Heinrich Schneider. I ptk. / Kalle Merusk, Taavi Annus, Madis Ernits, Heiki Lindpere, Lauri Madise. II ptk. / Oliver Kask, Madis Ernits, Taavi Annus, Peeter Roosma, Rait Maruste, Eerik Kergandberg, Ivo Pilving, Uno Lõhmus, Merilin Kiviorg, Einar Vene, Ülle Madise. III ptk. / Oliver Kask. IV ptk. / Lauri Madise, Aaro Mõttus, Jüri Põld, Tiina Runthal. V ptk. / Eerik-Juhan Truuväli, Ülle Madise, Jüri Põld, Urmas Reinsalu. VI ptk. / Kalle Merusk, Jüri Põld. VII ptk. / Eerik-Juhan Truuväli, Jüri Liventaal, Jüri Põld. VIII ptk. / Lasse Lehis. IX ptk. / Kristi Land, Heiki Lindpere, Lauri Madise, Heiki Pisuke. X ptk. / Oliver Kask, Enn Markvart, Jüri Põld. XI ptk. / Ülle Madise, Janek Laidvee, Heinrich Schneider. XII ptk. / Berit Aaviksoo, Mihkel Allik, Enn Markvart, Raul Narits, Aare Reenumägi, Peeter Roosma. XIII ptk. / Raul Narits, Uno Lõhmus, Madis Ernits, Jüri Põld. XIV ptk. / Vallo Olle, Arno Almann, Jüri Liventaal, Ülle Madise. XV ptk. / Eerik-Juhan Truuväli, Aaro Mõttus. Eesti Vabariigi põhiseaduse rakendamise seadus / Oliver Kask, Raul Narits, Peeter Roosma. Eesti Vabariigi põhiseaduse täiendamise seadus / Berit Aaviksoo, Julia Laffranque, Ülle Madise, Jüri Põld. Eesti Vabariigi põhiseadus 1990-2008 : bibliograafia (seisuga september 2008) / koost. Maia Ruttu

  2. Aaviksoo soovib IRL-ile leida uue peasekretäri / Mirko Ojakivi

    Index Scriptorium Estoniae

    Ojakivi, Mirko

    2010-01-01

    IRL-i poliitik, kaitseminister Jaak Aaviksoo on seisukohal, et erakonna organisatsioonilise juhtimisega peaks tegelema isik, kes pole iga päev seotud muu tööga. IRL-i peasekretär Margus Tsahkna on samas ka Riigikogu liige. IRL-i esimeheks kandideerib Mart Laar, aseesimeesteks Jaak Aaviksoo, Ene Ergma, Tõnis Lukas ja Juhan Parts

  3. Teras, mille armid ei roosteta / Ain Alvela

    Index Scriptorium Estoniae

    Alvela, Ain, 1967-

    2008-01-01

    Roostevaba terase kasutamine. Vt. samas: Roostevaba teras; Raual kolmekordne hinnavahe; Terase roostekindlust parandab legeerimine; Paide veetorud peavad kestma 25 aastat. Diagramm: Terasetootmine maailmas. Kommenteerib Taavi Pauri

  4. Taavi Rõivas alustas kampaaniat SMS-laenude vastu / Lauri Birkan

    Index Scriptorium Estoniae

    Birkan, Lauri

    2007-01-01

    Riigikogu liikme Taavi Rõivase ettepanek piirata SMS-laene või need hoopis ära kaotada tekitas laenupakkujate vastasseisu. OÜ Moneytrade juhatuse liige Andrei Kjahrenov leiab, et siis peaks ära keelama ka krediitkaardid. Rahandusministeeriumi osakonnajuhataja Lelo Liive selgitus

  5. Kui hästi või halvasti ... / Jaak Aaviksoo, Piret Hartman, Heli Aru

    Index Scriptorium Estoniae

    Aaviksoo, Jaak, 1954-

    2003-01-01

    TÜ rektor J. Aaviksoo, Üliõpilaskondade Liidu juhatuse esimees P. Hartman ja Haridus- ja Teadusministeeriumi kõrghariduse talituse juhataja H. Aru vastavad küsimusele, kui hästi või halvasti on end õigustanud kõrghariduses aasta toiminud 3+2 süsteem

  6. Ain Prosa ja Surma õpipoiss / Ain Prosa ; interv. Ene Paaver

    Index Scriptorium Estoniae

    Prosa, Ain, 1967-

    2001-01-01

    Terry Pratchetti "Mort - Surma õpipoiss" Eesti Draamateatris, lavastaja Ain Prosa. Lavastajast ja tema töödest. Arvavad ka stsenarist Mihkel Ulman, näitleja Pille Lukin ja Rakvere teatri direktor Indrek Saar

  7. "Nizkii reiting - eto problema" / Taavi Veskimägi ; interv. Tatjana Opekina

    Index Scriptorium Estoniae

    Veskimägi, Taavi, 1974-

    2006-01-01

    Res Publica liidri Taavi Veskimägi suhtumisest president Arnold Rüütli võimalikku jätkamisse, hinnangutest tuntud poliitikute lahkumisele Res Publicast, ühenduse kujunemisest parteiks, partei reitingust, valitseva koalitsiooni kriitika

  8. "Nizkii reiting - eto problema" / Taavi Veskimägi ; interv. Tatjana Opekina

    Index Scriptorium Estoniae

    Veskimägi, Taavi, 1974-

    2006-01-01

    Res Publica liidri Taavi Veskimägi suhtumisest president Arnold Rüütli võimalikku jätkamisse, hinnangutest tuntud poliitikute lahkumisele Res Publicast, ühenduse kujunemisest parteiks, partei reitingust, valitseva koalitsiooni kriitika

  9. Don Ain Kaalepile Hispaania autasu

    Index Scriptorium Estoniae

    2003-01-01

    5. okt. anti Tartu Ülikoolis Ain Kaalepile üle Hispaania Kuningriigi autasu - Katoliikliku Isabeli Ordu kommendadoori-astme medal (Encomienda de la Orden de Isabel la Cat̤lica). Vt. ka Looming, 2003, nr. 11, lk. 1750

  10. Ain Kivisaar : äärelinn pole kvaliteetne investeering / Ain Kivisaar ; interv. Enn Tosso

    Index Scriptorium Estoniae

    Kivisaar, Ain, 1978-

    2007-01-01

    Ilmunud ka: Delovõje Vedomosti : Nedvizhimost 24. okt. lk. 2-3. Küsimustele kinnisvaraturu olukorra ja investeeringute kohta vastab Metro Capital Managementi finantsjuht Ain Kivisaar. CV: Ain Kivisaar

  11. Peaminister Taavi Rõivas vastas arupärimisele merenduspoliitikast / tekst: Tauri Roosipuu

    Index Scriptorium Estoniae

    Rõivas, Taavi, 1979-

    2016-01-01

    Peaminister Taavi Rõivas vastas Riigikogus Vabaerakonna liikmete arupärimisele Eesti merenduspoliitikast. Arupärimisele järgnenud küsimuste-vastuste stenogramm lühendatult: Artur Talvik, Kersti Sarapuu, Andres Herkel, Andres Ammas, Jaak Madisson

  12. Meistri kutsumine / Taavi Talve, Indrek Köster ; intervjueerinud Elena Šmakova

    Index Scriptorium Estoniae

    Talve, Taavi

    2009-01-01

    Loomingulise ühenduse Johnson ja Johnson - Taavi Talve, Indrek Köster - näitus "Meistri kutsumine" Hobusepea Galeriis 27. aprillini. Autorid 2006. aastal alustatud Paldiski linnaruumi ja selle elanikke kaasavast projektist, mille lõppeesmärk on luua Paldiskisse Amandus Adamsoni skulptuur. Linnaelanike lemmikuks osutus teos "Laeva viimne ohe", mille savist suurenduse modelleerib Mare Mikof

  13. Meistri kutsumine / Taavi Talve, Indrek Köster ; intervjueerinud Elena Šmakova

    Index Scriptorium Estoniae

    Talve, Taavi

    2009-01-01

    Loomingulise ühenduse Johnson ja Johnson - Taavi Talve, Indrek Köster - näitus "Meistri kutsumine" Hobusepea Galeriis 27. aprillini. Autorid 2006. aastal alustatud Paldiski linnaruumi ja selle elanikke kaasavast projektist, mille lõppeesmärk on luua Paldiskisse Amandus Adamsoni skulptuur. Linnaelanike lemmikuks osutus teos "Laeva viimne ohe", mille savist suurenduse modelleerib Mare Mikof

  14. Baudelaire Eestis : märkmeid. III / Ain Kaalep

    Index Scriptorium Estoniae

    Kaalep, Ain, 1926-

    2013-01-01

    Ants Orase loodud eesti aleksandriinist. Artiklis tuuakse välja Charles Baudelaire luuletuse "Correspondances" eri tõlked (Ants Oras, Ain Kaalep) ja luuletuse "Le rêve d'un curieux" tõlked (Ilmar Laaban, Ain Kaalep)

  15. Baudelaire Eestis : märkmeid. III / Ain Kaalep

    Index Scriptorium Estoniae

    Kaalep, Ain, 1926-

    2004-01-01

    Ants Orase loodud eesti aleksandriinist. Artiklis tuuakse välja Charles Baudelaire luuletuse "Correspondances" eri tõlked (Ants Oras, Ain Kaalep) ja luuletuse "Le rêve d'un curieux" tõlked (Ilmar Laaban, Ain Kaalep)

  16. Baudelaire Eestis : märkmeid. III / Ain Kaalep

    Index Scriptorium Estoniae

    Kaalep, Ain, 1926-

    2004-01-01

    Ants Orase loodud eesti aleksandriinist. Artiklis tuuakse välja Charles Baudelaire luuletuse "Correspondances" eri tõlked (Ants Oras, Ain Kaalep) ja luuletuse "Le rêve d'un curieux" tõlked (Ilmar Laaban, Ain Kaalep)

  17. Baudelaire Eestis : märkmeid. III / Ain Kaalep

    Index Scriptorium Estoniae

    Kaalep, Ain, 1926-

    2013-01-01

    Ants Orase loodud eesti aleksandriinist. Artiklis tuuakse välja Charles Baudelaire luuletuse "Correspondances" eri tõlked (Ants Oras, Ain Kaalep) ja luuletuse "Le rêve d'un curieux" tõlked (Ilmar Laaban, Ain Kaalep)

  18. AinS quorum sensing regulates the Vibrio fischeri acetate switch.

    Science.gov (United States)

    Studer, Sarah V; Mandel, Mark J; Ruby, Edward G

    2008-09-01

    The marine bacterium Vibrio fischeri uses two acyl-homoserine lactone (acyl-HSL) quorum-sensing systems. The earlier signal, octanoyl-HSL, produced by AinS, is required for normal colonization of the squid Euprymna scolopes and, in culture, is necessary for a normal growth yield. In examining the latter requirement, we found that during growth in a glycerol/tryptone-based medium, wild-type V. fischeri cells initially excrete acetate but, in a metabolic shift termed the acetate switch, they subsequently utilize the acetate, removing it from the medium. In contrast, an ainS mutant strain grown in this medium does not remove the excreted acetate, which accumulates to lethal levels. The acetate switch is characterized by the induction of acs, the gene encoding acetyl coenzyme A (acetyl-CoA) synthetase, leading to uptake of the excreted acetate. Wild-type cells induce an acs transcriptional reporter 25-fold, coincident with the disappearance of the extracellular acetate; in contrast, the ainS mutant did not display significant induction of the acs reporter. Supplementation of the medium of an ainS mutant with octanoyl-HSL restored normal levels of acs induction and acetate uptake. Additional mutant analyses indicated that acs regulation was accomplished through the regulator LitR but was independent of the LuxIR quorum-signaling pathway. Importantly, the acs mutant of V. fischeri has a competitive defect when colonizing the squid, indicating the importance of proper control of acetate metabolism in the light of organ symbiosis. This is the first report of quorum-sensing control of the acetate switch, and it indicates a metabolic connection between acetate utilization and cell density.

  19. Kaval-Ain ja Vanapagan / Urmas Kaju

    Index Scriptorium Estoniae

    Kaju, Urmas, 1956-2014

    2005-01-01

    Ühispanga endise juhi Ain Hanschmidti juhtumi taustal leiab autor, et nüüd on tekkinud hea võimalus kohalikku ärikliimat puhastada, uurida ja avalikkuse ette tuua selle loo detailid ning anda toimunule nii õiguslik kui ka moraalne hinnang

  20. Tume aine ulatub lasteraamatuisse / Mari Niitra

    Index Scriptorium Estoniae

    Niitra, Mari, 1979-

    2007-01-01

    Lastekirjandusepäevast Tartu Linnaraamatukogus. Räägiti Philip Pullmani põnevustriloogiast "Tema tumedad ained" (Tiritamm, 2002-2005), kõrvutati J. K. Rowlingi Harry Potteri sarja Dmitri Jemetsi Tanja Grotteri lugudega, külalisesineja Peeter Sauter

  1. Mida arvate ideest, et kõrgkoole võiks juhtida ülikoolivälistest inimestest koosnev nõukogu? / Jaak Aaviksoo, Maris Mälzer, Peeter Kreitzberg, Peep Sürje

    Index Scriptorium Estoniae

    2010-01-01

    Küsimusele vastavad Tartu Ülikooli eelmine rektor Jaak Aaviksoo, Eesti Üliõpilaskondade Liidu esimees Maris Mälzer, Riigikogu kultuurikomisjoni esimees Peeter Kreitzberg ja Tallinna Tehnikaülikooli rektor Peep Sürje

  2. Mida arvate ideest, et kõrgkoole võiks juhtida ülikoolivälistest inimestest koosnev nõukogu? / Jaak Aaviksoo, Maris Mälzer, Peeter Kreitzberg, Peep Sürje

    Index Scriptorium Estoniae

    2010-01-01

    Küsimusele vastavad Tartu Ülikooli eelmine rektor Jaak Aaviksoo, Eesti Üliõpilaskondade Liidu esimees Maris Mälzer, Riigikogu kultuurikomisjoni esimees Peeter Kreitzberg ja Tallinna Tehnikaülikooli rektor Peep Sürje

  3. [Tulumaksumäära langetamise peatamisest] / Keit Pentus, Taavi Veskimägi, Marek Strandberg...[jt.

    Index Scriptorium Estoniae

    2008-01-01

    Kommentaari maksumaksjate liidu (EML) seisukohale, et tulumaksumäära langetamise külmutamine on põhiseadusega vastuolus, annavad Keit Pentus Reformierakonnast, Taavi Veskimägi Isamaa ja Res Publica Liidust, Marek Strandberg Erakonnast Eestimaa Rohelisd ning õiguskantsleri avalike suhete nõunik Jaana Padrik

  4. Reinsalu: Maripuu, pane rahakott nõueteks valmis / Mirko Ojakivi ; kommenteerinud Eiki Nestor, Rauno Veri ja Taavi Rõivas

    Index Scriptorium Estoniae

    Ojakivi, Mirko

    2009-01-01

    Riigikogu põhiseaduskomisjoni liikme Urmas Reinsalu arvates tuleks puudega inimeste toetuse viibimisest tekitatud kahjud sotsiaalministeeriumil kindlasti hüvitada. Sotsiaalministeerium kavatseb arutada puudega inimeste katusorganisatsioonidega võimalikku kahju kompenseerimist. Eiki Nestor, Rauno Veri ja Taavi Rõivas vastavad küsimusele, kas nad toetavad umbusaldusavaldust Maret Maripuule

  5. Morphology-Controlled Growth of AIN One-Dimensional Nanostructures

    Institute of Scientific and Technical Information of China (English)

    Ting XIE; Min YE; Xiaosheng FANG; Zhi JIANG; Li CHEN; Mingguang KONG; Yucheng WU; Lide ZHANG

    2008-01-01

    Aluminum nitride (AIN) nanowires, serrated nanoribbons, and nanoribbons were selectively obtained through a simple chloride assisted chemical vapor deposition process. The morphologies of the products could be controlled by adjusting the deposition position and the flux of the reactant gas. The morphologies and structures of the AIN products were investigated in detail. The formation mechanism of the as-prepared different morphologies of AIN one-dimensional (1D) nanostructures was discussed on the basis of the experimental results.

  6. Effects of AIN nucleation layer thickness on crystal quality of AIN grown by plasma-assisted molecular beam epitaxy

    Institute of Scientific and Technical Information of China (English)

    Ren Fan; Hao Zhi-Biao; Hu Jian-Nan; Zhang Chen; Luo Yi

    2010-01-01

    In this paper,the effects of thickness of AIN nucleation layer grown at high temperature on AIN epi-layer crystalline quality are investigated.Crack-free AIN samples with various nucleation thicknesses are grown on sapphire substrates by plasma-assisted molecular beam epitaxy.The AIN crystalline quality is analysed by transmission electron microscope and x-ray diffraction(XRD)rocking curves in both(002)and(102)planes.The surface profiles of nucleation layer with different thicknesses after in-situ annealing are also analysed by atomic force microscope.A critical nucleation thickness for realising high quality AIN films is found.When the nucleation thickness is above a certain value,the(102)XRD full width at half maximum(FWHM)of AIN bulk increases with nucleation thickness increasing,whereas the(002)XRD FWHM shows an opposite trend.These phenomena can be attributed to the characteristics of nucleation islands and the evolution of crystal grains during AIN main layer growth.

  7. Baudelaire Eestis : märkmeid. II / Ain Kaalep

    Index Scriptorium Estoniae

    Kaalep, Ain, 1926-

    2013-01-01

    Ants Orasest eesti luuletõlkekultuuri arendamisel. Ka Baudelaire'i luuletuse Bénédiction ("Õnnistus") kahe esimese stroofi kolm tõlget eesti keelde: Johannes Semperi, Indrek Hirve ja Ain Kaalepi versioonid

  8. Baudelaire Eestis : märkmeid. II / Ain Kaalep

    Index Scriptorium Estoniae

    Kaalep, Ain, 1926-

    2002-01-01

    Ants Orase aleksandriini tõlkepõhimõtetest. Ch. Baudelaire'i luuletuse Bénédiction ("Õnnistus") kahe esimese stroofi kolm tõlget eesti keelde - Johannes Semperi, Indrek Hirve ja Ain Kaalepi eestindused

  9. Põhikooli ainesõnastikud / Heiki Jaan Kaalep, Jaan Mikk

    Index Scriptorium Estoniae

    Kaalep, Heiki-Jaan, 1962-

    2008-01-01

    Eesti vene õppekeelega koolidele keskastme ainesõnastike loomise konkursi tulemustest, kirjeldatakse koostatud sõnastike eesmärke ja kirjestruktuuri, samuti loomisprotsessi etappe. Vaadeldakse ka morfoloogiaalase tarkvara kasutamisvõimalusi sõnastiku loomisel

  10. Põhikooli ainesõnastikud / Heiki Jaan Kaalep, Jaan Mikk

    Index Scriptorium Estoniae

    Kaalep, Heiki-Jaan, 1962-

    2008-01-01

    Eesti vene õppekeelega koolidele keskastme ainesõnastike loomise konkursi tulemustest, kirjeldatakse koostatud sõnastike eesmärke ja kirjestruktuuri, samuti loomisprotsessi etappe. Vaadeldakse ka morfoloogiaalase tarkvara kasutamisvõimalusi sõnastiku loomisel

  11. Kolmas võimalus : Veel JR 200 kirjanduselust / Ain Kaalep

    Index Scriptorium Estoniae

    Kaalep, Ain, 1926-

    1996-01-01

    Vastuseks Ott Arderi artiklile 'Laulu võimu täius ja viletsus', Looming, nr. 5, samuti Sirje Oleski artiklile 'Prooimion Ain Kaalepi elu- ja loominguloole', Looming, nr. 6. Ka Eerik Tederi uurimusest 'Suomenpojat Viron Kirjallisuudessa ja heidän teostensa vastaanotto Suomessa' (Jyväskylä, 1996)

  12. Keila Tervisekeskus. Ujula = Keila Health Club. Swimming Pool / Ain Padrik

    Index Scriptorium Estoniae

    Padrik, Ain, 1947-

    2001-01-01

    Projekteerija: Arhitektuuribüroo Künnapu & Padrik. Arhitektid Ain Padrik ja Kristi Alamaa, sisearhitekt Sirje Männik. Konstruktsioonid: Jaan Laks, A-Grupp. Ujulas on võistlus- ja lastebassein, suvel on avatud välibassein. 5 ill.: I korruse plaan, ristlõige, vaated

  13. Keila Tervisekeskus. Ujula = Keila Health Club. Swimming Pool / Ain Padrik

    Index Scriptorium Estoniae

    Padrik, Ain, 1947-

    2001-01-01

    Projekteerija: Arhitektuuribüroo Künnapu & Padrik. Arhitektid Ain Padrik ja Kristi Alamaa, sisearhitekt Sirje Männik. Konstruktsioonid: Jaan Laks, A-Grupp. Ujulas on võistlus- ja lastebassein, suvel on avatud välibassein. 5 ill.: I korruse plaan, ristlõige, vaated

  14. Krundi müük võiks EKA ehitusest viiendiku säästa / Ann-Marii Nergi ; kommenteerinud Jaak Aaviksoo

    Index Scriptorium Estoniae

    Nergi, Ann-Marii

    2011-01-01

    Eesti Kunstiakadeemia peab õigeks ehitada uus õppehoone ajaloolisele asukohale. Hoone ehituse ettevalmistamiseks on kulunud ligi viis miljonit eurot. EKA uue hoone mujale ehitamise osas avaldavad arvamust Metro Capital Management Eesti juht Ain Kivisaar ja riigihangete keskuse juhatuse liige Margus Lantin

  15. Turism on/ei ole eksport?! / Ain Hinsberg

    Index Scriptorium Estoniae

    Hinsberg, Ain

    2008-01-01

    Autor tõdeb, et riik ei soovi tunnistada turismi kui eksportiva sektori olulisust Eesti majanduses. Turismisektori konkurentsivõimele mõjuks pärssivalt majutusteenuste käibemaksu määra tõstmine, mida märkis oma kirjas Riigikogule ja valitsusele ka Eesti Hotellide ja Restoranide Liit. Vt. ka: Ain Hinsberg. Tunnustuseta kuuendik Eesti majandusest riigiga ümarlaua taga. Ärielu (2000) juuli, nr. 7-8, lk. 77-79

  16. The statues of 'Ain Ghazal: discovery, recovery and reconstruction

    Directory of Open Access Journals (Sweden)

    Kathryn W. Tubb

    2001-10-01

    Full Text Available The early Neolithic site of 'Ain Ghazal in Jordan is famous for the discovery there of a cache of 28 lime-plaster statues that are among the earliest known large-scale human figures, dated to approximately 8700 years ago. The member of the Institute's staff who is responsible for the conservation of the statues describes how she set about recovering, investigating and reconstructing them.

  17. Turism on/ei ole eksport?! / Ain Hinsberg

    Index Scriptorium Estoniae

    Hinsberg, Ain

    2008-01-01

    Autor tõdeb, et riik ei soovi tunnistada turismi kui eksportiva sektori olulisust Eesti majanduses. Turismisektori konkurentsivõimele mõjuks pärssivalt majutusteenuste käibemaksu määra tõstmine, mida märkis oma kirjas Riigikogule ja valitsusele ka Eesti Hotellide ja Restoranide Liit. Vt. ka: Ain Hinsberg. Tunnustuseta kuuendik Eesti majandusest riigiga ümarlaua taga. Ärielu (2000) juuli, nr. 7-8, lk. 77-79

  18. Secukinumab (AIN-457) for the treatment of Psoriasis.

    Science.gov (United States)

    Jaleel, Tarannum; Elmets, Craig; Weinkle, Allison; Kassira, Sama; Elewski, Boni

    2016-01-01

    Secukinumab (also known as AIN-457) is a human monoclonal antibody targeting IL-17A, which has been recently FDA-approved for the treatment of moderate to severe psoriasis and psoriatic arthritis with coexistent moderate to severe plaque psoriasis based on clinical trials demonstrating excellent efficacy. This review will address the rationale for targeting the IL-23/Th17/IL-17 axis, the role of IL-17 and Th17 cells in psoriasis and other chronic inflammatory diseases, and will examine pre-clinical studies, pharmacologic properties, clinical efficacy, and the safety profile of secukinumab.

  19. Puente sobre el río Ain

    Directory of Open Access Journals (Sweden)

    Editorial, Equipo

    1963-02-01

    Full Text Available Owing to the construction of the new dam on the river Ain. the water of the river level has risen considerably above the earlier level of flow at the suspension bridge in the neighbourhood of Serrieres sur Ain. Hence it became necessary to substitute this structure by a more modern one, suitable to present day traffic demands. This paper summarises the main features of this new bridge. The new bridge spans the river by means of a reinforced concrete arch of 120 m span. The arch is circular, and the deck rests on a palissade supported by the arch. The maximum rise is 30 ms at the crown. The deck carries a roadway 7 ms wide and two sidewalks of 1 m width each, for pedestrians. The deck is supported by by four longitudinal beams, and the arch has a box section and 4 longitudinal stiffners. In the crown zone the stiffners, the deck and the cylindrical surfaces become integrated and enclose three hollow chambers. This structure has great stiffness. The depth of the arch is constant, except at the crown, and is 2.40 ms. This depth gives the arch a pleasing and slender aspect. The palissade consist of four rows of columns, of 0.80x0.20 ms section, at intervals of 12.50 ms. The radius of the arch is 78.80 ms, and its transversal box section has a total width of 8.60 ms. The thickness of the inner cylindrical surface is 0.20 ms. The springers consist of two large reinforced concrete blocks, of approximately 10 ms length and 4.70 ms height. The construction of the bridge was done with the aid of a Blondin cable, of 5 tns capacity, spanning 290 ms. The main constructional aid was a. wooden scaffolding, cantilevered from the sides, consisting of 10 trusses. The timber elements were nailed and bolted together. The top part of the framework supports a formwork, made with a double layer of boards, 27 mm in thickness, crossing each other at 45°. The scaffolding was erected in successive phases and a number of guy cables were employed to stabilise the structure

  20. Reações de hipersensibilidade a aines

    OpenAIRE

    Yifan, Li

    2016-01-01

    Trabalho final do 6º ano médico com vista à atribuição do grau de mestre (área científica de imunologia clínica) no âmbito do ciclo de estudos de Mestrado Integrado em Medicina. Atualmente os anti-inflamatórios não-esteroides (AINEs) constituem um grupo fármacos com características analgésicas, antipiréticas, anti-inflamatórias e ações inibidoras das plaquetas, que são utilizados no tratamento da dor, inflamação, febre, entre outros. Segundo a Organização Mundial de Saúde (OMS) as reaç...

  1. Air quality in Ain Shams University Surgery Hospital.

    Science.gov (United States)

    El Awady, M Y; El Rahman, A T Abd; Al Bagoury, L S; Mossad, I M

    2014-12-01

    Through air sampling, it was possible to evaluate microbial contamination in environments at high risk of infection, and to check the efficiency of ventilation system and the medical team's hygiene procedures. This study measured the concentration of particulate matter (PM) 2.5 or less microns and microbiological organisms in operating rooms (OR), intensive care units (ICU) and emergency rooms (ER) in Ain Shams University Surgery Hospital, and to assess ventilation characteristics in operating rooms in the hospital. The passive air sampling was done from ICUs, ORs, and ERs in Ain Shams University Surgery Hospital. Also for each operating room, an observational checklist was done to record other factors that may affect air quality in the room. The evaluated air quality indices were: suspended (PM) 2.5 micrometer or less, culture media and microbial identification of bacteria and fungi, and temperature and relative humidity. The results showed that the highest mean found for bacterial (105.70±30.49) and fungi concentration (7.50±5.30) was in ER. The three settings did not differ statistically as regard levels of PM 2.5, temperature, and relative humidity. A positive correlation exits between bacteria and fungi concentration on one hand and relative humidity on the other. Diphteroid, CONS, MRSA, S. aureus, and Anthracoid were the most frequent isolated bacterial types, while Penicillium and Asperigillus fumigatus were the most frequent isolated fungi. In operating rooms, the percent of unmasked persons present and the temperature positively influence the bacterial count, while ventilation condition is negatively influencing fungi count, and the number of persons present in the operating room positively affects the PM level.

  2. 17 September 2013 - Estonian Minister of Education and Research J. Aaviksoo signing the guest book with CERN Director-General R- Heuer; visiting the TOTEM facility with TOTEM Collaboration Spokesperson S. Giani; in the LHC tunnel at Point 5 with International Relations Adviser T. Kurtyka and visiting the CMS cavern with CMS Collaboration Spokesperson J. Incandela. International Relations Adviser R. Voss present.

    CERN Multimedia

    Anna Pantelia

    2013-01-01

    17 September 2013 - Estonian Minister of Education and Research J. Aaviksoo signing the guest book with CERN Director-General R- Heuer; visiting the TOTEM facility with TOTEM Collaboration Spokesperson S. Giani; in the LHC tunnel at Point 5 with International Relations Adviser T. Kurtyka and visiting the CMS cavern with CMS Collaboration Spokesperson J. Incandela. International Relations Adviser R. Voss present.

  3. Ettevõtjad taunivad ühispankur Ain Hanschmidti tehinguid / Hindrek Riikoja

    Index Scriptorium Estoniae

    Riikoja, Hindrek

    2005-01-01

    Ettevõtjad on seisukohal, et juhul kui Ain Hanschmidt oli 1990-ndatel aastatel varjatult Tallinki suuromanik, käitus ta pangajuhina ebaeetiliselt andes laevafirmale soodsaid laene ning tegemist oli huvide konfliktiga. Vt. samas: Pankuri minek laevafirmasse vallandas skandaali

  4. Üks väike kirjavahetus / H. G.; Ain Kaalep

    Index Scriptorium Estoniae

    G., H.

    2001-01-01

    Kirjavahetus H. G. ja Ain Kaalepi vahel ajendatuna Vello Helki (Kas Eesti Vabariik on 83-aastane - Akadeemia 2/2001) ja Jaan Isotamme (Kommentaar V. Šironini artiklile "Eesti KGB likvideerimine" - Akadeemia 3/2001) artiklitest

  5. Aineüleste pädevuste koolitus Pestalozzi programmi raames / Tiia Pukk, Tiiu Vaher

    Index Scriptorium Estoniae

    Pukk, Tiia

    2011-01-01

    1969 alguse saanud Pestalozzi koolitusprogramm on suunatud Euroopa kultuurikonventsiooniga ühinenud 49 riigi haridustöötajatele. Seekordne üritus toimus Tartus, koolituse teemaks aineülesed pädevused

  6. Tumedad ained kirjanduses ja päriselt / Mare Müürsepp

    Index Scriptorium Estoniae

    Müürsepp, Mare

    2007-01-01

    Analüüsitud on Philip Pullmani triloogiasse "Tema tumedad ained" kuuluvaid romaane : Pullman, Philip. Kuldne kompass. Tallinn : Tiritamm, 2002; Pullman, Philip. Inglite torn. Tallinn : Tiritamm, 2004; Pullman, Philip. Vaigust kiiker. Tallinn : Tiritamm, 2005

  7. Aineüleste pädevuste koolitus Pestalozzi programmi raames / Tiia Pukk, Tiiu Vaher

    Index Scriptorium Estoniae

    Pukk, Tiia

    2011-01-01

    1969 alguse saanud Pestalozzi koolitusprogramm on suunatud Euroopa kultuurikonventsiooniga ühinenud 49 riigi haridustöötajatele. Seekordne üritus toimus Tartus, koolituse teemaks aineülesed pädevused

  8. Ain Hanschmidt jättis küsijad vastuseta / Andrus Karnau

    Index Scriptorium Estoniae

    Karnau, Andrus

    2005-01-01

    Ühispanga endise juhi Ain Hanschmidti 26. septembri pöördumine ei andnud vastuseid tema äritehingutega seoses esile kerkinud olulistele küsimustele: mille eest ta sai osalused laevakompaniis Tallink Grupp ja Haapsalu HRM-is. Lisa: Ain Hanschmidti argumendid. Küsimusele, kas Hanschmidti seletused olid piisavad vastavad Eesti Investorite Liidu juhatuse liige Heldur Meerits ja Sillamäe Soojuselektrijaama juhataja Väino Sarnet

  9. Ain Hanschmidt jättis küsijad vastuseta / Andrus Karnau

    Index Scriptorium Estoniae

    Karnau, Andrus

    2005-01-01

    Ühispanga endise juhi Ain Hanschmidti 26. septembri pöördumine ei andnud vastuseid tema äritehingutega seoses esile kerkinud olulistele küsimustele: mille eest ta sai osalused laevakompaniis Tallink Grupp ja Haapsalu HRM-is. Lisa: Ain Hanschmidti argumendid. Küsimusele, kas Hanschmidti seletused olid piisavad vastavad Eesti Investorite Liidu juhatuse liige Heldur Meerits ja Sillamäe Soojuselektrijaama juhataja Väino Sarnet

  10. Ruumiinstallatsioon "Epitsenter" / Taavi Suisalu

    Index Scriptorium Estoniae

    Suisalu, Taavi

    2011-01-01

    Lõputöö eesmärgiks oli tekitada ruum, milles oleks võimalik nihestada oma igapäevast ajataju ja tajuda olemise keset. Süstematiseeritakse teadmisi, kuidas ajast on mõeldud ning kuidas suudame seda tajuda. Ka ajakäsitustest eesti ja ameerika installatsioonikunstis. Praktiliseks osaks on ruumiinstallatsioon, mille eesmärgiks on narratiivse ja sensoorse tunnetuse/ajakäsitluse vastanduse läbi tekitada olukord, kus oleks võimalik võimendatult tajuda oleviku mitmetahulisust, aimata/kogeda millegi üldisema kohalolu

  11. An integrated water resources management strategy for Al-Ain City, United Arab Emirates

    Science.gov (United States)

    Mohamed, M. M.

    2014-09-01

    Al-Ain is the second largest city in the Emirate of Abu Dhabi and the third in the UAE. Currently, desalination plants are the only source of drinking water in the city with an average daily supply of 170 MIG. Recently, Abu Dhabi Urban Planning Council (UPC) released Al-Ain 2030 Plan. Projects suggested in this plan, over and above the expected natural population growth, will certainly put additional stress on the water resources in the city. Therefore, Al-Ain city seems to be in urgent need for an integrated water resources management strategy towards achieving sustainable development. This strategy will contain three main components; namely, a Water Demand Forecasting Model (WDFM), a Water Budget Model (WBM), and a Water Resources Optimization Model (WROM). The main aim of this paper is to present the WBM that estimates all inflows and outflows to assess water resources sustainability in the city.

  12. Aine y riesgo cardiovascular: los menos posibles, a la menor dosis posible y durante el menor tiempo posible

    Directory of Open Access Journals (Sweden)

    Ferrán Catalá-López

    2014-09-01

    Conclusiones: Existe poca evidencia para sugerir que alguno de los AINE estudiados es seguro en términos de riesgo cardiovascular. Naproxeno parece ser menos perjudicial que el resto. El riesgo cardiovascular asociado al uso de AINE debe ser tenido en cuenta en la prescripción de cualquiera de estos medicamentos.

  13. Kurja lilled / Charles Baudelaire ; prantsuse k. tlk. Ain Kaalep ja Märt Väljataga

    Index Scriptorium Estoniae

    Baudelaire, Charles

    2000-01-01

    Sisu: Õnnistamine ; "Jumaldan Sind ma siin, öist taevavõlvi nägev / tlk. Ain Kaalep ; Palkon / tlk. Märt Väljataga ; Kodukäija ; Kassid / tlk. A. Kaalep ; Armastades valet / tlk. M. Väljataga ; Üksildase vein ; Päeva lõpp / tlk. Ain Kaalep. Orig.: Bénédiction ; "Je t'adore ̉ l'égal de la vo͠te nocturne ; Le balcon ; Les chats ; L'amour du mensonge ; Le vin du solitaire ; La fin de la journée

  14. Kurja lilled / Charles Baudelaire ; prantsuse k. tlk. Ain Kaalep ja Märt Väljataga

    Index Scriptorium Estoniae

    Baudelaire, Charles

    2000-01-01

    Sisu: Õnnistamine ; "Jumaldan Sind ma siin, öist taevavõlvi nägev / tlk. Ain Kaalep ; Palkon / tlk. Märt Väljataga ; Kodukäija ; Kassid / tlk. A. Kaalep ; Armastades valet / tlk. M. Väljataga ; Üksildase vein ; Päeva lõpp / tlk. Ain Kaalep. Orig.: Bénédiction ; "Je t'adore ̉ l'égal de la vo͠te nocturne ; Le balcon ; Les chats ; L'amour du mensonge ; Le vin du solitaire ; La fin de la journée

  15. GarcÍa Lorca luulest ja Ain Kaalepi tõlkest / Jüri Talvet

    Index Scriptorium Estoniae

    Talvet, Jüri, 1945-

    1998-01-01

    Arvustus: GarcÍa Lorca, Federico. Mu kätes põleb tuli : valitud luuletused / tlk. ja saateks: Ain Kaalep. 2. tr. Tallinn : Vagabund, 1997. Ilmunud ka kogumikus: Talvet, Jüri. Tõrjumatu äär. Tartu : Ilmamaa, 2005, lk. 442-453

  16. Performance Variables: Some Versions of Dylan's "It Ain't Me, Babe."

    Science.gov (United States)

    Poague, Leland A.

    1979-01-01

    Using Bob Dylan's three somewhat different versions of "It Ain't Me, Babe," the author investigates the variables of Dylan's performances and how they alter the meanings of his songs, and suggests that the more we know about popular song the more we will understand the songs we subsequently encounter. (KC)

  17. Poolsajandi õnnesoovid Jaak Aaviksoole / Ain Heinaru, Jaak Kangilaski, Tõnu Lehtsaar...[jt.

    Index Scriptorium Estoniae

    2004-01-01

    Mõtteid Tartu Ülikooli rektorist tema 50. sünnipäeva puhul : Ain Heinaru, Jaak Kangilaski, Tõnu Lehtsaar, Indrek Reimand, Toomas Kiho, Leelo Kriisa, Peeter Olesk, Risto Tammelo, Birute Klaas, Peeter Saari, Andrus Ansip, Mait Klaassen, Marika Kullamaa, Kaupo Bend

  18. Eesti Panga president eitas kahtlast koostööd Ain Hanschmidtiga / Toivo Tänavsuu

    Index Scriptorium Estoniae

    Tänavsuu, Toivo

    2005-01-01

    Eesti Panga president Andres Lipstok teatas, et sai Ain Hanschmidti osalusest Haapsalu HMR-is teada augusti keskel, kui käisid vastavasisulised läbirääkimised. Ühtlasi kinnitas Lipstok, et ei kavatse Eesti Panga presidendi kohalt tagasi astuda

  19. ISO sertifikaat kuulutab tootja mainet üle maailma / Ain Alvela

    Index Scriptorium Estoniae

    Alvela, Ain, 1967-

    2006-01-01

    Ilmunud ka: Delovõje Vedomosti 12. apr. lk. 24-25. ISO standardi rakendamine tagab toodangu kvaliteedi ja annab firmale usaldusväärsuse. Kommenteerib Ain Noormägi. Vt. samas: ISO 9001; ISO 14 001; Universaalne standard kohandub ettevõtte vajadustega

  20. GarcÍa Lorca luulest ja Ain Kaalepi tõlkest / Jüri Talvet

    Index Scriptorium Estoniae

    Talvet, Jüri, 1945-

    1998-01-01

    Arvustus: GarcÍa Lorca, Federico. Mu kätes põleb tuli : valitud luuletused / tlk. ja saateks: Ain Kaalep. 2. tr. Tallinn : Vagabund, 1997. Ilmunud ka kogumikus: Talvet, Jüri. Tõrjumatu äär. Tartu : Ilmamaa, 2005, lk. 442-453

  1. ISO sertifikaat kuulutab tootja mainet üle maailma / Ain Alvela

    Index Scriptorium Estoniae

    Alvela, Ain, 1967-

    2006-01-01

    Ilmunud ka: Delovõje Vedomosti 12. apr. lk. 24-25. ISO standardi rakendamine tagab toodangu kvaliteedi ja annab firmale usaldusväärsuse. Kommenteerib Ain Noormägi. Vt. samas: ISO 9001; ISO 14 001; Universaalne standard kohandub ettevõtte vajadustega

  2. The Scientific Method Ain't What It Used to Be

    Science.gov (United States)

    Herreid, Clyde Freeman

    2010-01-01

    Remember the time when all you had to do was memorize these five steps: ask a question, formulate a hypothesis, perform experiment, collect data, and draw conclusions? And you received full credit for defining the scientific method. Well, those days are gone. This article discusses why the "scientific method ain't what it used to be." (Contains 2…

  3. The Vibrio fischeri quorum-sensing systems ain and lux sequentially induce luminescence gene expression and are important for persistence in the squid host.

    Science.gov (United States)

    Lupp, Claudia; Urbanowski, Mark; Greenberg, E Peter; Ruby, Edward G

    2003-10-01

    Bacterial quorum sensing using acyl-homoserine lactones (acyl-HSLs) as cell-density dependent signalling molecules is important for the transcriptional regulation of many genes essential in the establishment and the maintenance of bacteria-host associations. Vibrio fischeri, the symbiotic partner of the Hawaiian bobtail squid Euprymna scolopes, possesses two distinct acyl-HSL synthase proteins, LuxI and AinS. Whereas the cell density-dependent regulation of luminescence by the LuxI-produced signal is a well-described phenomenon, and its role in light organ symbiosis has been defined, little is known about the ain system. We have investigated the impact of the V. fischeri acyl-HSL synthase AinS on both luminescence and symbiotic colonization. Through phenotypic studies of V. fischeri mutants we have found that the AinS-signal is the predominant inducer of luminescence expression in culture, whereas the impact of the LuxI-signal is apparent only at the high cell densities occurring in symbiosis. Furthermore, our studies revealed that ainS regulates activities essential for successful colonization of E. scolopes, i.e. the V. fischeri ainS mutant failed to persist in the squid light organ. Mutational inactivation of the transcriptional regulator protein LuxO in the ainS mutant partially or completely reversed all the observed phenotypes, demonstrating that the AinS-signal regulates expression of downstream genes through the inactivation of LuxO. Taken together, our results suggest that the two quorum-sensing systems in V. fischeri, ain and lux, sequentially induce the expression of luminescence genes and possibly other colonization factors.

  4. Rector's office as of 31 December 2005

    Index Scriptorium Estoniae

    2006-01-01

    TÜ rektoraadi koosseis: rektor prof. Jaak Aaviksoo, teadusprorektor prof. Ain Heinaru, õppeprorektor prof. Tõnu Lehtsaar, prorektor prof. Jaak Kangilaski; administratsioonidirektor Mihkel Pärnoja, finantsdirektor Taimo Saan, haldusdirektor Riho Illak, akadeemiline sekretär Ivar-Igor Saarniit

  5. Rector's office as of 31 December 2006

    Index Scriptorium Estoniae

    2007-01-01

    Rektor prof. Jaak Aaviksoo, teadusprorektor prof. Ain Heinaru, õppeprorektor prof. Birute Klaas, administratsioonidirektor prof. Mihkel Pärnoja, finantsdirektor Taimo saan, haldusdirektor Riho Illak, akadeemiline sekretär Ivar-Igor Saarniit

  6. Rektoraat seisuga 31.12. 2005

    Index Scriptorium Estoniae

    2006-01-01

    TÜ rektoraadi koosseis: rektor prof. Jaak Aaviksoo, teadusprorektor prof. Ain Heinaru, õppeprorektor prof. Tõnu Lehtsaar, prorektor prof. Jaak Kangilaski; administratsioonidirektor Mihkel Pärnoja, finantsdirektor Taimo Saan, haldusdirektor Riho Illak, akadeemiline sekretär Ivar-Igor Saarniit

  7. Rector's office as of 31 December 2006

    Index Scriptorium Estoniae

    2007-01-01

    Rektor prof. Jaak Aaviksoo, teadusprorektor prof. Ain Heinaru, õppeprorektor prof. Birute Klaas, administratsioonidirektor prof. Mihkel Pärnoja, finantsdirektor Taimo saan, haldusdirektor Riho Illak, akadeemiline sekretär Ivar-Igor Saarniit

  8. Rektoraat seisuga 31.12.2006

    Index Scriptorium Estoniae

    2007-01-01

    Rektor prof. Jaak Aaviksoo, teadusprorektor prof. Ain Heinaru, õppeprorektor prof. Birute Klaas, administratsioonidirektor prof. Mihkel Pärnoja, finantsdirektor Taimo saan, haldusdirektor Riho Illak, akadeemiline sekretär Ivar-Igor Saarniit

  9. Rector's office as of 31 December 2005

    Index Scriptorium Estoniae

    2006-01-01

    TÜ rektoraadi koosseis: rektor prof. Jaak Aaviksoo, teadusprorektor prof. Ain Heinaru, õppeprorektor prof. Tõnu Lehtsaar, prorektor prof. Jaak Kangilaski; administratsioonidirektor Mihkel Pärnoja, finantsdirektor Taimo Saan, haldusdirektor Riho Illak, akadeemiline sekretär Ivar-Igor Saarniit

  10. Rektoraat seisuga 31.12. 2005

    Index Scriptorium Estoniae

    2006-01-01

    TÜ rektoraadi koosseis: rektor prof. Jaak Aaviksoo, teadusprorektor prof. Ain Heinaru, õppeprorektor prof. Tõnu Lehtsaar, prorektor prof. Jaak Kangilaski; administratsioonidirektor Mihkel Pärnoja, finantsdirektor Taimo Saan, haldusdirektor Riho Illak, akadeemiline sekretär Ivar-Igor Saarniit

  11. Rektoraat seisuga 31.12.2006

    Index Scriptorium Estoniae

    2007-01-01

    Rektor prof. Jaak Aaviksoo, teadusprorektor prof. Ain Heinaru, õppeprorektor prof. Birute Klaas, administratsioonidirektor prof. Mihkel Pärnoja, finantsdirektor Taimo saan, haldusdirektor Riho Illak, akadeemiline sekretär Ivar-Igor Saarniit

  12. Pamidronato endovenoso en espondilitis anquilosante refractaria a antiinflamatorios no esteroideos (AINES) y sulfasalazina

    OpenAIRE

    García-Poma, Augusto; Universidad Nacional Mayor de San Marcos. Lima, Perú; Departamento de Enfermedades Sistémicas. Hospital Nacional Edgardo Rebagliati Martins, EsSalud. Lima, Perú; Montero-Jauregui, Manuel; Departamento de Enfermedades Sistémicas. Hospital Nacional Edgardo Rebagliati Martins, EsSalud. Lima, Perú; Terrazas, Henry; Universidad Nacional Mayor de San Marcos. Lima, Perú; Departamento de Enfermedades Sistémicas. Hospital Nacional Edgardo Rebagliati Martins, EsSalud. Lima, Perú; Miraval, Tatiana; Departamento de Enfermedades Sistémicas. Hospital Nacional Edgardo Rebagliati Martins, EsSalud. Lima, Perú; Becerra, Felipe; Universidad Nacional Mayor de San Marcos. Lima, Perú; Departamento de Enfermedades Sistémicas. Hospital Nacional Edgardo Rebagliati Martins, EsSalud. Lima, Perú; Segami, María I; Universidad Nacional Mayor de San Marcos. Lima, Perú; Departamento de Enfermedades Sistémicas. Hospital Nacional Edgardo Rebagliati Martins, EsSalud. Lima, Perú

    2013-01-01

    Objetivo: Evaluar la terapia con pamidronato, en pacientes con espondilitis anquilosante (EA) activa, con respuesta subóptima o falla a los antiinflamatorios no-esteroideos (AINES) y sulfasalazina. Diseño: Estudio clínico comparativo. Lugar: Hospital Nacional Edgardo Rebagliati Martins, EsSalud, Lima, Perú. Participantes: Pacientes con espondilitis anquilosante. Intervenciones. Se incluyó 9 pacientes con EA (6 varones), con enfermedad activa (BASDAI ≥4), actividad axial y falta de respuesta a...

  13. COxSwAIN: Compressive Sensing for Advanced Imaging and Navigation

    Science.gov (United States)

    Kurwitz, Richard; Pulley, Marina; LaFerney, Nathan; Munoz, Carlos

    2015-01-01

    The COxSwAIN project focuses on building an image and video compression scheme that can be implemented in a small or low-power satellite. To do this, we used Compressive Sensing, where the compression is performed by matrix multiplications on the satellite and reconstructed on the ground. Our paper explains our methodology and demonstrates the results of the scheme, being able to achieve high quality image compression that is robust to noise and corruption.

  14. Pamidronato endovenoso en espondilitis anquilosante refractaria a antiinflamatorios no esteroideos (AINES y sulfasalazina

    Directory of Open Access Journals (Sweden)

    Augusto García-Poma

    2007-03-01

    Full Text Available Objetivo: Evaluar la terapia con pamidronato, en pacientes con espondilitis anquilosante (EA activa, con respuesta subóptima o falla a los antiinflamatorios no-esteroideos (AINES y sulfasalazina. Diseño: Estudio clínico comparativo. Lugar: Hospital Nacional Edgardo Rebagliati Martins, EsSalud, Lima, Perú. Participantes: Pacientes con espondilitis anquilosante. Intervenciones. Se incluyó 9 pacientes con EA (6 varones, con enfermedad activa (BASDAI > o = 4, actividad axial y falta de respuesta a los Aines y sulfasalazina a dosis de 3g/d. Todos los pacientes recibieron 60 mg de pamidronato mensual, en infusión endovenosa, durante 6 meses, y continuaron tomando AINES y sulfasalazina. La mejoría clínica fue evaluada usando el ASAS 20. En forma secundaria se evaluó el ASAS 40, BASDAI 50, BASDAI, BASFI Y BASMI, a las 24 y 48 semanas (32 a 86 semanas. La diferencia entre el índice de pre y postratamiento fue evaluada usando la prueba de Wilcoxon. Principales medidas de resultados: Evaluación del ASAS 20. Resultados: El 67% alcanzó un Asas 20 a las 24 semanas y 78% a las 48 semanas; 33,3% y 55,6% tuvieron ASAS 40 y 33,3%; y 44,4% alcanzó BASDAI 50 a las 24 y 48 semanas, respectivamente. Un paciente recayó a la semana 20. Tres pacientes (33,3% permanecieron sin cambios. A las 24 y 48 semanas, la media de BASDAI disminuyó en 45,1% (p=0,007 y en 52,1% (p=0,01, la media de BASFI en 38,2% (p=0,007 y en 52,3% (p=0,007, y la media de BASMI en 39,2% (p=0,01 y 39,2% (p=0,01, respectivamente. Los eventos adversos no fueron importantes con esta terapia. Conclusiones: El tratamiento con pamidronato demostró ser efectivo en este grupo de pacientes con EA, refractaria a AINES y a sulfasalazina.

  15. Antiinflamatorios no esteroideos (AINES).: Consideraciones para su uso estomatológico

    OpenAIRE

    Andrés A. Pérez Ruiz; Ana Marta López Mantecón; Ileana Grau León

    2002-01-01

    Se realiza una revisión extensa y actualizada sobre los antiinflamatorios no esteroideos (AINEs), con el fin de actualizar al estomatólogo en su uso. Para ello se revisan aspectos importantes del proceso inflamatorio en estructuras de la boca que como las pulpitis, presentan sus peculiaridades. Se identifica a una de las 2 familias de autacoides provenientes de los fosfolípidos de membrana celular, es decir, los eicosanoides derivados a partir de algunos ácidos grasos polisaturados, en partic...

  16. Monsieur Philippe Galli Préfet de l’Ain France

    CERN Multimedia

    Maximilien Brice

    2011-01-01

    Photo 35: Le chef du département Physique P. Bloch, le porte-parole de la Collaboration CMS G. Tonelli,le Sous-Préfet de Gex O. Laurens-Bernard, le chef du département Technologie F. Bordry, le Péfet de l'Ain P. Galli et le Directeur-général R. Heuer. Photo 62: signature du livre d'or avec le Directeur de la recherche et de l'informatique S. Bertolucci.

  17. Utilización de antiinflamatorios no esteroideos (AINEs) a nivel hospitalario

    OpenAIRE

    Rodríguez Rivas, Migdalia; López Guerra, Regla Lisbel; Ventura Padrón, María Caridad; Casas Blanco, José Carlos; Rodríguez Rivas, Rafael; Martínez Chávez, Yaquelín

    2001-01-01

    Los antiinflamatorios no esteroideos (AINEs) se encuentran, dentro del gran universo de medicamentos actuales, entre los fármacos más empleados. Se realizó un estudio de utilización de medicamentos en 4 hospitales de la provincia Villa Clara: Hospital Universitario "Celestino Hernández Robau", Hospital Universitario "Arnaldo Milián Castro", Hospital Infantil "José Luis Miranda" y Hospital Psiquiátrico Provincial. Fueron revisadas las Historias Clínicas de los pacientes ingresados durante el a...

  18. Gastropatía por Aines. Factores de Riesgo y Hallazgos Endoscópico. Banes 2008.

    OpenAIRE

    Jorge Luís Pérez Jará; Raymond Cruz Tillán; Lisandra Naranjo García

    2009-01-01

    Se realizó un estudio descriptivo de corte transversal y retrospectivo, con el fin de describir el comportamiento de la Gastropatía aguda por AINES teniendo en cuenta factores de riesgo y hallazgos endoscópicos, en el Hospital Clínico Quirúrgico y Policlínica César Fornet Fruto, de Banes, en el año 2008. El universo quedó constituido por 65 personas, los datos se plasmaron en un formulario confeccionado para este fin. La tasa de prevalencia de Gastropatía por Aines fue de 18.51 por cada cien ...

  19. Analysis of Urban Expansion of the Resort City of Al Ain Using Remote Sensing and GIS

    Science.gov (United States)

    Issa, S.; Al Shuwaihi, A.

    2009-12-01

    The urban growth of AL Ain city has been investigated using remote sensing data for three different dates, 1972, 1990 and 2000. We used three Landsat images together with socio-economic data in a post-classification analysis to map the spatial dynamics of land use/cover changes and identify the urbanization process in Al Ain resort city, United Arab Emirates. Land use/cover statistics, extracted from Landsat Multi-spectral Scanner (MSS). Thematic Mapper (TM) and Enhanced Thematic Mapper plus (ETM +) images for 1972. 1990 and 2000 respectively, revealed that the built-up area has expanded by about 170.53km2. The city was found to have a tendency for major expansion in four different directions: along the Abu Dhabi highway, along Dubai highway, Myziad direction and Hafeet recreational area. Expansion in any direction was found to be governed by the availability of road network, suitability for construction, utilities, economic activities, geographical constraints, and legal factors (boundary with Sultanate of Oman). The road network in particular has influenced the spatial patterns and structure of urban development, so that the expansion of the built-up areas has assumed an accretive as well as linear growth along the major roads. The research concludes that the development is based on conservation of agricultural areas (oases) and reclamation of the desert for farming and agricultural activities. The integration of remote sensing and GIS was found to be effective in monitoring LULC changes and providing valuable information necessary for planning and research.

  20. Determinants of Diabetes and Hypertension Control in Ambulatory Healthcare in Al Ain, United Arab Emirates

    Directory of Open Access Journals (Sweden)

    Latifa M. Baynouna

    2014-05-01

    Full Text Available bjectives: This study aims to study determinants for the control of diabetes and hypertension in Al Ain Ambulatory Healthcare patients. Method: This is a cross sectional observational study of patients attending ambulatory healthcare centers in Al Ain, United Arab Emirates in 2009. From a yearly audit evaluating the care of patients with diabetes and hypertension, the determinants for improved diabetes and hypertension outcomes were identified from a total of 512 patients and its association with glycemic and blood pressure control were studied. Results: From all variables studied, only the clinic where the patient was treated helped predict both improved blood sugar and blood pressure control. For patients with diabetes, poor control the year before (p<0.001, the number of chronic disease clinic visits (p=0.042 and triglyceride levels (p=0.007 predicted worse control of diabetes. A predictor of poor control of blood pressure (p<0.001 for patients with hypertension was poor control of blood pressure in the year before. Conclusion: In this population, the healthcare system and the team played major roles as determinants in the control of patient’s diabetes and blood pressure more than any of the other factors examined.

  1. Teaduskeskus Ahhaa = Ahhaa Science Centre / Vilen Künnapu, Ain Padrik, Malle Jürgenson, Tea Tammelaan ; intervjueerinud Margit Mutso

    Index Scriptorium Estoniae

    2012-01-01

    Tartus Sadama 1 auva Ahhaa teaduskeskuse arhitektuurist ja sisearhitektuurist. Arhitektid: Ain Padrik ja Vilen Künnapu, kaasa töötasid Kristjan Tõlk, Kristiin Keernik, Siim Tuksam, Hannes Tilk (Künnapu & Padrik). Sisearhitektid: Tea Tammelaan, Krista Lepland ja Malle Jürgenson (Laika, Belka & Strelka). Infograafika: Alar Pikkorainen

  2. Tallinna Sadama konverents "1965-2015: Soome sild & valge laev kui tunnel läbi raudse eesriide" / Ain Hinsberg

    Index Scriptorium Estoniae

    Hinsberg, Ain

    2015-01-01

    1965. aastal Tallinna ja Helsingi vahelise reisilaeva liikluse taasavamisele pühendatud ja kahe linna koostöö- ja majandussuhteid käsitlenud konverentsist, kus ettekannetega esinesid Tiit Kask, Pekka Linnainen, Kulle Raig, Kimmo Mäki, Joakim Helenius, Ain Hinsberg Toomas Danneberg

  3. Teaduskeskus Ahhaa = Ahhaa Science Centre / Vilen Künnapu, Ain Padrik, Malle Jürgenson, Tea Tammelaan ; intervjueerinud Margit Mutso

    Index Scriptorium Estoniae

    2012-01-01

    Tartus Sadama 1 auva Ahhaa teaduskeskuse arhitektuurist ja sisearhitektuurist. Arhitektid: Ain Padrik ja Vilen Künnapu, kaasa töötasid Kristjan Tõlk, Kristiin Keernik, Siim Tuksam, Hannes Tilk (Künnapu & Padrik). Sisearhitektid: Tea Tammelaan, Krista Lepland ja Malle Jürgenson (Laika, Belka & Strelka). Infograafika: Alar Pikkorainen

  4. The antioxidant response of the liver of male Swiss mice raised on a AIN 93 or commercial diet

    Directory of Open Access Journals (Sweden)

    Caetano Aline C

    2013-01-01

    Full Text Available Abstract Background Reactive oxygen species (ROS are formed under natural physiological conditions and are thought to play an important role in many human diseases. A wide range of antioxidants are involved in cellular defense mechanisms against ROS, which can be generated in excess during stressful conditions, these include enzymes and non-enzymatic antioxidants. The aim of this study was to evaluate the antioxidant responses of mice to two diets control, commercial and the purified AIN 93 diet, commonly used in experiments with rodents. Results Malondialdehyde (MDA and hydrogen peroxide (H2O2 concentrations and superoxide dismutase (SOD and glutathione reductase (GR activities determined in the liver were lower in the group of mice fed with the AIN 93 diet, while catalase (CAT activity was higher in the same group, when compared to the group fed on the commercial diet. Liver glutathione peroxidase (GSH-Px activity was similar in the groups fed on either AIN 93 or the commercial diets. Two SOD isoforms, Mn-SODII and a Cu/Zn-SODV, were specifically reduced in the liver of the AIN 93 diet fed animals. Conclusions The clear differences in antioxidant responses observed in the livers of mice fed on the two diets suggest that the macro- and micro-nutrient components with antioxidant properties, including vitamin E, can promote changes in the activity of enzymes involved in the removal of the ROS generated by cell metabolism.

  5. Otvetshajet Taavi Aas, vitse-mer Tallinna / Taavi Aas

    Index Scriptorium Estoniae

    Aas, Taavi, 1966-

    2006-01-01

    Tallinna linnavalitsus kuulutas välja konkursi ning valib välja ehitusettevõtted, kes remondivad koolid ja 30 aasta jooksul kannavad remondi- ja ekspluatatsioonikulusid, linn maksab firmadele renditasu. Selgitusi jagab Tallinna abilinnapea

  6. Dietary intake of ain-93 standard diet induces Fatty liver with altered hepatic fatty acid profile in Wistar rats.

    Science.gov (United States)

    Farias Santos, Juliana; Suruagy Amaral, Monique; Lima Oliveira, Suzana; Porto Barbosa, Júnia; Rego Cabral-Jr, Cyro; Sofia Melo, Ingrid; Bezerra Bueno, Nassib; Duarte Freitas, Johnatan; Goulart Sant'ana, Antônio; Rocha Ataíde, Terezinha

    2015-05-01

    Introducción: En la investigación científica, hay varias dietas estándar para los animales, generalmente concebidas por instituciones científicas. La dieta AIN-93 es ampliamente utilizada, pero hay algunos informes de esteatosis hepática en ratones Wistar alimentadas con esta dieta. Objetivo: Evaluar las repercusiones hepáticas de la ingesta de la dieta estándar AIN-93 en ratones Wistar. Métodos: Cuarenta recién destetados, ratones Wistar machos, con 21 días de edad fueron alimentados con la dieta AIN-93 o una dieta comercial, durante 1 mes o 4 meses. El aumento de peso, la bioquímica sérica, la histología hepática y el perfil de ácidos grasos hepáticos fueron analizados. Resultados: Se observó esteatosis hepática, especialmente en el grupo alimentado con la dieta AIN-93. Glucosa en suero, peso absoluto y relativo del hígado y los niveles hepáticos de ácidos grasos oleico, palmitoleico, esteárico y palmítico se relacionaron con la esteatosis observada, mientras el lipidograma y los marcadores sanguíneos de la función hepática, no se relacionaron. Conclusión: La dieta estándar AIN-93 causó esteatosis hepática aguda en ratones Wistar, que puede comprometer su uso como una dieta estándar para los estudios experimentales con roedores. El perfil de ácidos grasos hepáticos se asoció con la esteatosis, con posibles implicaciones para el pronóstico de la enfermedad.

  7. The prevalence of group A streptococcal throat carriage in Al Ain, United Arab Emirates.

    Science.gov (United States)

    Dawson, K P; Ameen, A S; Nsanze, H; Bin-Othman, S; Mustafa, N

    1996-06-01

    The aim of this study was to establish the carrier rate of group A beta haemolytic streptococci in school children in Al Ain, United Arab Emirates. One thousand and two randomly selected school children aged 5-7 years had their throats swabbed twice for both culture and direct antigen detection of group A streptococci. One hundred and fourteen children (11.3%) had both a positive antigen and culture test, while 216 (21.6%) had antigen-positive tests only and 16 (1.5%) had a positive culture only. Thus, the combination of culture and antigen detection revealed a carrier rate of 35.4% in the children examined. We conclude that in an affluent but isolated desert area on the Tropic of Cancer, group A streptococcal carriage rate is high. Antigen detection is superior to culture techniques in asymptomatic carrier studies.

  8. Knowledge of periconceptional folic acid use among pregnant women at Ain Shams University Hospital, Cairo, Egypt.

    Science.gov (United States)

    Al-Darzi, W; Al-Mudares, F; Farah, A; Ali, A; Marzouk, D

    2014-10-12

    Egypt has a high incidence of neural tube defects. Folic acid supplementation in the periconceptional period is known to lower the risk of such defects. This cross-sectional study aimed to measure the level of knowledge about periconceptional folic acid use among pregnant women attending for antenatal care at Ain Shams University Hospital, Cairo, Egypt in 2012. Questionnaires were filled through personal interviews with 660 pregnant women. Of the respondents, 62.4% had heard of folic acid and 39.2% knew about the role of folic acid supplementation in prevention of congenital anomalies. Knowledge about using folic acid before and in the first trimester of pregnancy was highest among university-educated women and those working in professional occupations. Only 18.8% of women reported taking folic acid, and 8.8% had used it before conception. Awareness campaigns are suggested to improve knowledge about folic acid among women in the childbearing period in Egypt.

  9. Kodu maamaksust vabaks! / Taavi Madiberk

    Index Scriptorium Estoniae

    Madiberk, Taavi

    2008-01-01

    Praeguse maamaksupoliitika mõjust ühiskonnas ja kodu maksustamise seaduslikkusest. Lisatud: Lehis, Lasse. Ceterum censeo - maamaks tuleb kaotada. - Vt.: http://www.maksumaksjad.ee/modules/smartsection/item.php?itemid=572

  10. Kodu maamaksust vabaks! / Taavi Madiberk

    Index Scriptorium Estoniae

    Madiberk, Taavi

    2008-01-01

    Praeguse maamaksupoliitika mõjust ühiskonnas ja kodu maksustamise seaduslikkusest. Lisatud: Lehis, Lasse. Ceterum censeo - maamaks tuleb kaotada. - Vt.: http://www.maksumaksjad.ee/modules/smartsection/item.php?itemid=572

  11. Contribution to the hydrodynamic modeling of groundwater in the Ain El Bel syncline Wilaya of Djelfa (Algeria)

    Science.gov (United States)

    Azlaoui, Mohamed; Nezli, Imed Eddine; Djelita, Belkhier; Boutoutaou, Djamel

    2017-02-01

    In arid and semi-arid areas, the protection and preservation of water resources is based on integrated resource managements, which will prove a fruitful way to deal with pollution and shortage of water-the source of life for man on Earth. Djelfa region, and particularly Ain El Bel, the potential water has not able to satisfy human needs,and agriculture, and industry. This article is a contribution to hydrodynamic modeling of the Barremian aquifer of Ain El Bel syncline, with "Modflow" software wich provides a deterministic two-dimensional numerical simulation in steady state and transient of underground water in the studied aquifer. The main results provided a better view of different scenarios to the piezometrics fluctuations. The established predictions show an alarming state of this aquifer, where the need for integrated management of groundwater resources is, to ensure sustainable development.

  12. Antiinflamatorios no esteroideos (AINES.: Consideraciones para su uso estomatológico

    Directory of Open Access Journals (Sweden)

    Andrés A. Pérez Ruiz

    2002-08-01

    Full Text Available Se realiza una revisión extensa y actualizada sobre los antiinflamatorios no esteroideos (AINEs, con el fin de actualizar al estomatólogo en su uso. Para ello se revisan aspectos importantes del proceso inflamatorio en estructuras de la boca que como las pulpitis, presentan sus peculiaridades. Se identifica a una de las 2 familias de autacoides provenientes de los fosfolípidos de membrana celular, es decir, los eicosanoides derivados a partir de algunos ácidos grasos polisaturados, en particular, ácido araquidónico, que tras la acción de enzimas da lugar a la formación de prostaglandinas, prostaciclinas, tromboxeno A2 y leucotrienos. Conocidos estos antecedentes, nos ocupamos de fármacos usados para combatir los síntomas y signos de la inflamación. Casi todos los antiinflamatorios no esteroideos utilizados en la actualidad, casi todos, inhiben las actividades de la ciclooxigenasa 1 constitutiva y la ciclooxigenasa 2, inducida en el sitio de la inflamación y con ello, la síntesis de prostaglandinas y tromboxanos. Se alude a la ventaja terapéutica de los inhibidores de la COX-2 que aparecen hoy en el mercado. Se expone las dosis y frecuencias de los AINEs, sus interacciones, así como las reacciones adversas al medicamento y contraindicaciones, y se proponen aquellos que son de interés en la práctica estomatológica.Non-steroidal anti-inflammatory drugs. Considerations about their dental use. An extensive updated review of non-steroidal anti-inflammatory agents (NSAIN was made to give an updated information to the dentist about their use. To this purpose, important aspects of the inflammatory process in mouth structures like pulpitis that present with their own peculiarities are reviewed. We identified one of the two autacoid families from cell membrane phospholipids, that is, eicosanoids derived from some polysaturated fatty acids, in particular, arachidonic acid, which, after the action of enzymes, give rise to the formation of

  13. Climate change and their consequences on coastal zone of Ain el Turck in Oran

    Directory of Open Access Journals (Sweden)

    Mohammed Tewfik Bouroumi

    2017-12-01

    Full Text Available Algeria does not escape the problem of the climate change, its geographical position in zone of transition, and its dry and semi-arid climate, in fact a very vulnerable space. In Algeria, approximately two thirds of the population is concentrated on the coast which represents only 4 % of the territory. The Mediterranean coast, in particular in Algeria, is subjected to pressures: financial stakes, climatic risks, pollutions and conservation of the water. It is on the basis of the critical and objective report with regard to a wild urbanization of the Algerian coast as well as the influence of the demographic pressure that the choice of the search for this article was held. This publication has for objective to raise (to draw up a current situation (inventory of fixtures of the sector of the environment in Algeria and to present through the case of the coastal city of Oran the consequences of climate change. We propose, to review the situation through the case of the municipality of Ain El Türck, by basing itself on data relative to the evolution of the temperatures and the sea level.

  14. Pediatric and youth traffic-collision injuries in Al Ain, United Arab Emirates: a prospective study.

    Directory of Open Access Journals (Sweden)

    Michal Grivna

    Full Text Available AIM: To study the mechanism of road traffic collisions (RTC, use of safety devices, and outcome of hospitalized pediatric and youth RTC injured patients so as to give recommendations regarding prevention of pediatric RTC injuries. METHODS: All RTC injured children and youth (0-19-year-olds who were admitted to Al Ain City's two major trauma centers or who died after arrival to these centers were prospectively studied from April 2006 to October 2007. Demography of patients, road-user and vehicle types, crash mechanism, usage of safety devices, injured body regions, injury severity, Revised Trauma Score, Glasgow Coma Scale, intensive care unit admissions, hospital stay and mortality were analyzed. RESULTS: 245 patients were studied, 69% were vehicle occupants, 15% pedestrians, 9% motorcyclists and 5% bicyclists. 79% were males and 67% UAE citizens. The most common mechanism of RTC was rollover of vehicle (37% followed by front impact collision (32%. 32 (13% of vehicle occupants were ejected from car. 63% of ejected occupants and 70% of motorcyclists sustained head injuries. Only 2% (3/170 vehicle passengers used seatbelts and 13% (3/23 motorcyclists a helmet. CONCLUSIONS: Male drivers and UAE nationals were at high risk of RTC as drivers and as motorcyclists. Ejection rate was high because safety restraint use was extremely low in our community. More education and law enforcement focusing especially on car/booster seat use is needed.

  15. Aaviksoo võistleb Donald Trumpiga

    Index Scriptorium Estoniae

    2007-01-01

    Peep Aaviksoole ja tema äripartneritele kuuluv IPC Investment tegeleb Rumeenias lisaks kinnisvarainvesteeringutele ka ehitusmaterjalide tootmisega. USA kinnisvaramagnaat Donald Trump on otsustanud riiki investeerida miljard eurot

  16. Aaviksoo võistleb Donald Trumpiga

    Index Scriptorium Estoniae

    2007-01-01

    Peep Aaviksoole ja tema äripartneritele kuuluv IPC Investment tegeleb Rumeenias lisaks kinnisvarainvesteeringutele ka ehitusmaterjalide tootmisega. USA kinnisvaramagnaat Donald Trump on otsustanud riiki investeerida miljard eurot

  17. Seadus, kultuur ja poliitilised valikud / Jaak Aaviksoo

    Index Scriptorium Estoniae

    Aaviksoo, Jaak, 1954-

    2006-01-01

    Ilmunud ka: Sakala, Lääne Elu, Vooremaa, Põhjarannik, Severnoje Poberezhje 16. nov. lk. 2, Hiiu Leht, Harjumaa 17. nov. lk. 2, Meie Maa, Võrumaa Teataja 18. nov. lk. 2, Nädaline 21. nov. lk. 2, Sõnumitooja, Vali Uudised 22. nov. lk. 2, Lõunaleht 23. nov. lk. 2, Virumaa Teataja 5. dets. lk. 11. Autori sõnul vajab Eesti riik valimisseaduse revisjoni eesmärgiga suurendada rahva otsest kontrolli saadikute tegevuse üle, vajame mehhanisme professionaalse teadmise suuremaks kaasamiseks nii seadusandliku kui täidesaatva võimu teostamisse, sõltumatule analüüsile tuginevaid riiklike investeeringute otsuseid

  18. Road risk-perception and pedestrian injuries among students at Ain Shams University, Cairo, Egypt.

    Science.gov (United States)

    Ibrahim, Jehan M; Day, Hannah; Hirshon, Jon Mark; El-Setouhy, Maged

    2012-07-01

    Road traffic injuries (RTIs) constitute 45% of injury mortality in Egypt; 75% of these injuries are pedestrians related. Traditionally, research on road traffic safety has focused on the traffic environment and the vehicles. However, little attention has been given to road risky behaviors and perceptions of road safety by pedestrians as risk factors associated with high pedestrian injury rates. This study aimed to examine the relationship between road risk- perception, specific road behaviors, and self-reported pedestrian injuries among university students in Cairo, Egypt. A cross sectional survey was conducted among university students aged 18 to 24 years old at Ain Shams University in Cairo. Questions covered socio-demographic variables, injury episodes, road behaviors, road risk-perceptions, attitudes towards injury prevention, and road safety education. The survey was completed by 1,324 students. Two hundred ninety (21.9%) of the participants suffered from pedestrian injury during the past 6 months; of these, 28.9% were admitted to hospital or clinic as a result of the injury, 39.3% were unable to go to university or leave home because of the injury for a period ranging from one day up to one week. Participants were more likely to suffer from pedestrian injury when they did not always "look both ways to cross the road", whereas always "waiting for a green light" was protective. Students who "perceived it safe to cross the road from any point" or "did not perceive it to be safer to cross at a zebra crossing" were less likely to "look both ways" before crossing the road. Similarly, there was a positive association between road safety education and participants' road crossing behaviors. Inappropriate youths' road behaviors were significantly associated with pedestrian injury. There was also a positive association between road risk perception and road behaviors. This suggests that a behavioral approach together with modification of the traffic environment (such as

  19. Spatial and temporal variability in sedimentation rates associated with cutoff channel infill deposits: Ain River, France

    Science.gov (United States)

    Piegay, H.; Hupp, C.R.; Citterio, A.; Dufour, S.; Moulin, B.; Walling, D.E.

    2008-01-01

    Floodplain development is associated with lateral accretion along stable channel geometry. Along shifting rivers, the floodplain sedimentation is more complex because of changes in channel position but also cutoff channel presence, which exhibit specific overflow patterns. In this contribution, the spatial and temporal variability of sedimentation rates in cutoff channel infill deposits is related to channel changes of a shifting gravel bed river (Ain River, France). The sedimentation rates estimated from dendrogeomorphic analysis are compared between and within 14 cutoff channel infills. Detailed analyses along a single channel infill are performed to assess changes in the sedimentation rates through time by analyzing activity profiles of the fallout radionuclides 137Cs and unsupported 210Pb. Sedimentation rates are also compared within the channel infills with rates in other plots located in the adjacent floodplain. Sedimentation rates range between 0.65 and 2.4 cm a -1 over a period of 10 to 40 years. The data provide additional information on the role of distance from the bank, overbank flow frequency, and channel geometry in controlling the sedimentation rate. Channel infills, lower than adjacent floodplains, exhibit higher sedimentation rates and convey overbank sediment farther away within the floodplain. Additionally, channel degradation, aggradation, and bank erosion, which reduce or increase the distance between the main channel and the cutoff channel aquatic zone, affect local overbank flow magnitude and frequency and therefore sedimentation rates, thereby creating a complex mosaic of sedimentation zones within the floodplain and along the cutoff channel infills. Last, the dendrogeomorphic and 137Cs approaches are cross validated for estimating the sedimentation rate within a channel infill. Copyright 2008 by the American Geophysical Union.

  20. Awareness of breast cancer among female students at Ain Shams University, Egypt.

    Science.gov (United States)

    Boulos, Dina Nabih Kamel; Ghali, Ramy R

    2013-11-04

    The present study aimed to determine knowledge of breast cancer risk factors, symptoms and early detection methods and to identify knowledge and practice of breast self-examination among Ain Shams University female students. This is a descriptive cross sectional study.Most study participants had low level of knowledge of breast cancer risk factors. The most widely known risk factors by the students were smoking 66.9%, followed by radiation to the chest 63.7% and genetic factors 63.7%. Most of the students (81.6%) identified breast lump as a symptom for breast cancer. However, non lump symptoms were less known and less than half were aware of other warning signs. Mass media such as TV and/or radio were identified as the main source of information on breast cancer by 89.1% of students followed by relatives 39.2%. Only 8.8% of students identified correctly the appropriate time to perform breast self examination and 1.3% reported performing it regularly every month. The most common reasons for not practicing BSE were" did not know how to perform it" (47.7%) and lack of interest (35%). The findings of this study showed that there is low level of knowledge on breast cancer risk factors, early warning signs and BSE among female university students and that only few students practice BSE monthly. Health care workers should develop effective breast health programs targeting youth to help females to gain healthy habits starting very early during their formative years.

  1. Effects of dams on water temperature: example of the Ain River (France); Influence des barrages-reservoirs sur la temperature de l'eau: exemple d'application au bassin versant de l'Ain

    Energy Technology Data Exchange (ETDEWEB)

    Poirel, A.; Gailhard, J. [EDF/DTG, 38 - Grenoble (France); Capra, H. [CEMAGREF/DYNAM, 69 - Lyon (France)

    2010-07-01

    The aim of this paper is to illustrate with a lot of data series on the Ain river, the changes observed on water temperatures, especially for summer values. Models are calibrated and used to simulate water temperatures under different assumptions of flow management to deduct effects of dams. Projections on the period 1950-2099 were made on the basis of a climate scenario, a hydrological model and models of water temperature. This simulation confirms the risk of a sharp rise in water temperatures in summer related to rising air temperatures and lower low flows. (authors)

  2. Road risk-perception and pedestrian injuries among students at Ain Shams University, Cairo, Egypt

    Directory of Open Access Journals (Sweden)

    Maged El-Setouhy

    2012-07-01

    Full Text Available BACKGROUND: Road traffic injuries (RTIs constitute 45% of injury mortality in Egypt; 75% of these injuries are pedestrians related. Traditionally, research on road traffic safety has focused on the traffic environment and the vehicles. However, little attention has been given to road risky behaviors and perceptions of road safety by pedestrians as risk factors associated with high pedestrian injury rates. This study aimed to examine the relationship between road risk- perception, specific road behaviors, and self-reported pedestrian injuries among university students in Cairo, Egypt. METHODS: A cross sectional survey was conducted among university students aged 18 to 24 years old at Ain Shams University in Cairo. Questions covered socio-demographic variables, injury episodes, road behaviors, road risk-perceptions, attitudes towards injury prevention, and road safety education. RESULTS: The survey was completed by 1,324 students. Two hundred ninety (21.9% of the participants suffered from pedestrian injury during the past 6 months; of these, 28.9% were admitted to hospital or clinic as a result of the injury, 39.3% were unable to go to university or leave home because of the injury for a period ranging from one day up to one week. Participants were more likely to suffer from pedestrian injury when they did not always "look both ways to cross the road", whereas always “waiting for a green light” was protective. Students who "perceived it safe to cross the road from any point" or "did not perceive it to be safer to cross at a zebra crossing" were less likely to "look both ways" before crossing the road. Similarly, there was a positive association between road safety education and participants’ road crossing behaviors. CONCLUSION: Inappropriate youths' road behaviors were significantly associated with pedestrian injury. There was also a positive association between road risk perception and road behaviors. This suggests that a behavioral

  3. AINEs como tratamiento coadyuvante de la enfermedad periodontal NSAIDs in the treatment of periodontal disease

    Directory of Open Access Journals (Sweden)

    T Beca

    2007-08-01

    Full Text Available Se presenta una revisión bibliográfica acerca de la aplicación de antiinflamatorios de forma coadyuvante en el tratamiento periodontal. Tras una breve introducción, se establecen las bases inmunológicas de la inflamación y destrucción periodontal, centrándonos en el metabolismo del ácido araquidónico y los cuatro mediadores más implicados actualmente en la destrucción periodontal: prostaglandina E2 (PGE2, prostaglandina F2a (PGF2a, leucotrieno B4 (LTB4 y factor activador de plaquetas (PAF, y estableciendo su mecanismo de acción, su relación con la destrucción periodontal a través de las metaloproteinasas (MMPs y su relación con algunas interleuquinas de la cascada inflamatoria también relacionadas con la destrucción tisular. Después se expone una relación de los fármacos más empleados en la literatura para la inhibición de todos estos mediadores (Antiinflamatorios no esteroideos o AINEs, ácidos grasos omega3, tetraciclinas y bifosfonatos, explicando su mecanismo de acción y los estudios que los han investigado y posteriormente se ha llevado a cabo una recopilación de los escasos estudios que realizan mediciones clínicas para finalizar estableciendo una serie de conclusiones.SUMMARY A review about the application of antiinflammatories as an aid for the periodontal treatment is presented. After a brief introduction, we explain the immunological bases of periodontal inflamation and tissue destruction, focusing on arachidonic acid metabolism and the four most important inflammatory mediators now in periodontal tissue resorption: prostaglandin E2 (PGE2, prostaglandin F2a(PGF2a, leucotriene B4 (LTB4 and platelet activation factor (PAF, and explaining their actions and role in inflammation through matrix metalloproteinase (MMPs and their relation with some other mediators in the inflammatory chain also related with tissue resorption. After, we expound some of the most used drugs for the inhibition of all of these mediators

  4. Influence of bilayer period on the characteristics of nanometre-scale ZrN/TiAIN multilayers.

    Science.gov (United States)

    Vladescu, A; Kiss, A; Popescu, A; Braic, M; Balaceanu, M; Braic, V; Tudor, I; Logofatu, C; Negrila, C C; Rapeanu, R

    2008-02-01

    In the last decade, considerable research effort was directed to the deposition of multilayer films with layer thicknesses in the nanometer range (superlattice coatings), in order to increase the performance of various cutting tools and machine parts. The goal of the present work was to investigate the main microstructural, mechanical and wear resistance characteristics of a superlattice coating, consisting of alternate multilayer ZrN/TiAIN films, with various bilayer periods (5 / 20 nm). The coatings were deposited by the cathodic arc method on Si, plain carbon steel and high speed steel substrates to be used as wear resistance surfaces. The multilayer structures were prepared by using shutters placed in front of each cathode (Zr and Ti+Al). The characteristics of multilayer structures (elemental and phase composition, texture, Vickers microhardness, thickness, adhesion, and wear resistance) were determined by using various techniques (AES, XPS, XRD, microhardness measurements, scratch, and tribological tests). A comparison with the properties of ZrN and TiAIN single-layer coatings was carried out.

  5. Estudio biofarmacéutico de geles antiinflamatorios no esteroideos (AINES

    Directory of Open Access Journals (Sweden)

    Margarita Restrepo

    2000-02-01

    Full Text Available

    Los antiinflamatorios no esteroideos (AINES son un grupo heterogéneo de compuestos con actividad analgésica, antipirética y antiinflamatoria que comparten efectos secundarios indeseables, tales como: ulceración gástrica e intestinal, anemia, bloqueo de la agregación plaquetaria, inhibición de la motilidad uterina e hipersensibilidad. Los AINES se utilizan por vía tópica con el fin de aliviar lesiones en tejidos blandos a los cuales puede llegarse directamente a través de la piel, evitando así los efectos colaterales indeseables.

    Actualmente para la gran mayoría de los medicamentos se exige valorar la Biodisponibilidad como criterio de calidad. Biodisponibilidad se define como la cantidad de fármaco que llega a sangre o plasma después de la administración del medicamento que lo contiene y la velocidad a la cual este proceso ocurre; esta determinación de Biodisponibilidad no resulta útil en el caso de medicamentos que se administran a través de la piel y no alcanzan circulación sistémica; la biodisponibilidad relativa o Bioequivalencia es la comparación de las biodisponibilidades de dos medicamentos para determinar si son similares en su comportamiento farmacocinético dentro del organismo.

    El presente trabajo pretende estandarizar y validar un método que permita determinar concentraciones de fármaco en tejidos, en este tipo de medicamentos administrados por vía tópica, que no alcanzan circulación sistémica y por lo tanto no pueden ser cuantificados en sangre o plasma; además pretendemos que esta metodología pueda ser propuesta como una técnica para determinar biodisponibilidad y/o bioequivalencia para este tipo de productos. Para lograr estos objetivos, inicialmente, se induce la inflamación a un grupo

  6. Eripedagoogid ootavad poliitilisi otsuseid / Plado, Kaja; Karlep, Karl; Ostrat, Ain; Maila, Meelika; Binsol, Hene; Kontor, Ana; küsitlenud Martin Krõlov

    Index Scriptorium Estoniae

    2007-01-01

    Eripedagoogide vestlusringis osalevad: Tartu Ülikooli eripedagoogika osakonna juhataja Kaja Plado, emeriitdotsent pedagoogikadoktor Karl Karlep, Tartu Kroonuaia Kooli direktor Ain Ostrat ja õppealajuhataja Meelike Maila, Tartu Hiie Kooli õppealajuhataja Hene Binsol ning Tartu Nõustamis- ja õpiabi keskuse juhataja Ana Kontor

  7. Fracaso renal agudo secundario a combinación de inhibidores del sistema renina-angiotensina, diuréticos y AINES. “La Triple Whammy”1

    Directory of Open Access Journals (Sweden)

    Rosa Maria Garcia Camin

    2015-03-01

    Conclusiones: El tratamiento con IECA, ARA II, diuréticos y/o AINES presenta elevada incidencia de ingreso por FRA, siendo los diuréticos en monoterapia, doble y triple terapia combinada los que ocasionan la mayor incidencia. El FRAETW supone elevados costes sanitarios y muertes evitables.

  8. Kas uus töölepingu seaduse eelnõu on õnnestunud? / Olga Aasav, Arno Arukask, Ain Tammvere...[jt.] ; interv. Martin Pau

    Index Scriptorium Estoniae

    2008-01-01

    Vastavad restoranklubi Atlantis tegevjuht Olga Aasav, ametiühingute keskliidu osakonnajuhataja Arno Arukuusk, AS Estiko Investeeringud juhataja Ain Tammvere, Tartu Ülikooli ametiühingu esimees Aleksander Jakobson, AS Samelin tegevdirektor Leida Kikka, AS Enics Eesti tegevjuht Kalle Kuusik, personalispetsialist Lea Oras ja Tartu Tarbijate Kooperatiivi juhatuse esimees Tarmo Punger

  9. Eripedagoogid ootavad poliitilisi otsuseid / Plado, Kaja; Karlep, Karl; Ostrat, Ain; Maila, Meelika; Binsol, Hene; Kontor, Ana; küsitlenud Martin Krõlov

    Index Scriptorium Estoniae

    2007-01-01

    Eripedagoogide vestlusringis osalevad: Tartu Ülikooli eripedagoogika osakonna juhataja Kaja Plado, emeriitdotsent pedagoogikadoktor Karl Karlep, Tartu Kroonuaia Kooli direktor Ain Ostrat ja õppealajuhataja Meelike Maila, Tartu Hiie Kooli õppealajuhataja Hene Binsol ning Tartu Nõustamis- ja õpiabi keskuse juhataja Ana Kontor

  10. Comparisonof GaN-Based Light-Emitting Diodes by Using the AlGaN Electron-Blocking Layer and InAIN Electron-Blocking Layer

    Institute of Scientific and Technical Information of China (English)

    陈峻; 范广涵; 庞玮; 郑树文

    2011-01-01

    Optical properties of GaN-based light-emitting diodes(LEDs)are studied numerically by using AlGaN and InAIN electron-blocking layers(EBLs).Through the simulations of emission spectra,carrier concentration distribution,energy band,electrostatic field,internal quantum efficiency and output power,the results show that the LEDs with design of the InAIN EBL structure have a better performance over the original LEDs using an AlGaN EBL.The spectrum intensity and output power are enhanced significantly,and the efficiency droop of internal quantum efficiency is improved effectively with this design of InAlN EBL structure.It is proved that the strengths of carrier confinement and electron leakage current play a critical role in the performance of luminescence in LEDs.%Optical properties of GaN-based light-emitting diodes (LEDs) are studied numerically by using AlGaN and InAIN electron-blocking layers (EBLs). Through the simulations of emission spectra, carrier concentration distribution, energy band, electrostatic Reid, internal quantum efficiency and output power, the results show that the LEDs with design of the InAIN EBL structure have a better performance over the original LEDs using an AlGaN EBL. The spectrum intensity and output power are enhanced significantly, and the efficiency droop of internal quantum efficiency is improved effectively with this design of InAIN EBL structure. It is proved that the strengths of carrier confinement and electron leakage current play a critical role in tie performance of luminescence in LEDs.

  11. Temperature Dependent Thermal Conductivity and Elastic Properties of a-InGaZnO4 and a-In2Ga2ZnO7 Thin Films

    Science.gov (United States)

    Thompson, W. D.; White, B. E.

    2016-10-01

    Amorphous In-Ga-Zn-O is an important oxide semiconductor in advanced display technologies. Despite its importance, little has been reported on the thermal and elastic properties of this material. Here, the temperature dependence of the thermal conductivity, shear modulus, and internal friction of a-InGaZnO4 and a-In2Ga2ZnO7 films are presented. The thermal conductivity of a-In2Ga2ZnO7, measured from 100 K to room temperature, was found to be larger than that of a-InGaZnO4 over the entire temperature range. At room temperature the thermal conductivities were 1.9 W/m K and 1.4 W/m K for the a-In2Ga2ZnO7 and a-InGaZnO4 films, respectively. The shear modulus and internal friction of these films were measured in the temperature range of 340 mK to 65 K. At 4.2 K the shear modulus of the a-InGaZnO4 and a-In2 Ga2ZnO7 films was 44 GPa and 42 GPa, respectively. The internal friction of thin films at each composition exhibited a temperature dependence and magnitude that is in agreement with that observed in all amorphous solids. As the self-heating effect is of concern in the development of amorphous In-Ga-Zn-O based thin film transistors on low thermal conductivity substrates, a thermal model of such a device utilizing a-In2Ga2ZnO7 or a-InGaZnO4 as the active layer was explored. It was found that the temperature increase of the thin film transistor channel is essentially independent of the thermal conductivity of the active layer.

  12. Haematology and biochemistry values of captive sand cats (Felis margarita) in Al Ain Wildlife Park and Resort, United Arab Emirates

    Institute of Scientific and Technical Information of China (English)

    Stephen Chege; Arshad Toosy; Judith Howlett; Ahmed Saker; John Kagira

    2013-01-01

    Objective: To investigate the haematology and biochemistry values of apparently healthy captive sand cats kept in Al Ain Wildlife Park and Resort, United Arab Emirates, with a view to establishing baseline values.Methods:Blood was collected from the femoral vein using aseptic techniques, kept in a cool box and sent to laboratory for analysis. The blood was analysed for haematological and biochemical values using veterinary hematology and chemistry analysers (ABX ABC Vet, Horiba ABX SAS Montpellier, France). Results: Haematological values were within the normal ranges recorded in domestic cats and there was no statistical difference between values found in males and females. Aspartate aminotransferase values were higher (P0.05) between males and females values.Conclusions:Our results present reference ranges for haematology and biochemistry parameters in captive sand cats. These values will be important for diagnosis of various diseases and monitoring of treatments.

  13. Using CrAIN Multilayer Coatings to Improve Oxidation Resistance of Steel Interconnects for Solid Oxide Fuel Cell Stacks

    Energy Technology Data Exchange (ETDEWEB)

    Smith, Richard J.; Tripp, C.; Knospe, Anders; Ramana, C. V.; Gorokhovsky, Vladimir I.; Shutthanandan, V.; Gelles, David S.

    2004-06-01

    The requirements of low cost and high-tempurature corrosion resistance for bipolar interconnect plates in solid oxide fuel cell stacks has directed attention to the use of metal plates with oxidation resistant coatings. We have investigatedt he performance of steel plates with multilayer coatings consisting of CrN for electrical conductivity and CrAIN for oxidation resistance. The coatings were deposited usin large area filterd arc deposition technolgy, and subsequently annealed in air for up to 25 hours at 800 degrees celsius. The composition, structer and morphology of the coated plates were characterized using RBS, nuclear reaction analysis, AFM and TEM techniques. By altering the architecture of the layers within the coatings, the rate of oxidation was reduced by more than an order of magnitute. Electrical resistance was measured at room temperature.

  14. Influência da dieta AIN-93 na mortalidade e no processo de remodelação cardíaca após o infarto do micárdio

    OpenAIRE

    Ardisson, Lidiane Paula [UNESP

    2009-01-01

    o objetivo do nosso estudo foi avaliar a influência da dieta AIN-93 na mortalidade e no processo de remodelação cardíaca após o infarto agudo do miocárdio em ratos. Foram utilizados ratos Wistar, machos, que após o desmame foram divididos em dois grupos: grupo controle (n =62), o qual recebeu dieta padrão de nosso laboratório (Labina) e grupo AIN-93 (n= 70), que recebeu a dieta AIN-93. Ao atingirem peso ao redor de 250g, os ratos foram submetidos ao infarto experimental; em alguns animais foi...

  15. Aine või toote ravimina määratlemine Eestis Euroopa Liidu õiguse valguses : [magistritöö] / Kaili Lellep ; Tartu Ülikool, õigusteaduskond ; juhendaja Ants Nõmper

    Index Scriptorium Estoniae

    Lellep, Kaili

    2010-01-01

    Aine või toote määratlemisest toiduna, kosmeetikatootena, meditsiiniseadmena, ravimina. Määratlustest Eestis ja nende vastavusest Euroopa Liidu õigusega, määratluste tagajärgedest, ettepanekutest vastuolulise õigusakti muutmiseks

  16. Kas ja kui palju jälgite kutsetunnistuse olemasolu uue töötaja palkamisel? Kas ja kui palju teie firmas kutsetunnistusega töötajaid on? / Eve Reitalu, Ain Käpp, Rein Must ... [jt.

    Index Scriptorium Estoniae

    2012-01-01

    Küsimustele vastasid Arctic Sport fitnessvaldkonna juht Eve Reitalu, TallinnHotels OÜ / Aldera Hotell OÜ tegevdirektor Ain Käpp, AS Decora Ehitus direktor Rein Must, OÜ Afterone juhataja Argo Tõruke ja DPD Eesti ASi tegevjuht Tarmo Tael

  17. Aine või toote ravimina määratlemine Eestis Euroopa Liidu õiguse valguses : [magistritöö] / Kaili Lellep ; Tartu Ülikool, õigusteaduskond ; juhendaja Ants Nõmper

    Index Scriptorium Estoniae

    Lellep, Kaili

    2010-01-01

    Aine või toote määratlemisest toiduna, kosmeetikatootena, meditsiiniseadmena, ravimina. Määratlustest Eestis ja nende vastavusest Euroopa Liidu õigusega, määratluste tagajärgedest, ettepanekutest vastuolulise õigusakti muutmiseks

  18. EXIGENCES TECHNIQUES DANS LA CONSTRUCTION ET REGLEMENTATION : ETUDE D’UN EXEMPLE DE LOGEMENT COLLECTIF A AIN-SMARA (ALGERIE

    Directory of Open Access Journals (Sweden)

    B BENRACHI

    2002-12-01

    Full Text Available La construction d’un édifice de qualité standard et répondant aux exigences techniques est   obtenue grâce au développement du savoir-faire et au respect des règles de l’art et de la réglementation en vigueur.  Une étude détaillée sur les  exigences techniques et le respect de la réglementation  d’un logement en collectif  nouvellement construit et inhabité à Ain-Smara, nous a montré  qu’il y a une satisfaction pour certaines d'entre-elles et une non-conformité pour d’autres. Il en résulte que le degré de satisfaction de ce logement est inférieur à celui recommandé dans le cadre de la réglementation, ce qui diminue sa qualité par rapport au standard exigé.

  19. The decline of the early Neolithic population center of 'Ain Ghazal and corresponding earth-surface processes, Jordan Rift Valley

    Science.gov (United States)

    Zielhofer, Christoph; Clare, Lee; Rollefson, Gary; Wächter, Stephan; Hoffmeister, Dirk; Bareth, Georg; Roettig, Christopher; Bullmann, Heike; Schneider, Birgit; Berke, Hubert; Weninger, Bernhard

    2012-11-01

    'Ain Ghazal is among the earliest large population centers known in the Middle East. A total of four major stratigraphic cultural units have been identified: 1) The oldest Middle Pre-Pottery Neolithic B (MPPNB) unit (10.2 to 9.5 cal ka BP) clearly corresponds with the early Holocene maximum Dead Sea levels. 2) The second unit consists of Late Pre-Pottery Neolithic B (LPPNB) in situ walls and hearths. 3) In the subsequent PPNC (8.9 to 8.6 cal ka BP) the population density at the settlement drops dramatically, which corresponds with a significant drop in the Dead Sea level. 4) The 4th stratigraphic unit is characterized by the "Yarmoukian rubble layer". Additionally, there is evidence for a previously unrecognized use of the site by Chalcolithic pastoralists. Sedimentological analyses reveal a constant increase in dust from a remote source during the entire human occupation period, which correlates well with the detectable drops in climatic humidity from the Dead Sea. As the major focus of this study, we can now rule out previous notions that the "Yarmoukian" rubble layer could have been produced by (catastrophic) slope-scale gravitational movements. To this point, it appears that the Neolithic mega-site was abandoned due to a climatic aridification.

  20. Development and usability of the MAINtAIN, an inventory assessing nursing staff behavior to optimize and maintain functional activity among nursing home residents: a mixed-methods approach.

    Science.gov (United States)

    Kuk, Nienke O; Zijlstra, G A Rixt; Bours, Gerrie J J W; Hamers, Jan P H; Kempen, Gertrudis I J M

    2016-02-02

    Functional decline is common in nursing home residents. Nursing staff can help prevent this decline, by encouraging residents to be more active in functional activities. Questionnaires measuring the extent to which nursing staff encourage functional activity among residents are lacking. In addition, there are no measurement instruments to gain insight into nursing staff perceived barriers and facilitators to this behavior. The aim of this study was to develop, and study the usability, of the MAastrIcht Nurses Activities INventory (MAINtAIN), an inventory assessing a) the extent to which nursing staff perceive to perform behaviors that optimize and maintain functional activity among nursing home residents and b) the perceived barriers and facilitators related to this behavior. Using a mixed-methods approach the MAINtAIN was developed and its usability was studied. Development was based on literature, expert opinions, focus group (N = 3) and individual interviews (N = 14) with residents and staff from nine nursing homes in the Netherlands. Usability was studied in a cross-sectional study with 37 nurses and certified nurse assistants; data were analyzed using descriptive statistics. Development of the MAINtAIN resulted in two distinctive parts: MAINtAIN-behaviors and MAINtAIN-barriers. MAINtAIN-behaviors, targeting nursing staff behavior to optimize and maintain functional activity, includes 19 items covering activities of daily living, household activities, and miscellaneous activities. MAINtAIN-barriers addresses the perceived barriers and facilitators related to this behavior and comprises 33 items covering barriers and facilitators related to the residents, the professionals, the social context, and the organizational and economic context. The usability study showed that the inventory was not difficult to complete, that items and response options were clear, and that the number of missing values was low. Few items showed a floor or ceiling effect. The

  1. Homefucking is Killing Prostitution / Taavi Eelmaa

    Index Scriptorium Estoniae

    Eelmaa, Taavi, 1971-

    2008-01-01

    Mis jääb vaatajale teatrietendusest meelde? Ilmus Kris Moori raamat "Homefucking is Killing Prostitution". Raamat sisaldab tekste ja Erki Lauri fotosid Von Krahli Teatri samanimelisest etendusest, mida kordagi ei mängitud

  2. Rahvusvaheline fotograafia suvekool Latgales / Taavi Tatsi

    Index Scriptorium Estoniae

    Tatsi, Taavi

    2007-01-01

    Augustis 2007 toimus rahvusvaheline fotograafia suvekool (ISSP) Latgales, Lätis. Osavõtjad Lätist, Eestist, Leedust, Venemaalt, Saksamaalt, Poolast, Suurbritanniast ja Hispaaniast. Keskenduti kontseptuaalsele lähenemisele ja maailmamõistmise avardamisele fotograafia vahendite abil

  3. Homefucking is Killing Prostitution / Taavi Eelmaa

    Index Scriptorium Estoniae

    Eelmaa, Taavi, 1971-

    2008-01-01

    Mis jääb vaatajale teatrietendusest meelde? Ilmus Kris Moori raamat "Homefucking is Killing Prostitution". Raamat sisaldab tekste ja Erki Lauri fotosid Von Krahli Teatri samanimelisest etendusest, mida kordagi ei mängitud

  4. PI/AIN纳米复合薄膜结构与介电性能研究%Structure and Dielectric Properties of PI/AIN Hybrid Film

    Institute of Scientific and Technical Information of China (English)

    李广; 殷景华; 刘晓旭; 冯宇; 田付强; 雷清泉

    2011-01-01

    采用原位聚合法制备了聚酰亚胺/氮化铝(PI/AlN)纳米复合薄膜,用小角散射(SAXS)、扫描电镜(SEM)对薄膜进行表征,研究了不同纳米掺杂量对材料电阻率、介电常数(ε)和介质损耗因数(tanδ)的影响.结果表明,随着纳米AlN含量的增加,分形结构由质量分形转变为表面分形,当AlN含量为1%时,复合薄膜的介电常数达到最低值,电阻率提高了一个数量级;介质损耗在低频范围内明显增加;AlN的掺杂提高了纳米复合薄膜的绝缘性能.%A polyimide/aluminum nitride(PI/A1N) nano-composite film was prepared by in-situ poly merization method. The microscopic structure of the film was characterized by small angle scat tering (SAXS) and scanning electron microscope (SEM) . The effects of nano-AIN content on the volume resistivity, permittivity(e) and dielectric loss of the film were studied. The results show that with increasing the nano-AIN content, the fractal structure changes from quality fractal to surface fractal. The permittivity of the film attains the minimum value when the nano-AIN content is 1%. The volume resistivity is increased by one order of magnitude, and the dielectric loss in creases obviously in low frequency range, which indicates that the addition of A1N can improve the insulation performance.

  5. Keelatud ained / Ave Oit

    Index Scriptorium Estoniae

    Oit, Ave

    2012-01-01

    Öko- ja looduskosmeetikas keelatud või piirangutega lubatud koostisainetest: silikoonid, etoksüleeritud emulgaatorained (PEG-ühendid), toorõli baasil valmistatud rasvained ja emulgaatorid s.h mineraalõlid ja -vahad

  6. Ain't Misbehavin'

    Science.gov (United States)

    Poliniak, Susan

    2011-01-01

    Maintaining order in the classroom is a concern that ranks near the top of "every" teacher's list, no matter the subject taught. Successful classroom management will not only make the teaching--and learning--process easier, but it also will benefit the teacher's energy level and sanity. Recent studies suggest that controlling students' behavior…

  7. Keelatud ained / Ave Oit

    Index Scriptorium Estoniae

    Oit, Ave

    2012-01-01

    Öko- ja looduskosmeetikas keelatud või piirangutega lubatud koostisainetest: silikoonid, etoksüleeritud emulgaatorained (PEG-ühendid), toorõli baasil valmistatud rasvained ja emulgaatorid s.h mineraalõlid ja -vahad

  8. Rahvusvaheline turismikonverents / Ain Hinsberg

    Index Scriptorium Estoniae

    Hinsberg, Ain

    2011-01-01

    Radisson Blu Hotel Olümpias 28. aprillil korraldatud konverentsist "Läänemere regiooni turismiteadmuse toetus turismimajandusele ja -ettevõtlusele 2011-2026", millega tähistati Eesti Hotelli- ja Turismikõrgkooli EHTE 15. sünnipäeva. Thomas Mielke, Maritta Hiltuneni, Kristian Sieversi, Pauli Santala, Inese Šīrava, Maija Rozite ja Kestutis Ambrozaitise konverentsil peetud ettekannetest ja paneeldiskussioonist

  9. Turundusteenistus / Ain Kaljurand

    Index Scriptorium Estoniae

    Kaljurand, Ain, 1965-

    2004-01-01

    Ilmunud ka: 2003 : annual report : [Eesti Raudtee]. - Tallinn, 2004, lk. 15-20; 2003 : godovoi ottshjot : [Eesti Raudtee]. - Tallinn, 2004, lk. 15-20. Ülevaade AS-i Eesti Raudtee 2003. a. kaubaveost veomahtude ja kaubagruppide järgi, turundusteenistusest, hinnapoliitikast

  10. Turundusteenistus / Ain Kaljurand

    Index Scriptorium Estoniae

    Kaljurand, Ain, 1965-

    2004-01-01

    Ilmunud ka: 2003 : annual report : [Eesti Raudtee]. - Tallinn, 2004, lk. 15-20; 2003 : godovoi ottshjot : [Eesti Raudtee]. - Tallinn, 2004, lk. 15-20. Ülevaade AS-i Eesti Raudtee 2003. a. kaubaveost veomahtude ja kaubagruppide järgi, turundusteenistusest, hinnapoliitikast

  11. ain defla, algeria

    African Journals Online (AJOL)

    Hamaidi-Chergui F, Brahim Errahmani M, Debib A, Hamaidi M.S

    2016-05-01

    May 1, 2016 ... gastroenteritis to severe and sometimes fatal dysentery, cholera, or typhoid [3]. ... Their presence in drinking water indicates that disease-causing .... Wells constructed should be properly ringed and covered to avoid the ...

  12. Narkootilise ja psühhotroopse aine suures koguses ebaseaduslik käitlemine suure varalise kasu saamise eesmärgil : [magistritöö] / Kerli Lepik ; Tartu Ülikool, õigusteaduskond ; juhendaja: Jaan Ginter

    Index Scriptorium Estoniae

    Lepik, Kerli, 1989-

    2013-01-01

    Suures koguses narkootilise ja psühhotroopse aine käsitlemisest, suure varalise kasu saamise eesmärgist, võrdlus teiste Euroopa riikidega (EL, Läti, Leedu, Soome, Norra, Tšehhi), suurest varalisest kasust kui koosseisutunnusest ja alternatiividest

  13. A Microstructural Comparison of the Initial Growth of AIN and GaN Layers on Basal Plane Sapphire and SiC Substrates by Low Pressure Metalorganic Chemical Vapor Depositon

    Science.gov (United States)

    George, T.; Pike, W. T.; Khan, M. A.; Kuznia, J. N.; Chang-Chien, P.

    1994-01-01

    The initial growth by low pressure metalorganic chemical vapor deposition and subsequent thermal annealing of AIN and GaN epitaxial layers on SiC and sapphire substrates is examined using high resolution transmission electron microscopy and atomic force microscopy.

  14. Jõekääru Jazz täitis eesmärgi nii korraldajate, esinejate kui publiku poolelt / Allan Liik, Hedvig Hanson, Andre Maaker, Ain Agan...[jt.] ; foto ja küsitl. Kaire Tensuda

    Index Scriptorium Estoniae

    2007-01-01

    Jõekääru Jazz'ile järgneval nädalal tõi ürituse peakorraldaja Allan Liik toimetusse seal esinenud muusikud. Vestlusringis olid: Allan Liik, Hedvig Hanson, Andre Maaker, Ain Agan, Raivo Tafenau ja Sergio Bastos

  15. Narkootilise ja psühhotroopse aine suures koguses ebaseaduslik käitlemine suure varalise kasu saamise eesmärgil : [magistritöö] / Kerli Lepik ; Tartu Ülikool, õigusteaduskond ; juhendaja: Jaan Ginter

    Index Scriptorium Estoniae

    Lepik, Kerli, 1989-

    2013-01-01

    Suures koguses narkootilise ja psühhotroopse aine käsitlemisest, suure varalise kasu saamise eesmärgist, võrdlus teiste Euroopa riikidega (EL, Läti, Leedu, Soome, Norra, Tšehhi), suurest varalisest kasust kui koosseisutunnusest ja alternatiividest

  16. Jõekääru Jazz täitis eesmärgi nii korraldajate, esinejate kui publiku poolelt / Allan Liik, Hedvig Hanson, Andre Maaker, Ain Agan...[jt.] ; foto ja küsitl. Kaire Tensuda

    Index Scriptorium Estoniae

    2007-01-01

    Jõekääru Jazz'ile järgneval nädalal tõi ürituse peakorraldaja Allan Liik toimetusse seal esinenud muusikud. Vestlusringis olid: Allan Liik, Hedvig Hanson, Andre Maaker, Ain Agan, Raivo Tafenau ja Sergio Bastos

  17. Impact of cooling condition on the crystal structure and surface quality of preferred c-axis-oriented AIN films for SAW devices

    Institute of Scientific and Technical Information of China (English)

    ZHANG Geng-yu; YANG Bao-he; ZHAO Jian; LI Cui-ping; LI Ming-ji

    2011-01-01

    AIN films with preferred c-axis orientation are deposited on Si substrates using the radio frequency (RF) magnetron sputtering method. The post-processing is carried out under the cooling conditions including high vacuum, low vacuum under deposition gas ambient and low vacuum under dynamic N2 ambient. Structures and morphologies of the films are analyzed by X-ray diffraction (XRD) and atomic force microscopy (AFM). The hardness and Young's modulus are investigated by the nanoindenter. The experimental results indicate that the (100) and (110) peak intensities decrease in the XRD spectra and the root-mean-square of roughness (Rrms) of the film decreases gradually with the increase of the cooling rate. The maximum values of the hardness and Young's modulus are obtained by cooling in low vacuum under deposition gas ambient. The reason for orientation variation of the films is explained from the perspective of the Al-N bond formation.

  18. Evaluation of the impact of water harvesting techniques on the evolution of piezometric head of Ain El Bidha groundwater in Kairouan at the Central part of Tunisia

    Science.gov (United States)

    Mechergui, M. Mohamed; Henda Saoudi, Mme

    2016-04-01

    This study aims to assess the impact of water harvesting constructed hydraulic structures (big and small dams, terraces, seuils for recharge…) on the evolution of piezometric head of Ain El Beidha groundwater table. The measurements of depth of water table, taken at the end of rain season and at the end of irrigation season, in many piezometers and monitoring wells, for a long period of observation before and after implementation of all the hydraulic structures, were used with the cumulative rain to the highest water table to diagnostic the effect of natural recharge and constructed hydraulic structures. According to the analysis of curves illustrating the evolution of piezometric head and rainfall over time, it was shown that despite the fact that the same amount of rain fall on the total area in the limits of Ain El Beidha groundwater table, the piezometers respond differently. This is because there are many sources of recharge and many factors affecting the recharge. First of all, the aquifer is divided in four compartments (the calcareous formation of Djebel El Houyareb, the plio-quaternary formation, the Miocene formation: Baglia and Saouaf). All those respond differently to the recharge by their capacity of infiltration and their hydrodynamic characteristics. The recharge of the groundwater table was increased by the implementation of small soil and water conservation structures, artificial lakes, El Haouareb Dam, run off in the natural Oued bads and seuils for recharge installed in the bads of oueds. The different piezometric drown maps were used to determine the flow direction and hydraulic gradient in order to identify the recharge areas, while tracking maps for three equal piezometric heads 210 m 300 m and 370 m established over different years made it possible to assess the impact of hydraulic structures, namely the effect of SWC and Ben Zitoun Lake. To illustrate the impact of El Houareb dam on the groundwater, the piezometric maps and local values

  19. Eesti väärib paremat / Jaak Aaviksoo

    Index Scriptorium Estoniae

    Aaviksoo, Jaak, 1954-

    2006-01-01

    Ilmunud ka: Virumaa Teataja, Põhjarannik, Severnoje Poberezhje, Meie Maa, Vooremaa 3. okt. lk. 11,2,2,2,2, Sakala, Pärnu Postimees, Sõnumitooja 4. okt. lk. 2,15,2, Lõunaleht 5. okt. lk. 2, Kuulutaja, Vali Uudised 6. okt. lk. 6,2, Järva Teataja 7. okt. lk. 2. Autori sõnul on Eestis tajutav usalduskriis, mille põhjuseks on eetiliste piiride kadumine meie poliitilistest otsustest. Ta toob välja kolm arenguprioriteeti riigi edasiseks arenguks

  20. Eesti väärib paremat / Jaak Aaviksoo

    Index Scriptorium Estoniae

    Aaviksoo, Jaak, 1954-

    2006-01-01

    Ilmunud ka: Virumaa Teataja, Põhjarannik, Severnoje Poberezhje, Meie Maa, Vooremaa 3. okt. lk. 11,2,2,2,2, Sakala, Pärnu Postimees, Sõnumitooja 4. okt. lk. 2,15,2, Lõunaleht 5. okt. lk. 2, Kuulutaja, Vali Uudised 6. okt. lk. 6,2, Järva Teataja 7. okt. lk. 2. Autori sõnul on Eestis tajutav usalduskriis, mille põhjuseks on eetiliste piiride kadumine meie poliitilistest otsustest. Ta toob välja kolm arenguprioriteeti riigi edasiseks arenguks

  1. NATO laienemine peab jätkuma / Jaak Aaviksoo

    Index Scriptorium Estoniae

    Aaviksoo, Jaak, 1954-

    2008-01-01

    Albaania ja Horvaatia kirjutasid alla NATO liitumisprotokollidele. Kaitseminister tõstab esile nende pingutusi liitumiseks NATO-ga ning nende panust Afganistanis ning leiab, et NATO ja küllap tulevikus ka EL-i laienemisega Balkanile täidame oma auvõla. NATO laienemisest

  2. Ülikool peab muutunud oludega kohanema / Jaak Aaviksoo

    Index Scriptorium Estoniae

    Aaviksoo, Jaak, 1954-

    2009-01-01

    Eestis seostub Euroopa Liidu üks suuremaid ühiseid haridusettevõtmisi - nn Bologna reform - eelkõige 3+2-süsteemi kasutuselevõtuga. Samal teemal: Kalm, Volli. Bologna protsess ja massikõrgharidus : David Coyne'i seisukohtade kommentaariks

  3. Silmapiiril negatiivne eelarve vol. 2 / Raivo Sormunen

    Index Scriptorium Estoniae

    Sormunen, Raivo, 1976-

    2008-01-01

    Aprilli maksutulude laekumine näitab, et sügisel võib Eestit oodata veel teine negatiivne lisaeelarve. Diagrammid: Maksude laekumine. Kommenteerivad: Taavi Veskimägi, Ain Seppik, Ivari Padar, Aivar Sõerd ja Jürgen Ligi

  4. Res Publica eelnõu Hanschmidti asjas tekitab vastakaid arvamusi / Gert D. Hankewitz

    Index Scriptorium Estoniae

    Hankewitz, Gert D.

    2005-01-01

    Res Publica esitas Riigikogule eelnõu, mis peab vajalikuks tellida Ühispanga endise juhi Ain Hanschmidti tegemiste uurimiseks sõltumatu audit väliseksperdilt. Vt. samas: Taavi Veskimägi. Skandaal heidab varju Eesti Pangale; Hanschmidti skandaal lahvatas 700 miljoni kroonise kingituse peale

  5. Res Publica eelnõu Hanschmidti asjas tekitab vastakaid arvamusi / Gert D. Hankewitz

    Index Scriptorium Estoniae

    Hankewitz, Gert D.

    2005-01-01

    Res Publica esitas Riigikogule eelnõu, mis peab vajalikuks tellida Ühispanga endise juhi Ain Hanschmidti tegemiste uurimiseks sõltumatu audit väliseksperdilt. Vt. samas: Taavi Veskimägi. Skandaal heidab varju Eesti Pangale; Hanschmidti skandaal lahvatas 700 miljoni kroonise kingituse peale

  6. Merepäevade turismikonverents "Mis saab pärast kultuuripealinna aastat?"

    Index Scriptorium Estoniae

    2011-01-01

    Tallinna Merepäevade raames 15. juulil 2011 toimunud turismikonverentsist, mille korraldasid Tallinna Sadam ja SA Tallinn 2011ning kus esinesid Taavi Aas, Ain Kaljurand, Jaanus Mutli, Evelyn Sepp, Helena Tšistova-Pohlak, Paul Aguraiuja, Gisela Müller

  7. Merepäevade turismikonverents "Mis saab pärast kultuuripealinna aastat?"

    Index Scriptorium Estoniae

    2011-01-01

    Tallinna Merepäevade raames 15. juulil 2011 toimunud turismikonverentsist, mille korraldasid Tallinna Sadam ja SA Tallinn 2011ning kus esinesid Taavi Aas, Ain Kaljurand, Jaanus Mutli, Evelyn Sepp, Helena Tšistova-Pohlak, Paul Aguraiuja, Gisela Müller

  8. ERKI moe ülevaatus pakkus täismajale toreda õhtu / Tiiu Oga

    Index Scriptorium Estoniae

    Oga, Tiiu

    2007-01-01

    Eesti Kunstiakadeemia 13.01.2007 Salme kultuurikesksuses toimunud moeetendusest. Lavastaja Kaarel Väli, graafiline kujundus Eiko Ojala, videokunstnikud Taavi Varm ja Aleks Tenusaar koos RGB-ga, lavaline kujundus Ain Nurmela, valguskunstnik Meelis Lusmägi koos ET Valgusega. Korraldajad Jaanika Terasmaa ja Ester Kannelmäe

  9. Tallinna Merepäevade turismikonverents

    Index Scriptorium Estoniae

    2012-01-01

    13. juulil Lennusadama angaarides toimunud turismikonverentsist "Lennukad ideed Lennusadamas", kus esinesid Tallinna abilinnapea Taavi Aas, Tallinna Sadama ärisuunajuht Ahto Ader, müügijuht Aare Maurer, EHTE arenduse ja uuringute osakonna juhataja Ain Hinsberg, kes rääkis projektist "Cultural Tourism 2011", Tallinna Lennujaama juhatuse esimees Rein Loik, Lennusadama tegevjuht Ott Sarapuu

  10. Tallinna Merepäevade turismikonverents

    Index Scriptorium Estoniae

    2012-01-01

    13. juulil Lennusadama angaarides toimunud turismikonverentsist "Lennukad ideed Lennusadamas", kus esinesid Tallinna abilinnapea Taavi Aas, Tallinna Sadama ärisuunajuht Ahto Ader, müügijuht Aare Maurer, EHTE arenduse ja uuringute osakonna juhataja Ain Hinsberg, kes rääkis projektist "Cultural Tourism 2011", Tallinna Lennujaama juhatuse esimees Rein Loik, Lennusadama tegevjuht Ott Sarapuu

  11. Application of a TiAIN coating for the increase wear resistance of a passage floodgate manufactured in steel T9; Aplicacion de un recubrimiento de TiAIN para el incremento de la resistencia al desgaste de una compuerta de paso fabricada en acero T9

    Energy Technology Data Exchange (ETDEWEB)

    Montes de Oca, J.; Gonzalez, H. J. [Centro de Investigacion en Ciencia Aplicada y Tecnologia Avanzada, IPN, Unidad Altamira, Km. 14.5 Carretera Tampico-Puerto industrial Altamira, 89600 Altamira, Tamaulipas (Mexico); Solis, E. [Hy-Teck Fluid Power, Blvd. A. Lopez Mateos No. 310, Col. Nuevo Aeropuerto, 89337 Tampico, Tamaulipas (Mexico); Moreno, J. [Departamento de Ingenieria Metalurgica, Escuela Superior de Ingenieria Quimica e Industrias Extractivas, IPN, UPALM Unidad Zacatenco, 07730 Mexico D. F. (Mexico); Munoz S, J. [Centro de Investigacion y de Estudios Avanzados, Unidad Queretaro, Libramiento Norponiente No. 2000, Fracc. Real de Juriquilla, 76230 Santiago de Queretaro, Queretaro (Mexico)], e-mail: jmontedeocav@ipn.mx

    2009-07-01

    The present work reports a study to increase wear resistance of a ball passage floodgate (steel type T9) trough the application of a thick film (coating). This study have included a material and process selection, synthesis of the coating on steel plates as substrates and spherical device, assembling of the coated floodgate on the ball valves, and finally an evaluation of the valves in the process of a thermoelectric power station. Taking into account the different requirements, a TiAIN coating prepared by cathodic arc evaporation was finally retained. The crystal structure, morphology and chemical composition of the coating were evaluated by x-ray diffraction (XRD) and scanning electron microscopy equipped with an energy dispersive spectrometer (SEM-EDS). Finally, mechanical properties such as hardness and Young modulus were determined by nano indentation. (Author)

  12. Comparative Hydrological and Geoelectrical Study on the Quaternary Aquifer in the Deltas of Wadi Badaa and Ghweiba, El Ain El Sukhna Area, Northwest Suez Gulf, Egypt

    Directory of Open Access Journals (Sweden)

    M. M. El Osta

    2010-01-01

    Full Text Available El Ain El Sukhna area was selected in the last ten years to initiate many governmental and investmental programs. The different activities in that area depend mainly on the groundwater of the Quaternary aquifer, which forms the main water bearing strata. In the present work, twenty one geoelctrical soundings using the Schlumberger configuration are carried out at selected sites especially in missing parts from wells to delineate the groundwater setting in such sites. Eight of them are conducted in the close vicinity of water wells, where lithologs and pumping test data of these wells are available to relate hydrologic and geoelctric measurements. The pumping tests data are analyzed by using AQTESOLV program and the geolectrical sounding data were interpreted by partial curve matching technique to obtain the initial parameters. The results indicated that, the transmissivity is found to be closely related with transverse resistance and the hydraulic conductivity with average transverse resistivity, while the salinity is inversely related with resistivity. Finally, priority map for drilling water wells is constructed to make the results more illustrative and useful for decision maker. The promising area for drilling is located at the western portion of the study region.

  13. Influence of applied electric field on the absorption coefficient and subband distances in asymmetrical AIN/GaN coupled double quantum wells

    Institute of Scientific and Technical Information of China (English)

    Cen Long-Bin; Shen Bo; qin Zhi-Xin; Zhang Guo-Yi

    2009-01-01

    The influence of applied electric fields on the absorption coefficient and subband distances in asymmetrical AlN/GaN coupled double quantum wells (CDQWs) has been investigated by solving Schrodinger and Poisson equations self-consistently. It is found that the absorption coefficient of the intersubband transition (ISBT) between the ground state and the third excited state (1odd -2even) can be equal to zero when the electric fields are applied in asymmetrical A1N/GaN CDQWs,which is related to applied electric fields induced symmetry recovery of these states. Meanwhile,the energy distances between 1odd -2even and 1even - 2even subbands have different relationships from each other with the increase of applied electric fields due to the different polarization-induced potential drops between the lett and the right wells. The results indicate that an electrical-optical modulator operated within the opto-communication wavelength range can be realized in spite of the strong polarization-induced electric fields in asymmetrical AIN/GaN CDQWs.

  14. 不同厚度TiN和TiAlN涂层残留应力分析%Analysis on residual stress of various thickness of TiAIN and TiN coatings

    Institute of Scientific and Technical Information of China (English)

    王海洋; 曾传亮; 张祥林; 肖祥芷

    2011-01-01

    TiN and TiAIN coatings are often used in fine blanking dies. The phase variation of TiN and TiAIN coatings was analyzed by XRD in this research. The residual stress of TiN coating and substrate and TiAIN substrate was measured using sin2i|* method, and the microhardness of the coating was measured by microhardness tester. The results show that: there is obvious preferred orientation in the crystal surface of TiN coating (111) and (222), the residual stress of TiN coating ranges from -2 347 Mpa to-1920 Mpa, and that of the substrate from-154.9 Mpa to-69.21 Mpa, both of which decrease with the increase of coating thickness. The main phase composition of TiAIN coating is Ti3Al3N2 and there is preferred orientation in the crystal surface of (107). The residual stress of the substrate is between -123.7 Mpa to 469.5 Mpa, mainly in tensile stress state, which has a large influence on the die life and increases along with the coating thickness. The microhardness of TiN and TiAIN coatings also increases along with the film thickness.%TiN和TiAlN涂层常应用于精冲模,采用XRD技术分析了不同厚度TiN和TiAlN涂层的相变化,并采用Sin2Ψ法测量了TiN涂层和基体以及TiAlN基体的残留应力,应用显微硬度计测量了涂层的显微硬度.结果表明:TiN涂层(111)和(222)晶面存在明显择优取向,涂层残留应力分布在-2 347 ~ -1920MPa,基体残留应力分布在-154.9~-69.21 MPa,均随厚度增加而减小;TiAIN涂层主要相成分为Ti3Al3N2,且(107)晶面存在择优取向,基体残留应力分布在-123.7 ~ 469.5 MPa,主要呈拉应力状态,且随厚度增加而增大,对模具寿命有较大影响;TiN和TiAIN涂层显微硬度随厚度增加而增大.

  15. Haigekassa : mäng efektiivsuse piiril / Kärt Blumberg

    Index Scriptorium Estoniae

    Blumberg, Kärt

    2008-01-01

    Haigekassa tulud vähenevad 2009. aastal ligi miljard krooni. Tallinna Arstide Liidu juhatuse esimehe Toomas Kariisi hinnangul tähendab eelarve kärbe seda, et edaspidi hakatakse teenuseid pakkuma senisest vähem ja järjekorrad pikenevad. Poliitikauuringute keskuse Praxis juhi Ain Aaviksoo arvamus. Vt. samas: Haigekassal on varuks mitu varianti. Kommenteerib PERH-i juhatuse esimees ja haigekassa nõukogu liige Tõnis Allik

  16. Jebel Hafit and the Al Ain oases (Eastern Abu Dhabi, United Arab Emirates): an integrative approach of a cultural landscape through the scope of geodiversity

    Science.gov (United States)

    Giusti, Christian; Louchet, André; Beuzen-Waller, Tara; Ragala, Rachid; Pavlopoulos, Kosmas; Fouache, Éric; Cohen, Marianne; Desruelles, Stéphane; Gramond, Delphine

    2015-04-01

    human settlements and occupation, it is possible to characterize a threefold transition: first, the former transition between the pre-Islamic prehistoric societies and the development of Muslim societies; second, the more recent transition between the traditional historical society (farmers) and the contemporary society, characterized by the growth of urbanization, the creation of modern transport infrastructure and the concomitant growth of tourist flows; third, the current transition between the yesterday and tomorrow Al Ain City, due to the transformation of a local town centred on national economics all along the second half of the twentieth century, into an international town more open to the wider world with the management of a possible increased 20 % of tourist flow because of the inscription of Cultural Sites of Al Ain on the UNESCO's World Heritage List. It is not possible to completely ignore the fact that the Jebel Hafit and its foothills are partly crossed by an international boundary. In case of political tensions, this may cause some difficulties for the management of this territory, with contradictory requirements between security, tourism, traditional land use, and scientific research.

  17. Caractérisation et préconcentration granulométrique de la matière feldspathique d'Ain-Barbar, Algérie

    Science.gov (United States)

    Djouama, M. C.; Bounouala, M.; Ain-Souya, A.; Ghers, M.

    2005-05-01

    Les feldspaths sont répandus dans l'écorce terrestre mais seuls les feldspaths potassiques et sodiques sont très recherchés dans l'industrie céramique et verrière. Pour qu'ils soient utilisables, ces matériaux doivent contenir très peu d'impuretés nocives de fer et surtout de silice. La carrière d'Ain-Barbar exploite la matière feldspathique de teneurs moyennes respectives 74,5% SiO{2}, 9,5% 12,75% Al{2}O{3}, 1,30% Fe{2}O{3} et 9,5 K{2}O (0,90% Na{2}O). Toutefois, on constate un taux très élevé en quartz ce qui diminue la valeur du produit marchand et une teneur élevée en fer ce qui donne au produit fabriqué, des aspects de coloration le rendant impropre à la commercialisation. A cet effet, une caractérisation minéralogique et chimique a été réalisée sur une série d'échantillons prélevés du site d'extraction de la substance utile. Des essais de préconcentration granulométrique ont montré qu'un classement dimensionnel peut offrir une qualité de produits acceptables par les céramistes.

  18. Evolución del consumo y gasto farmacéutico público de anti-inflamatorios no esteroideos (aines) en el período 2001 - 2005 Evolution of public consumption and spending on non-steroidal anti-inflammatory drugs (nsaids) during the period 2001 to 2005

    OpenAIRE

    Patricia Barber Pérez; Melvin Morera Salas; Amada Aparicio Llanos; Yanira Xirinachs Salazar

    2007-01-01

    Este estudio observacional retrospectivo analizó el consumo y gasto farmacéutico de AINEs (antiinflamatorios no esteroideos) clásicos en Costa Rica en el periodo 2001-2005. Su objetivo es contribuir al conocimiento de la estructura de gasto y perfil de utilización y consumo farmacológico de este grupo de medicamentos con el fin de abordar con mayores garantías la gestión del irremediable proceso de aparición y previsible financiación pública de los AINEs de nueva generación en el país. Los AI...

  19. AIN Monolithic Microchannel Cooled Heatsink for High Power Laser Diode Array%应用于大功率激光二极管列阵的单片集成微通道制冷热沉

    Institute of Scientific and Technical Information of China (English)

    马杰慧; 方高瞻; 蓝永生; 马骁宇

    2005-01-01

    介绍了一种应用于大功率激光二极管列阵的新型单片集成微通道制冷热沉.这种热沉已制造并经过测试.10叠层的激光二极管列阵的热阻为0.121℃/W.相邻两个激光条的间距是1.17mm.在20%高占空比条件下,波长为808nm左右,峰值功率可以达到611W.%A novel AIN monolithic microchannel cooled heatsink for high power laser diode array is introduced.The high power stack laser diode array with an AIN monolithic microchannel heatsink is fabricated and tested.The thermal impedance of a 10 stack laser diode array is 0.121℃/W.The pitch between two adjacent bars is 1.17mm.The power level of 611W is achieved under the 20% duty factor condition at an emission wavelength around 808nm.

  20. Saeveskeid kollitab palgipuudus / Ain Alvela

    Index Scriptorium Estoniae

    Alvela, Ain, 1967-

    2007-01-01

    Palgitoorme nappus ja teravnev konkurents metsatööstusettevõtete seas on toonud kaasa saeveskite tooraine hinna tõusu ja koondamiste laine puidufirmades. Tabelid: Puidutööstuse eksport ja import 2007. aasta 1. poolaastal. Joonised: Raie riigi- ja erametsadest (2001-2006); Ümarpuidu hind RMK (Riigimetsa Majandamise Keskuse) metsades (1999-2007); Ümarpuidu import; Männipalgi keskmine hind RMK vahelaos. Diagramm: Okaspuu saematerjali ekspordihind Eestis ja Soomes

  1. Fantaasia killapeod : [rets.] / Ain Kaalep

    Index Scriptorium Estoniae

    Kaalep, Ain, 1926-

    1997-01-01

    Ilm.: Looming 1968, nr. 10, lk. 1592-1595 . Rets. rmt.: Alliksaar, Artur. Nimetu saar. Tallinn : Perioodika, 1966. 80 lk. (Loomingu Raamatukogu; 1966, 7); Alliksaar, Artur. Olematus võiks ju ka olemata olla. Tallinn ; Perioodika, 1968. 80 lk. (Loomingu Raamatukogu; 1968, 9/10).

  2. Endasse kapseldunud aine / Edgar Krull

    Index Scriptorium Estoniae

    Krull, Edgar, 1948-

    2002-01-01

    IEA (International Association for Evaluation of Educational Achievement = Rahvusvaheline Assotsiatsioon Haridussaavutuste Hindamiseks) kodanikuõpetuse uurimusest 28 riigis. Kodanikuõpetuse teadmiste, sellest arusaamise tasemest Euroopas, postsotsialistlikes riikides, Eestis

  3. Endasse kapseldunud aine / Edgar Krull

    Index Scriptorium Estoniae

    Krull, Edgar, 1948-

    2002-01-01

    IEA (International Association for Evaluation of Educational Achievement = Rahvusvaheline Assotsiatsioon Haridussaavutuste Hindamiseks) kodanikuõpetuse uurimusest 28 riigis. Kodanikuõpetuse teadmiste, sellest arusaamise tasemest Euroopas, postsotsialistlikes riikides, Eestis

  4. Fantaasia killapeod : [rets.] / Ain Kaalep

    Index Scriptorium Estoniae

    Kaalep, Ain, 1926-

    1997-01-01

    Ilm.: Looming 1968, nr. 10, lk. 1592-1595 . Rets. rmt.: Alliksaar, Artur. Nimetu saar. Tallinn : Perioodika, 1966. 80 lk. (Loomingu Raamatukogu; 1966, 7); Alliksaar, Artur. Olematus võiks ju ka olemata olla. Tallinn ; Perioodika, 1968. 80 lk. (Loomingu Raamatukogu; 1968, 9/10).

  5. Pensionide maksustamine muutub lihtsamaks / Taavi Veskimägi

    Index Scriptorium Estoniae

    Veskimägi, Taavi, 1974-

    2005-01-01

    Tulumaksuseaduse muutmise eelnõust, mis puudutab pensionide maksustamist. Sama ka Vali Uudised 4. veeb. 2005, lk. 4 ; Põhjarannik 3. veeb. 2005, lk. 4 ; Hiiu Leht 4. veeb. 2005, lk. 7 ; Võrumaa Teataja 5. veeb. 2005, lk. 2 ; Lääne Elu 5. veeb. 2005, lk. 2 ; Koit 3. veeb. 2005, lk. 4 ; Elva Postipoiss 5. veeb. 2005, lk. 2 ; Türi Rahvaleht 4. veeb. 2005, lk. 4 ; Meie Maa 5. veeb. 2005, lk. 5 ; Pärnu Postimees 5. veeb. 2005, lk. 15 ; Sõnumitooja 9. veeb. 2005, lk. 6 ; Virumaa Teataja 8. veeb. 2005, lk. 7 ; Valgamaalane 8. veeb. 2005, lk. 2 ; Vooremaa 19. veeb. 2005, lk. 2 ; Sakala 17. veeb. 2005, lk. 5

  6. Elektrimajanduse piiratud valikud / Taavi Veskimägi

    Index Scriptorium Estoniae

    Veskimägi, Taavi, 1974-

    2007-01-01

    Ilmunud ka: Virumaa Teataja, 17. aug. 2007, lk. 15; Hiiu Leht, 17. aug. 2007, lk. 2; Harju Ekspress, 17. aug. 2007, lk. 6; Põhjarannik, 17. aug. 2007, lk. 2; Severnoje Poberezhje, 17. aug. 2007, lk. 2; Meie Maa, 17. aug. 2007, lk. 2; Elva Postipoiss, 18. aug. 2007, lk. 4; Oma Saar, 22. aug. 2007, lk. 5; Vali Uudised, 22. aug. 2007, lk. 2; Vooremaa, 28. aug. 2007, lk. 2; Sakala, 6. sept. 2007, lk. 2. Eesti energiapoliitikast. Autor leiab, et kuna tulevikus on Eesti elektrimajanduses valikute hulk üsna kasin, on praegu kõik uued lahendused elektrimajanduses kaalumist väärt ning parimaks lahenduseks on Eestile energiaallikate ja tootjate mitmekesisus

  7. Raamat päästab Võtikvere / Taavi Arus

    Index Scriptorium Estoniae

    Arus, Taavi

    2007-01-01

    Võtikvere kaheksandad raamatuküla päevad, mille külalisteks olid ka Kadri Kõusaar, Jürgen Rooste, Kärt Hellerma, Jan Kaus jt. ning eesti kirjanduse tõlkijad Heidi Granqvist Rootsist ja Turid Farbregd Norrast

  8. Siili teavituskampaania tagas ajaloo suurima õppuse toimumise / Taavi Karotamm

    Index Scriptorium Estoniae

    Karotamm, Taavi

    2016-01-01

    2015. a. mais toimunud Kaitseväe suurõppuse "Siil" teavituskampaaniast. Eesti Kaitsevägi pälvis "Kaitseväe ja Eesti vabariigi ajaloo suurima sõjalise õppuse Siil 2015 mainekampaania" eest konkursil Suhtekorralduse auhind 2015 eripreemia

  9. Balti rahvaste liitmisest ja lahutamisest / Eerik Purje ; fotod: Taavi Tamtik

    Index Scriptorium Estoniae

    Purje, Eerik, 1927-

    2012-01-01

    Teisipäeval, 1. mai õhtul pidas Tartu College'i saalis ingliskeelse loengu temal "The Baltic States: Moving Together or Apart?" Tartu Ülikooli Balti poliitika professor ja Eesti Välispoliitika Instituudi direktor dr Andres Kasekamp

  10. Visuaalse kultuuri vitamiinid festivali näituseprogrammis / Taavi Tatsi

    Index Scriptorium Estoniae

    Tatsi, Taavi

    2007-01-01

    Tartu visuaalse kultuuri festivali "Maailmafilm" kolmest näitusest. Prantslase Anne Testut' fotonäitus "Eurooplased lauas" (23.03.-15.04.2007) ja "Kaljujoonised Lõuna-Aafrikas" (26.03.-1.04.2007) Eesti Rahva Muuseumis ning Kanada põlisrahvaste graafikanäitus "Kaarnad, hundid, seitse konna ja üks lehm" (28.03.-22.04.2007) Ateena kinos

  11. Indrek Mandre ellujäämisvalem / Taavi Raudne

    Index Scriptorium Estoniae

    Raudne, Taavi

    2004-01-01

    Puiduärimees Indrek Mandre elust, teenistusest Nõukogude armees, äritegevusest, vaidlusest maksuametiga kümne miljoni krooni tagastamata käibemaksu pärast ning tema toetuseks korraldatud kampaaniatest. Vt. samas: Mandre soovib selgitust

  12. Raamat päästab Võtikvere / Taavi Arus

    Index Scriptorium Estoniae

    Arus, Taavi

    2007-01-01

    Võtikvere kaheksandad raamatuküla päevad, mille külalisteks olid ka Kadri Kõusaar, Jürgen Rooste, Kärt Hellerma, Jan Kaus jt. ning eesti kirjanduse tõlkijad Heidi Granqvist Rootsist ja Turid Farbregd Norrast

  13. Pensionide maksustamine muutub lihtsamaks / Taavi Veskimägi

    Index Scriptorium Estoniae

    Veskimägi, Taavi, 1974-

    2005-01-01

    Tulumaksuseaduse muutmise eelnõust, mis puudutab pensionide maksustamist. Sama ka Vali Uudised 4. veeb. 2005, lk. 4 ; Põhjarannik 3. veeb. 2005, lk. 4 ; Hiiu Leht 4. veeb. 2005, lk. 7 ; Võrumaa Teataja 5. veeb. 2005, lk. 2 ; Lääne Elu 5. veeb. 2005, lk. 2 ; Koit 3. veeb. 2005, lk. 4 ; Elva Postipoiss 5. veeb. 2005, lk. 2 ; Türi Rahvaleht 4. veeb. 2005, lk. 4 ; Meie Maa 5. veeb. 2005, lk. 5 ; Pärnu Postimees 5. veeb. 2005, lk. 15 ; Sõnumitooja 9. veeb. 2005, lk. 6 ; Virumaa Teataja 8. veeb. 2005, lk. 7 ; Valgamaalane 8. veeb. 2005, lk. 2 ; Vooremaa 19. veeb. 2005, lk. 2 ; Sakala 17. veeb. 2005, lk. 5

  14. Kelle pension vajab enim tõstmist? / Taavi Rõivas

    Index Scriptorium Estoniae

    Rõivas, Taavi, 1979-

    2007-01-01

    Riigikogu liikme sõnul näeb Reformierakond vajadust tõsta eeskätt praeguste vanemate pensionäride pensioni, Keskerakonna esitatud pensioniseaduse muudatus aga viiks praegu töötavate inimeste tulevikupensioni tõusule. Ta selgitab pensioni kujunemist ning kutsub inimesi oma arvamust avaldama, kelle pension peaks praegu olema esikohal

  15. Visuaalse kultuuri vitamiinid festivali näituseprogrammis / Taavi Tatsi

    Index Scriptorium Estoniae

    Tatsi, Taavi

    2007-01-01

    Tartu visuaalse kultuuri festivali "Maailmafilm" kolmest näitusest. Prantslase Anne Testut' fotonäitus "Eurooplased lauas" (23.03.-15.04.2007) ja "Kaljujoonised Lõuna-Aafrikas" (26.03.-1.04.2007) Eesti Rahva Muuseumis ning Kanada põlisrahvaste graafikanäitus "Kaarnad, hundid, seitse konna ja üks lehm" (28.03.-22.04.2007) Ateena kinos

  16. Kohalike omavalitsuste tuludest / Taavi Veskimägi

    Index Scriptorium Estoniae

    Veskimägi, Taavi, 1974-

    2004-01-01

    Ilmunud ka: Meie Maa, 20. juuli 2004, lk. 2; Koit, 20. juuli 2004, lk. 6; Võrumaa Teataja, 20. juuli 2004, lk. 2; Sõnumitooja, 21. juuli 2004, lk. 6; Vali Uudised, 21. juuli 2004, lk. 2; Vooremaa, 22. juuli 2004, lk 2; Pärnu Postimees, 23. juuli 2004, lk. 11; Hiiu Leht, 23. juuli 2004, lk. 2; Lääne Elu, 24. juuli 2004, lk. 2; Virumaa Teataja, 27. juuli 2004, lk. 2; Järva Teataja, 3. aug. 2004, lk. 2. Kohalike omavalitsuste eelarveprobleemidest

  17. Kohaliku omaalgatuse programm paneb maaelule õla alla / Taavi Tuur

    Index Scriptorium Estoniae

    Tuur, Taavi

    2005-01-01

    Kohaliku omaalgatuse programm on riigieelarvest rahastatav regionaalse arengu programm, mille eesmärk on kohalik areng ja piirkondade konkurentsivõime suurenemine kogukonna kaasamise ja tugevdamise kaudu

  18. Kohalike omavalitsuste tuludest / Taavi Veskimägi

    Index Scriptorium Estoniae

    Veskimägi, Taavi, 1974-

    2004-01-01

    Ilmunud ka: Meie Maa, 20. juuli 2004, lk. 2; Koit, 20. juuli 2004, lk. 6; Võrumaa Teataja, 20. juuli 2004, lk. 2; Sõnumitooja, 21. juuli 2004, lk. 6; Vali Uudised, 21. juuli 2004, lk. 2; Vooremaa, 22. juuli 2004, lk 2; Pärnu Postimees, 23. juuli 2004, lk. 11; Hiiu Leht, 23. juuli 2004, lk. 2; Lääne Elu, 24. juuli 2004, lk. 2; Virumaa Teataja, 27. juuli 2004, lk. 2; Järva Teataja, 3. aug. 2004, lk. 2. Kohalike omavalitsuste eelarveprobleemidest

  19. Elektrimajanduse piiratud valikud / Taavi Veskimägi

    Index Scriptorium Estoniae

    Veskimägi, Taavi, 1974-

    2007-01-01

    Ilmunud ka: Virumaa Teataja, 17. aug. 2007, lk. 15; Hiiu Leht, 17. aug. 2007, lk. 2; Harju Ekspress, 17. aug. 2007, lk. 6; Põhjarannik, 17. aug. 2007, lk. 2; Severnoje Poberezhje, 17. aug. 2007, lk. 2; Meie Maa, 17. aug. 2007, lk. 2; Elva Postipoiss, 18. aug. 2007, lk. 4; Oma Saar, 22. aug. 2007, lk. 5; Vali Uudised, 22. aug. 2007, lk. 2; Vooremaa, 28. aug. 2007, lk. 2; Sakala, 6. sept. 2007, lk. 2. Eesti energiapoliitikast. Autor leiab, et kuna tulevikus on Eesti elektrimajanduses valikute hulk üsna kasin, on praegu kõik uued lahendused elektrimajanduses kaalumist väärt ning parimaks lahenduseks on Eestile energiaallikate ja tootjate mitmekesisus

  20. Balti rahvaste liitmisest ja lahutamisest / Eerik Purje ; fotod: Taavi Tamtik

    Index Scriptorium Estoniae

    Purje, Eerik, 1927-

    2012-01-01

    Teisipäeval, 1. mai õhtul pidas Tartu College'i saalis ingliskeelse loengu temal "The Baltic States: Moving Together or Apart?" Tartu Ülikooli Balti poliitika professor ja Eesti Välispoliitika Instituudi direktor dr Andres Kasekamp

  1. Siili teavituskampaania tagas ajaloo suurima õppuse toimumise / Taavi Karotamm

    Index Scriptorium Estoniae

    Karotamm, Taavi

    2016-01-01

    2015. a. mais toimunud Kaitseväe suurõppuse "Siil" teavituskampaaniast. Eesti Kaitsevägi pälvis "Kaitseväe ja Eesti vabariigi ajaloo suurima sõjalise õppuse Siil 2015 mainekampaania" eest konkursil Suhtekorralduse auhind 2015 eripreemia

  2. Robin Hood tuleb / Taavi Veskimägi

    Index Scriptorium Estoniae

    Veskimägi, Taavi, 1974-

    2002-01-01

    Ilmunud ka: Põhjarannik, Severnoje Poberezhje 24. august lk. 2, Estonija 25. august lk. 2, Nädaline 24. august lk. 4, Valgamaalane 24. august lk. 2, Hiiumaa 24. august lk. 3, Lääne-Harju Ekspress 31. august lk. 4, Järva Teataja 3. september lk. 2, Vooremaa 3. september lk. 7, Virumaa Teataja 6. september lk. 7, Koit 5. september lk. 6. Autori arvates võiks üksikisiku tulumaksust 100% jääda kohalikele omavalitsustele. Autor: Res Publica

  3. Emajõe Ateena kadunud aarded / Taavi Minnik

    Index Scriptorium Estoniae

    Minnik, Taavi, 1986-

    2015-01-01

    Baltisaksa orientalisti Otto von Richteri surma järel tema pere poolt keiserlikule Tartu ülikoolile annetatud kunsti- ning raamatukogu saatusest. Esimese maailmasõja ajal evakueeriti enamik keiserliku Tartu ülikooli varadest Venemaale Voroneži, kuhu asus ka suur osa õppejõududest ning üliõpilastest. Millised on tänapäeval võimalused need aarded Eestisse tagasi tuua

  4. Robin Hood tuleb / Taavi Veskimägi

    Index Scriptorium Estoniae

    Veskimägi, Taavi, 1974-

    2002-01-01

    Ilmunud ka: Põhjarannik, Severnoje Poberezhje 24. august lk. 2, Estonija 25. august lk. 2, Nädaline 24. august lk. 4, Valgamaalane 24. august lk. 2, Hiiumaa 24. august lk. 3, Lääne-Harju Ekspress 31. august lk. 4, Järva Teataja 3. september lk. 2, Vooremaa 3. september lk. 7, Virumaa Teataja 6. september lk. 7, Koit 5. september lk. 6. Autori arvates võiks üksikisiku tulumaksust 100% jääda kohalikele omavalitsustele. Autor: Res Publica

  5. Eesti luuletaja päris oma prantsuse luuleraamat. August Sanga, Jaan Krossi ja Ain Kaalepi loomingust 1960. aastail / An Estonian Poet’s Own Book of French Poetry. About the Works of August Sang, Jaan Kross and Ain Kaalep in the 1960s

    Directory of Open Access Journals (Sweden)

    Katre Talviste

    2013-12-01

    Full Text Available This article positions the translations of French verse works (plays and selected collections of individual poets that August Sang, Jaan Kross and Ain Kaalep made in the 1960s, onto the background of their own original works. At that time, August Sang translated four plays by Molière (The Misanthrope, Tartuffe, The School for Wives in 1961; Amphitryon in 1961, which have already been discussed in relation to the tradition of translating the French syllabic verse into Estonian, because these translations form a considerable part of the body of Estonian translations of French verse poetry. For Jaan Kross and Ain Kaalep, the wider context is created by the so-called free verse battles in the 1950s, to which we can link Kross’ translation of a selected collection of Éluard (Veel enne kostma peab, 1969 and Kaalep’s translation of a selected collection of Prévert (Kuidas portreteerida lindu, 1965. One of the two remaining translations by Kross, (Rostand’s Cyrano de Bergerac, 1964, can also be examined in relation to the problems of translating verse, but the other, (Béranger’s Laulud, 1963, should be discussed in the framework of intellectual and cultural resistance, a part of which was also the struggle put up for the existence of free verse in the 1950s and 1960s. Of August Sang’s original work, the article examines his collection of poems Võileib suudlusega (1963, written simultaneously with his translations of Molière’s plays and published right after them. Both the translations and the collection of original poems have attracted critics’ attention with their remarkable lack of linguistic constraint and simplicity. Although Sang has rarely voiced theoretical ideas about translation or explained his method, both his poetic image, outlined in the collection Võileib suudlusega, and his search for right words, reflected in the drafts of his translations, let us believe that the simplicity of expression and the avoidance of marked

  6. Contribution of electromagnetic and tomographic technique to the study of the impact of salinity in soils of the experimental station of Al Ain Atti (Errachidia, Morocco)

    Science.gov (United States)

    Benamara, A.; El Harnafi, M.; Ammar, A.

    2017-03-01

    is closely related to the concentration of mineral particles. Characterization studies at the La Ronde tailings mine (Agnico-Eagle Ltd, in Abitibi), showed quite encouraging results (Campos, 2004; Anterrieu, 2006). Since it is a salt-bearing areas (highly conductive) and given that the induced polarization is very sensitive to the ground conductivity; by measurement of residual potential, so we took measures chargeability tomography, the result is compared to the resistivity measured at different soils (control and irrigated), which will better clarify the impact of salinity on the quality of the disturbed soil. Indeed, the chargeability response it possible to characterize the different irrigated soils and its variation is attributed not only to the effect of saline irrigation but also the existence of an heterogeneity of the original ground. Prospecting in electrical tomography has displayed vertically and horizontally anomalies existing within the experimental site of the station of Ain Al Atti, it showed that: - accumulation of salinity becomes wider going from the control ground to that of Acacias. - surveyed the ground at least appear more homogeneous in surface, but their conductivity varies in depth. - salinity origin and the concretion formed on the surface greatly influenced chargeability and resistivity measured on the different experimental soils.

  7. 15. XI kell 17 avatakse EKA galeriis...

    Index Scriptorium Estoniae

    2004-01-01

    Näitus "ERKI moe-show" 10 aastat", mille koostasid Karolin Kuusik, Gerli Liivamägi, Kristina Paju, Külli-Kerttu Siplane ja Agne Talu. Eksponeeritakse ka Jaanus Orgusaare, Vassilissa, Aldo Järvsoo ning Hula noortekollektsiooni esinemiste meeldejäävamaid hetki. 20. XI kinos Kosmos ERKI moeetendus "Go". Lavastuse autorid Taavet Jansen ja Oksana Titova, kunstiline juht Ain Nurmela, videokunstnik Taavi Warm, graafiline kujundus Martin Eelmalt, helikujundus Remi Prualilt

  8. 15. XI kell 17 avatakse EKA galeriis...

    Index Scriptorium Estoniae

    2004-01-01

    Näitus "ERKI moe-show" 10 aastat", mille koostasid Karolin Kuusik, Gerli Liivamägi, Kristina Paju, Külli-Kerttu Siplane ja Agne Talu. Eksponeeritakse ka Jaanus Orgusaare, Vassilissa, Aldo Järvsoo ning Hula noortekollektsiooni esinemiste meeldejäävamaid hetki. 20. XI kinos Kosmos ERKI moeetendus "Go". Lavastuse autorid Taavet Jansen ja Oksana Titova, kunstiline juht Ain Nurmela, videokunstnik Taavi Warm, graafiline kujundus Martin Eelmalt, helikujundus Remi Prualilt

  9. Concilier développement agricole et usage pérenne des eaux souterraines : un dialogue multi-acteurs dans la zone d’Ain Timguenay (province de Séfrou

    Directory of Open Access Journals (Sweden)

    Issam Sellika

    2016-10-01

    Full Text Available Au Maroc, l’utilisation des eaux souterraines pour l’irrigation a permis un développement agricole rapide dans de nombreuses régions, mais a aussi fait émerger des situations de baisse des niveaux piezométriques des nappes qui menacent la durabilité de cette agriculture irriguée. L’article présente une action de recherche portant sur la conception d’un projet de territoire agricole durable alliant développement agricole et usage pérenne des ressources en eau souterraine. L’étude a eu lieu dans la zone d’Ain Timguenay (province de Séfrou, qui connait un fort développement de la production de pommes et de prunes depuis une quinzaine d’années. Le programme de recherche a impliqué les agriculteurs, la commune rurale d’Ain Timguenay, les institutions du Ministère de l’Agriculture et l’Agence de bassin hydraulique du Sébou. Une analyse des dynamiques agricoles locales et des tendances nationales a servi de support aux discussions. L’étude de l’aquifère et de ses usages a permis d’établir un bilan sommaire et un ordre de grandeur des surfaces qui pourraient encore être plantées sans que les consommations en eau soient supérieures à la recharge de l’aquifère en année pluviométrique moyenne. Une réflexion prospective menée avec les agriculteurs a mis en évidence deux scénarios possibles à l’échelle locale: 1 un scénario où les difficultés économiques que rencontrent actuellement les exploitations de la zone se renforcent, conduisant à un ralentissement des nouvelles plantations, d’où une pression limitée sur la nappe ; 2 un scénario où les exploitations réussissent à faire face aux défis actuels de production et de commercialisation et de ce fait continuent à planter, ce qui conduit à une consommation en eau bien supérieure à la recharge de la nappe. L’ensemble des acteurs impliqués a participé à l’élaboration d’un troisième scénario permettant de concilier d

  10. Eesti kaitsmise võimalused ja väljakutsed / Jaak Aaviksoo

    Index Scriptorium Estoniae

    Aaviksoo, Jaak, 1954-

    2009-01-01

    Eesti riikluse korraldamisel ja kaitsmisel olulistest printsiipidest: eneseteadvus, eneseusk ja eneseväärikus olla võrdne teiste riikidega, tahe ja valmisolek vabaduse eest seista ning rahvusvahelise koostöö tähtus

  11. Sõjaraamatu hävitamisel on seos Eestiga / Hendrik Vosman, Tuuli Koch ; kommenteerinud Jaak Aaviksoo

    Index Scriptorium Estoniae

    Vosman, Hendrik

    2011-01-01

    Suurbritannia ajakirjaniku Toby Harndeni Afganistani sõda käsitlevast raamatust "Dead Men Risen: The Welsh Guards and the Real Story of Britain's War in Afganistan" ("Ülestõusnud surnud: Walesi kaardivägi ja tegelik lugu brittide sõjast Afganistanis"). Briti kaitseministeerium lükkab ümber Harndeni väite raamatu ümber puhkenud skandaali poliitilisest tagamaast, autori arvates kartis kaitseministeerium, et raamatus leiduv info võiks Eestit ärritada

  12. Sõjaraamatu hävitamisel on seos Eestiga / Hendrik Vosman, Tuuli Koch ; kommenteerinud Jaak Aaviksoo

    Index Scriptorium Estoniae

    Vosman, Hendrik

    2011-01-01

    Suurbritannia ajakirjaniku Toby Harndeni Afganistani sõda käsitlevast raamatust "Dead Men Risen: The Welsh Guards and the Real Story of Britain's War in Afganistan" ("Ülestõusnud surnud: Walesi kaardivägi ja tegelik lugu brittide sõjast Afganistanis"). Briti kaitseministeerium lükkab ümber Harndeni väite raamatu ümber puhkenud skandaali poliitilisest tagamaast, autori arvates kartis kaitseministeerium, et raamatus leiduv info võiks Eestit ärritada

  13. Inimelu väärtust rahas ei mõõda / Jaak Aaviksoo

    Index Scriptorium Estoniae

    Aaviksoo, Jaak, 1954-

    2008-01-01

    Ilmunud ka: Eesti Eest = Za Estoniju : Izdanije objedinenija "Sojuz Otetshestva i Res Publica" 16. okt. 2008, lk. 3. Kaitseminister selgitab, et 2009. aasta eelarves on sõjaliste kaitsekulutuste jaoks ette nähtud 1,9% sisemajanduse kogutoodangust, järgmiste aastate suurimad kuluartiklid kaitse-eelarves on seotud rahvusliku julgeolekuga

  14. Inimelu väärtust rahas ei mõõda / Jaak Aaviksoo

    Index Scriptorium Estoniae

    Aaviksoo, Jaak, 1954-

    2008-01-01

    Ilmunud ka: Eesti Eest = Za Estoniju : Izdanije objedinenija "Sojuz Otetshestva i Res Publica" 16. okt. 2008, lk. 3. Kaitseminister selgitab, et 2009. aasta eelarves on sõjaliste kaitsekulutuste jaoks ette nähtud 1,9% sisemajanduse kogutoodangust, järgmiste aastate suurimad kuluartiklid kaitse-eelarves on seotud rahvusliku julgeolekuga

  15. Globaalsus + lennundus = Star Alliance? / Ain Hinsberg

    Index Scriptorium Estoniae

    Hinsberg, Ain

    2002-01-01

    Erinevad koostöövormid lennufirmade vahel, alliansside teke ja areng maailmas. Maailma juhtivad lennundusalliansid ja nende poolt kaetud riigid ja sihtkohad. Kommenteerib Estonian Airi president Erki Urva

  16. Lahesõjas viik / Ain Hinsberg

    Index Scriptorium Estoniae

    Hinsberg, Ain

    2001-01-01

    Helsingi ja Tallinna vahel liikuvate laevafirmade konkurents: Silja Line, Nordic Jet Line, Tallink ja Linda Line. Tabelid: reisijad laevaliinil Helsingi-Tallinn 1998-2001; Helsingi-Tallinna liinil kiirlaevade turuosad 1999-2000

  17. Norma Maja astub kindlalt tulevikku / Ain Alvela

    Index Scriptorium Estoniae

    Alvela, Ain, 1967-

    2000-01-01

    AS Norma Maja saavutas kõrged kasumi ja kasumi kasvu näitajad töötajate koondamisega. Tabel: Norma Maja valdused, AS Norma Maja areng, AS ETK Majad areng. Arvamused: Ero Toom, Ivar Lahi ja Rein Loo

  18. Norma Maja astub kindlalt tulevikku / Ain Alvela

    Index Scriptorium Estoniae

    Alvela, Ain, 1967-

    2000-01-01

    AS Norma Maja saavutas kõrged kasumi ja kasumi kasvu näitajad töötajate koondamisega. Tabel: Norma Maja valdused, AS Norma Maja areng, AS ETK Majad areng. Arvamused: Ero Toom, Ivar Lahi ja Rein Loo

  19. Palmse haagised vallutavad Euroopat / Ain Alvela

    Index Scriptorium Estoniae

    Alvela, Ain, 1967-

    2016-01-01

    Peamiselt põllumajanduses kasutatavaid haagiseid tootev OÜ Palmse Metall kuulub Eesti metallitööstuses nende ettevõtete sekka, kes õnnestub toodangut ka piiri taga oma kaubamärgi all müüa. Vestlusest OÜ Palmse Metall juhatuse liikme ja osaniku Janar Kaldaga

  20. Lennart Mere viiest raamatust / Ain Kaalep

    Index Scriptorium Estoniae

    Kaalep, Ain, 1926-

    1997-01-01

    Varem ilmunud: Edasi 1976, 8. august, nr. 187, lk. 2. Rets. rmt.: Meri, Lennart. Kobrade ja karakurtide jälgedes: Kesk-Aasia matkamärkmeid. Tallinn: ERK, 1959. 158 lk.; Meri, Lennart. Laevapoisid rohelisel ookeanil. Tallinn : ERK, 1961. 175 lk.; Meri, Lennart. Tulemägede maale : reisipäevik 160. meridiaanilt. Tallinn : ERK, 1964. 264 lk.; Meri, Lennart. Virmaliste väraval: reisiraamat Tallinnast Beringi väina eskimote juurde. Tallinn : Eesti Raamat, 1974. lk. 328 lk. Meri, Lennart. Hõbevalge: reisikiri tuulest ja muinasluulest. Tallinn : Eesti Raamat, 1976. 488 lk.

  1. Lahesõjas viik / Ain Hinsberg

    Index Scriptorium Estoniae

    Hinsberg, Ain

    2001-01-01

    Helsingi ja Tallinna vahel liikuvate laevafirmade konkurents: Silja Line, Nordic Jet Line, Tallink ja Linda Line. Tabelid: reisijad laevaliinil Helsingi-Tallinn 1998-2001; Helsingi-Tallinna liinil kiirlaevade turuosad 1999-2000

  2. Globaalsus + lennundus = Star Alliance? / Ain Hinsberg

    Index Scriptorium Estoniae

    Hinsberg, Ain

    2002-01-01

    Erinevad koostöövormid lennufirmade vahel, alliansside teke ja areng maailmas. Maailma juhtivad lennundusalliansid ja nende poolt kaetud riigid ja sihtkohad. Kommenteerib Estonian Airi president Erki Urva

  3. Sõna viidi, teine toodi : [rets.] / Ain Kaalep

    Index Scriptorium Estoniae

    Kaalep, Ain, 1926-

    1997-01-01

    Ilm.: Keel ja Kirjandus 1986, nr. 7, lk. 438-439. Rets. rmt.: Sõja laul. Das Estnische Kriegslied. Zusammengestellt und mit Hilfe von Bertolt Brecht und Margarete Steffin ins Deutsche übertragen vom Hella Wuolijoki, estnisch und deutsch herausgegeben und kommentiert von Hans Peter Neureuter, Ruth Mirov und Ülo Tedre. Helsinki : Otava, 1984. 181 lk.

  4. Makita kalmistu antropoloogiline aines / Luule Heapost

    Index Scriptorium Estoniae

    Heapost, Luule

    1993-01-01

    Tabel : Makita koljude keskmised mõõtmed ; Tabel : 13.-15. sajandi Makita koljud ja võrdlusmaterjalid Eestist ; Tabel 3 : 13. -15. sajandi Makita koljud ning võrdlusandmeid soome-ugri hõimude asualadelt ; Tabel 4 : 15.- 17. sajandi Makita koljud ja võrdlusandmed ; Tabel 5 : Makita koljude võrdlusandmed (Pernose'i meetodil) ; Tabel 6 : Makita luustike pikkade luude keskmine pikkus ; Tabel 7 : Kehapikkuse võrdlusandmed

  5. Evolución del consumo y gasto farmacéutico público de anti-inflamatorios no esteroideos (aines en el período 2001 - 2005 Evolution of public consumption and spending on non-steroidal anti-inflammatory drugs (nsaids during the period 2001 to 2005

    Directory of Open Access Journals (Sweden)

    Patricia Barber Pérez

    2007-12-01

    Full Text Available Este estudio observacional retrospectivo analizó el consumo y gasto farmacéutico de AINEs (antiinflamatorios no esteroideos clásicos en Costa Rica en el periodo 2001-2005. Su objetivo es contribuir al conocimiento de la estructura de gasto y perfil de utilización y consumo farmacológico de este grupo de medicamentos con el fin de abordar con mayores garantías la gestión del irremediable proceso de aparición y previsible financiación pública de los AINEs de nueva generación en el país. Los AINEs son un grupo de fármacos asociados de forma especial a los nuevos estilos de vida cuyo nivel de consumo crece de forma ininterrumpida y cuya participación en el gasto farmacéutico es cada vez más relevante. En la actualidad, constituyen el cuarto grupo en gasto farmacéutico público con un incremento del 15% en términos reales en el periodo 2001-2004. El consumo de AINEs para 2005 en Costa Rica es de 21,02 DHD (dosis diaria por habitante y día y en el periodo 2000-2005 su consumo se ha incrementado un 48%. Respecto al consumo en 2005 de los principios activos que forman este grupo farmacológico destaca la Indometacina con un 6,36 DHD, Sulindaco con 6,06 DHD y el Ibuprofeno con 4,36 DHD y el Tenoxican con 3,25 DHD. El CTD (Coste de Tratamiento Diario varía entre 2 céntimos de dólar para el Ibuprofeno y 1,49 dólares para el Tenoxican.This observational, retrospective study analyzed the pharmaceutical consumption and expense of classic NSAIDs (non-steroidal anti-inflammatory drugs in Costa Rica during the period 2001 to 2005. Its objective was to contribute to knowledge regarding the expense structure as well as the pattern of use and pharmacological consumption of this group of medicines with the purpose of providing better support to the inexorable process of the appearance and foreseeable public financing of new-generation NSAIDs in our country. NSAIDs are a group of medicines associated in a special fashion to the new lifestyles

  6. Jah koostööle! / Taavi Veskimägi

    Index Scriptorium Estoniae

    Veskimägi, Taavi, 1974-

    2005-01-01

    Ilmunud ka: Türi Rahvaleht 2. dets., lk. 2, Kuulutaja 2. dets., lk. 4, Põhjarannik 2. dets., lk. 2, Severnoje Poberezhje 2. dets., lk. 2, Pärnu Postimees 3. dets., lk. 19, Lääne Elu 3. dets., lk. 2, Võrumaa Teataja 3. dets., lk. 2, Koit 3. dets., lk. 6, Vooremaa 3. dets. lk. 2, Sakala 6. dets. lk. 2, Meie Maa 7. dets. lk. 2, Nädaline 8. dets. lk. 2. Res Publica esimehe sõnul vajab erakond 2007. aasta valimisteks tugevat koostöölepet Reformierakonna, sotsiaaldemokraatide ja Isamaaliidu vahel

  7. Teraviljatoodete tootmine, tarbimine ja kaubandus : [1994-2004 Eestis] / Taavi Kuntu

    Index Scriptorium Estoniae

    Kuntu, Taavi

    2005-01-01

    Ilmunud ka: Agriculture and the development of rural life : overview 2004/2005. - Tallinn, 2005, lk. 34-41. Teravilja, teraviljasaadusi ja muid toiduaineid töötlev tööstus annab väärtuseliselt ligikaudu 18% Eesti toiduainetööstuse kogutoodangust. Diagrammid. Tabel

  8. Piimatööstus : [1990-ndad, 2000-2003 Eestis] / Taavi Kuntu

    Index Scriptorium Estoniae

    Kuntu, Taavi

    2004-01-01

    Ilmunud ka: Agriculture and rural development : overview 2003/2004. - Tallinn, 2004, lk. 59-69. 2003. a. moodustas piima tootmine põllumajanduse kogutoodangust hinnanguliselt 28%, toiduainetööstuses oli piimatööstuse osakaal 26%. Diagrammid. Tabelid. Graafikud

  9. Alexela loodab LNG terminali rajamise õiguse endale saada / Andrus Karnau ; kommenteerinud Taavi Veskimägi

    Index Scriptorium Estoniae

    Karnau, Andrus

    2011-01-01

    Alexela Grupp loodab saada Balti riikide ja Soome ühise veeldatud maagaasi ehk LNG terminali operaatoriks. Naabrite tihe konkurents gaasi pärast - neli riiki on esitanud viis Balti LNG terminali projekti. Kaart

  10. Capita Selecta Early Music Amsterdam : Kas eestlastele ainus koht varajase muusika õpinguteks? / Taavi-Mats Utt

    Index Scriptorium Estoniae

    Utt, Taavi-Mats

    2000-01-01

    SICi (Stichting Internationale Concerten en Werkgroepen) korraldatavast varajase muusika koolitusest, seminaride sarjast "Capita Selecta Early Music Amsterdam", SICi plaanist laiendada tegevust Kiievi ja Peterburi konservatooriumidesse

  11. Governance and law in transition states : [doktoritöö] / Taavi Annus ; juhendaja: Wolfgang Drechsler

    Index Scriptorium Estoniae

    Annus, Taavi, 1977-

    2004-01-01

    Sisaldab artikleid: Comparative constitutional reasoning : the law and strategy of selecting the right arguments ; Die Verfassungsentwicklung in Estland von 1992 bis 2001 ; Judicial behavior in transition : the effects of judge and defendant characteristics ; The right to health protection in the Estonian Constitution ; German authors on Estonian minority rights

  12. Governance and law in transition states : [doktoritöö] / Taavi Annus ; juhendaja: Wolfgang Drechsler

    Index Scriptorium Estoniae

    Annus, Taavi, 1977-

    2004-01-01

    Sisaldab artikleid: Comparative constitutional reasoning : the law and strategy of selecting the right arguments ; Die Verfassungsentwicklung in Estland von 1992 bis 2001 ; Judicial behavior in transition : the effects of judge and defendant characteristics ; The right to health protection in the Estonian Constitution ; German authors on Estonian minority rights

  13. Meediaekspert: vene inimesed väsivad infosõjast / Valeri Solovei ; intervjueerinud Taavi Minnik

    Index Scriptorium Estoniae

    Solovei, Valeri

    2015-01-01

    Intervjuu Venemaa Välisministeeriumi Moskva Riikliku Rahvusvaheliste Suhete Instituudi avalike suhete kateedri juhataja professor Valeri Soloveiga, kellelt ilmus raamat "Fake - absoluutne relv", mis keskendub meediamanipulatsioonidele ja propagandale. Nendel teemadel räägib ta ka intervjuus

  14. Euroopa tulevikuvisiooni näeme Ceutas ja Melillas / Daniel Pipes ; intervjueerinud Taavi Minnik

    Index Scriptorium Estoniae

    Pipes, Daniel

    2016-01-01

    Intervjuu Lähis-Ida Foorumi presidendi Daniel Pipesiga Euroopa migratsioonikriisist ja vigadest migratsioonipoliitikas. Probleemidest, mida massiimmigratsioon Kolmandast Maailmast Euroopale kaasa toob ning radikaalse islami ohtudest

  15. Obshtshejevropeiskoje roditelskoje possobije - horoshii primer, podannõi Estoniei / Taavi Rõivas

    Index Scriptorium Estoniae

    Rõivas, Taavi, 1979-

    2008-01-01

    Euroopa Komisjon tegi liikmesriikidele ettepaneku rakendada vähemalt 18 nädala pikkust vanemahüvitist. Riigikogu liige viitab, et Eestis on hüvitise-aastatel kasvanud sündimus 20,7%. ilmunud ka Vesti Estonii okt. lk. 4

  16. Jah koostööle! / Taavi Veskimägi

    Index Scriptorium Estoniae

    Veskimägi, Taavi, 1974-

    2005-01-01

    Ilmunud ka: Türi Rahvaleht 2. dets., lk. 2, Kuulutaja 2. dets., lk. 4, Põhjarannik 2. dets., lk. 2, Severnoje Poberezhje 2. dets., lk. 2, Pärnu Postimees 3. dets., lk. 19, Lääne Elu 3. dets., lk. 2, Võrumaa Teataja 3. dets., lk. 2, Koit 3. dets., lk. 6, Vooremaa 3. dets. lk. 2, Sakala 6. dets. lk. 2, Meie Maa 7. dets. lk. 2, Nädaline 8. dets. lk. 2. Res Publica esimehe sõnul vajab erakond 2007. aasta valimisteks tugevat koostöölepet Reformierakonna, sotsiaaldemokraatide ja Isamaaliidu vahel

  17. Eesti ema kuju autor selgub sügisel / Taavi Linnamäe

    Index Scriptorium Estoniae

    Linnamäe, Taavi

    2004-01-01

    Võrru Vee tänava äärsele haljasalale plaanitava moumendi looja leidmise konkursist. Eesti Kujurite Ühendus valib välja viis inimest, kellel palutakse osaleda. Žürii esimeheks lubas hakata Jaak Soans. Moumendi idee autor Hans Sissas

  18. Kuidas võidelda Vene propagandaga? / Valeri Solovei ; intervjueerinud Taavi Minnik

    Index Scriptorium Estoniae

    Solovei, Valeri

    2016-01-01

    Intervjuu Venemaa Välisministeeriumi Moskva Riikliku Rahvusvaheliste Suhete Instituudi avalike suhete kateedri juhataja professor Valeri Soloveiga Kremli propaganda mõjust välismaal ning seal elavatele venelastele

  19. Clinton või Trump - USA jaoks ühtviisi katastroof / David Satter ; intervjueerinud Taavi Minnik

    Index Scriptorium Estoniae

    Satter, David

    2016-01-01

    Intervjuu maineka Ühendriikide Venemaa eksperdi David Satteriga, kes hoiatab, et Ameerika presidendivalimistel on inimestel valida kahe äärmiselt halva kandidaadi - Donald Trumpi ning Hillary Clintoni vahel

  20. Kuidas üheskoos ajalugu mäletada? / Taavi Arus

    Index Scriptorium Estoniae

    Arus, Taavi

    2007-01-01

    Tallinna Ülikoolis 26. ja 27. juulil toimuvast loengusarjast, kus astuvad loengutega üles ajaloolased Peter Burke, Leonidas Donskis ja Maurice Bloch. Tallinna Ülikooli rektori professor Rein Raua sõnul on nimetatud loengusari üks selle suve intellektuaalseid kõrghetki. Loengutele järgnevad arutelud, mida juhivad vastavalt Tallinna Ülikooli Eesti Humanitaarinstituudi lektor Marek Tamm, filosoofiaprofessor Tõnu Viik ning antropoloogiadotsent Lorenzo Canas

  1. Belgia kunstikoguja segab Kuressaaret kunstiafääri / Taavi Tuisk

    Index Scriptorium Estoniae

    Tuisk, Taavi

    2008-01-01

    Mehhikos elav belglane Francis Alys (1959) süüdistab 1997. a. Saaremaa biennaali korraldajaid temale kuulunud ja biennaalil eksponeeritud tööde (Jean-Jacques Henner' maali koopiad) äravahetamises

  2. Rohkem iseseisvust ja vabadust kohalikele omavalitsustele / Taavi Veskimägi

    Index Scriptorium Estoniae

    Veskimägi, Taavi, 1974-

    2004-01-01

    Ilmunud ka: Lääne Elu, 16. sept. 2004, lk. 2; Sakala, 16. sept. 2004, lk. 2; Pärnu Postimees, 16. sept. 2004, lk. 15; Põhjarannik, 17. sept. 2004, lk. 2; Severnoje Poberezhje, 17. sept. 2004, lk. 2; Võrumaa Teataja, 18. sept. 2004, lk. 2; Koit, 18. sept. 2004, lk. 6; Meie Maa, 18. sept. 2004, lk. 2; Sõnumitooja, 22. sept. 2004, lk. 6. Rahandusministri artikkel kohalike omavalitsuste maksupoliitikast

  3. Kuidas üheskoos ajalugu mäletada? / Taavi Arus

    Index Scriptorium Estoniae

    Arus, Taavi

    2007-01-01

    Tallinna Ülikoolis 26. ja 27. juulil toimuvast loengusarjast, kus astuvad loengutega üles ajaloolased Peter Burke, Leonidas Donskis ja Maurice Bloch. Tallinna Ülikooli rektori professor Rein Raua sõnul on nimetatud loengusari üks selle suve intellektuaalseid kõrghetki. Loengutele järgnevad arutelud, mida juhivad vastavalt Tallinna Ülikooli Eesti Humanitaarinstituudi lektor Marek Tamm, filosoofiaprofessor Tõnu Viik ning antropoloogiadotsent Lorenzo Canas

  4. Obshtshejevropeiskoje roditelskoje possobije - horoshii primer, podannõi Estoniei / Taavi Rõivas

    Index Scriptorium Estoniae

    Rõivas, Taavi, 1979-

    2008-01-01

    Euroopa Komisjon tegi liikmesriikidele ettepaneku rakendada vähemalt 18 nädala pikkust vanemahüvitist. Riigikogu liige viitab, et Eestis on hüvitise-aastatel kasvanud sündimus 20,7%. ilmunud ka Vesti Estonii okt. lk. 4

  5. Vene lavastaja: teater peab olema ühiskondliku diskussiooni keskuseks / Filipp Los ; intervjueerinud Taavi Minnik

    Index Scriptorium Estoniae

    Los, Filipp, 1967-

    2016-01-01

    Intervjuu Rakvere teatri juures külalislavastajana tegutseva Filipp Losiga Moskvast, kes tõi lavale Vladimir Žerebtsovi näidendi "Ausammas". Lavastusest, teatrist ja selle juurde kuuluvast Eestis ja Venemaal, ka nende ühiskondades toimuvast

  6. Lech Wałęsa - kangelane või reetur? / Zygmunt Dzieciolowski ; intervjueerinud Taavi Minnik

    Index Scriptorium Estoniae

    Dzieciolowski, Zygmunt

    2016-01-01

    Intervjuu Poola politoloogi ja ajakirjaniku Zygmunt Dzieciolowskiga Solidaarsuse liikumise juhi Lech Wałęsa elu tumedatest varjudest, käimasolevast skandaalist seoses tema sidemetega kommunistliku režiimi salapolitsei SBga ning kohast Poola ühiskonnas ja ajaloos

  7. Avatud pilguga suletud ruumis / Klavdij Sluban ; interv. Jean Pascal Ollivry ja Taavi Tatsi

    Index Scriptorium Estoniae

    Sluban, Klavdij

    2006-01-01

    1963. a. Pariisis sündinud Klavdij Sluban alustas pikaajalist projekti 1995. aastal, pildistades ise ja organiseerides sissejuhatavaid fotokursusi noorte kinnipidamisasutustes Prantsusmaal, Balkanimaades ja mitmetes endise Nõukogude Liidu maades

  8. Ühest 1855. aastal ilmunud osalt eestikeelsest kaardist / Taavi Pae, Raivo Aunap

    Index Scriptorium Estoniae

    Pae, Taavi, 1976-

    2010-01-01

    Kaardi muudavad eriliseks 231 paralleelnimetustena esitatud eestikeelset toponüümi. Kaart on loodud eelkõige andmaks ettekujutust baltisaksa maailmast. Kõige rohkem andmeid on toodud Kuramaa kubermangust. Kaardi sisust, retseptsioonist ja seostest

  9. Valitsus räägib üht, teeb teist / Taavi Veskimägi

    Index Scriptorium Estoniae

    Veskimägi, Taavi, 1974-

    2006-01-01

    Ilmunud ka: Sõnumitooja 6. dets. lk. 2. Isamaa ja Res Publica Liidu kaasesimehe hinnangul on 2007. a. riigieelarves prioriteediks seatud bürokraatia- ja valitsemiskulude kasv, mitte pered, haridus ja tervishoid

  10. Meie eesmärk on hoolivus / Taavi Veskimägi

    Index Scriptorium Estoniae

    Veskimägi, Taavi, 1974-

    2005-01-01

    Ilmunud ka: Meie Maa 12. november lk. 2, Hiiu Leht 15. november lk. 2, Valgamaalane 17. november lk. 2, Pärnu Postimees 18. november lk. 15. Res Publica fraktsiooni esitatud muudatusettepanekutest 2006. a. riigieelarve eelnõule

  11. Teraviljatoodete tootmine, tarbimine ja kaubandus : [1994-2004 Eestis] / Taavi Kuntu

    Index Scriptorium Estoniae

    Kuntu, Taavi

    2005-01-01

    Ilmunud ka: Agriculture and the development of rural life : overview 2004/2005. - Tallinn, 2005, lk. 34-41. Teravilja, teraviljasaadusi ja muid toiduaineid töötlev tööstus annab väärtuseliselt ligikaudu 18% Eesti toiduainetööstuse kogutoodangust. Diagrammid. Tabel

  12. Piimatööstus : [1990-ndad, 2000-2003 Eestis] / Taavi Kuntu

    Index Scriptorium Estoniae

    Kuntu, Taavi

    2004-01-01

    Ilmunud ka: Agriculture and rural development : overview 2003/2004. - Tallinn, 2004, lk. 59-69. 2003. a. moodustas piima tootmine põllumajanduse kogutoodangust hinnanguliselt 28%, toiduainetööstuses oli piimatööstuse osakaal 26%. Diagrammid. Tabelid. Graafikud

  13. Eesti ballaadid. Frondil ja tagalas / Jaak Johanson, Ants Johanson ; interv. Taavi Eelmaa

    Index Scriptorium Estoniae

    Johanson, Jaak, 1959-

    2004-01-01

    18. augustil esietendub Soorinna külas Kuusalu vallas Von Krahli Teatri ja Filharmoonia Kammerkoori ühisprojektina Veljo Tormise "Eesti ballaadid", muusikajuht Tõnu Kaljuste, koreograaf Aki Suzuki, lavastaja Peeter Jalakas. Loo on koostanud Lea Tormis, tekstid seadnud folklorist Ülo Tedre

  14. Euroopa tulevikuvisiooni näeme Ceutas ja Melillas / Daniel Pipes ; intervjueerinud Taavi Minnik

    Index Scriptorium Estoniae

    Pipes, Daniel

    2016-01-01

    Intervjuu Lähis-Ida Foorumi presidendi Daniel Pipesiga Euroopa migratsioonikriisist ja vigadest migratsioonipoliitikas. Probleemidest, mida massiimmigratsioon Kolmandast Maailmast Euroopale kaasa toob ning radikaalse islami ohtudest

  15. Vene lavastaja: teater peab olema ühiskondliku diskussiooni keskuseks / Filipp Los ; intervjueerinud Taavi Minnik

    Index Scriptorium Estoniae

    Los, Filipp, 1967-

    2016-01-01

    Intervjuu Rakvere teatri juures külalislavastajana tegutseva Filipp Losiga Moskvast, kes tõi lavale Vladimir Žerebtsovi näidendi "Ausammas". Lavastusest, teatrist ja selle juurde kuuluvast Eestis ja Venemaal, ka nende ühiskondades toimuvast

  16. Capita Selecta Early Music Amsterdam : Kas eestlastele ainus koht varajase muusika õpinguteks? / Taavi-Mats Utt

    Index Scriptorium Estoniae

    Utt, Taavi-Mats

    2000-01-01

    SICi (Stichting Internationale Concerten en Werkgroepen) korraldatavast varajase muusika koolitusest, seminaride sarjast "Capita Selecta Early Music Amsterdam", SICi plaanist laiendada tegevust Kiievi ja Peterburi konservatooriumidesse

  17. Clinton või Trump - USA jaoks ühtviisi katastroof / David Satter ; intervjueerinud Taavi Minnik

    Index Scriptorium Estoniae

    Satter, David

    2016-01-01

    Intervjuu maineka Ühendriikide Venemaa eksperdi David Satteriga, kes hoiatab, et Ameerika presidendivalimistel on inimestel valida kahe äärmiselt halva kandidaadi - Donald Trumpi ning Hillary Clintoni vahel

  18. (Konstitutsiooniline) renvoi: kas põhiseaduslik nõue või kaera Trooja hobusele? / Berit Aaviksoo

    Index Scriptorium Estoniae

    Aaviksoo, Berit, 1978-

    2015-01-01

    Võrdsuspõhiõiguse ning pöörddiskrimineerimise kaotamise nõude mõjust Eesti õiguskorras. Artikkel põhineb 3. oktoobril 2014 Tartus 33. Eesti õigusteadlaste päevadel „Kümme aastat õiguslõimet“ peetud ettekandel

  19. (Konstitutsiooniline) renvoi: kas põhiseaduslik nõue või kaera Trooja hobusele? / Berit Aaviksoo

    Index Scriptorium Estoniae

    Aaviksoo, Berit, 1978-

    2015-01-01

    Võrdsuspõhiõiguse ning pöörddiskrimineerimise kaotamise nõude mõjust Eesti õiguskorras. Artikkel põhineb 3. oktoobril 2014 Tartus 33. Eesti õigusteadlaste päevadel „Kümme aastat õiguslõimet“ peetud ettekandel

  20. Märgistus kinnitab toote ohutust / Ain Alvela

    Index Scriptorium Estoniae

    Alvela, Ain, 1967-

    2005-01-01

    Euroopa Liidus kehtivad eri tootegruppidele nende ohutust tagavad nõuded, teiste seas ka CE-märgistus. Kommenteerivad Enno Rebane, Aldo Unga, Viktor Krutob ja Urmas Leitmäe. Vt. samas: Hallar Meybaum. Keemiatööstus maadleb ülereguleerimisega

  1. I-WARP: Individual Water mAin Renewal Planner

    Directory of Open Access Journals (Sweden)

    Y. Kleiner

    2010-05-01

    Full Text Available I-WARP is based upon a nonhomogeneous Poisson approach to model breakage rates in individual water mains. The structural deterioration of water mains and their subsequent failure are affected by many factors, both static (e.g., pipe material, pipe size, age (vintage, soil type and dynamic (e.g., climate, cathodic protection, pressure zone changes. I-WARP allows for the consideration of both static and dynamic factors in the statistical analysis of historical breakage patterns. This paper describes the mathematical approach and demonstrates its application with the help of a case study. The research project within which I-WARP was developed, was jointly funded by the National Research Council of Canada (NRC, and the Water Research foundation (formerly known as the American Water Works Association Research Foundation – AwwaRF and supported by water utilities from USA and Canada.

  2. Quantum non-locality - It ain't necessarily so...

    CERN Document Server

    Zukowski, Marek

    2015-01-01

    Bell's theorem is 50 years old. Still there is a controversy about its implications. Much of it has its roots in confusion regarding the premises from which the theorem can be derived. Some claim that a derivation of Bell's inequalities requires just locality assumption, and nothing more. Violations of the inequalities are then interpreted as ``nonlocality'' or ``quantum nonlocality''. We show that such claims are unfounded and that every derivation of Bell's inequalities requires a premise -- in addition to locality and freedom of choice -- which is either assumed tacitly, or unconsciously, or is embedded in a single compound condition (like Bell's ``local causality''). The premise is equivalent to the assumption of existence of additional variables which do not appear in the quantum formalism (in form of determinism, or joint probability for outcomes of all conceivable measurements, or ``additional causes`'', or ``hidden variables'', ``complete description of the state'' or counterfactual definiteness, etc....

  3. Kibuvits üllatab ja pakub leevendust / Ain Raal

    Index Scriptorium Estoniae

    Raal, Ain, 1961-

    2005-01-01

    Taani teadlased avastasid-eraldasid kibuvitsaseemnetest ja viljakestadest uue põletikuvastase toimeaine galaktolipiidi (GOPO). Seda lipiidi sisaldub kõige enam koer-kibuvitsa alamliigis Hyben Vital Litos. Nüüdseks on GOPO saamisviis ja nimi patenteeritud nii Euroopas kui ka USAs

  4. Saaremaa taotleb LIFE programmist 50 miljonit krooni / Ain Lember

    Index Scriptorium Estoniae

    Lember, Ain

    2001-01-01

    Vilsandi Rahvuspark ja Pärandkoosluste Kaitse Ühing esitasid EL Komisjonile LIFE programmi raames projektitaotlused. Ajalehe küsimustele vastab Vilsandi rahvuspargi kaitsekorralduskava spetsialist Enn Kaljo

  5. Natura 2000 sai tuule tiibadesse Raplamaal / Ain Aivela

    Index Scriptorium Estoniae

    Aivela, Ain

    2004-01-01

    Natura 2000 idee jõudis Eestisse 2000. aastal, mil pilootprojekti raames ning Taani riigi rahalisel toel alustati Natura-võrgustiku eelvalikualade mahamärkimist Lääne- ja Raplamaal. Kommenteerinud Aleksei Lotman

  6. Jõupaberi tootmine tagab Kehra vabriku kasumi / Ain Alvela

    Index Scriptorium Estoniae

    Alvela, Ain, 1967-

    2015-01-01

    Kehra paberivabrik on kodumaa metsaomaniku jaoks oluline okaspuu paberipuidu tarnija, kasutades umbes viiendiku sellise sortimendi aastasest raiemahust. Vabriku toodangust lõviosa moodustab pakendipaber. Selle tootmine tagab ka kasumi

  7. Vallad saavad teede korrashoiuks poole rohkem raha / Ain Lember

    Index Scriptorium Estoniae

    Lember, Ain

    2006-01-01

    2006. a. on riigieelarvest kohalikele omavalitsuste teedele ette nähtud 265 miljonit krooni. Tabel: Riigieelarvest Saare maakonna omavalitsustele kohalike teede hoolduseks ette nähtud summad 2005. ja 2006. a.

  8. Puti povõshenija effektivnosti proizvodstva / Ain Alvela

    Index Scriptorium Estoniae

    Alvela, Ain, 1967-

    2008-01-01

    Kulude kokkuhoid aitab saavutada kõrgemat tootlikkust. Vt. samas: Indeks rosta proizvoditelnosti za period 2000-2007gg., %. Kommenteerivad: Aleksandr Miina, Ants Pak, Kaul Aulasmägi, Veljo Haube ja Kuido Kuntro

  9. Hoiatuslask õhku presidendi julgeoleku nimel / Ain Lepikult ; interv. Urmo Soonvald

    Index Scriptorium Estoniae

    Lepikult, Ain

    2005-01-01

    Julgestuspolitsei direktor Eesti riigijuhtide julgestamisest, riigijuhte turvava ihukaitsja tööst ja palgast, ohtlikest episoodidest Eesti riigijuhtide turvamisel, alarmsõidust. Lisa. Küsimused, mis tekivad filme vaadates

  10. Hoiatuslask õhku presidendi julgeoleku nimel / Ain Lepikult ; interv. Urmo Soonvald

    Index Scriptorium Estoniae

    Lepikult, Ain

    2005-01-01

    Julgestuspolitsei direktor Eesti riigijuhtide julgestamisest, riigijuhte turvava ihukaitsja tööst ja palgast, ohtlikest episoodidest Eesti riigijuhtide turvamisel, alarmsõidust. Lisa: Küsimused, mis tekivad filme vaadates. Kommenteerivad Euroopa Komisjoni asepresident Siim Kallas ja endine peaminister Mart Laar

  11. PEPTIC ULCER FREQUENCY DIFFERENCES RELATED TO H. PYLORI OR AINES

    Directory of Open Access Journals (Sweden)

    Diego Michelon de CARLI

    2015-03-01

    Full Text Available Background Peptic ulcer etiology has been changing because of H. pylori decline. Objectives To estimate peptic ulcer prevalence in 10 years-interval and compare the association with H. pylori and use of non-steroidal anti-inflammatory drugs. Methods Records assessment in two periods: A (1997-2000 and B (2007-2010, searching for peptic ulcer, H. pylori infection and non-steroidal anti-inflammatory drugs use. Results Peptic ulcer occurred in 30.35% in A and in 20.19% in B. H. pylori infection occurred in 73.3% cases in A and in 46.4% in B. Non-steroidal anti-inflammatory drugs use was 3.5% in A and 13.3% in B. Neither condition occurred in 10.4% and 20.5% in A and B respectively. Comparing both periods, we observed reduction of peptic ulcer associated to H. pylori (P=0.000, increase of peptic ulcer related to non-steroidal anti-inflammatory drugs (P=0.000 and idiopathic peptic ulcer (P=0.002. The concurrent association of H. pylori and non-steroidal anti-inflammatory drugs was also higher in B (P=0.002. Rates of gastric ulcer were higher and duodenal ulcer lower in the second period. Conclusions After 10 years, the prevalence of peptic ulcer decreased, as well as ulcers related to H. pylori whereas ulcers associated to non-steroidal anti-inflammatory drugs increased. There was an inversion in the pattern of gastric and duodenal ulcer and a rise of idiopathic peptic ulcer.

  12. Kevadelaul : [luuletused] / Federico Garcia Lorca ; tlk. Ain Kaalep

    Index Scriptorium Estoniae

    García Lorca, Federico, 1898-1936

    2006-01-01

    Sisu: Kevadelaul ; Uued laulud ; Unenägu ; Uus süda ; Rõske siseõu ; Risttee : "Oh valu: mu värsid võtnud..." ; Ballaad mereveest ; Huile ; Vaikus ; Risttee : "Tuul puhub läänest..." ; Sevilla ; Kuus keelt ; Memento ; Kolm linna : Malaguena ; Cordoba agul ; Tants ; Kitarrimõistatus ; Poolkuu ; Neli kollast ballaadi ; Aadam ; Tasakaal ; Friis ; Maha raiuti kolm puud ; Teokarp ; Rumal laul ; Õhtu ; Ratsaniku laul ; Debussy ; Kuu tõuseb ; Kaks õhtust kuud ; Serenaad ; Laul lahkuvast päevast ; Kuuba neegrilaul ; Itk Ignacio Sanchez Mejiase surma puhul ; Madrigal Santiago linnale ; Hällilaul surnud Rosalia Castrole ; Kuu tants Santiagos ; Gaseel kohutavast lähedusest ; Gaseel tumedast surmast ; Gaseel põgenemisest ; Gaseel saja-aastasest armastusest ; Kassiida okstest ; Kassiida selili lebavast naisest ; Kassiida unenäost vabas õhus ; Kassiida tumedaist tuvidest ; Vee süit ; Herbaariumid ; Omega ; Ood Salvador Dalile ; "Ma kardan, kas su imet ma ei kaota..." . Eluloolisi andmeid autori kohta lk. 879

  13. Saaremaa taotleb LIFE programmist 50 miljonit krooni / Ain Lember

    Index Scriptorium Estoniae

    Lember, Ain

    2001-01-01

    Vilsandi Rahvuspark ja Pärandkoosluste Kaitse Ühing esitasid EL Komisjonile LIFE programmi raames projektitaotlused. Ajalehe küsimustele vastab Vilsandi rahvuspargi kaitsekorralduskava spetsialist Enn Kaljo

  14. Invsteeringutoetuste saajate ring väheneb / Ain Lember

    Index Scriptorium Estoniae

    Lember, Ain

    2009-01-01

    Eestimaa talupidajate keskliit ei ole rahul mikropõllumajandusettevõtte arendamise investeeringutoetuse (meede 1.4.1) ja loomakasvatusehitiste investeeringutoetuse (meede 1.4.2) määruses tehtud muudatustega

  15. Kibuvits üllatab ja pakub leevendust / Ain Raal

    Index Scriptorium Estoniae

    Raal, Ain, 1961-

    2005-01-01

    Taani teadlased avastasid-eraldasid kibuvitsaseemnetest ja viljakestadest uue põletikuvastase toimeaine galaktolipiidi (GOPO). Seda lipiidi sisaldub kõige enam koer-kibuvitsa alamliigis Hyben Vital Litos. Nüüdseks on GOPO saamisviis ja nimi patenteeritud nii Euroopas kui ka USAs

  16. Kevadelaul : [luuletused] / Federico Garcia Lorca ; tlk. Ain Kaalep

    Index Scriptorium Estoniae

    García Lorca, Federico, 1898-1936

    2006-01-01

    Sisu: Kevadelaul ; Uued laulud ; Unenägu ; Uus süda ; Rõske siseõu ; Risttee : "Oh valu: mu värsid võtnud..." ; Ballaad mereveest ; Huile ; Vaikus ; Risttee : "Tuul puhub läänest..." ; Sevilla ; Kuus keelt ; Memento ; Kolm linna : Malaguena ; Cordoba agul ; Tants ; Kitarrimõistatus ; Poolkuu ; Neli kollast ballaadi ; Aadam ; Tasakaal ; Friis ; Maha raiuti kolm puud ; Teokarp ; Rumal laul ; Õhtu ; Ratsaniku laul ; Debussy ; Kuu tõuseb ; Kaks õhtust kuud ; Serenaad ; Laul lahkuvast päevast ; Kuuba neegrilaul ; Itk Ignacio Sanchez Mejiase surma puhul ; Madrigal Santiago linnale ; Hällilaul surnud Rosalia Castrole ; Kuu tants Santiagos ; Gaseel kohutavast lähedusest ; Gaseel tumedast surmast ; Gaseel põgenemisest ; Gaseel saja-aastasest armastusest ; Kassiida okstest ; Kassiida selili lebavast naisest ; Kassiida unenäost vabas õhus ; Kassiida tumedaist tuvidest ; Vee süit ; Herbaariumid ; Omega ; Ood Salvador Dalile ; "Ma kardan, kas su imet ma ei kaota..." . Eluloolisi andmeid autori kohta lk. 879

  17. Bassilaulja Ain Anger lummas Viini publiku / Talvi Nurgamaa

    Index Scriptorium Estoniae

    Nurgamaa, Talvi

    2008-01-01

    1. aprillil Musikvereini klaassaalis Viinis toimunud laulja soolokontserdist sarjast "Lied. Bühne", klaveril Jendrik Springer. Samal ajal kudses saalis toimunud Tonkünstler Orchester kontserdist, dirigent Kristjan Järvi

  18. New Hollandi uued väledad putukad / Ain Alvela

    Index Scriptorium Estoniae

    Alvela, Ain, 1967-

    2016-01-01

    New Holland tõi avalikkuse ette kaks uut seeriat. Mõlema mudelivalik esindab praegu põllutraktorite tootmises valitsevat moodi - nutikaid, väledaid ja universaalseid masinaid võimsusvahemikus 100-200 hobujõudu

  19. Geniaalne aines, hämmastav film / Tarmo Teder

    Index Scriptorium Estoniae

    Teder, Tarmo, 1958-

    2006-01-01

    Oktoobri algul Kuressaares peetud Saaremaalt pärit ameerika arhitekti Louis Kahni konverentsi raames Kuressaare Linnateatris näidatud dokumentaalfilmist "Minu arhitekt" ("My Architect") : režissöör Nathaniel Kahn : Ameerika Ühendriigid 2003

  20. Tuuleenergia kasutamisvõimalused Eestis / Ain Kull, Valdur Tiit

    Index Scriptorium Estoniae

    Kull, Ain, 1973-

    2005-01-01

    Autorite hinnangul on seni Eestis ulatuslik tuulejõu kasutamine raskendatud nii finantsprobleemide, kodumaise tootmise puudumise, rannikupiirkondade elektriliinide väikese võimsuse kui ka Narva põlevkivijaamade alakoormatuse tõttu. Tabel

  1. Bassilaulja Ain Anger lummas Viini publiku / Talvi Nurgamaa

    Index Scriptorium Estoniae

    Nurgamaa, Talvi

    2008-01-01

    1. aprillil Musikvereini klaassaalis Viinis toimunud laulja soolokontserdist sarjast "Lied. Bühne", klaveril Jendrik Springer. Samal ajal kudses saalis toimunud Tonkünstler Orchester kontserdist, dirigent Kristjan Järvi

  2. Peakorter city's paneb firma mainele aluse / Ain Alvela

    Index Scriptorium Estoniae

    Alvela, Ain, 1967-

    2001-01-01

    Ilmunud ka: Delovõje Vedomosti 5. sept., lk. 13. Euroopa suurfirmade omanikud mõistavad, et vaatamata globaliseerumisele on eduka äritegevuse pant näost-näkku kokkusaamine klientidega, millele paneb aluse büroo omamine mainekas asukohas. Diagramm

  3. Eestis käis ilmataadi maapealne asemik / Ain Kallis

    Index Scriptorium Estoniae

    Kallis, Ain, 1942-

    2005-01-01

    Tänavu täitub 200 aastat pidevate instrumentaalsete ilmamõõtmiste algusest Eestis. Keskkonnaminister Villu Reiljan ja Euroopa Keskpika Ilmaennustuse Keskuse (European Centre for Medium-Range Weather Forecasts, ECMWF) direktor Dominique Marbouty kirjutasid alla koostöölepingule

  4. Advokaadi kutse-eetika reason d’etre / Ain Alvin

    Index Scriptorium Estoniae

    Alvin, Ain, 1959-

    2014-01-01

    Advokaadi kohustus on kutsetegevuses järgida lisaks seadusele kutse-eetika nõudeid, häid kombeid ja südametunnistust. Mida sellised kohustused sisuliselt tähendavad, millest tuleneb vajadus kutse-eetika kutseühendusesisese reguleerimise järele ja milline on kutse-eetika normide sisu?

  5. Euroopa tootjad ei ole rahul USA survega / Ain Lember

    Index Scriptorium Estoniae

    Lember, Ain

    2006-01-01

    Seoses USA survega Euroopa turgude avanemiseks ning probleemidega Brasiilia toidukaupade ekspordi osas, kutsub üleeuroopalise põllumajandustootjate liit COPA ja põllumajandustööandjate organisatsioonide liit COGECA Euroopa valitsusjuhte üles lõpetama järeleandmiste tegemise

  6. Poliitiline areng / Vello Pettai, Daunis Auers, Aine Ramonaite

    Index Scriptorium Estoniae

    Pettai, Vello, 1968-

    2011-01-01

    Ülevaade demokraatlikust arengust Baltimaades - valitsuste stabiilsus, parlamendi usaldatavus, valimised, erakonnad, kodanikuühiskonna areng, poliitika läbipaistvus, huvi poliitika vastu ühiskonnas. Tabelid, joonised

  7. Political development / Vello Pettai, Daunis Auers, Aine Ramonaite

    Index Scriptorium Estoniae

    Pettai, Vello, 1968-

    2011-01-01

    Ülevaade demokraatlikust arengust Baltimaades - valitsuste stabiilsus, parlamendi usaldatavus, valimised, erakonnad, kodanikuühiskonna areng, poliitika läbipaistvus, huvi poliitika vastu ühiskonnas. Tabelid, joonised

  8. New Hollandi uued väledad putukad / Ain Alvela

    Index Scriptorium Estoniae

    Alvela, Ain, 1967-

    2016-01-01

    New Holland tõi avalikkuse ette kaks uut seeriat. Mõlema mudelivalik esindab praegu põllutraktorite tootmises valitsevat moodi - nutikaid, väledaid ja universaalseid masinaid võimsusvahemikus 100-200 hobujõudu

  9. Nägemus Suurest Prantsuse revolutsioonist : [essee] / Ain Kaalep

    Index Scriptorium Estoniae

    Kaalep, Ain, 1926-

    1997-01-01

    Ilm.: Edasi 1989, 15. juuli, nr. 162, lk. 5. Teostest: Blos, Wilhelm. Prantsuse revolutsioon. Tartu : Noor-Eesti, 1914. Suits, Gustav. Kõik on kokku unenägu. Tartu : Noor-Eesti, 1922. France, Anatole. Jumalad janunevad. Tallinn, 1920.

  10. Rootslased tahavad kanepikasvatuseks Saaremaalt maad osta / Ain Lember

    Index Scriptorium Estoniae

    Lember, Ain

    2004-01-01

    Saaremaal viibis projekti Industri Hampe Gotland juht Tomas Persson, kes otsis kanepikasvatuseks sobilikke põllumaid ja lõi sidemeid ettevõtetega, kus on võimalik kanepit kasutada. Perssoni külaskäik on jätkuks Kuressaares toimunud seminarile "Tööstuslik kanep - Saaremaa jätkusuutliku arengu märksõna"

  11. Puti povõshenija effektivnosti proizvodstva / Ain Alvela

    Index Scriptorium Estoniae

    Alvela, Ain, 1967-

    2008-01-01

    Kulude kokkuhoid aitab saavutada kõrgemat tootlikkust. Vt. samas: Indeks rosta proizvoditelnosti za period 2000-2007gg., %. Kommenteerivad: Aleksandr Miina, Ants Pak, Kaul Aulasmägi, Veljo Haube ja Kuido Kuntro

  12. Political development / Vello Pettai, Daunis Auers, Aine Ramonaite

    Index Scriptorium Estoniae

    Pettai, Vello, 1968-

    2011-01-01

    Ülevaade demokraatlikust arengust Baltimaades - valitsuste stabiilsus, parlamendi usaldatavus, valimised, erakonnad, kodanikuühiskonna areng, poliitika läbipaistvus, huvi poliitika vastu ühiskonnas. Tabelid, joonised

  13. Poliitiline areng / Vello Pettai, Daunis Auers, Aine Ramonaite

    Index Scriptorium Estoniae

    Pettai, Vello, 1968-

    2011-01-01

    Ülevaade demokraatlikust arengust Baltimaades - valitsuste stabiilsus, parlamendi usaldatavus, valimised, erakonnad, kodanikuühiskonna areng, poliitika läbipaistvus, huvi poliitika vastu ühiskonnas. Tabelid, joonised

  14. Jõupaberi tootmine tagab Kehra vabriku kasumi / Ain Alvela

    Index Scriptorium Estoniae

    Alvela, Ain, 1967-

    2015-01-01

    Kehra paberivabrik on kodumaa metsaomaniku jaoks oluline okaspuu paberipuidu tarnija, kasutades umbes viiendiku sellise sortimendi aastasest raiemahust. Vabriku toodangust lõviosa moodustab pakendipaber. Selle tootmine tagab ka kasumi

  15. Eestis käis ilmataadi maapealne asemik / Ain Kallis

    Index Scriptorium Estoniae

    Kallis, Ain, 1942-

    2005-01-01

    Tänavu täitub 200 aastat pidevate instrumentaalsete ilmamõõtmiste algusest Eestis. Keskkonnaminister Villu Reiljan ja Euroopa Keskpika Ilmaennustuse Keskuse (European Centre for Medium-Range Weather Forecasts, ECMWF) direktor Dominique Marbouty kirjutasid alla koostöölepingule

  16. Eesti ehitusturu kasv tipneb 2006. aastal / Ain Hinsberg

    Index Scriptorium Estoniae

    Hinsberg, Ain

    2002-01-01

    Taanis asuva uuringufirma European Construction Research, mis jälgib ja prognoosib Ida- ja Lääne-Euroopa ning Lähis-Ida, Hiina ja Aasia ehitusturgu, ennustab Eestile jätkuvat kasvu. Diagramm: Eesti ehitusturu areng 1999-2010

  17. Meie esimese luuletõlke-antoloogia puhul : [rets.] / Ain Kaalep

    Index Scriptorium Estoniae

    Kaalep, Ain, 1926-

    1997-01-01

    Ilm.: Kirjandus kriitiku pilguga : artikleid, arvustusi ja aastaülevaateid 1975-1976. Tallinn : Eesti Raamat, 1978, lk. 25-31 ; Keel ja Kirjandus 1975, nr. 5, lk. 309-311 . Rets. rmt.: Sang, August. Laenatud laulud I: luuletõlkeid. Tallinn : Eesti Raamat, 1973. 336 lk.; Sang, August. Laenatud laulud II: luuletõlkeid. Tallinn : Eesti Raamat, 1974. 392 lk.

  18. Firmadel tasub jäätmeid sorteerida / Ain Alvela

    Index Scriptorium Estoniae

    Alvela, Ain, 1967-

    2007-01-01

    Ettevõte saab jäätmete sorteerimisel ja liikide kaupa jagamisel need raha eest müüa. Diagramm: Taaskasutamine kogub hoogu. Vt. samas: Uuest aastast võimalik kolm stsenaariumi; Paljudel jäätmetel on kindel kokkuostuhind; Taaskasutatav toore üha väärtuslikum. Kommenteerib Riho Saksus

  19. Cathodoluminescence and Magnetic Properties of Mn+ Implanted AIN

    Institute of Scientific and Technical Information of China (English)

    LI Ming-Kai; LI Cheng-Bin; LIU Chuan-Sheng; FAN Xiang-Jun; FU De-Jun; SHON Yun; KANG Tae-Won

    2004-01-01

    @@ The Ⅲ-Ⅴ wide band gap semiconductors show the potential in applications for dilute magnetic semiconductors.AlN films are implanted with 20-keV Mn+ ions with a dose of 5 × 1016cm-2. The cross section of as-implanted AlN are investigated by field-emission scanning electron microscopy and the energy dispersive spectra. The result confirms that the implantation depth is about 100nm. Cathodoluminescence measurements show the main peak at 2.6eV attributed to a donor-to-Mn2+ transition. It is argued that the Mn element in AlN can act as a p-type dopant peak at 2.07eV. The magnetic measurement shows a transition temperature of 100K in the implanted AlN annealed at 500℃ for 30min. Clear ferromagnetic hysteresis was observed at 77K, with a coercive field of 212.7Oe.

  20. Synthesis and Sintering of AIN using Enriched Nitrogen

    National Research Council Canada - National Science Library

    MARUYAMA, Tadashi; ISHIKAWA, Makoto

    1996-01-01

    ...°C in a vacuum furnace to synthesize Al15N. In the initial reaction process, a small amount of AlF3 was mixed with the Al powder to suppress excess temperature rise due to the heat of formation of the nitride...

  1. Tuuleenergia kasutamisvõimalused Eestis / Ain Kull, Valdur Tiit

    Index Scriptorium Estoniae

    Kull, Ain, 1973-

    2005-01-01

    Autorite hinnangul on seni Eestis ulatuslik tuulejõu kasutamine raskendatud nii finantsprobleemide, kodumaise tootmise puudumise, rannikupiirkondade elektriliinide väikese võimsuse kui ka Narva põlevkivijaamade alakoormatuse tõttu. Tabel

  2. Lühidalt lahe tagant / toimetanud Ain Hinsberg

    Index Scriptorium Estoniae

    2011-01-01

    Haaga-Helia Rakenduskõrgkooli uuringust Soome restoranide kasvutendetsist. Helsingi majutusettevõtete statistilisi andmeid 2010. World Desingn Capital Helsinki 2012 pöördumisest avalikkusele ideede saamiseks. Suomenlinna turismi arendamisest. Soome turismimajandusest ja uuendustest turisminduses

  3. Ain't We Never Gonna Study No Grammar?

    Science.gov (United States)

    Simmons, Eileen A.

    1991-01-01

    Describes the dilemmas involved with teaching Standard American English (SAE) while still accepting and not judging nonstandard dialects. Relates how the teacher used "Pygmalion" by George Bernard Shaw to show students why they needed to learn SAE. (PRA)

  4. Advokaadi kutse-eetika reason d’etre / Ain Alvin

    Index Scriptorium Estoniae

    Alvin, Ain, 1959-

    2014-01-01

    Advokaadi kohustus on kutsetegevuses järgida lisaks seadusele kutse-eetika nõudeid, häid kombeid ja südametunnistust. Mida sellised kohustused sisuliselt tähendavad, millest tuleneb vajadus kutse-eetika kutseühendusesisese reguleerimise järele ja milline on kutse-eetika normide sisu?

  5. Geniaalne aines, hämmastav film / Tarmo Teder

    Index Scriptorium Estoniae

    Teder, Tarmo, 1958-

    2006-01-01

    Oktoobri algul Kuressaares peetud Saaremaalt pärit ameerika arhitekti Louis Kahni konverentsi raames Kuressaare Linnateatris näidatud dokumentaalfilmist "Minu arhitekt" ("My Architect") : režissöör Nathaniel Kahn : Ameerika Ühendriigid 2003

  6. Natura 2000 sai tuule tiibadesse Raplamaal / Ain Aivela

    Index Scriptorium Estoniae

    Aivela, Ain

    2004-01-01

    Natura 2000 idee jõudis Eestisse 2000. aastal, mil pilootprojekti raames ning Taani riigi rahalisel toel alustati Natura-võrgustiku eelvalikualade mahamärkimist Lääne- ja Raplamaal. Kommenteerinud Aleksei Lotman

  7. 虚晶近似法研究AIN-Al2O3固溶体系的力学性能和电子结构%Investigation of the electronic and mechanical properties of Al2O3-AlN solid solution by virtual crystal approximation

    Institute of Scientific and Technical Information of China (English)

    王颖; 卢铁城; 王跃忠; 岳顺利; 齐建起; 潘磊

    2012-01-01

    , AIN are both direct bandgap materials. Hybridizations take place between Al-3p, 3s and O, N-2p orbitals near the Fermi level in the AlON. The calculated results are consistent with relevant experimental results, which provides a theoretical method and reference for the further study.

  8. UniCredit Bank Eesti juht: Meie võimalused on Venemaal ja Euroopas, mitte Hiinas / Taavi Laur

    Index Scriptorium Estoniae

    Laur, Taavi

    2010-01-01

    UniCredit Bank Eesti juht vastab küsimustele, kas kriis tõi Eesti majanduses kaasa struktuurimuutuse, mis on praegu ettevõtjatele suurim väljakutse, kas Eesti võiks olla Euroopa ja Venemaa vaheline transiidimaa

  9. Riik ootas TeliaSoneralt üle turuhinna pakkumist / Taavi Veskimägi ; interv. Vallo Toomet

    Index Scriptorium Estoniae

    Veskimägi, Taavi, 1974-

    2004-01-01

    Rahandusminister ei näe võimalust, et riigil oleks TeliaSonera pakutud hinna juures võimalik oma osalust Eesti Telekomis võõrandada. Tema sõnul oli konsultatsioonifirma McKinsey pakutud hinnasiht kõrgem kui TeliaSonera pakutu

  10. Res Publicat on täna vaja rohkem kui kunagi varem / Taavi Veskimägi

    Index Scriptorium Estoniae

    Veskimägi, Taavi, 1974-

    2005-01-01

    Res Publica esimees seab erakonnale ülesandeks selgitada inimestele, et Res Publicat võib usaldada. Ta selgitab, et Res Publica parempoolne poliitika tähendab ka hoolimist nendest, kes ei saa endaga hakkama. Vt. samas: Viimased kampaaniapäevad

  11. Euroopa improviseerijate ansambel kutsus ainsaks külaliseks eesti muusiku / Taavi Kerikmäe ; interv. Kristina Kõrver

    Index Scriptorium Estoniae

    Kerikmäe, Taavi, 1976-

    2005-01-01

    Improvisatsioonilise muusikaga tegutsevast organisatsioonist GRIM, sellega seoses toimunud Euroopa improviseerijate ansambli kontsertidest Prantsusmaal, ansamblist, intervjuu ansamblis osalenud eesti muusikuga

  12. Aas : pole vahet, kas odavalt korteri saajal on kinnisvara või mitte / Taavi Aas ; interv. Urmas Seaver

    Index Scriptorium Estoniae

    Aas, Taavi, 1966-

    2007-01-01

    Ilmunud ka: Postimees : na russkom jazõke, 2. märts 2007, lk. 8. Tallinna abilinnapea sõnul ei pea linn vajalikuks uurida, kas turuhinnast palju odavamalt kortereid saavatel inimestel on juba kinnisvara, sest nii hüvitatakse neile omandireformiga tehtud ülekohut

  13. Raamat Läänemere vägilastest - jäälõhkujatest / Taavi Kelder

    Index Scriptorium Estoniae

    Kelder, Taavi

    2006-01-01

    rets. rmt.: "Suur Tõll" ja teised Eesti jäämurdjad/Vladimir Kopelman, Jaak Sammet, Peedu Sammalsoo...[jt.]; koostaja Mati Õun. Tallinn: Sentinel, 2005. 98 lk. : ill. Tiitellehel ka autorid: Mati Õun, Olaf Vaarmaa, Heino Arumäe, Roman Matkiewitcz

  14. Intellektuaalomand ja selle kuuluvus tarkvaraarenduslepingutes : [magistritöö] / Taavi Viilol ; Tartu Ülikool, õigusteaduskond ; juhendaja: Mario Rosentau

    Index Scriptorium Estoniae

    Viilol, Taavi

    2014-01-01

    Mõistetest, eritarkvara arenduslepingutest, intellektuaalomandi seadusjärgsest kuuluvusest, käsutatavatest IO õigustest ja nende üleminekust, autoriõigusest, kaubamärgiseaduse kohaldatavusest tarkvarale, tööstusdisainilahendusest, patendist

  15. Raamat Läänemere vägilastest - jäälõhkujatest / Taavi Kelder

    Index Scriptorium Estoniae

    Kelder, Taavi

    2006-01-01

    rets. rmt.: "Suur Tõll" ja teised Eesti jäämurdjad/Vladimir Kopelman, Jaak Sammet, Peedu Sammalsoo...[jt.]; koostaja Mati Õun. Tallinn: Sentinel, 2005. 98 lk. : ill. Tiitellehel ka autorid: Mati Õun, Olaf Vaarmaa, Heino Arumäe, Roman Matkiewitcz

  16. UniCredit Bank Eesti juht: Meie võimalused on Venemaal ja Euroopas, mitte Hiinas / Taavi Laur

    Index Scriptorium Estoniae

    Laur, Taavi

    2010-01-01

    UniCredit Bank Eesti juht vastab küsimustele, kas kriis tõi Eesti majanduses kaasa struktuurimuutuse, mis on praegu ettevõtjatele suurim väljakutse, kas Eesti võiks olla Euroopa ja Venemaa vaheline transiidimaa

  17. Järjest rohkem venelasi saab aru, et neid on petetud / Ivan Tšumakov ; intervjueerinud Taavi Minnik

    Index Scriptorium Estoniae

    Tšumakov, Ivan

    2016-01-01

    Intervjuu Venemaa ökonomisti ja poliitikaanalüütiku Ivan Tšumakoviga Venemaa majanduslikest perspektiividest ja sellest, mida võimude poliitika on Venemaa tavakodanikele viimastel aastatel kaasa toonud

  18. Res Publicat on täna vaja rohkem kui kunagi varem / Taavi Veskimägi

    Index Scriptorium Estoniae

    Veskimägi, Taavi, 1974-

    2005-01-01

    Res Publica esimees seab erakonnale ülesandeks selgitada inimestele, et Res Publicat võib usaldada. Ta selgitab, et Res Publica parempoolne poliitika tähendab ka hoolimist nendest, kes ei saa endaga hakkama. Vt. samas: Viimased kampaaniapäevad

  19. Intellektuaalomand ja selle kuuluvus tarkvaraarenduslepingutes : [magistritöö] / Taavi Viilol ; Tartu Ülikool, õigusteaduskond ; juhendaja: Mario Rosentau

    Index Scriptorium Estoniae

    Viilol, Taavi

    2014-01-01

    Mõistetest, eritarkvara arenduslepingutest, intellektuaalomandi seadusjärgsest kuuluvusest, käsutatavatest IO õigustest ja nende üleminekust, autoriõigusest, kaubamärgiseaduse kohaldatavusest tarkvarale, tööstusdisainilahendusest, patendist

  20. 18 octobre 2013 - Le Préfet de l’Ain L. Touvet signe le livre d'or avec le Directeur général du CERN R. Heuer et le Chef du Département Technologie F. Bordry. Photo de groupe, de gauche à droite: T. Kupisz, Secrétaire général de la sous préfecture de Gex; L. Miralles, Chef du Département Infrastructure et services généraux; F. Eder, Délégué aux Relations avec les Etats hôtes; S. Donnot, Sous-préfet de Gex; L. Touvet, Préfet de l'Ain; E. Sches, Sous-préfète de Nantua; E.Gröniger-Voss, Conseiller juridique du CERN; R. Heuer, Directeur général; F. Bordry, Chef du Département Technologie et P. Bloch, Chef du Département Physique.

    CERN Multimedia

    Anna Pantelia

    2013-01-01

    18 octobre 2013 - Le Préfet de l’Ain L. Touvet signe le livre d'or avec le Directeur général du CERN R. Heuer et le Chef du Département Technologie F. Bordry. Photo de groupe, de gauche à droite: T. Kupisz,\tSecrétaire général de la sous préfecture de Gex; L. Miralles, Chef du Département Infrastructure et services généraux; F. Eder, Délégué aux Relations avec les Etats hôtes; S. Donnot, Sous-préfet de Gex; L. Touvet, Préfet de l'Ain; E. Sches, Sous-préfète de Nantua; E.Gröniger-Voss, Conseiller juridique du CERN; R. Heuer, Directeur général; F. Bordry, Chef du Département Technologie et P. Bloch, Chef du Département Physique.

  1. Vahistatute võrdne kohtlemine Eesti vanglates ja arestimajades : [magistritöö] / Sigrid Nurm ; Tartu Ülikool, õigusteaduskond ; juhendajad: Ene Andresen, Berit Aaviksoo

    Index Scriptorium Estoniae

    Nurm, Sigrid, 1988-

    2013-01-01

    Võrdse kohtlemise põhiõigusest, kinnipidamistingimustest ja riietusest, keelatud esemetest, kambrivälisest tegevusest, massiteabevahendite kättesaadavusest, kinnipidamisasutuse välisest suhtlemisest, ettepanekutest ebavõrdse kohtlemise kõrvaldamiseks

  2. Petturlik hr Rottmann, föderaliseeruv Euroopa ja põhiseaduse aluspõhimõtted - poleemiline pastišš / Berit Aaviksoo

    Index Scriptorium Estoniae

    Aaviksoo, Berit, 1978-

    2013-01-01

    Euroopa Kohtu 2. märtsi 2010. a otsusest C-3135/08. Euroopa Liidu kodakondsus. Föderaliseeruv Euroopa. Põhiseaduse aluspõhimõtted. Artikkel põhineb autori 22. veebr. 2013. a. Tartu Ülikooli õigusteaduskonnas kaitstud doktoritööl "Riigi otsustamisruumi ahenemine: kodakondsus nüüdisaegses Euroopas"

  3. Petturlik hr Rottmann, föderaliseeruv Euroopa ja põhiseaduse aluspõhimõtted - poleemiline pastišš / Berit Aaviksoo

    Index Scriptorium Estoniae

    Aaviksoo, Berit, 1978-

    2013-01-01

    Euroopa Kohtu 2. märtsi 2010. a otsusest C-3135/08. Euroopa Liidu kodakondsus. Föderaliseeruv Euroopa. Põhiseaduse aluspõhimõtted. Artikkel põhineb autori 22. veebr. 2013. a. Tartu Ülikooli õigusteaduskonnas kaitstud doktoritööl "Riigi otsustamisruumi ahenemine: kodakondsus nüüdisaegses Euroopas"

  4. Kuus rektorit arvavad : [mõtteavaldused haridusest kui riskantsest investeeringust] / Mikko Lagerspetz, Kalle Tammemäe, Jaak Aaviksoo ... [jt.] ; intervjueeris Ede Schank

    Index Scriptorium Estoniae

    Aaviksoo, Jaak, 1954-

    2001-01-01

    Intervjuu kuue era- ja riikliku kõrgkooli rektoriga Eesti kõrghariduse ja ülikoolide hetkeseisust, kas olukorda Eesti kõrgharidusmaastikul võib võrrelda erapankade buumiga möödunud kümnendi alguses

  5. Deposition and characterization of TaAIN thin films by reactive magnetron sputtering; Deposicao e caracterizacao de filmes finos de TaAIN depositados por magnetron sputtering

    Energy Technology Data Exchange (ETDEWEB)

    Oliveira, G.B.; Fernandez, D.R.; Fontes Junior, A.S.; Felix, L.C.; Tentardini, E.K. [Universidade Federal de Sergipe (UFS), Sao Cristovao, SE (Brazil). Departamento de Ciencia e Engenharia de Materiais; Hubler, R. [Pontificia Universidade Catolica do Rio Grande do Sul (PUC-RS), RS (Brazil); Silva Junior, A.H. da, E-mail: brito-g@hotmail.com [Universidade Federal do Rio Grande do Sul (UFRGS), RS (Brazil)

    2016-07-01

    Phase stability, oxidation resistance and great mechanical properties are the main objectives when synthesizing protective coatings. The tantalum nitride (TaN) has aroused interest because of its high temperature stability, chemical inertness and thermal conductivity. However, it has a low hardness value when compared to other coatings. Researches has shown that one way to improvements in the properties of a thin film is by adding other elements in the deposition process. Therefore, the objective of this study was to deposit thin films of TaAlN by magnetron sputtering, changing the aluminum concentration of 2, 5, 7, to 14%. Then the coatings were characterized by EDS, RBS, GIXRD and nanohardness. In this study was found that the aluminum deposited did not change the oxidation resistance of the coating, and the highest value of hardness was 28 GPa for the sample with 14 at.%. (author)

  6. Mis on parem - Zaporozhets või Mercedes? / Andres Langemets

    Index Scriptorium Estoniae

    Langemets, Andres, 1948-

    2007-01-01

    Vastukaja Mikko Lagerspetzi artiklile 5. dets. Postimehes, mis oli omakorda vastukaja Jaak Aaviksoo artiklile 19. nov. Postimehes. Sotsioloogiast, sotsiaalteadlastest ja sotsioloogilistest küsitlustest

  7. Tartu maantee läheb sel kevadel kindlasti remonti / Uwe Gnadenteich

    Index Scriptorium Estoniae

    Gnadenteich, Uwe

    2005-01-01

    Tartu maantee rekonstrueerimise esimesest etapist. Tallinna abilinnapead Vladimir Maslov ja Peep Aaviksoo teelaiendusele ette jäävate kinnisvaraobjektide ostmise hetkeseisust, selleks ettenähtud summast

  8. Putini sõprade käes on Riia ja peagi võibolla ka Seim / Otto Ozols ; intervjueerinud Taavi Minnik

    Index Scriptorium Estoniae

    Ozols, Otto

    2016-01-01

    Intervjuu Läti kirjaniku ja publitsisti Otto Ozolsiga lõunanaabrite juures toimuvast ning sellest, kuidas on viimaste aastate arengud Euroopas ja Venemaal puudutanud Läti poliitikat ning ühiskonda

  9. Eesti saab Euroopa rahaliidu 17. liikmeks / Andrus Karnau ; kommenteerinud Marek Belka, Angela Merkel, Taavi Veskimägi ja Andrus Ansip

    Index Scriptorium Estoniae

    Karnau, Andrus

    2010-01-01

    1. jaanuaril liitub Eesti euroga. Eesti majandusest. Maailmas on käimas kolm valuutasõda: Hiina jeeni ümber, maailma rikkamate riikide keskpankade ümber ja arenevate riikide valitsuste valuutainterventsioonide ümber

  10. Putini sõprade käes on Riia ja peagi võibolla ka Seim / Otto Ozols ; intervjueerinud Taavi Minnik

    Index Scriptorium Estoniae

    Ozols, Otto

    2016-01-01

    Intervjuu Läti kirjaniku ja publitsisti Otto Ozolsiga lõunanaabrite juures toimuvast ning sellest, kuidas on viimaste aastate arengud Euroopas ja Venemaal puudutanud Läti poliitikat ning ühiskonda

  11. Eesti saab Euroopa rahaliidu 17. liikmeks / Andrus Karnau ; kommenteerinud Marek Belka, Angela Merkel, Taavi Veskimägi ja Andrus Ansip

    Index Scriptorium Estoniae

    Karnau, Andrus

    2010-01-01

    1. jaanuaril liitub Eesti euroga. Eesti majandusest. Maailmas on käimas kolm valuutasõda: Hiina jeeni ümber, maailma rikkamate riikide keskpankade ümber ja arenevate riikide valitsuste valuutainterventsioonide ümber

  12. ISISe kadudes jätkaks võitlejad rünnakuid oma päritolumaades / Gil Ad Ariely ; intervjueerinud Taavi Minnik

    Index Scriptorium Estoniae

    Ariely, Gil Ad

    2016-01-01

    Intervjuu Iisraeli riikliku julgeoleku-uuringute instituudi vanemteaduri ja Iisraeli armee erukolonelleitnandi Gil Ad Arielyga. Islamiriigi survestamine Süürias ja Iraagis võib kaasa tuua õhupalliefekti - enamik välisvõitlejaid läheks sinna, kus neil on mugavam ja kus on võimalik oma võitlust jätkata

  13. ISISe kadudes jätkaks võitlejad rünnakuid oma päritolumaades / Gil Ad Ariely ; intervjueerinud Taavi Minnik

    Index Scriptorium Estoniae

    Ariely, Gil Ad

    2016-01-01

    Intervjuu Iisraeli riikliku julgeoleku-uuringute instituudi vanemteaduri ja Iisraeli armee erukolonelleitnandi Gil Ad Arielyga. Islamiriigi survestamine Süürias ja Iraagis võib kaasa tuua õhupalliefekti - enamik välisvõitlejaid läheks sinna, kus neil on mugavam ja kus on võimalik oma võitlust jätkata

  14. Eesti tootjad eiravad teadlikult CE-märgistust / Ain Alvela

    Index Scriptorium Estoniae

    Alvela, Ain, 1967-

    2005-01-01

    Ilmunud ka: Delovõje Vedomosti 2. nov. lk. 27. Euroopa Liit nõuab ehitusmaterjalide märgistamist CE-märgistusega, kuid kontrolli puudumise tõttu ei kiirusta tootjad nõude täitmisega. Kommenteerivad Urmas Leitmäe ja Hanno Egipt. Vt. samas: CE-märgistus annab tootele garantii; Märk teavitab klienti

  15. Recubrimientos protectores de TiN y AIN: comportamiento frente a temperatura

    Directory of Open Access Journals (Sweden)

    Auger, M. A.

    2006-04-01

    Full Text Available The use of ceramic materials like titanium and aluminium nitrides have experienced a great improvement in the last years due to the variety of applications they show. The use as protective coatings on industrial tools is one important application with very favorable results for the moment, as it is the use as coating molds used for different elements fabrication. One of the mostly often used techniques to deposit protective coatings is the sputtering technique, which has been used in this work. In the present study we have analysed structural and mechanical properties of TiN and AlN thin films, using X-Ray diffraction, scanning electron microscopy, nanoindentation and pin-on-disk techniques. Thermal treatments have been applied on the mentioned films, applying three different temperature values: 750oC, 850oC y 950oC. Changes in their properties before and after the treatments have been observed. TiN layers show a thermal resistance around 750oC. The thermal resistance for AlN layers is around 850oC, being also observed an improvement in their properties when applying 850ºC of thermal treatment.

    La utilización de materiales cerámicos como el nitruro de titanio o de aluminio ha experimentado una gran popularización en los últimos años gracias a su gran variedad de aplicaciones. Una importante aplicación que cuenta hasta el momento con resultados muy favorables es la de su uso como recubrimientos protectores de herramientas industriales, así como de moldes empleados en la fabricación de diferentes elementos. Una de las técnicas más utilizadas en la obtención de recubrimientos protectores es la técnica de sputtering, utilizada en este trabajo. En el presente estudio se han analizado las propiedades estructurales y mecánicas de láminas delgadas de TiN y AlN mediante las técnicas de difracción de rayos X, microscopía electrónica de barrido, nanoindentación y pin-on-disk. Dichas capas han sido sometidas a un tratamiento térmico en el que se han aplicado tres temperaturas: 750oC, 850oC y 950oC, y se han observado variaciones en sus propiedades antes y después del tratamiento. Las capas de TiN presentan una resistencia térmica en torno a 750oC. Las capas de AlN resisten hasta una temperatura en torno a 850oC, observándose además una mejoría en sus propiedades al ser sometidas a dicha temperatura de 850oC.

  16. Uudised : Ain Anger tuli ooperilauljate konkursil esikohale. Elton Johni fotokogu näitus

    Index Scriptorium Estoniae

    2000-01-01

    A. Anger võitis 11.-14. juuliniu Lätis Jurmalas toimunud rahvusvahelise noorte ooperilauljate konkursi "Amber Sea Voices". E. John korraldab novembris Ameerikas Atlantas oma fotokogu avaliku näituse "Chorus of Light"

  17. Veiko Õunpuu pälvis Euroopa Talendi auhinna / Ain Lember

    Index Scriptorium Estoniae

    Lember, Ain

    2008-01-01

    Cannes'i filmifestivali raames toimuval Euroopa päeval antakse filmirežissöör Veiko Õunpuule üle Euroopa Talendi auhind (European Talent Prize) mängufilmiprojekti "Püha Tõnu Kiusamine" eest (produtsent Katrin Kissa). MEDIA Desk Eesti juht Anu Ernits peab seda suureks võiduks kogu Eesti filmile

  18. Tunnustuseta kuuendik Eesti majandusest riigiga ümarlaua taga / Ain Hinsberg

    Index Scriptorium Estoniae

    Hinsberg, Ain

    2000-01-01

    Turismiettevõtjad juhivad tähelepanu sellele, et riigil on jäänud arusaamatuks turismi kui majandussektori tähtsus ja tähendus. Turismi arengukava 2000-2004. Kommenteerivad: Toomas Hendrik Ilves, Riina Lõhmus, Mart Laar, Mihkel Pärnoja ja David Gorman

  19. Sõjanuiad, võimusümbolid ja margapuud / Ain Mäesalu, Jüri Peets

    Index Scriptorium Estoniae

    Mäesalu, Ain, 1955-

    2010-01-01

    Artiklis käsitletakse muinas- ja keskaegsete sõjanuiade problemaatikat arheoloogiliste leidude, kirjalike allikate ja omaaegsete kunstiteoste põhjal. Eestist leitud sõjanuiapeadest, mida kasutati 12.-13. sajandil relvadena, kuid need võisid sümboliseerida ka selle omaniku kõrget staatust. 19.-20. sajandil kasutati samasuguseid metalltahukaid margapuu otsaraskusena

  20. A Completely New Type of Actuator -or- This Ain't Your Grandfather's Internal Combustion Engine

    Science.gov (United States)

    Gore, Brian W.; Hawkins, Gary F.; Hess, Peter A.; Moore, Teresa A.; Fournier, Eric W.

    2010-01-01

    A completely new type of actuator - one that is proposed for use in a variety of environments from sea to land to air to space - has been designed, patented, built, and tested. The actuator is loosely based on the principle of the internal combustion engine, except that it is a completely closed system, only requiring electrical input, and the working fuel is water. This paper outlines the theory behind the electrolysis- and ignition-based cycle upon which the actuator operates and describes the performance capability test apparatus and results for the actuator. A mechanism application that harnessed the unit s power to twist a scaled rotor blade is also highlighted.

  1. Recubrimientos protectores de TiN y AIN: comportamiento frente a temperatura

    OpenAIRE

    O. SÁNCHEZ; J. M. Albella; M. A. Auger

    2006-01-01

    [ES] La utilización de materiales cerámicos como el nitruro de titanio o de aluminio ha experimentado una gran popularización en los últimos años gracias a su gran variedad de aplicaciones. Una importante aplicación que cuenta hasta el momento con resultados muy favorables es la de su uso como recubrimientos protectores de herramientas industriales, así como de moldes empleados en la fabricación de diferentes elementos. Una de las técnicas más utilizadas en la obtención de recubrimie...

  2. Summertime, and the Choosin' Ain't Easy: An Ice Cream Counting Problem.

    Science.gov (United States)

    Kreith, Kurt

    1992-01-01

    Utilizes the problem of determining the number of different ice cream cones and cups that can be made from a choice of 31 flavors to investigate the concepts of combinations and permutations. Provides a set of six related problems with their answers. (MDH)

  3. Eesti puidutööstuse tulevik : nutikas turundus / Ain Alvela

    Index Scriptorium Estoniae

    Alvela, Ain, 1967-

    2015-01-01

    Eesti metsa- ja puidutööstuse kestev areng sõltub suuresti sellest, kuidas oskame üleilmselt turul avanenud võimalustest kinni haarata, samas ennast võimalikult pilkupüüdvalt turundades. Vestlusest ettevõtlusminister Urve Palo ja Tartu Ülikooli turunduse dotsendi ning TÜ majandusteaduskonna ettevõtlus- ja innovatsioonikeskuse juhataja Andres Kuusikuga

  4. Kolm traktorit, mis teevad kõiki töid / Ain Alvela

    Index Scriptorium Estoniae

    Alvela, Ain, 1967-

    2015-01-01

    Järgmine aasta toob Eesti põllumeeste käsutusse vähemalt kolm uut sarnases võimsusklassis traktorit: Valtra N-seeria, Kubota M7-seeria, Claas Arion 400-seeria. Kõiki neid iseloomustav ühine nimetaja on universaalsus

  5. Metsanduse lisandväärtused vajavad teadvustamist / Ain Alvela, Kairi Oja

    Index Scriptorium Estoniae

    Alvela, Ain, 1967-

    2013-01-01

    Oma seisukohti tutvustavad keskkonnaministeeriumi asekantsler Marku Lamp, AS-i Arco Real Estate põllu- ja metsamaade maakler Margus Põld, RMK juht Aigar Kallas, OÜ Metsaekspert juhataja Peep Põntson, EMÜ professor Hardi Tullus, Hiiumaa metsaseltsi eestvedaja Aira Toss

  6. Konkurentide ees annab eelise disainiga tegelemine / Peter L. Phillips ; intervjueerinud Ain Alvela

    Index Scriptorium Estoniae

    Phillips, Peter L.

    2010-01-01

    Intervjuu rahvusvaheliselt tunnustatud disainieksperdiga tootmisettevõtete ja disainerite koostöö tähtsusest, disaineri rollist. Eksperdi sõnul on äärmiselt oluline kasutada toodete eristumiseks ja nende turustamiseks disaini, kui Eesti tootjatel on soov müüa tooteid Eestist välja

  7. Preliminary investigations of the southeastern section of the settlement site of Lehmja / Ain Lavi

    Index Scriptorium Estoniae

    Lavi, Ain, 1951-

    2007-01-01

    Seoses Tallinn-Tartu maantee rekonstrueerimisega toimusid 1985.-1986. aastal Lehmja asula lõunapoolsel alal mahukad päästekaevamised. Selgus, et tegemist on I aastatuhandest pärit asulakohaga, milliseid teatakse Eestis vähe. 2006. aasta kaevamismetoodikast ja uurimistulemustest

  8. "I Know There Ain't No Pigs with Wigs": Challenges of Tier 2 Intervention

    Science.gov (United States)

    Stephens, Diane; Cox, Robin; Downs, Anne; Goforth, Jennie; Jaeger, Lisa; Matheny, Ashley; Plyler, Kristi; Ray, Sandra; Riser, Lee; Sawyer, Beth; Thompson, Tara; Vickio, Kathy; Wilcox, Cindy

    2012-01-01

    As a part of Response to Intervention, for three years, ten reading interventionists provided supplemental support to readers. They formed a learning community, took an inquiry-based approach to assessment and developed a theory of what students needed to know and be able to do as readers. They addressed and learned from several other challenges:…

  9. Laevade erinevate soetamisviiside kommertstingimuste võrdlev analüüs / Ain Eidast, Allan Kivi

    Index Scriptorium Estoniae

    Eidast, Ain, 1939-2013

    2005-01-01

    Laevade erinevate soetamisviiside analüüs näitab, et ühtse, kõikidele osapooltele vastuvõetavate tingimuste väljatöötamine ja rakendamine ei ole tehniliselt võimalik ning majanduslikult õigustatud. Tabelid. Diagrammid

  10. Trial excavations of the northern part of the Lehmja settlement site / Ain Lavi

    Index Scriptorium Estoniae

    Lavi, Ain

    2004-01-01

    Hilisrauaajal on pinnaveetaseme tõus sundinud Lehmja asukaid ümber asuma Tuuleveskimäe lõuna- ja edelajalamile. 2003. aasta kaevamiste põhjal näib, et Tuuleveskimäe edelanõlvale tekkis asustus keskajal

  11. Growth characteristics, optical properties, and crystallinity of thermal and plasma-enhanced ALD AIN films

    NARCIS (Netherlands)

    Van Bui, H.; Wiggers, F.B.; Aarnink, A.A.I.; Nguyen, M.D.; Jong, de M.P.; Kovalgin, A.Y.; Gupta, A.Y.

    2014-01-01

    Using real-time in-situ spectroscopic ellipsometry and ex-situ atomic force microscopy and X-ray diffraction, we have investigated the growth characteristics, especially ocusing on the initial growth (nucleation) regime, optical properties and crystalline structure of thin films of aluminum nitride

  12. Katrin Pudersell kaitses farmaatsiadoktori väitekirja / Ain Raal, Elmar Arak

    Index Scriptorium Estoniae

    Raal, Ain, 1961-

    2006-01-01

    3. mail 2006 kaitses farmaatsiamagister Tartu Ülikooli arstiteaduskonna nõukogu ees doktoriväitekirja "Tropaanalkaloidide ja riboflaviini produktsioon koera-pöörirohu (Hyoscyamus niger L.) põllu- ja koekultuurides

  13. Preliminary investigations of the southeastern section of the settlement site of Lehmja / Ain Lavi

    Index Scriptorium Estoniae

    Lavi, Ain, 1951-

    2007-01-01

    Seoses Tallinn-Tartu maantee rekonstrueerimisega toimusid 1985.-1986. aastal Lehmja asula lõunapoolsel alal mahukad päästekaevamised. Selgus, et tegemist on I aastatuhandest pärit asulakohaga, milliseid teatakse Eestis vähe. 2006. aasta kaevamismetoodikast ja uurimistulemustest

  14. Eesti ei maksa Natura aladel toetust 7800 krooni hektari kohta / Ain Lember

    Index Scriptorium Estoniae

    Lember, Ain

    2004-01-01

    EL 2007-2013 eelarve eelnõu kohaselt võib Natura 2000 aladel tegutsevatele põllumajandustootjatele maksta põllumajanduskõlviku hektari kohta igal aastal kuni 7800 krooni. Põllumajandusministeeriumi spetsialistid ei pea nii suurte toetuste maksmist võimalikuks

  15. Jaan Tõnissoniga kakskümmend aastat tagasi : [art.] / Ain Kaalep

    Index Scriptorium Estoniae

    Kaalep, Ain, 1926-

    1997-01-01

    Ilm.: Edasi 1988, 12. november, nr. 259, lk. 4-5. Tekst ilmub täiendatult. A. Kaalep oma Jaan Tõnissonile pühendatud luuletustest "Romansid Don Quijotest, mis Cide Hamete Benengeli pühendas Don Juan de Trillo, Dianogada hertsogi õndsale mälestusele", ilmunud kogus "Klaasmaastikud" (Tallinn : Eesti Raamat, 1971)

  16. MTZ trügib maailma mõjukate traktoritootjate sekka : [Minski traktoritehas] / Ain Alvela

    Index Scriptorium Estoniae

    Alvela, Ain, 1967-

    2015-01-01

    2016. a oma asutamise 70. aastapäeva tähistav Minski traktoritehas (MTZ) panustab viimse kümnendi jooksul jõuliselt Euroopa tingimustele ja nõuetele vastavate traktorite välja töötamisele ning tootmisele

  17. Teaduspargist võrsub eriti agar gasell / Ain Alvela ; kommenteerinud Seren Eilmann

    Index Scriptorium Estoniae

    Alvela, Ain, 1967-

    2010-01-01

    Tallinna tehnoloogiapargi Tehnopol ja Tartu teaduspargi ettevõtlusinkubaatorid pakuvad ettevõtluskeskkonda kiiret arengut taotlevatele ettevõtetele. Tehnopolis on gaselli staatuse saanud 22 firmat, Tartu teaduspargis 13 firmat. AS-ist Proekspert, OÜ-st Interfire. Tabel

  18. "You Ain't My Daddy!": Black Male Teachers and the Politics of Surrogate Fatherhood

    Science.gov (United States)

    Brockenbrough, Ed

    2012-01-01

    Recent scholarship on male teachers across several national contexts has investigated the dilemmas of hegemonic masculinity for male educators while only recently beginning to examine race as a mediator of masculinity politics in teaching. Conversely, an emergent body of work on Black male teachers has centred analyses of race and culture, but has…

  19. Eesti edukad ettevõtted ahvatlevad varakaid piiritaguseid ülesostjaid / Ain Alvela

    Index Scriptorium Estoniae

    Alvela, Ain, 1967-

    2006-01-01

    Viimasel ajal on sagenenud ettevõtete ülevõtmine piiritaguste firmade poolt. Vt. samas: Atria pole Valga kasumlikkust tõstnud; Valio sai Võru juustu näol oma kontserni ka juustutööstuse; Tartu Õlletehas neelas Ösel Foodsi; Plus Brewery nime saanud Pärnu Õlu uuendab seadmeid ja brände

  20. "If It Ain't Broke, Don't Fix It"

    DEFF Research Database (Denmark)

    Blasco, Maribel; Tackney, Charles

    2013-01-01

    embedded in the hidden curriculum, which made Danish higher education effective at producing graduates with analytical and personal abilities and dispositions, such as reflexivity, curiosity, collaboration and trust that are particularly suitable for today's globalised, knowledge–based economies. We...

  1. Sulev Keedus : "Jonathan" on film esti indiaanlastest / Sulev Keedus ; interv. Ain Lember

    Index Scriptorium Estoniae

    Keedus, Sulev, 1957-

    2007-01-01

    Dokumentaalfilm "Jonathan Austraaliast" : režissöör ja operaator Sulev Keedus : F-Seitse 2007. Režissöör filmist, kaitstes end kohaliku rahva süüdistuste vastu filmis kujutatu ebaeetilisuse üle

  2. Äripäev maakonnas : Ida-Virumaa / Ain Alvela

    Index Scriptorium Estoniae

    Alvela, Ain, 1967-

    2007-01-01

    Ida-Virumaa edukamad firmad 2006. aastal. Vt. samas: Narva KÕK sai moodsa maja; Gasellidele soodne ärikliima; Tulus õlitootmine annab arenguplaanidele indu; Metallurgiatehas saadab akuplii taastootmisse; Tehnika rentimine käib ehitamisega kõrvu; Küsimustele vastab Eesti Keemiatööstuse Liidu tegevdirektor Hallar Meybaum: Piirangud sunnivad põlevkivi väärtustama

  3. Otepää piiskoplinnuse hävimisdaatumist / Ain Mäesalu

    Index Scriptorium Estoniae

    Mäesalu, Ain, 1955-

    2010-01-01

    Ülevaade, miks autor hakkas 1980. aastate keskel toetama hüpoteesi Otepää keskaegse linnuse hävimisest 1396. aastal. Samas on kriitiliselt vaetud sama ajakirja numbris mõningaid Jaak Mälli seisukohti

  4. Küla arengukava on külaarengu toetuse saamiseks vajalik / Ain Lember

    Index Scriptorium Estoniae

    Lember, Ain

    2004-01-01

    Liikumine Kodukant kavatseb esitada põllumajandusministeeriumile protestikirja, kuna ei nõustu ministeeriumi infopäevadel levitatava tõlgendusega nagu võiks külade taastamise ja arendamise meetme toetust taotleda ka ilma küla arengukavata. Arvamust avaldavad: Maris Ode, Lemmi Maasik, Heli Raamets, Marek Raud ja Sille Rähn

  5. "It Ain't Necessarily So" - Interpretations and Misinterpretations of Quantum Theory

    Science.gov (United States)

    Stachel, John

    After describing some recent misinterpretations of Bohr's views on quantum theory, largely based on their conflation with those of Heisenberg, a correct account of Bohr's approach is given in his own words. Then some guidelines toward a valid interpretation of quantization are discussed, including: the role of the quantum of action, the primacy of processes over states, the difference between classical and quantum ensembles, and between non-relativistic quantum mechanics and relativistic quantum field theory.

  6. Odnim blazhennõm dnjom : [luuletused] / Uku Masing ; lühibiograafia: A. K. [Ain Kaalep

    Index Scriptorium Estoniae

    Masing, Uku, 1909-1985

    1999-01-01

    Sisu: Odnim blazhennõm dnjom ; Veter tshelnok bõl ; Pesn soldat, otstupajushishih pod natiskom netshistoi silõ / tlk. Svetlan Semenenko ; "Tõ groznaja gora..." ; "Ne mozhet ditja bez ottsa naroditsja..." ; K predelam ; Vestnik iz "Magellanovõh oblakov" : katkend ; Postigaja i verja ; V kazhdom strannike - nadezhda / tlk. A. Zorin. Orig.: Ühel kaunil päeval ; Süstik on tuul ; Tontide eest taganejate sõdurite laul ; "Sa oled mägi, mida kardavad me karjad..." ; "Välja südamest visata..." ; Piiridele püüdes ; Saadik Magellani pilvest : katkend ; Mõistu saades ja uskudes ; Iga rändur on lootus

  7. Prügifirma ähvardas kohtuga Ida-Saaremaa omavalitsusi / Ain Lember

    Index Scriptorium Estoniae

    Lember, Ain

    2009-01-01

    OÜ Prügimees lubab Ida-Saaremaa valdadele saadetud kirjas nõuda kohtu kaudu omavalitsustelt välja kahju, mille on ettevõttele väidetavalt põhjustanud valdade keeldumine tõsta alates 1. juulist 2009. aastal olmejäätmete veo piirhinda

  8. "It Ain't Hard No More!" Individualizing Instruction for Struggling Readers

    Science.gov (United States)

    Stover, Katie; Sparrow, Amanda; Siefert, Bobbi

    2017-01-01

    Despite sound instructional practices to develop foundational reading skills with young learners, numerous learners continue to lag behind in literacy learning. Many do not view themselves as readers, lack motivation, and become disengaged with learning in general. This article shares a research-based instructional framework developed by one of…

  9. Äripäev maakonnas : Lääne-Virumaa TOP / Ain Alvela

    Index Scriptorium Estoniae

    Alvela, Ain, 1967-

    2007-01-01

    Lääne- Virumaa edukamad firmad 2006. aastal. Vt. samas: Kaevanduste laienemine hirmutab Sõmeru valda; Lääne-Virus ebatüüpilised gasellid; Tsemenditootja naudib pikaajalise eeltöö vilju; Eesti ärikliima sobib mööblitootjale; Palms hõivab Euroopat; Küsimustele vastab Rakvere linnapea Andres Jaadla

  10. Applying of whole-tree harvesting method; Kokopuujuontomenetelmaen soveltaminen aines- ja energiapuun hankintaan

    Energy Technology Data Exchange (ETDEWEB)

    Vesisenaho, T. [VTT Energy, Jyvaeskylae (Finland); Liukkonen, S. [VTT Manufacturing Technology, Espoo (Finland)

    1997-12-01

    The objective of this project is to apply whole-tree harvesting method to Finnish timber harvesting conditions in order to lower the harvesting costs of energy wood and timber in spruce-dominant final cuttings. In Finnish conditions timber harvesting is normally based on the log-length method. Because of small landings and the high level of thinning cuttings, whole-tree skidding methods cannot be utilised extensively. The share of stands which could be harvested with whole-tree skidding method showed up to be about 10 % of the total harvesting amount of 50 mill. m{sup 3}. The corresponding harvesting potential of energy wood is 0,25 Mtoe. The aim of the structural measurements made in this project was to get information about the effect of different hauling methods into the structural response of the tractor, and thus reveal the possible special requirements that the new whole-tree skidding places forest tractor design. Altogether 7 strain gauge based sensors were mounted into the rear frame structures and drive shafts of the forest tractor. Five strain gauges measured local strains in some critical details and two sensors measured the torque moments of the front and rear bogie drive shafts. Also the revolution speed of the rear drive shaft was recorded. Signal time histories, maximum peaks, Time at Level distributions and Rainflow distributions were gathered in different hauling modes. From these, maximum values, average stress levels and fatigue life estimates were calculated for each mode, and a comparison of the different methods from the structural point of view was performed

  11. MTZ trügib maailma mõjukate traktoritootjate sekka : [Minski traktoritehas] / Ain Alvela

    Index Scriptorium Estoniae

    Alvela, Ain, 1967-

    2015-01-01

    2016. a oma asutamise 70. aastapäeva tähistav Minski traktoritehas (MTZ) panustab viimse kümnendi jooksul jõuliselt Euroopa tingimustele ja nõuetele vastavate traktorite välja töötamisele ning tootmisele

  12. Impact of life style on the nutritional status of medical students at Ain Shams University.

    Science.gov (United States)

    Bakr, E M; Ismail, N A; Mahaba, H M

    2002-01-01

    This cross sectional study was carried out to assess the nutritional status of medical students and to determine its relation to their life style. The study involved 317 students at, Am Shams University. Anthropometric measurements such as weight, height, mid-arm circumference, triceps skin fold thickness and body mass index were measured. The students completed a self-administered questionnaire including data about some life style factors and food-frequency consumption. The study revealed that 41.3% of the students were of normal weight while 9.5% of the sample were underweight, 36.9% were overweight and 12.5% were obese. The mean mid upper arm circumference (MUAC) and mid arm muscle circumference (MAMC) of males was significant higher than that of females, while the mean triceps skin fold (TSF) of females was significant higher than that of males. The food frequency questionnaire analysis showed that most of students consume all food groups items faire. There was no statistical significant difference between the body mass index (BMI) of students and different types of food consumption. About two thirds of the students used to practice exercise, 26.9% of the students practiced exercise for less than 2 hours per week, while 33.9% of them for more than 2 hours. There was no statistical significant difference between the BMI of students and different types of exercise. However, there was significant higher percentage of males play sports and practice running (44.7% and 19.4% respectively) compared to (11.7% and 8.1%) of females. Sixty four percent of the students usually have regular meals. About 87.2% of obese compared to 64.9% of normal weight students eat snacks between meals, the difference was statistically significant. Obese individuals eat more during watching television and during feeling of stress compared to non-obese and the difference was statistically significant. The duration of practicing exercise, sports and playing computer was significantly higher in males than females. However, the duration of watching television was significantly higher in females than males. Logistic regression analysis results showed that family history of obesity and some life style factors as duration of computer use, eating more during stress time and snacking between meals were important risk factors for obesity. We concluded that about half of medical students were overweight and obese. The most important life style factors responsible for obesity were longer time spent using computer, eating more during time of stress and snacking between meals. Also, genetic factors played an important role in development of obesity. It is recommended to develop nutritional education and physical activities programs to face the problem of increasing the rate of overweight and obesity among university students.

  13. Füüsikud maailma päästmas / Ain Ainsaar

    Index Scriptorium Estoniae

    Ainsaar, Ain

    2003-01-01

    9.-11. oktoobrini Tallinna Pedagoogikaülikoolis aset leidnud rahvusvahelisest seminarist "Tiheda plasma ja materjalide interaktsioon", kus käsitleti termotuumareaktorite mudelite ehitamisel ette tulnud tehnilisi raskusi

  14. Sõjageograafia aine ja Eestimaa sõjageograafia 1920. aastatel / Kersti Vennik

    Index Scriptorium Estoniae

    Vennik, Kersti, 1975-

    2003-01-01

    Autori arvates puudub praeguses ohvitseride väljaõppes kursus, kus selgitataks täpsemalt Eesti maastike omadusi, erinevate maastiku-komponentide omavahelist koosmõju ning maastiku mõju kaitsejõudude tegevusele. Polkovnik Nikolai Reegi (1890-1942) panusest Eesti geograafiateaduse ajalukku

  15. AINEs como tratamiento coadyuvante de la enfermedad periodontal NSAIDs in the treatment of periodontal disease

    OpenAIRE

    2007-01-01

    Se presenta una revisión bibliográfica acerca de la aplicación de antiinflamatorios de forma coadyuvante en el tratamiento periodontal. Tras una breve introducción, se establecen las bases inmunológicas de la inflamación y destrucción periodontal, centrándonos en el metabolismo del ácido araquidónico y los cuatro mediadores más implicados actualmente en la destrucción periodontal: prostaglandina E2 (PGE2), prostaglandina F2a (PGF2a), leucotrieno B4 (LTB4) y factor activador de plaquetas (PAF)...

  16. Konkurendid üritavad Rakvere lihatrooni kõigutada / Ain Alvela

    Index Scriptorium Estoniae

    Alvela, Ain, 1967-

    2008-01-01

    HK Ruokatalo kontserni kuuluv Rakvere Lihakombinaat on Eesti lihatootjate seas liidrikohal, omades kolmandikku turust. Vt. samas: CV: Anne Mere; AS Rakvere Lihakombinaat; Rohkem kui sajandipikkune ajalugu; Atria Baltic; Lihatööstuses peab kõik minema müügiks koos saba ja sarvedega; Viiner versus juurikad; Tootmine ja loomakasvatus käivad käsikäes; Tabel: Suuremad lihatoodete valmistajad Eestis; Diagramm: Lihatootjate turuosad 2008. aasta suvel. Kommenteerivad Olli Antniemi ja Olle Horm

  17. Odnim blazhennõm dnjom : [luuletused] / Uku Masing ; lühibiograafia: A. K. [Ain Kaalep

    Index Scriptorium Estoniae

    Masing, Uku, 1909-1985

    1999-01-01

    Sisu: Odnim blazhennõm dnjom ; Veter tshelnok bõl ; Pesn soldat, otstupajushishih pod natiskom netshistoi silõ / tlk. Svetlan Semenenko ; "Tõ groznaja gora..." ; "Ne mozhet ditja bez ottsa naroditsja..." ; K predelam ; Vestnik iz "Magellanovõh oblakov" : katkend ; Postigaja i verja ; V kazhdom strannike - nadezhda / tlk. A. Zorin. Orig.: Ühel kaunil päeval ; Süstik on tuul ; Tontide eest taganejate sõdurite laul ; "Sa oled mägi, mida kardavad me karjad..." ; "Välja südamest visata..." ; Piiridele püüdes ; Saadik Magellani pilvest : katkend ; Mõistu saades ja uskudes ; Iga rändur on lootus

  18. Effects of heat treatment on the properties of powder injection molded AIN ceramics

    Institute of Scientific and Technical Information of China (English)

    DU Xueli; QIN Mingli; Akhtar Farid; FENG Peizhong; QU Xuanhui

    2008-01-01

    The effects of two different heat-treatment atmospheres,nitrogen atmosphere and reducing nitrogen atmosphere with carbon,on the properties of Y2O3-doped aluminum nitride (AlN) ceramics were investigated.The AlN powder as a raw material was synthesized by self-propagating high-temperature synthesis (SHS) and compacts were fabricated by employing powder injection molding technique.The polymer-wax binder consisted of 60 wt.% paraffin wax (PW),35 wt.% polypropylene (PP),and 5 wt.% stearic acid (SA).After the removal of binder,specimens were sintered at 1850℃ in nitrogen atmosphere under atmospheric pressure.To improve the thermal conductivity,sintered samples were reheated.The result reveals that the heat-treatment atmosphere has significant effect on the properties and secondary phase of AlN ceramics.The thermal conductivity and density of AlN ceramics reheated in nitrogen gas are 180 W·m-1 K-1 and 3.28 g,cm-3 and the secondary phase is yttrium aluminate.For the sample reheated in reducing nitrogen atmosphere with carbon,the thermal conductivity and density are 173 W.m-1.K-1 and 3.23 g·cm-3,respectively,and the secondary phase is YN.

  19. Promõshlennõje zonõ ohvatil "mjortvõi sezon" / Ain Alvela

    Index Scriptorium Estoniae

    Alvela, Ain, 1967-

    2008-01-01

    Arendajad on tehnoparkide rajamise ooterežiimile pannud - ostjaid jaguks, kuid võimalusi napib. Diagramm: Za pjat let stoimost zemli promõshlennogo naznatshenija võrosla v pjat raz; Tabel: Naiboleje dorogaja zemlja - v promparke Lasnamäe. Kommenteerivad Enn Tosso, Nikolai Pitshugov ja Urmas Ahven

  20. Füüsikud maailma päästmas / Ain Ainsaar

    Index Scriptorium Estoniae

    Ainsaar, Ain

    2003-01-01

    9.-11. oktoobrini Tallinna Pedagoogikaülikoolis aset leidnud rahvusvahelisest seminarist "Tiheda plasma ja materjalide interaktsioon", kus käsitleti termotuumareaktorite mudelite ehitamisel ette tulnud tehnilisi raskusi

  1. Eesti ei maksa Natura aladel toetust 7800 krooni hektari kohta / Ain Lember

    Index Scriptorium Estoniae

    Lember, Ain

    2004-01-01

    EL 2007-2013 eelarve eelnõu kohaselt võib Natura 2000 aladel tegutsevatele põllumajandustootjatele maksta põllumajanduskõlviku hektari kohta igal aastal kuni 7800 krooni. Põllumajandusministeeriumi spetsialistid ei pea nii suurte toetuste maksmist võimalikuks

  2. Living with the Sermon of the Mount : an uncomfortable presence of transcendence / Ain Riistan

    Index Scriptorium Estoniae

    Riistan, Ain, 1965-

    2003-01-01

    Ettekanne sümpoosionilt: Gemeinsames Symposium der Evangelisch-Theologischen Fakultät der Universität Tartu, der Estnischen Studiengesellschaft für Morgenlandkunde und der Deutschen Religionsgeschichtlichen Studiengesellschaft. Tartu, 2001

  3. Rising bacterial resistance to common antibiotics in Al Ain, United Arab Emirates.

    Science.gov (United States)

    Al-Kaabi, M R; Tariq, W U-Z; Hassanein, A A

    2011-06-01

    There is a dearth of local information in Al Amin, United Arab Emirates about antibiotic resistance patterns. In this retrospective study in a tertiary referral hospital, antibiotic susceptibility results were analysed over the 5-year period 2004-08 and compared with a previous study in the same hospital during 1999-2002. Staphylococcus aureus showed a significant decrease in sensitivity to oxacillin from 95.0% in the period 1999-2002 to 84.4% in 2008. Sensitivity of Acinetobacter spp. to imipenem dropped from 99.0% in 2004 to only 32.5% in 2008. During the same period, almost half of Escherichia coli isolates developed resistance to cefotoxime. Significant reductions in sensitivity to Pseudomonas aeruginosa between 1999 and 2008 were found for almost all the antibiotics tested. Klebsiella spp. did not show any significant change in resistance to any of the tested antibiotics. Serious efforts are needed to reduce the risk of the spread of resistant strains of bacteria.

  4. If Momma Ain't Happy: Explaining Declines in Marital Satisfaction among New Mothers

    Science.gov (United States)

    Dew, Jeffrey; Wilcox, W. Bradford

    2011-01-01

    This study tests competing explanations for the link between the transition to motherhood and declines in wives' marital satisfaction. Using data from the first and second waves of the National Survey of Families and Households (N = 569), we found that new mothers' marital satisfaction declines could be attributed to reductions in wives' quality…

  5. Euroopa tootjad tahavad jätkata sotsiaalset põllumajandust / Ain Lember

    Index Scriptorium Estoniae

    Lember, Ain

    2006-01-01

    Üleeuroopaline põllumajandustootjate liit COPA ja põllumajandustöötajate organisatsioonide liit COGECA kutsuvad säilitama Euroopas juurdunud põllumajandusmudelit, mis on sattunud muu maailma surve alla

  6. Teaduspargist võrsub eriti agar gasell / Ain Alvela ; kommenteerinud Seren Eilmann

    Index Scriptorium Estoniae

    Alvela, Ain, 1967-

    2010-01-01

    Tallinna tehnoloogiapargi Tehnopol ja Tartu teaduspargi ettevõtlusinkubaatorid pakuvad ettevõtluskeskkonda kiiret arengut taotlevatele ettevõtetele. Tehnopolis on gaselli staatuse saanud 22 firmat, Tartu teaduspargis 13 firmat. AS-ist Proekspert, OÜ-st Interfire. Tabel

  7. Sõjanuiad, võimusümbolid ja margapuud / Ain Mäesalu, Jüri Peets

    Index Scriptorium Estoniae

    Mäesalu, Ain, 1955-

    2010-01-01

    Artiklis käsitletakse muinas- ja keskaegsete sõjanuiade problemaatikat arheoloogiliste leidude, kirjalike allikate ja omaaegsete kunstiteoste põhjal. Eestist leitud sõjanuiapeadest, mida kasutati 12.-13. sajandil relvadena, kuid need võisid sümboliseerida ka selle omaniku kõrget staatust. 19.-20. sajandil kasutati samasuguseid metalltahukaid margapuu otsaraskusena

  8. Üleilmne kriis halvendab tööohutust / Ain Alvela ; kommenteerinud Heidi Vilu

    Index Scriptorium Estoniae

    Alvela, Ain, 1967-

    2009-01-01

    Euroopa Tööohutuse ja Töötervishoiu agentuuri uuringust selgus, et majanduskriisi süvenedes muutuvad töötingimused nigelamaks ja töötegemine tervisele ohtlikumaks, kuid Eesti statistika näitab, et enne kriisi juhtus tööõnnetusi rohkem. Samast uuringust selgus, et keemia põhjustab aastas 74 000 inimese surma, kuid Eestis asuvad keemiatööstusettevõtted AS Cambrex ja AS Chemi-Pharm ei usu seda. Tabel

  9. Promõshlennõje zonõ ohvatil "mjortvõi sezon" / Ain Alvela

    Index Scriptorium Estoniae

    Alvela, Ain, 1967-

    2008-01-01

    Arendajad on tehnoparkide rajamise ooterežiimile pannud - ostjaid jaguks, kuid võimalusi napib. Diagramm: Za pjat let stoimost zemli promõshlennogo naznatshenija võrosla v pjat raz; Tabel: Naiboleje dorogaja zemlja - v promparke Lasnamäe. Kommenteerivad Enn Tosso, Nikolai Pitshugov ja Urmas Ahven

  10. DiSC aitab käitumist parandada / Ain Kivesti

    Index Scriptorium Estoniae

    Kivesti, Ain

    2008-01-01

    DiSC testi abil on võimalik saada ülevaade personaalsetest käitumishoiakutest ning vastavalt olukorrale on võimalik harjumuspärast reageerimisstiili radikaalselt muuta. Kommenteerivad Jorma Sarv ja Paavo Pilv

  11. Metallifirmade prioriteediks sai tootearendus / Ain Alvela ; kommenteerinud Jüri Riives

    Index Scriptorium Estoniae

    Alvela, Ain, 1967-

    2010-01-01

    Metallitöötlemisega tegelevate firmade juhid on valdavalt arvamusel, et praegu pole aeg paigutada raha ettevõtte laienemise ja tootmismahu suurendamise hüvanguks, vaid tegelda tuleks tootearenduse ja kogu ettevõtte struktuuri korrastamisega. Sobiv on aeg ka mõne ettevõtte ülesostmiseks

  12. Saarlased peavad PRIA-le tagastama 2,9 miljonit krooni / Ain Lember

    Index Scriptorium Estoniae

    Lember, Ain

    2007-01-01

    69 Saaremaa põllumajandustootjat peavad PRIA-le tagasi maksma 2,9 miljonit krooni toetusraha, nõue puudutab ühtse pindalatoetuse, põllukultuuride kasvatamise täiendava otsetoetuse, mahetootmise toetuse, keskkonnasõbraliku tootmise ja ebasoodsamate alade toetuse raames väljamakstud summasid

  13. Jaani seek väärib säilitamist / Ain Mäesalu

    Index Scriptorium Estoniae

    Mäesalu, Ain

    2001-01-01

    5. oktoobril kogunes Jaani seegi varemete vahele Eesti juhtivatest arheoloogidest koosnev arheoloogiamälestiste nõukogu, kes otsustas, et müüristik on väga väärtuslik muinsus. Samal seisukohal on ka muinsuskaitsjad. Agne Trummali ja Toomas Tamla kommentaarid

  14. Pattern of community acquired pneumonia in pregnant ladies in Ain Shams University hospitals

    Directory of Open Access Journals (Sweden)

    Aya M. Abdel Dayem

    2012-10-01

    Conclusion: Morbidity and mortality in pregnant patients with pneumonia continue to present a significant challenge. Early recognition of the diseases process and prompt treatment are required to ascertain an optimal outcome. The treatments in the gravid patients generally follow standard guide lines for the treatment of pneumonia in adults. Concern for fetal outcome should not delay treatment as improvement in maternal oxygenation and status is the best way to ensure fetal protection.

  15. Kohtuotsus on õige : ['Siioni tarkade protokolli' eesti tõlke hävitamine] / Ain Kaalep

    Index Scriptorium Estoniae

    Kaalep, Ain, 1926-

    1995-01-01

    Vastukaja : Tärni, Aulis. Tuleriit kohalikust punasest kütusest // Postimees. - 1995. - 24.nov. - Lk.6; Kalmre, Vahur. Raamatute kaitseks // Postimees. - 1995. - 27.nov. - Lk. 6; Langemets, Andres. Eesti ja juudi // Postimees. - 1995. - 30.nov. - Lk.8

  16. [Human papillomaviruses in the pathogenesis of intraepithelial neoplasia (AIN) and carcinoma of the anus].

    Science.gov (United States)

    von Knebel Doeberitz, M; Reuschenbach, M

    2010-01-01

    HPV infections have been implicated in the pathogenesis of anal cancers. The mode of infection and subsequent transformation resembles very much the pathogenesis of cervical and other HPV-associated cancers. The molecular dissection of individual steps required to achieve cellular transformation within an HPV-infected cell led to the identification of novel biomarkers that make it possible to identify HPV-transformed cells with substantially higher precision in comparison to conventional methods. Since effective antiretroviral therapy allows for possible long-term survival of HIV-infected individuals who are at very high risk to develop HPV-associated cancers in the anogenital tract, these new developments have become increasingly relevant for practicing dermatologists and proctologists. We here briefly review the basic concepts and some clinical applications of this recent research.

  17. Naprapathic manual therapy and other factors of importance for the prognosis of neck and back ain

    OpenAIRE

    2014-01-01

    Introduction: Neck and back pain common health problems causing economic burden and individual suffering worldwide. Aim: The overall aim of this thesis was to increase understanding of naprapathic manual therapy and other factors of potential importance for the prognosis of back and neck pain. Specific aims: Study I: 1) to assess and compare the sex-specific recovery from spinal pain and psychological distress as single and comorbid conditions, 2) to describe the interrelationships bet...

  18. Water Ser - areng läbi torude ja üle kraavide / Ain Alvela

    Index Scriptorium Estoniae

    Alvela, Ain, 1967-

    2007-01-01

    1992. aastal asutatud vee- ja kanalisatsioonitorustike paigaldamisele spetsialiseerunud perefirma AS Water Ser on kasvanud rahvusvaheliselt mainekaks kontserniks. Vt. samas: Perefirma arengu kronoloogia; Amet sai alguse teismelise eas kraavikaevamisest. Kommenteerivad Andrus Piir ja Toomas Kapp

  19. DiSC aitab käitumist parandada / Ain Kivesti

    Index Scriptorium Estoniae

    Kivesti, Ain

    2008-01-01

    DiSC testi abil on võimalik saada ülevaade personaalsetest käitumishoiakutest ning vastavalt olukorrale on võimalik harjumuspärast reageerimisstiili radikaalselt muuta. Kommenteerivad Jorma Sarv ja Paavo Pilv

  20. Living with the Sermon of the Mount : an uncomfortable presence of transcendence / Ain Riistan

    Index Scriptorium Estoniae

    Riistan, Ain, 1965-

    2003-01-01

    Ettekanne sümpoosionilt: Gemeinsames Symposium der Evangelisch-Theologischen Fakultät der Universität Tartu, der Estnischen Studiengesellschaft für Morgenlandkunde und der Deutschen Religionsgeschichtlichen Studiengesellschaft. Tartu, 2001

  1. Metsateede kasutamine eeldab naabri austamist / Ain Alvela, Ketlin Rauk ; kommenteerinud Uno Luht

    Index Scriptorium Estoniae

    Alvela, Ain, 1967-

    2015-01-01

    Oma seisukohti väljendavad RMK Metsaparandustalituse juhataja Margus Reimann, OÜ Iriscorp Transport juhataja Kaido Sikk, AS Karo Trans juhatuse liige Meelis Lippe, Kohila vallavanem Heiki Hepner, Hiiumaa metsaseltsi juht Aira Toss

  2. "Ain't Misbehavin": Towards a Developmentally-Specified Nosology for Preschool Disruptive Behavior

    Science.gov (United States)

    Wakschlag, Lauren S.; Tolan, Patrick H.; Leventhal, Bennett L.

    2010-01-01

    There is increasing consensus that disruptive behavior disorders and syndromes (DBDs) are identifiable in preschool children. There is also concomitant recognition of the limitations of the current DBD nosology for distinguishing disruptive behavior symptoms from the normative misbehavior of early childhood. In particular, there appears to be…

  3. 2018 : tööstust veavad keskkond ja tervis / Ain Alvela

    Index Scriptorium Estoniae

    Alvela, Ain, 1967-

    2008-01-01

    Arengufondi foorumil "Tööstusvedurid 2018" tõdeti, et kümne aasta pärast peab Eesti majandus olulises osas toetuma töötlevale tööstusele. Kommenteerivad: Arvo Kivikas, Heikki Mäki ja Jaanus Purga

  4. 11. septembri 2001 mõju globaalse logistika arengule / Ain Kiisler

    Index Scriptorium Estoniae

    Kiisler, Ain, 1965-

    2002-01-01

    Maailma Kaubanduskeskuse pihta suunatud terrorirünnak sunnib paljusid USA kontserne tegema muudatusi oma tarneketis: käibele on tulnud uus mõiste - kontinentaalne hankemudel, luuakse taas puhverkaubavarud; otsitakse alternatiive õhutranspordile

  5. "She ain't no human being": le rock anglais chante sa reine

    OpenAIRE

    Chastagner, Claude

    1995-01-01

    The Beatles, The Smiths and The Sex Pistols have all sung the Queen, to celebrate or denigrate her. But in all cases, it is the sacrificial victim more than the human being or the official figure that is put forward.; The Beatles, The Smiths et The Sex Pistols ont tous les trois chanté la reine, une reine vilipendée ou célébrée mais toujours posée comme une victime sacrificielle.

  6. "You Ain't the Right Color, Pal": White Resentment of Affirmative Action.

    Science.gov (United States)

    Lynch, Frederick R.; Beer, William R.

    1990-01-01

    Discusses the growing sense of grievance among younger working-class and middle-class White males most affected by affirmative action preferences. Suggests that measures intended to ensure equal opportunity and proportional representation for minority groups may be contributing to racial polarization on college campuses, in workplaces, and in…

  7. 2018 : tööstust veavad keskkond ja tervis / Ain Alvela

    Index Scriptorium Estoniae

    Alvela, Ain, 1967-

    2008-01-01

    Arengufondi foorumil "Tööstusvedurid 2018" tõdeti, et kümne aasta pärast peab Eesti majandus olulises osas toetuma töötlevale tööstusele. Kommenteerivad: Arvo Kivikas, Heikki Mäki ja Jaanus Purga

  8. HIGH STRAIN RATE SUPERPLASTICITY OF A AIN PARTICULATE REINFORCED 6061Al COMPOSITE

    Institute of Scientific and Technical Information of China (English)

    L.H. Han; J.T. Niu; D.M. Jiang; T. Imai

    2001-01-01

    The superplasticity of AlNp/6061Al composite, fabricated by powder metallurgy method and hot-rolled after extrusion, was investigated. The AlNp/6061Al composite exhibits an m-value of 0.49 and a maximum elongation of 438% in the strain rates ranging from 10-2-10°s-1 and at temperatures from 823K to 893K. Differential scanning calorimeter was used to ascertain the possibility of any partial melting in the vicinity of optimum superplastic temperature. These results suggested that liquid phase existed where maximum elongation was obtained.

  9. Otepää piiskoplinnuse hävimisdaatumist / Ain Mäesalu

    Index Scriptorium Estoniae

    Mäesalu, Ain, 1955-

    2010-01-01

    Ülevaade, miks autor hakkas 1980. aastate keskel toetama hüpoteesi Otepää keskaegse linnuse hävimisest 1396. aastal. Samas on kriitiliselt vaetud sama ajakirja numbris mõningaid Jaak Mälli seisukohti

  10. Ligi 800 km kruusateid utsitab edu püüdlema / Ain Alvela

    Index Scriptorium Estoniae

    Alvela, Ain, 1967-

    2003-01-01

    Põlvamaa ettevõtete TOP-i 1. koht. Põlvamaa edukaim ettevõte on maakonnas riigiteede hooldetöid teostav Põlva Teed AS. Diagramm: Põlva Teed AS käive ja kasum 2001-2003. Kommenteerib Riho Sõrmus.

  11. Summertime, and the Choosin' Ain't Easy: An Ice Cream Counting Problem.

    Science.gov (United States)

    Kreith, Kurt

    1992-01-01

    Utilizes the problem of determining the number of different ice cream cones and cups that can be made from a choice of 31 flavors to investigate the concepts of combinations and permutations. Provides a set of six related problems with their answers. (MDH)

  12. Pemberian Obat-Obatan Anti Inflamasi Non Steroid (AINS pada Anak

    Directory of Open Access Journals (Sweden)

    Fajriani Fajriani

    2012-10-01

    Full Text Available We know that non-steroid anti-inflammatory drugs (NSAIDs analgetic, antipirettan and anti-inflammatory effect. This drugs can decrease pain simptomaticly, the most widely prescribed drugs worldwide and being the drugs of first choice other inflammatory pain. There is many kind NSAIDs that we knaw, like aspirin, parasetamol, ibuprofen, mefenamic acid, endometasin, diklofenak, piroksikan and nemosulide. Every kind of NSAIDs has its advantage and dis advantage for that beneficial actions and side effects. That beneficial actions and harmful side effects of NSAID can be associated with its mechanism of action. Using NSAID for children must in attention. This article is expented to give information and to help the collegnes in the selecting drugs NSAID for child.DOI: 10.14693/jdi.v15i3.27

  13. "Ain't Misbehavin'": Bench Conduct and Nonverbal Expectancy Effects in Criminal Jury Trials.

    Science.gov (United States)

    Sanders, Wayne

    The possibility that judges' expectancy effects may adversely affect the results of jury trials is a problem that needs careful theoretical analysis and innovative methods of resolution. Traditional efforts by the legal community to counteract the threat of verbal/nonverbal bias by judges include the "Code of Judicial Conduct," curative…

  14. Konkurentide ees annab eelise disainiga tegelemine / Peter L. Phillips ; intervjueerinud Ain Alvela

    Index Scriptorium Estoniae

    Phillips, Peter L.

    2010-01-01

    Intervjuu rahvusvaheliselt tunnustatud disainieksperdiga tootmisettevõtete ja disainerite koostöö tähtsusest, disaineri rollist. Eksperdi sõnul on äärmiselt oluline kasutada toodete eristumiseks ja nende turustamiseks disaini, kui Eesti tootjatel on soov müüa tooteid Eestist välja

  15. Metsateede kasutamine eeldab naabri austamist / Ain Alvela, Ketlin Rauk ; kommenteerinud Uno Luht

    Index Scriptorium Estoniae

    Alvela, Ain, 1967-

    2015-01-01

    Oma seisukohti väljendavad RMK Metsaparandustalituse juhataja Margus Reimann, OÜ Iriscorp Transport juhataja Kaido Sikk, AS Karo Trans juhatuse liige Meelis Lippe, Kohila vallavanem Heiki Hepner, Hiiumaa metsaseltsi juht Aira Toss

  16. The Repeal of Section 28: It Ain't over 'til It's over

    Science.gov (United States)

    Greenland, Katy; Nunney, Rosalind

    2008-01-01

    Section 28 (part of the Local Government Act of 1988) was a notorious piece of legislation that sought to prevent local education authorities in the UK from "promoting homosexuality". The effect of Section 28 was to create uncertainty and fear among teachers as to what was (and what was not) permitted in schools. Over time practitioners…

  17. Water Ser - areng läbi torude ja üle kraavide / Ain Alvela

    Index Scriptorium Estoniae

    Alvela, Ain, 1967-

    2007-01-01

    1992. aastal asutatud vee- ja kanalisatsioonitorustike paigaldamisele spetsialiseerunud perefirma AS Water Ser on kasvanud rahvusvaheliselt mainekaks kontserniks. Vt. samas: Perefirma arengu kronoloogia; Amet sai alguse teismelise eas kraavikaevamisest. Kommenteerivad Andrus Piir ja Toomas Kapp

  18. Saaremaa sadamate majanduslik-regionaalpoliitiline tähtsus ja arenguperspektiivid / Taavo Asuja, Ain Eidast

    Index Scriptorium Estoniae

    Asuja, Taavo

    2005-01-01

    Et puudub selgus püsiühenduse rajamise ning selle tegevuse suhtes, on raskendatud sadamate arengu pikaajaline prognoosimine ja suunamine. Autorite hinnangul oleks vaja koostada Saaremaa sadamate arengu kontseptsioon. Tabelid. Diagrammid

  19. Rannakalanduse tulevik sõltub varust / Ain Soome ; interv. Agnes Jürgens

    Index Scriptorium Estoniae

    Soome, Ain

    2008-01-01

    Kalapüügiseaduse muudatustest. Lisatud: kalastajad. Ilmunud ka Hiiu Leht 2. mai 2008, lk. 4 ; Oma Saar 6. mai 2008, lk. 4 ; Vooremaa 13. mai 2008, lk. 2 ; Lääne Elu 20. mai 2008, lk. 4, lisatud: taustainfo ; Harju Elu 3. juuni 2008, lk. 2 ; Peipsi Rannik = Tshudskoje Poberezhje mai 2008, lk.4, lisatud: taustinfo

  20. Leaving home ain't easy: protein export systems in Gram-positive bacteria.

    Science.gov (United States)

    Freudl, Roland

    2013-01-01

    Transport of proteins into or across biological membranes is catalyzed by membrane-bound transport machineries. In Gram-positive bacteria, the vast majority of proteins are exported out of the cytosol by the conserved general secretion (Sec) system or, alternatively, by the twin-arginine translocation (Tat) system, that closely resemble their well-studied counterparts in Gram-negative bacteria. Besides these common major export routes, additional unique protein export systems (such as accessory Sec2 systems and/or type VII/WXG100 secretion systems) exist in some Gram-positive bacteria that are specifically involved in the secretion of limited subsets of proteins.

  1. It Ain't Easy Livin' in the Big Easy: Down and Dazed but Not out

    Science.gov (United States)

    Sulkowski, Michael L.; West, Jill; Lazarus, Philip J.

    2011-01-01

    In this article, the impact of two major disasters (Hurricane Katrina and the Deepwater Horizon oil rig fire and subsequent oil spill) on residents of New Orleans and the Gulf Coast are discussed. An overriding concern as expressed by the recently released report issued by the National Commission on Children and Disasters, 2010 "Report to the…

  2. Laevade erinevate soetamisviiside kommertstingimuste võrdlev analüüs / Ain Eidast, Allan Kivi

    Index Scriptorium Estoniae

    Eidast, Ain, 1939-2013

    2005-01-01

    Laevade erinevate soetamisviiside analüüs näitab, et ühtse, kõikidele osapooltele vastuvõetavate tingimuste väljatöötamine ja rakendamine ei ole tehniliselt võimalik ning majanduslikult õigustatud. Tabelid. Diagrammid

  3. Saaremaa sadamate majanduslik-regionaalpoliitiline tähtsus ja arenguperspektiivid / Taavo Asuja, Ain Eidast

    Index Scriptorium Estoniae

    Asuja, Taavo

    2005-01-01

    Et puudub selgus püsiühenduse rajamise ning selle tegevuse suhtes, on raskendatud sadamate arengu pikaajaline prognoosimine ja suunamine. Autorite hinnangul oleks vaja koostada Saaremaa sadamate arengu kontseptsioon. Tabelid. Diagrammid

  4. Ühiskondliku Leppe Sihtasutus tahab GMO üle otsustamise anda elanikele / Ain Lember

    Index Scriptorium Estoniae

    Lember, Ain

    2005-01-01

    Ühiskondliku Leppe Sihtasutus peab mõttekaks ühineda üle-euroopalise algatusega muuta EL seadusandlust selliselt, et GMO-vabade piirkondade kehtestamiseks õigus jääb maaomanike ja ametnike asemel elanikele

  5. Kodumaine allhange jõuab ka siinsete tootjateni / Ain Alvela ; kommenteerinud Ardo Kalda

    Index Scriptorium Estoniae

    Alvela, Ain, 1967-

    2015-01-01

    Metallitööfirma OÜ Haapsalu Metal on Rootsi kapitalile kuuluv allhanketellimustele spetsialiseerunud ettevõte, mille tootevalikusse kuuluvad näiteks ka Eesti ettevõtete tellimusel valminud saetööstusseadmed, kalatööstuse automatiseeritud tootmisliinid, metsatraktorite keskliigendid, turbakaevandamiseks mõeldud masinate ümberseadistamine ning võistlusautode detailid

  6. Ester Tuiksoo : Saksamaa on Eestile biomassi ja GMO vallas eeskujuks / Ain Lember

    Index Scriptorium Estoniae

    Lember, Ain

    2006-01-01

    Põllumajandusminister Ester Tuiksoo ja abiminister Rain Vändre kohtusid Kielis Schleswig-Holsteini liidumaa ministri dr. Christian von Boetticheriga, peateemadeks abi biomassi ja geneetiliselt muundatud kultuurtaimede kooseksisteerimise vallas

  7. Rannakalanduse tulevik sõltub varust / Ain Soome ; interv. Agnes Jürgens

    Index Scriptorium Estoniae

    Soome, Ain

    2008-01-01

    Kalapüügiseaduse muudatustest. Lisatud: kalastajad. Ilmunud ka Hiiu Leht 2. mai 2008, lk. 4 ; Oma Saar 6. mai 2008, lk. 4 ; Vooremaa 13. mai 2008, lk. 2 ; Lääne Elu 20. mai 2008, lk. 4, lisatud: taustainfo ; Harju Elu 3. juuni 2008, lk. 2 ; Peipsi Rannik = Tshudskoje Poberezhje mai 2008, lk.4, lisatud: taustinfo

  8. Lindora 11.-12. sajandi kääbaskalmistuantropoloogiline aines / Leiu Heapost

    Index Scriptorium Estoniae

    Heapost, Leiu, 1936-

    2006-01-01

    Kagu-Eesti seni kõige varasem laibahaudadest saadud atropoloogiline materjal pärineb Lindora kääbaskalmetest. Lindora ümarkääbastesse maetud olid morfoloogiliselt võrdlemisi sarnased, kõrge ja kitsa koljuga, pikakasvulised ja graatsiliste jäsemeluudega

  9. ChAInGeS: The Chandra Arp Interacting Galaxies Survey

    CERN Document Server

    Smith, Beverly J; Miller, Olivia; Burleson, Jacob A; Nowak, Michael A; Struck, Curtis

    2012-01-01

    We have conducted a statistical analysis of the ultra-luminous X-ray point sources (ULXs; L(X) >= 10^39 erg/s) in a sample of galaxies selected from the Arp Atlas of Peculiar Galaxies. We find a possible enhancement of a factor of ~2-4 in the number of ULXs per blue luminosity for the strongly interacting subset. Such an enhancement would be expected if ULX production is related to star formation, as interacting galaxies tend to have enhanced star formation rates on average. For most of the Arp galaxies in our sample, the total number of ULXs compared to the far-infrared luminosity is consistent with values found earlier for spiral galaxies. This suggests that for these galaxies, ULXs trace recent star formation. However, for the most infrared-luminous galaxies, we find a deficiency of ULXs compared to the infrared luminosity. For these very infrared-luminous galaxies, AGNs may contribute to powering the far-infrared; alternatively, ULXs may be highly obscured in the X-ray in these galaxies and therefore not ...

  10. Ühiskondliku Leppe Sihtasutus tahab GMO üle otsustamise anda elanikele / Ain Lember

    Index Scriptorium Estoniae

    Lember, Ain

    2005-01-01

    Ühiskondliku Leppe Sihtasutus peab mõttekaks ühineda üle-euroopalise algatusega muuta EL seadusandlust selliselt, et GMO-vabade piirkondade kehtestamiseks õigus jääb maaomanike ja ametnike asemel elanikele

  11. Ester Tuiksoo : Saksamaa on Eestile biomassi ja GMO vallas eeskujuks / Ain Lember

    Index Scriptorium Estoniae

    Lember, Ain

    2006-01-01

    Põllumajandusminister Ester Tuiksoo ja abiminister Rain Vändre kohtusid Kielis Schleswig-Holsteini liidumaa ministri dr. Christian von Boetticheriga, peateemadeks abi biomassi ja geneetiliselt muundatud kultuurtaimede kooseksisteerimise vallas

  12. 500 tudengiga aines kontrollib eksamitöid õppejõu eest arvuti / Anu Mõistlik

    Index Scriptorium Estoniae

    Mõistlik, Anu

    2003-01-01

    Tartu Ülikooli selle semestri rahvarohkeima, 500 kuulajaga sotsiaalkultuurilise psühholoogia loengukursuse lõpus kirjutasid tudengid eksamitööks valikvastustega testi, mida hakkavad kontrollima arvutid

  13. Lindora 11.-12. sajandi kääbaskalmistuantropoloogiline aines / Leiu Heapost

    Index Scriptorium Estoniae

    Heapost, Leiu, 1936-

    2006-01-01

    Kagu-Eesti seni kõige varasem laibahaudadest saadud atropoloogiline materjal pärineb Lindora kääbaskalmetest. Lindora ümarkääbastesse maetud olid morfoloogiliselt võrdlemisi sarnased, kõrge ja kitsa koljuga, pikakasvulised ja graatsiliste jäsemeluudega

  14. Tõnu Virve: filmi aines puudutas mu enda mälestusi / Tõnu Virve ; intervjueerinud Andres Laasik

    Index Scriptorium Estoniae

    Virve, Tõnu, 1946-

    2009-01-01

    Intervjuu 22. septembril Kumu auditooriumis esilinastunud dokumentaalfilmi "Monument" (Freyja Film, 2009) režissööri Tõnu Virvega. Kesksel kohal on filmis Tallinna Tõnismäe monument (skulptor Enn Roos, arhitekt Arnold Alas)

  15. AINEs como tratamiento coadyuvante de la enfermedad periodontal NSAIDs in the treatment of periodontal disease

    OpenAIRE

    T Beca; Hernández, G; A. Bascones

    2007-01-01

    Se presenta una revisión bibliográfica acerca de la aplicación de antiinflamatorios de forma coadyuvante en el tratamiento periodontal. Tras una breve introducción, se establecen las bases inmunológicas de la inflamación y destrucción periodontal, centrándonos en el metabolismo del ácido araquidónico y los cuatro mediadores más implicados actualmente en la destrucción periodontal: prostaglandina E2 (PGE2), prostaglandina F2a (PGF2a), leucotrieno B4 (LTB4) y factor activador de plaquetas (PAF)...

  16. Uso racional de AINEs y antimicrobianos en odontopediatría

    OpenAIRE

    Mariel Colmenares Faraco; Ingrid Hoffmann; Efraín Guerrero; Henry Pérez

    2015-01-01

    The pediatric dentist in clinical practice needs to prescribe medications to their patients, this requirement should make it rationally, based on a diagnosis according to its clinical judgement and examinations for a comprehensive treatment plan. It is therefore important to know the peculiarities of the child in relation to drugs, which highlights the pharmacokinetics, pharmacodynamics, development and maturation, special care for the elimination of drugs. The pre...

  17. Sõjageograafia aine ja Eestimaa sõjageograafia 1920. aastatel / Kersti Vennik

    Index Scriptorium Estoniae

    Vennik, Kersti, 1975-

    2003-01-01

    Autori arvates puudub praeguses ohvitseride väljaõppes kursus, kus selgitataks täpsemalt Eesti maastike omadusi, erinevate maastiku-komponentide omavahelist koosmõju ning maastiku mõju kaitsejõudude tegevusele. Polkovnik Nikolai Reegi (1890-1942) panusest Eesti geograafiateaduse ajalukku

  18. "Ain't no one here but us social forces": constructing the professional responsibility of engineers.

    Science.gov (United States)

    Davis, Michael

    2012-03-01

    There are many ways to avoid responsibility, for example, explaining what happens as the work of the gods, fate, society, or the system. For engineers, "technology" or "the organization" will serve this purpose quite well. We may distinguish at least nine (related) senses of "responsibility", the most important of which are: (a) responsibility-as-causation (the storm is responsible for flooding), (b) responsibility-as-liability (he is the person responsible and will have to pay), (c) responsibility-as-competency (he's a responsible person, that is, he's rational), (d) responsibility-as-office (he's the responsible person, that is, the person in charge), and (e) a responsibility-as-domain-of-tasks (these are her responsibilities, that is, the things she is supposed to do). For all but the causal sense of responsibility, responsibility may be taken (in a relatively straightforward sense)-and generally is. Why then would anyone want to claim that certain technologies make it impossible to attribute responsibility to engineers (or anyone else)? In this paper, I identify seven arguments for that claim and explain why each is fallacious. The most important are: (1) the argument from "many hands", (2) the argument from individual ignorance, and (3) the argument from blind forces. Each of these arguments makes the same fundamental mistake, the assumption that a certain factual situation, being fixed, settles responsibility, that is, that individuals, either individually or by some group decision, cannot take responsibility. I conclude by pointing out the sort of decisions (and consequences) engineers have explicitly taken responsibility for and why taking responsibility for them is rational, all things considered. There is no technological bar to such responsibility. © Springer Science+Business Media B.V. 2010

  19. Elektroonilise aruandluskohustuse ja maksekäsu elektroonilise kiirmenetluse kooskõla Eesti Vabariigi põhiseadusega : [magistritöö] / Kadri-Catre Kasak ; Tartu Ülikool, õigusteaduskond ; juhendaja: Berit Aaviksoo

    Index Scriptorium Estoniae

    Kasak, Kadri-Catre

    2011-01-01

    Elektrooniliste menetluste regulatsioonist ja kehtestamise põhjendustest, majandusaasta aruande elektroonilise esitamise kohustuse ja maksekäsu elektroonilise kiirmenetluse kooskõlast põhiseadusega

  20. Elektroonilise aruandluskohustuse ja maksekäsu elektroonilise kiirmenetluse kooskõla Eesti Vabariigi põhiseadusega : [magistritöö] / Kadri-Catre Kasak ; Tartu Ülikool, õigusteaduskond ; juhendaja: Berit Aaviksoo

    Index Scriptorium Estoniae

    Kasak, Kadri-Catre

    2011-01-01

    Elektrooniliste menetluste regulatsioonist ja kehtestamise põhjendustest, majandusaasta aruande elektroonilise esitamise kohustuse ja maksekäsu elektroonilise kiirmenetluse kooskõlast põhiseadusega

  1. Protein (Cyanobacteria): 426260 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available aining protein Nostoc sp. PCC 7524 MKAAEYLSSAAKSVNEIPGITEATILEYFATLNAGEFLATAALFAEDGVMYPPFESGIVGPDAIANYLQQEAQDIKADTHQGIVEPLDNQHIQVQVTGKAQTSWCSVNVLWIFILNQHKEIIDAKIKLLASPQELLALRRE ...

  2. Nahast küünarvarrekaitsmed keskaegsest Tartust / Ain Mäesalu, Jüri Peets, Elna Haiba

    Index Scriptorium Estoniae

    Mäesalu, Ain

    2008-01-01

    2000. aastal Tartust leitud 14. sajandi lõpukümnenditest või 15. sajandi algusest pärinevatest küünarvarrekaitsmetest. Keskaegsest kaitsevarustusest, Tartu küünarvarrekaitsmete valmistamistehnikast, nende kahjustustest ja konserveerimisest

  3. It "Ain't" Always So: Sixth Graders' Interpretations of Hispanic-American Stories with Universal Themes

    Science.gov (United States)

    Rice, Peggy S.

    2005-01-01

    This article examines the responses of eight sixth grade students discussing four realistic fiction Hispanic-American multicultural stories with universal themes by Gary Soto in peer-led literature discussion groups. The results indicate the importance of a reader's sociocultural frame--class, race, and gender, on their interpretation of…

  4. Lootus : [luuletused] / Friedrich Schiller ; tlk. Ain Kaalep, Rein Sepp, Paul Viiding, Eduard Roos, Jaan Kross, Jakob Tamm

    Index Scriptorium Estoniae

    Schiller, Friedrich, 1759-1805

    2006-01-01

    Sisu: Lootus ; Õhtu ; Brutus ja Caesar ; Laura klaveri ees ; Rousseau ; Grupp Tartarosest ; Rõõmule ; Palvekiri ; Hektori lahkumine ; Kunstnikud ; Laulu võim ; Metafüüsik ; Ideaal ja elu ; Maailma jaotamine ; Neiu võõrsilt ; Külvaja ; Odysseus ; Kolumbus ; Antiikkultuur rändurile Põhjast ; Zeus Heraklesele ; Kõrgeim ; Laps hällis ; Surematus ; Võti ; Astronoomilised teosed ; Parim riik ; Minu usk ; Sõber ja vaenlane ; Harv seos ; Nooruse lätted ; Naiste otsus ; Ootus ja täitumine ; Ühine saatus ; Looduseuurijad ja transtsendentaalfilosoofid ; Ohtlik tulemus ; Anonüümne jõgi ; Valgus ja soojus ; Neiu kaebus ; Ühele moralistile ; Goethele ; Pagulane ; Saksa muusa ; Uue sajandi saabumine ; Punshilaul ; Mäelaul ; Polykratese sõrmus ; Rüütel Toggenburg ; Kinnas ; Alpi kütt ; Sõpradele. Eluloolisi andmeid autori kohta lk. 239

  5. Provenance studies of archaeological ceramics from Mar-Takla (Ain-Minin, Syria) using radioisotope X-ray fluorescence method

    Institute of Scientific and Technical Information of China (English)

    2001-01-01

    The radioisotope X-ray fluorescence method was applied to studies of the provenance of the ceramics fragments originated from the Mar-Takla site in Syria. The samples were irradiated 1000s by a 109Cd radioisotope source and 13 elements (Ca, Ti, Mn, Fe, Zn, Ga, As, Rb, Sr, Y, Zr, Nb, and Pb) were determined in 35 samples. The data were subjected to two multivariate statistical methods, cluster and principal components analysis (PCA). It was shown from the combination of the statistical techniques and the determination of elemental composition of the samples that 94% of the ceramic samples analyzed can be considered to be manufactured using two sources of raw materials.

  6. "If It Ain't True, Then It's Just a Book!" The Reading and Teaching of Faction Literature

    Science.gov (United States)

    Olin-Scheller, Christina; Tengberg, Michael

    2012-01-01

    This article examines issues related to the reading and teaching of faction literature in school. Faction is defined not only as a literary genre but also as a form of reading applied to the reader. The article discusses young people's encounters with novels "based on a true story" as well as the challenges this means for literature instruction.…

  7. 115 Qualité de la source Ain Hamma et effet du déversement de ses ...

    African Journals Online (AJOL)

    AKA BOKO

    physico-chimique et bactériologique des eaux de l'Oued Khoumane, Maroc. Ali BEN ... sont exposées à des pollutions agricoles, industrielles et / ou urbaines [4]. ... qu'il reçoit les eaux usées de la ville de Moulay Idriss Zerhoun, les eaux ..... Qualité physico-chimique et biologique des eaux polluées réutilisées en agriculture.

  8. Twin City - past 1823-2013 : EHTE ja Haaga-Helia ühisprojekt / Tiit Kask, Ain Hinsberg

    Index Scriptorium Estoniae

    Kask, Tiit

    2012-01-01

    Turismikoolide ühisprojektist "Twin City - Empowering & Designing Twin-Capital Destination - Past, Present and Future of Tourism in Greater-Helsinki and Greater-Tallinn Area", mille eesmärgiks on Tallinna ja Helsingi kui ühtse turismisihtkoha käsitluse loomine ja 26. aprillil Tallinnas toimunud seminarist "TwinCity Helsinki-Tallinn / Tallinn & Estonian tourism 1813-2013", mis kutsus üles tähistama Tallinna (Kadrioru) merekuurordi ja "Eesti Turismimajandus 200" juubelit 2013. aastal

  9. It ain't what you say, it's how you say it: linguistic and cultural diversity in the classroom.

    Science.gov (United States)

    Robinson, Cynthia Cole; Clardy, Pauline

    2011-01-01

    The disparity between the cultural and linguistic diversity of the teaching population and the student population continues to grow as teacher education programs enroll and graduate primarily white teacher candidates (83.7%). At the same time, the diversity of the K-12 student body has increased with 65% of public school students being from culturally and linguistically diverse backgrounds (National Center for Education Statistics, 2007). This chasm between the diversity of the teaching force and student population is of concern as many teachers report that they do not have the cultural knowledge and experience of working or living in diverse environments, yet will be faced with teaching a very diverse student population. Hence, the need for teacher candidates and current teachers to be explicitly taught the skills needed to successfully teach diverse student populations is urgent. In this article, we explore the following phenomena: how linguistic and cultural diversity is regarded in teacher education programs, as well as teacher candidates' and current K-12 teachers' dispositions towards students who do not share their cultural backgrounds or language (including those who vary in their dialects). Finally, we will present strategies that teacher educators can use to embrace and empower culturally and linguistically diverse (CLD) teacher candidates, as well as prepare teacher candidates to teach diverse student populations.

  10. Tootest olulisemaks saab ärimudel. Kandiline arbuus tavalisest 30 korda kallim / Ain Alvela ; kommenteerinud Janek Kalvi

    Index Scriptorium Estoniae

    Alvela, Ain, 1967-

    2011-01-01

    Eesti Arengufondi juhatuse esimehe Ott Pärna, ASi Kalev Chocolate Factory juhataja Kaido Kaare ja ASi Balsnack International Holding juhatuse esimehe Elmar Rusingu ettekannetest toiduainetööstuse aastakonverentsil "Uue tõusu ootuses". Graafik

  11. Method 445.0 In Vitro Determination of Chlorophyll a and Pheophytin ain Marine and Freshwater Algae by Fluorescence

    Science.gov (United States)

    This method provides a procedure for low level determination of chlorophyll a (chl a) and its magnesium free derivative, pheophytin a (pheo a), in marine and freshwater phytoplankton using fluorescence detection.(1,2) Phaeophorbides present in the sample are determined collective...

  12. Your tooth it ain't so purty but it's gen-u-ine: Cole Porter's comic song "Snagtooth Gertie".

    Science.gov (United States)

    Christen, Arden G; Christen, Joan A

    2010-01-01

    Cole Porter (1891-1964), an American musical icon, has been internationally acknowledged as one of the most cosmopolitan, sophisticated, elegant and influential composer-lyricists of the 20th century. Born in Indiana and raised in wealth and privilege, he attended both Yale and Harvard universities where he honed his song-writing skills. In his 800 tunes, many of which became smash hits, he blended fresh, witty, urbane and colloquial lyrics with catchy, singable melodies. He composed musical scores for both Broadway stage and Hollywood movies, but focused on the former. While Porter enjoyed penning comic songs, he rarely had them published. In 1946, Cole wrote the music and lyrics for a Broadway show entitled Around the World in Eighty Days. Deemed a failure, it closed after only 75 performances. One light-hearted ditty, "Snagtooth Gertie", which he composed for the show, was never used. The lyrics are presented for the first time in this paper.

  13. "School Ain't What It Used to Be": The Impact of the Young Latino in an Aging California Society.

    Science.gov (United States)

    Garcia, Jose Joel

    California's population changes will present challenging public policy dilemmas concerning employment, income, political participation, education, and health services. This paper shares research results to be published in a book entitled "The Burden of Support: The Young Latino in an Aging Society," by David Hayes-Bautista, Jorge Chapa,…

  14. Method 445.0 In Vitro Determination of Chlorophyll a and Pheophytin ain Marine and Freshwater Algae by Fluorescence

    Science.gov (United States)

    This method provides a procedure for low level determination of chlorophyll a (chl a) and its magnesium free derivative, pheophytin a (pheo a), in marine and freshwater phytoplankton using fluorescence detection.(1,2) Phaeophorbides present in the sample are determined collective...

  15. Tallinna Merepäevade turismikonverents käsitles mere ja linna kohtumispaiga arenguid ja arendamist / Ain Hinsberg

    Index Scriptorium Estoniae

    Hinsberg, Ain

    2013-01-01

    Tallinna Sadama, linnavalitsuse, Viking Line ja EHTE poolt 12. juulil Admiraliteedi basseiniääres Merepäevade paviljonis korraldatud konverentsist "Mere ja linna kohtumispaik kui linnaruum ja sihtkoht", kus esinesid Allan Kiil, Tiit Kask, Duncan Frazer Inglismaalt, Satu Lehtonen Soomest, Anu Hallik-Jürgenstein, Peeter Pere, Heikki Mäki, Evelyn Sepp ja Ahto Ader

  16. Etude experimentale de la disparition de coliformes fecaux d'un effluent urb ain en milieu marin

    OpenAIRE

    Bonnefont, J.; Lelong, P; Martin, Y.

    1984-01-01

    Nous avons étudié la perte de viabilité (vitesse de disparition = T90) de coliformes fécaux, dans des dispositifs expérimentaux clos à flux continu, en utilisant différentes dilutions d'un effluent urbain dans l'eau de mer. LesT90 obtenus sont relativement élevés (de 12 à 81 h). La vitesse de disparition dépend de la dilution de l'effluent et augmente avec celle-ci pour atteindre une valeur limite aux fortes dilutions, phénomène qui semble relié à la teneur en matière organique initiale du mé...

  17. Võimalus, et Narva elektrijaamades hakatakse toetuse eest puitu põletama, kütab kirgi / Ain Alvela

    Index Scriptorium Estoniae

    Alvela, Ain, 1967-

    2016-01-01

    Valitsuse otsus võimaldada Eestil müüa taastuvatest allikatest toodetud energia statistikat teistele Euroopa Liidu liikmesriikidele, on kired lõõmama pannud. Arvatakse, et see elavdab puiduturgu, kuid peljatakse ühtlasi, et ahju võib rännata puidutöösturitele vajalik tooraine

  18. Hydride vapor phase epitaxy growth of GaN, InGaN, ScN, and ScAIN

    NARCIS (Netherlands)

    Bohnen, T.

    2010-01-01

    Chemical vapor deposition (CVD); hydride vapor phase epitaxy (HVPE); gallium nitride (GaN); indium gallium nitride (InGaN); scandium nitride (ScN); scandium aluminum nitride (ScAlN); semiconductors; thin films; nanowires; III nitrides; crystal growth - We studied the HVPE growth of different III ni

  19. Effect of threading dislocations on the Bragg peakwidths of GaN, AIGaN, and AIN heterolayers.

    Energy Technology Data Exchange (ETDEWEB)

    Follstaedt, David Martin; Koleske, Daniel David; Lee, Stephen Roger; West, Allen Malone; Waldrip, Karen Elizabeth; Provencio, Paula Polyak; Allerman, Andrew Alan; Abernathy, C. R. (University of Florida, Gainsville, FL)

    2005-03-01

    We develop a reciprocal-space model that describes the (hkl) dependence of the broadened Bragg peakwidths produced by x-ray diffraction from a dislocated epilayer. We compare the model to experiments and find that it accurately describes the peakwidths of 16 different Bragg reflections in the [010] zone of both GaN and AlN heterolayers. Using lattice-distortion parameters determined by fitting the model to selected reflections, we estimate threading-dislocation densities for seven different GaN and AlGaN samples and find improved agreement with transmission electron microscopy measurements.

  20. "If It Ain't True, Then It's Just a Book!" The Reading and Teaching of Faction Literature

    Science.gov (United States)

    Olin-Scheller, Christina; Tengberg, Michael

    2012-01-01

    This article examines issues related to the reading and teaching of faction literature in school. Faction is defined not only as a literary genre but also as a form of reading applied to the reader. The article discusses young people's encounters with novels "based on a true story" as well as the challenges this means for literature…

  1. "Sa, haavapuu, kesköösel valendad..." : [luuletused] / Paul Celan ; saksa k. tlk. [ja saatesõna]: Ain Kaalep

    Index Scriptorium Estoniae

    Celan, Paul, pseud., 1920-1970

    2001-01-01

    Autorist lk. 49-50. Sisu: "Sa, haavapuu, kesköösel valendad..." ; Mälestus Prantsusmaast ; Aastad sinust minuni ; Surmafuuga ; Aja silm ; Kõnevõre ; Silm, lahtine ; Zürich, "Toonekure" kohvik : Nelly Sachsile ; Psalm ; "Niitpäikesed..." ; "Maovankris, mööda..." ; "Maastik urnidega..." ; Prahas ; "Kõmin: see on..." ; "Üks hambajälg eikuskilpool..." ; "Kahinais, otsekui meie alguses..." ; Teine ; "Teie oma..." ; "See, mis meid..." ; "Lõika palvekäsi..." ; "Ma kuulen, et kirves lõi õitsema..." ; "Leht, mille puu küljest..."

  2. It "Ain't" Always So: Sixth Graders' Interpretations of Hispanic-American Stories with Universal Themes

    Science.gov (United States)

    Rice, Peggy S.

    2005-01-01

    This article examines the responses of eight sixth grade students discussing four realistic fiction Hispanic-American multicultural stories with universal themes by Gary Soto in peer-led literature discussion groups. The results indicate the importance of a reader's sociocultural frame--class, race, and gender, on their interpretation of…

  3. Küttimine võib septembris peatuda. Maaomanikud vs. jahimehed / Ain Alvela ; kommenteerinud Heiki Hepner, Val Rajasaar

    Index Scriptorium Estoniae

    Alvela, Ain, 1967-

    2011-01-01

    Maksumaksjad ja maaomanikud toetavad Eesti jahindust sisuliselt viie miljoni euroga aastas, kuigi keskkonnaspetsialistide hinnangul võiks asi olla vastupidi. Kehtiv jahiseadus ei aita kaasa metsa väärtuse parandamisele. Tabelid

  4. Catering for Pilgrims: Petrographic Analysis of Late Antique Kitchenware from the Monastery of St Lot at Deir 'Ain 'Abata, Jordan

    Directory of Open Access Journals (Sweden)

    Louise Joyner

    2000-10-01

    Full Text Available Petrography has been used to elucidate patterns of production and consumption of kitchenware at a typical Early Christian desert monastery on the Pilgrim route. While some vessels may have been produced locally, there is evidence for long distance trade of other vessels.

  5. Nitric oxide as a mediator of gastrointestinal mucosal injury?—Say it ain't so

    Directory of Open Access Journals (Sweden)

    Paul Kubes

    1995-01-01

    Full Text Available Nitric oxide has been suggested as a contributor to tissue injury in various experimental models of gastrointestinal inflammation. However, there is overwhelming evidence that nitric oxide is one of the most important mediators of mucosal defence, influencing such factors as mucus secretion, mucosal blood flow, ulcer repair and the activity of a variety of mucosal immunocytes. Nitric oxide has the capacity to down-regulate inflammatory responses in the gastrointestinal tract, to scavenge various free radical species and to protect the mucosa from injury induced by topical irritants. Moreover, questions can be raised regarding the evidence purported to support a role for nitric oxide in producing tissue injury. In this review, we provide an overview of the evidence supporting a role for nitric oxide in protecting the gastrointestinal tract from injury.

  6. Microbial Etiology of Community-Acquired Pneumonia Among Infants and Children Admitted to the Pediatric Hospital, Ain Shams University

    Science.gov (United States)

    El Seify, Magda Yehia; Fouda, Eman Mahmoud; Ibrahim, Hanan Mohamed; Fathy, Maha Muhammad; Husseiny Ahmed, Asmaa Al; Khater, Walaa Shawky; El Deen, Noha Nagi Mohammed Salah; Abouzeid, Heba Galal Mohamed; Hegazy, Nancy Riyad Ahmed; Elbanna, Heba Salah Sayed

    2016-01-01

    Background While recognizing the etiology of community-acquired pneumonia is necessary for formulating local antimicrobial guidelines, limited data is published about this etiology in Egyptian pediatric patients. Objectives To determine the frequency of bacterial and viral pathogens causing community-acquired pneumonia (CAP) among immunocompetent Egyptian infants and preschool children. Methods Ninety infants and preschool-age children admitted to our hospital with CAP were prospectively included in the study. Etiological agents were identified using conventional bacteriological identification methods and IgM antibodies detection against common atypical respiratory bacteria and viruses. Results An etiology was identified in 59 patients (65.5%). Bacterial pathogens were detected in 43 (47.8%) of the cases while viral pathogens were detected in 23 (25.5%). Coinfection with more than one etiologic agent was evident in seven patients (7.8%). The most common typical bacterial cause of pneumonia was Staphylococcus aureus (n = 12, 13.3%), followed by Streptococcus pneumoniae and Klebsiella pneumoniae (n = 7, 7.8%, each). The commonest atypical bacterium was Mycoplasma pneumoniae (n = 10, 11.1%), whereas the commonest viral etiology was influenza viruses (n = 11, 12.2%). Conclusion Although we could not determine the causative agent in some studied cases, this study provides preliminary data regarding the spectrum and frequency of microorganisms causing CAP in Egyptian infants and preschool children.

  7. If it ain't broke, don't price fix it: the OFT and the PPRS.

    Science.gov (United States)

    Towse, Adrian

    2007-07-01

    The Office of Fair Trading (OFT) Report on the UK Pharmaceutical Price Regulation Scheme (PPRS) recommends that when the current five-year PPRS expires in 2010 it be replaced with 'value-based pricing' which involves pre-launch centralised government price setting based on a cost-per-QALY threshold plus periodic ex post reviews. I examine the validity of the OFTs criticisms of the existing PPRS, review its proposals and propose an alternative way forward. I conclude that PPRS has performed well as a procurement bargain between industry and the UK government. It does not, however, incentivise efficient relative prices. That is not its job. I identify a number of problems with the OFT proposals. I recommend that key elements of a reformed UK pharmaceutical environment for 2010 should include an expanded role for HTA but with companies retaining freedom to set prices at launch; HTA use targeted via a contingent value of information approach; a retained backstop PPRS, perhaps moving to an RPI-X type control; the use of risk sharing and non-linear pricing arrangements; measures to ensure more effective therapeutic switching at local level; and measures to improve the take up of cost-effective treatments.

  8. Läti elanikud NSVL SARK filterlaagrites 1944-1948 (allikate ülevaade) / Ainārs Bambals

    Index Scriptorium Estoniae

    Bambals, Ainārs, 1964-

    2010-01-01

    Läti filtreerimise kontroll-koondamispunktid olid Riias, Daugavpilsis, Jelgavas, Kuldīga, Liepājas, Skrundas, Tukumsis, Vāiņodes, Ventspilsis, Ugāles. Pärast Teist maailmasõda allutati filtreerimisele 91 000 Läti elanikku

  9. Twin City - past 1823-2013 : EHTE ja Haaga-Helia ühisprojekt / Tiit Kask, Ain Hinsberg

    Index Scriptorium Estoniae

    Kask, Tiit

    2012-01-01

    Turismikoolide ühisprojektist "Twin City - Empowering & Designing Twin-Capital Destination - Past, Present and Future of Tourism in Greater-Helsinki and Greater-Tallinn Area", mille eesmärgiks on Tallinna ja Helsingi kui ühtse turismisihtkoha käsitluse loomine ja 26. aprillil Tallinnas toimunud seminarist "TwinCity Helsinki-Tallinn / Tallinn & Estonian tourism 1813-2013", mis kutsus üles tähistama Tallinna (Kadrioru) merekuurordi ja "Eesti Turismimajandus 200" juubelit 2013. aastal

  10. Piimandus: laenukarid, ikaldused ja hinnaralli tõid kriisi / Ain Alvela ; kommenteerinud Tiit Tuuleveski, Urmas Põlluaas ja Tõnu Post

    Index Scriptorium Estoniae

    Alvela, Ain, 1967-

    2009-01-01

    Kuigi piimatootmisega tegelevad ettevõtted vajaksid tegevuse arendamiseks hädasti investeeringuid, jäävad enamiku rahastamisplaanid paremaid aegu ootama. Diagramm. Kommenteerivad Tiit Tuuleveski, Urmas Põlluaas ja Tõnu Post

  11. Läti elanikud NSVL SARK filterlaagrites 1944-1948 (allikate ülevaade) / Ainārs Bambals

    Index Scriptorium Estoniae

    Bambals, Ainārs, 1964-

    2010-01-01

    Läti filtreerimise kontroll-koondamispunktid olid Riias, Daugavpilsis, Jelgavas, Kuldīga, Liepājas, Skrundas, Tukumsis, Vāiņodes, Ventspilsis, Ugāles. Pärast Teist maailmasõda allutati filtreerimisele 91 000 Läti elanikku

  12. Õpilaste teadlikkus E-ainetest ja karastusjookides olevad E-ained / Dorel Donner ; juhendanud Karin Tuul

    Index Scriptorium Estoniae

    Donner, Dorel

    2014-01-01

    Räpina ühisgümnaasiumi 11. kl. õpilase uurimistööst, milles antakse ülevaade E-ainetest, nende kasutusaladest, eeldatavatest kõrvalmõjudest ning gümnaasiumiastme õpilaste karastusjookide tarbimise harjumustest ja üldisest E-ainetega seotud teadlikkusest

  13. Dystocia Ystocia Due to Due to Mummifiedummified Foetaloetal Monsteronster in ain a Yankasaankasa Ewewe: A Casease Reporteport

    Directory of Open Access Journals (Sweden)

    A.I. Kisani

    2012-06-01

    Full Text Available A 1 year old Yyankasa ewe weighing 24 kg was presented to the Large Animal Clinic unit of the Veterinary Teaching Hospital, University of Agriculture Makurdi, Nigeria. The owner with the complained t that she has been in labour for 24 h without delivery. Vital parameters were taken and found to be within the normal ranges. the The patient underwent general and obstetrical animal was examinationed. A diagnosis of dystocia was made with Tthe foetus was found to be in anterior presentation of the fetus, bilateral with the carpalus and shoulder flexioned and the neck deviated laterally.lateral deviation of the neck. Manual traction to deliver the foetus was not successful. Caesarean section was performed with the patient under sedation and epidural anaesthesiatherefore recommended. This was carried out and the dead foetus removed. Recovery post surgery was complete and the ewe was discharged five days post surgery.

  14. Tootest olulisemaks saab ärimudel. Kandiline arbuus tavalisest 30 korda kallim / Ain Alvela ; kommenteerinud Janek Kalvi

    Index Scriptorium Estoniae

    Alvela, Ain, 1967-

    2011-01-01

    Eesti Arengufondi juhatuse esimehe Ott Pärna, ASi Kalev Chocolate Factory juhataja Kaido Kaare ja ASi Balsnack International Holding juhatuse esimehe Elmar Rusingu ettekannetest toiduainetööstuse aastakonverentsil "Uue tõusu ootuses". Graafik

  15. Occurrence and detection of AmpC β-lactamases among Enterobacteriaceae isolates from patients at Ain Shams University Hospital

    OpenAIRE

    Soha A. El-Hady; Lamiaa A. Adel

    2015-01-01

    Background: AmpC β-lactamases are often plasmid mediated that hydrolyze all β-lactam antibiotics except cefepime and carbapenems. Aim of the study: We aimed to evaluate the presence of AmpC β-lactamase among Enterobacteriaceae isolates separated from patients with nosocomial infections, and to detect the genetic basis for AmpC production in these strains. Subjects and methods: 50 AmpC β-lactamase Enterobacteriaceae were analyzed for the presence of AmpC production. Three phenotypic AmpC...

  16. Development of Production PVD-AIN Buffer Layer System and Processes to Reduce Epitaxy Costs and Increase LED Efficiency

    Energy Technology Data Exchange (ETDEWEB)

    Cerio, Frank

    2013-09-14

    The DOE has set aggressive goals for solid state lighting (SSL) adoption, which require manufacturing and quality improvements for virtually all process steps leading to an LED luminaire product. The goals pertinent to this proposed project are to reduce the cost and improve the quality of the epitaxial growth processes used to build LED structures. The objectives outlined in this proposal focus on achieving cost reduction and performance improvements over state-of-the-art, using technologies that are low in cost and amenable to high efficiency manufacturing. The objectives of the outlined proposal focus on cost reductions in epitaxial growth by reducing epitaxy layer thickness and hetero-epitaxial strain, and by enabling the use of larger, less expensive silicon substrates and would be accomplished through the introduction of a high productivity reactive sputtering system and an effective sputtered aluminum-nitride (AlN) buffer/nucleation layer process. Success of the proposed project could enable efficient adoption of GaN on-silicon (GaN/Si) epitaxial technology on 150mm silicon substrates. The reduction in epitaxy cost per cm{sup 2} using 150mm GaN-on-Si technology derives from (1) a reduction in cost of ownership and increase in throughput for the buffer deposition process via the elimination of MOCVD buffer layers and other throughput and CoO enhancements, (2) improvement in brightness through reductions in defect density, (3) reduction in substrate cost through the replacement of sapphire with silicon, and (4) reduction in non-ESD yield loss through reductions in wafer bow and temperature variation. The adoption of 150mm GaN/Si processing will also facilitate significant cost reductions in subsequent wafer fabrication manufacturing costs. There were three phases to this project. These three phases overlap in order to aggressively facilitate a commercially available production GaN/Si capability. In Phase I of the project, the repeatability of the performance was analyzed and improvements implemented to the Veeco PVD-AlN prototype system to establish a specification and baseline PVD-AlN films on sapphire and in parallel the evaluation of PVD AlN on silicon substrates began. In Phase II of the project a Beta tool based on a scaled-up process module capable of depositing uniform films on batches of 4”or 6” diameter substrates in a production worthy operation was developed and qualified. In Phase III, the means to increase the throughput of the PVD-AlN system was evaluated and focused primarily on minimizing the impact of the substrate heating and cooling times that dominated the overall cycle time.

  17. Effects of high-temperature AIN buffer on the microstructure of AlGaN/GaN HEMTs

    Energy Technology Data Exchange (ETDEWEB)

    Coerekci, S., E-mail: scorekci@kirklareli.edu.tr [K Latin-Small-Letter-Dotless-I rklareli University, Department of Physics (Turkey); Oeztuerk, M. K. [Gazi University, Department of Physics (Turkey); Yu, Hongbo [Bilkent University, Nanotechnology Research Center (Turkey); Cakmak, M.; Oezcelik, S. [Gazi University, Department of Physics (Turkey); Oezbay, E. [Bilkent University, Nanotechnology Research Center, Department of Physics, Department of Electrical and Electronics Engineering (Turkey)

    2013-06-15

    Effects on AlGaN/GaN high-electron-mobility transistor structure of a high-temperature AlN buffer on sapphire substrate have been studied by high-resolution x-ray diffraction and atomic force microscopy techniques. The buffer improves the microstructural quality of GaN epilayer and reduces approximately one order of magnitude the edge-type threading dislocation density. As expected, the buffer also leads an atomically flat surface with a low root-mean-square of 0.25 nm and a step termination density in the range of 10{sup 8} cm{sup -2}. Due to the high-temperature buffer layer, no change on the strain character of the GaN and AlGaN epitaxial layers has been observed. Both epilayers exhibit compressive strain in parallel to the growth direction and tensile strain in perpendicular to the growth direction. However, an high-temperature AlN buffer layer on sapphire substrate in the HEMT structure reduces the tensile stress in the AlGaN layer.

  18. Söötmisega disainitud piim tagab tervisliku toidukraami / Ene Tammsaar ; intervjueerinud Ain Alvela ; kommenteerinud Üllas Jaaska

    Index Scriptorium Estoniae

    Tammsaar, Ene, 1952-

    2014-01-01

    Et farmidest tööstusse minevast toorpiimast saaks toota maitsvaid ja tervislikke tooteid, peab toorpiim olema kõrgeima võimaliku kvaliteediga. Selle tagamiseks on piimatööstused koostöös teadlastega ette võtnud piima koostise disainimise

  19. Hans Teiv : Eesti Postile peab jääma sotsiaalne mõõde / Ain Lember

    Index Scriptorium Estoniae

    Lember, Ain

    2007-01-01

    Eesti Posti juhatuse esimehe kohalt vabastatud Hans Teivi sõnul lahkus ta ametist, kuna tema nägemus Eesti Postist kui olulist sotsiaalset tähtsust omavast ettevõttest ei lähe kokku ärilist poolt peatähtsaks pidava suunaga

  20. Evaluations of parameters peculiar to the third group nitrides: BN, AIN, GaN and InN

    CERN Document Server

    Davydov, S Y

    2002-01-01

    The estimations of dielectric, optical electrooptical, magnetic and phonon characteristics of XN (X = B, Al, Ga, In) crystals are obtained by means of simple methods using both quantum mechanics and semiempirical approaches. The values of deformation potentials and magnetic susceptibility these nitrides are defined. The calculation results are compared with experimental data and data obtained by other authors

  1. "I Ain't Changing Anything": A Case-Study of Successful Generation 1.5 Immigrant College Students' Writing

    Science.gov (United States)

    Riazantseva, Anastasia

    2012-01-01

    The purpose of this case-study was to understand the relationship between success in college and L2 academic writing of three Generation 1.5 Russian-speaking middle-class college students and to describe the factors that could have contributed to the levels of academic literacy that these students developed. The following research questions were…

  2. Tööstust ootavad kosmos ja energeetika / Ain Alvela ; kommenteerinud Aleks Rulkov, Peep Rammo, Marek Pakkin ... [jt.

    Index Scriptorium Estoniae

    Alvela, Ain, 1967-

    2009-01-01

    Hannoveri tööstus- ja tehnoloogiamessi peamine sõnum Eesti tootjatele seisneb selles, et tuleb senisest pingsama tähelepanuga jälgida potentsiaalselt arenemisvõimeliste valdkondadae teket ning nendega kohe kaasa minna

  3. Straight talk about high-fructose corn syrup: what it is and what it ain't.

    Science.gov (United States)

    White, John S

    2008-12-01

    High-fructose corn syrup (HFCS) is a fructose-glucose liquid sweetener alternative to sucrose (common table sugar) first introduced to the food and beverage industry in the 1970s. It is not meaningfully different in composition or metabolism from other fructose-glucose sweeteners like sucrose, honey, and fruit juice concentrates. HFCS was widely embraced by food formulators, and its use grew between the mid-1970s and mid-1990s, principally as a replacement for sucrose. This was primarily because of its sweetness comparable with that of sucrose, improved stability and functionality, and ease of use. Although HFCS use today is nearly equivalent to sucrose use in the United States, we live in a decidedly sucrose-sweetened world: >90% of the nutritive sweetener used worldwide is sucrose. Here I review the history, composition, availability, and characteristics of HFCS in a factual manner to clarify common misunderstandings that have been a source of confusion to health professionals and the general public alike. In particular, I evaluate the strength of the popular hypothesis that HFCS is uniquely responsible for obesity. Although examples of pure fructose causing metabolic upset at high concentrations abound, especially when fed as the sole carbohydrate source, there is no evidence that the common fructose-glucose sweeteners do the same. Thus, studies using extreme carbohydrate diets may be useful for probing biochemical pathways, but they have no relevance to the human diet or to current consumption. I conclude that the HFCS-obesity hypothesis is supported neither in the United States nor worldwide.

  4. Saaremaal anti täiskäik LEADER-programmi käivitamiseks / Ain Lember

    Index Scriptorium Estoniae

    Lember, Ain

    2006-01-01

    Saaremaa Kodukandi korraldatud infopäeval sündis algatusrühm LEADER-tüüpi arendustegevuse ettevalmistamiseks maakonnas. Tabel: Saaremaa algatusrühma tegevuskava LEADER-tüüpi maapiirkondade arendustegevuse ettevalmistamiseks

  5. Üks liblika tiivalöök Brasiilias võib tekitada Texases tornaado / Ain Kallis

    Index Scriptorium Estoniae

    Kallis, Ain, 1942-

    2008-01-01

    Meteoroloog ja matemaatik Edward Norton Lorenz (1917-2008) tegi 1961. aastal tavalist numbrilist ilmaprognoosi. Arvutustes tehtud väikese ümarduse tõttu muutus lõpp-prognoos ebatäpseks. Kogetu põhjal formuleeris ta ühe kaoseteooria põhiprintsiibi

  6. "It ain't all as bad as it may seem": young Black lesbians' responses to sexual prejudice.

    Science.gov (United States)

    Reed, Sarah J; Valenti, Maria T

    2012-01-01

    This article explores the ways in which young, Black lesbians manage their sexual minority identity when experiencing sexual prejudice. Fourteen Black lesbians between the ages of 16 and 24 participated in semistructured interviews. Instances of sexual prejudice and the young women's responses were thematically analyzed using open and axial qualitative coding techniques. Results indicated that participants experienced sexual prejudice frequently and even within the lesbian community. Responses to sexual prejudice included: cognitive reframing of heterosexist messages, passing, gaining support from self-created gay families, and fighting back (physically and verbally) in the event of isolated instances of sexual prejudice. Analysis focuses on how gender identity relates to experiences of sexual prejudice and identity management strategies. Findings suggest that there are parallels between the management strategies of these women and young, Black gay and bisexual males and between these women and Black women who are coping with sexism and racism.

  7. V dvuh strofah 1-7 : [luuletused] / August Sang ; lühibiograafia: A. K. [Ain Kaalep

    Index Scriptorium Estoniae

    Sang, August, 1914-1969

    1999-01-01

    Sisu: V dvuh strofah 1-7 ; Kolõbelnaja ; Doroga / tlk. Leon Toom ; Pesn ob oboze ; Poslednaja usluga ; Vospominanije / tlk. A. Golemba. Orig.. Kahe stroofiga ; Hällilaul ; Teekond ; Laul järelväest ; Mälestus

  8. Development of GaN/AIN Self Assembled Quantum Dots for Room Temperature Operation of Quantum Dot Devices

    Science.gov (United States)

    2003-01-01

    Japanese Journal of Applied Physics , 40, part 1, (no. 3B), 1857-1895 2001 P. P. Paskov, P. O. Holtz, B. Monemar, J. M...Garcia, W. V. Schoenfeld, P. M. Petroff “Excited state magnetoluminescence of InAs/GaAs self-assembled quantum dots” Japanese Journal of Applied Physics , 40...heterostructures grown by plasma-assisted molecular beam epitaxy” Japanese Journal of Applied Physics , 40, part 1, (no. 11),

  9. Söötmisega disainitud piim tagab tervisliku toidukraami / Ene Tammsaar ; intervjueerinud Ain Alvela ; kommenteerinud Üllas Jaaska

    Index Scriptorium Estoniae

    Tammsaar, Ene, 1952-

    2014-01-01

    Et farmidest tööstusse minevast toorpiimast saaks toota maitsvaid ja tervislikke tooteid, peab toorpiim olema kõrgeima võimaliku kvaliteediga. Selle tagamiseks on piimatööstused koostöös teadlastega ette võtnud piima koostise disainimise

  10. Tobacco treatment TrAining Network in Crete (TiTAN-Crete: protocol for a controlled before-after study

    Directory of Open Access Journals (Sweden)

    Charis Girvalaki

    2016-06-01

    Full Text Available Rates of tobacco use in Greece are among the highest in Europe and are responsible for an enormous burden of chronic disease and death. A large proportion of tobacco users report an interest in quitting. Family medicine practices have been identified as important settings for identifying tobacco users, delivering advice to quit smoking, and providing tobacco treatment interventions. The 5A’s (ask, advice, assess, assist, arrange schema is an evidence-based model for addressing tobacco use in clinical settings. The rates at which primary care clinicians in Greece address tobacco use in their practice is unknown but, as in other countries, is understood to be sub-optimal. This paper describes the rationale, design, and protocol for a pre/post, controlled study to compare the effectiveness of a smoking cessation intervention delivered in primary care practices in Heraklion, Greece. The TiTAN-Crete intervention includes a 1-day tobacco treatment training program, dissemination of provider and patient resources and two booster training sessions. Participating providers and a cross-sectional sample of patients from their practices, will be surveyed. Outcome measures include changes in provider attitudes and beliefs, perceived behavioral control, intentions, and barriers related to smoking cessation treatment delivery. Rates at which providers deliver tobacco treatment to patients will be measured by patient report of 5As delivery. Multi-level modeling will be used to examine the effects of the intervention. This study will lead to a better understanding of how to best assist clinicians in Greece to enhance the rates at which smoking cessation treatments are delivered to smokers.

  11. Keskkonnakaitsjad pakuvad välja abinõud GMO saaste vältimiseks / Ain Lember

    Index Scriptorium Estoniae

    Lember, Ain

    2006-01-01

    Eesti Keskkonnaühenduste Koda esitas ettepanekud tagamaks geneetiliselt muundatud põllumajanduskultuuride kasvatamise selliselt, et need ei tekitaks kahju tava- ja mahepõllumeestele. Vt. samas: Põllumajandusminister Ester Tuiksoo kommentaar EKO ettepanekutele. Vt. samas: Eesti ilmselt toetab geenmuundatud taimede lubamist Euroopa Liitu ja lühiinterv. põllumajandusministeeriumi taimetervise osakonna juhataja Tambet Sovaga. Vt. ka lk. 5: Nastja Pertsjonok. GMO keskkonnakaitsja pilgu läbi

  12. Physician user satisfaction with an electronic medical records system in primary healthcare centres in Al Ain: a qualitative study

    OpenAIRE

    Al Alawi, Shamma; Al Dhaheri, Aysha; Al Baloushi, Durra; Al Dhaheri, Mouza; Engela A. M. Prinsloo

    2014-01-01

    Objectives To explore physician satisfaction with an electronic medical records (EMR) system, to identify and explore the main limitations of the system and finally to submit recommendations to address these limitations. Design A descriptive qualitative study that entailed three focus group interviews was performed among physicians using open-ended questions. The interviews were audiotaped, documented and transcribed verbatim. The themes were explored and analysed in different categories. Set...

  13. Keskkonnakaitsjad pakuvad välja abinõud GMO saaste vältimiseks / Ain Lember

    Index Scriptorium Estoniae

    Lember, Ain

    2006-01-01

    Eesti Keskkonnaühenduste Koda esitas ettepanekud tagamaks geneetiliselt muundatud põllumajanduskultuuride kasvatamise selliselt, et need ei tekitaks kahju tava- ja mahepõllumeestele. Vt. samas: Põllumajandusminister Ester Tuiksoo kommentaar EKO ettepanekutele. Vt. samas: Eesti ilmselt toetab geenmuundatud taimede lubamist Euroopa Liitu ja lühiinterv. põllumajandusministeeriumi taimetervise osakonna juhataja Tambet Sovaga. Vt. ka lk. 5: Nastja Pertsjonok. GMO keskkonnakaitsja pilgu läbi

  14. Lootus : [luuletused] / Friedrich Schiller ; tlk. Ain Kaalep, Rein Sepp, Paul Viiding, Eduard Roos, Jaan Kross, Jakob Tamm

    Index Scriptorium Estoniae

    Schiller, Friedrich, 1759-1805

    2006-01-01

    Sisu: Lootus ; Õhtu ; Brutus ja Caesar ; Laura klaveri ees ; Rousseau ; Grupp Tartarosest ; Rõõmule ; Palvekiri ; Hektori lahkumine ; Kunstnikud ; Laulu võim ; Metafüüsik ; Ideaal ja elu ; Maailma jaotamine ; Neiu võõrsilt ; Külvaja ; Odysseus ; Kolumbus ; Antiikkultuur rändurile Põhjast ; Zeus Heraklesele ; Kõrgeim ; Laps hällis ; Surematus ; Võti ; Astronoomilised teosed ; Parim riik ; Minu usk ; Sõber ja vaenlane ; Harv seos ; Nooruse lätted ; Naiste otsus ; Ootus ja täitumine ; Ühine saatus ; Looduseuurijad ja transtsendentaalfilosoofid ; Ohtlik tulemus ; Anonüümne jõgi ; Valgus ja soojus ; Neiu kaebus ; Ühele moralistile ; Goethele ; Pagulane ; Saksa muusa ; Uue sajandi saabumine ; Punshilaul ; Mäelaul ; Polykratese sõrmus ; Rüütel Toggenburg ; Kinnas ; Alpi kütt ; Sõpradele. Eluloolisi andmeid autori kohta lk. 239

  15. The application of magnetic self-filter to optimization of AIN film growth process during the impulse plasma deposition synthesis

    Directory of Open Access Journals (Sweden)

    Chodun Rafal

    2016-03-01

    Full Text Available This work presents the very first results of the application of plasma magnetic filtering achieved by a coil coupled with an electrical circuit of a coaxial accelerator during the synthesis of A1N thin films by use of Impulse Plasma Deposition method (IPD. The uniqueness of this technical solution lies in the fact that the filter is not supplied, controlled and synchronized from any external device. Our solution uses the energy from the electrical circuit of plasma accelerator. The plasma state was described on the basis of OES studies. Estimation of the effects of plasma filtering on the film quality was carried out on the basis of characterization of structure morphology (SEM, phase and chemical composition (vibrational spectroscopy. Our work has shown that the use of the developed magnetic self-filter improved the structure of the AlN coatings synthesized under the condition of impulse plasma, especially by the minimization of the tendency to deposit metallic aluminum droplets and columnar growth.

  16. Merle Karusoo uue tüki aines pärineb lõpukirjanditest / Garel Püüa

    Index Scriptorium Estoniae

    Püüa, Garel

    2006-01-01

    Lavastaja Merle Karusoo alustab peagi proove lavastusega, mis on koostatud õpilaste lõpukirjandite põhjal. Käsitletavad kirjanditeemad on venekeelsetelt lõpetajatelt ́ђجSeda maad nimetan ma kodumaakśђح ja eestlastelt ́ђجRahvussuhted 21. sajandiĺђح

  17. Merle Karusoo uue tüki aines pärineb lõpukirjandist / Garel Püüa

    Index Scriptorium Estoniae

    Püüa, Garel

    2006-01-01

    Merle Karusoo alustab proove eesti ja vene koolide õpilaste lõpukirjandite põhjal koostatud lavastusega. Septembris Draamateatris esietenduva Karusoo lavastuse tööpealkiri on "Küpsuskirjand 2005"

  18. Saaremaal anti täiskäik LEADER-programmi käivitamiseks / Ain Lember

    Index Scriptorium Estoniae

    Lember, Ain

    2006-01-01

    Saaremaa Kodukandi korraldatud infopäeval sündis algatusrühm LEADER-tüüpi arendustegevuse ettevalmistamiseks maakonnas. Tabel: Saaremaa algatusrühma tegevuskava LEADER-tüüpi maapiirkondade arendustegevuse ettevalmistamiseks

  19. Finance minister resigns amid fraud probe / Aleksei Gunter

    Index Scriptorium Estoniae

    Gunter, Aleksei, 1979-

    2003-01-01

    Rahandusminister Tõnis Paltsi tagasiastumisest. Uus kandidaat rahandusministri ametikohale on Res Publica parlamendifraktsiooni esimees ja rahanduskomisjoni liige Taavi Veskimägi. Kommentaarid Pakterminali juhatuse esimehelt Aadu Luukaselt

  20. Scotland Yardi looja otsib tihedas pubide konkurentsis oma nishshi / Merike Teder

    Index Scriptorium Estoniae

    Teder, Merike

    2005-01-01

    Jaanus Thalsonile kuuluvast Scotland Yardi pubist Laagris (sisearhitekt Taavi Aunre, 2000), Tallinnas Mere puiesteel (2004) ja avatavast samanimelisest pubist Kristiine keskuses ning kohvikuketist Mmuah