Mida sina täna õppisid? / Veikko Täär, Ain Aaviksoo, Ingrid Tõniste ... [jt.
2012-01-01
Oma õppimistest ja tulevikuplaanidest räägivad näitleja ja ettevõtja Veikko Täär, tervishoiuteadlane Ain Aaviksoo, tegevjuht Ingrid Tõniste, TV3 avalike suhete juht ja uudisteankur Anneli Adermann, arenduskonsultant Anu Puusaag, personaaltreener Katrin Pärt ja loodusarst Tiina Keldrima
2003-01-01
Eesti Telekomi nõukogu otsusest vabastada ametist EMT juhatuse esimees Peep Aaviksoo, uuest kandidaadist Valdo Kalmust ning EMT ja Elioni võimalikust ühinemisest. Diagramm: EMT turuosa libiseb Tele2-le. Vt. samas: EMT lahkuva juhi Peep Aaviksoo avalik kiri. Kommenteerivad Sami Seppänen, Üllar Jaaksoo, Monika Salu, Jaak Aaviksoo, Toomas Tamsar
Jaak Aaviksoo : Oborona i obrazovanije tak pohhozhi... / Jaak Aaviksoo ; interv. Jevgenija Garanzha
Aaviksoo, Jaak, 1954-
2007-01-01
Kaitseminister Jaak Aaviksoo vastab küsimustele, mis puudutavad riigi kaitsepoliitikat, uut riigikaitse plaani, Eesti-Vene suhteid, rahuvalve missioone, Kaitseliidu tegevust, ministeeriumi ja kaitseväe suhteid
Peep Aaviksoo kukutas EMT-kesksus / Jaan Männik ; interv. Vallo Toomet
Männik, Jaan, 1945-
2003-01-01
EMT nõukogu esimees ja Eesti Telekomi juhatuse esimees Jaan Männik vastab küsimustele, mis on seotud Peep Aaviksoo lahkumisega Eesti Mobiiltelefoni juhi kohalt. Vt. samas: Aaviksoo selgitab lahkumise põhjusi. Peep Aaviksoo kiri. Kommenteerivad Radiolinja Eesti juhatuse esimees Sami Seppänen, Tele2 Eesti juhatuse esimees Üllar Jaaksoo, Ühispanga analüütik Sven Kunsing
Kõrghariduse tulevik / Jaak Aaviksoo
Aaviksoo, Jaak, 1954-
2001-01-01
Teaduseelarveks 50 miljonit dollarit ning 100 doktorikraadi kaitsmist aastas on kaks korda rohkem kui kogu Eesti tänane ressurss. Tartu Ülikooli rektor Jaak Aaviksoo seab selle ülikooli 10 aasta sihiks
Atonen ja Aaviksoo tegid eile esimese 3G kõne / Viktoria Korpan
Korpan, Viktoria, 1976-
2003-01-01
Majandusminister Meelis Atonen ja Eesti Mobiiltelefoni juht Peep Aaviksoo pidasid EMT tehnoloogiakeskuses esimese ametliku kõne 3G testvõrgus. Lisaks tavakõnele videokõnet ja kiiret andmesidet võimaldav teenus jõuab kommertskasutusse orienteeruvalt aastal 2005, lubas Aaviksoo
2010-01-01
Oma USA visiidi ajal kohtus kaitseminister Jaak Aaviksoo USA relvajõudude küberväejuhatuse ülema kindral Keith Alexander'iga ja sai ülevaate USA küberkaitsekorraldusest. Ministri ja USA Esindajatekoja järgmise koosseisu relvajõudude komitee esimehe Howard McKeon'i kohtumisel räägiti Euroopa ja Eesti praegusest julgeolekunägemusest. Kaitseministri plaanis oli ka kohtumine USA kaitseministri Robert Gates'iga
Aaviksoo vihje : Reivik kaotab töö / Raimo Poom
Poom, Raimo
2008-01-01
Ärisidemete tekkimine Aivar Reiviku juhitava aktsiaseltsi Volta ja Vabadussõja võidusamba ehitaja Sans Souci vahel lõpetab Reiviku lepingu kaitseministeeriumiga. Kommenteerib kaitseminister Jaak Aaviksoo
Rector's office as of 31 December 2006
2007-01-01
Rektor prof. Jaak Aaviksoo, teadusprorektor prof. Ain Heinaru, õppeprorektor prof. Birute Klaas, administratsioonidirektor prof. Mihkel Pärnoja, finantsdirektor Taimo saan, haldusdirektor Riho Illak, akadeemiline sekretär Ivar-Igor Saarniit
2007-01-01
Rektor prof. Jaak Aaviksoo, teadusprorektor prof. Ain Heinaru, õppeprorektor prof. Birute Klaas, administratsioonidirektor prof. Mihkel Pärnoja, finantsdirektor Taimo saan, haldusdirektor Riho Illak, akadeemiline sekretär Ivar-Igor Saarniit
Külmetav haigekassa / Ain Aaviksoo
Aaviksoo, Ain, 1974-
2008-01-01
Autori hinnangul on suur oht, et Eesti patsiente ootab ees Läti saatus, kus on 40-50% tervishoiukuludest patsientide endi kanda. Eesti ees seisvaid valikuid analüüsides oleks parim valik ravikindlustuse reservide läbimõeldud kasutuselevõtt, kuid eeldusel, et otsitakse ravikindlustuse rahastamisele pikaajalisi sisulisi lahendusi. Graafik: Haigekassa kulude suhteline muutus
Zamerzajushtshaja Bolnitshnaja kassa / Ain Aaviksoo
Aaviksoo, Ain, 1974-
2008-01-01
Autori hinnangul on suur oht, et Eesti patsiente ootab ees Läti saatus, kus on 40-50% tervishoiukuludest patsientide endi kanda. Eesti ees seisvaid valikuid analüüsides oleks parim valik ravikindlustuse reservide läbimõeldud kasutuselevõtt, kuid eeldusel, et otsitakse ravikindlustuse rahastamisele pikaajalisi sisulisi lahendusi
Kui hästi või halvasti ... / Jaak Aaviksoo, Piret Hartman, Heli Aru
Aaviksoo, Jaak, 1954-
2003-01-01
TÜ rektor J. Aaviksoo, Üliõpilaskondade Liidu juhatuse esimees P. Hartman ja Haridus- ja Teadusministeeriumi kõrghariduse talituse juhataja H. Aru vastavad küsimusele, kui hästi või halvasti on end õigustanud kõrghariduses aasta toiminud 3+2 süsteem
Rector's office as of 31 December 2005
2006-01-01
TÜ rektoraadi koosseis: rektor prof. Jaak Aaviksoo, teadusprorektor prof. Ain Heinaru, õppeprorektor prof. Tõnu Lehtsaar, prorektor prof. Jaak Kangilaski; administratsioonidirektor Mihkel Pärnoja, finantsdirektor Taimo Saan, haldusdirektor Riho Illak, akadeemiline sekretär Ivar-Igor Saarniit
2006-01-01
TÜ rektoraadi koosseis: rektor prof. Jaak Aaviksoo, teadusprorektor prof. Ain Heinaru, õppeprorektor prof. Tõnu Lehtsaar, prorektor prof. Jaak Kangilaski; administratsioonidirektor Mihkel Pärnoja, finantsdirektor Taimo Saan, haldusdirektor Riho Illak, akadeemiline sekretär Ivar-Igor Saarniit
Kuimet, Paul, 1984-
2016-01-01
Paul Kuimet, Dénes Kalev Farkas ja Laura Kuusk räägivad, kuidas valmisid nende kunstnikuraamatud ja mis oli projekti tõukejõuks. Paul Kuimeti fotoraamat "In Vicinity", Dénes Kalev Farkasi raamatud "Evident in Advance" ja "Credo", Laura Kuuse raamat "Pop-up-book"
2006-01-01
TÜ teadustöötajaist ja õppejõududest on 2/3 doktorikraadiga. TÜ rektor Jaak Aaviksoo ja teadusprprektor Ain Heinaru valiti Euroopa kõrghariduspoliitika juhtorganitesse. Sotsiaalteaduskonna prof. Wolfgang Drechsler sai Saksa-Eesti akadeemiliste suhete arendamise eest Saksamaa Liitvabariigi Teeneteristi
Mazaheri, Alireza; Gnoffo, Peter A.; Johnston, Christopher O.; Kleb, Bil
2009-01-01
This users manual provides in-depth information concerning installation and execution of LAURA, version 5. LAURA is a structured, multi-block, computational aerothermodynamic simulation code. Version 5 represents a major refactoring of the original Fortran 77 LAURA code toward a modular structure afforded by Fortran 95. The refactoring improved usability and maintainability by eliminating the requirement for problem-dependent re-compilations, providing more intuitive distribution of functionality, and simplifying interfaces required for multiphysics coupling. As a result, LAURA now shares gas-physics modules, MPI modules, and other low-level modules with the FUN3D unstructured-grid code. In addition to internal refactoring, several new features and capabilities have been added, e.g., a GNU-standard installation process, parallel load balancing, automatic trajectory point sequencing, free-energy minimization, and coupled ablation and flowfield radiation.
Mazaheri, Alireza; Gnoffo, Peter A.; Johnston, Christopher O.; Kleb, Bil
2009-01-01
This users manual provides in-depth information concerning installation and execution of LAURA, version 5. LAURA is a structured, multi-block, computational aerothermodynamic simulation code. Version 5 represents a major refactoring of the original Fortran 77 LAURA code toward a modular structure afforded by Fortran 95. The refactoring improved usability and maintainability by eliminating the requirement for problem-dependent re-compilations, providing more intuitive distribution of functionality, and simplifying interfaces required for multiphysics coupling. As a result, LAURA now shares gas-physics modules, MPI modules, and other low-level modules with the FUN3D unstructured-grid code. In addition to internal refactoring, several new features and capabilities have been added, e.g., a GNU-standard installation process, parallel load balancing, automatic trajectory point sequencing, free-energy minimization, and coupled ablation and flowfield radiation.
Mazaheri, Alireza; Gnoffo, Peter A.; Johnston, Chirstopher O.; Kleb, Bil
2010-01-01
This users manual provides in-depth information concerning installation and execution of LAURA, version 5. LAURA is a structured, multi-block, computational aerothermodynamic simulation code. Version 5 represents a major refactoring of the original Fortran 77 LAURA code toward a modular structure afforded by Fortran 95. The refactoring improved usability and maintainability by eliminating the requirement for problem-dependent re-compilations, providing more intuitive distribution of functionality, and simplifying interfaces required for multi-physics coupling. As a result, LAURA now shares gas-physics modules, MPI modules, and other low-level modules with the FUN3D unstructured-grid code. In addition to internal refactoring, several new features and capabilities have been added, e.g., a GNU-standard installation process, parallel load balancing, automatic trajectory point sequencing, free-energy minimization, and coupled ablation and flowfield radiation.
Mazaheri, Alireza; Gnoffo, Peter A.; Johnston, Christopher O.; Kleb, William L.
2013-01-01
This users manual provides in-depth information concerning installation and execution of LAURA, version 5. LAURA is a structured, multi-block, computational aerothermodynamic simulation code. Version 5 represents a major refactoring of the original Fortran 77 LAURA code toward a modular structure afforded by Fortran 95. The refactoring improved usability and maintain ability by eliminating the requirement for problem dependent recompilations, providing more intuitive distribution of functionality, and simplifying interfaces required for multi-physics coupling. As a result, LAURA now shares gas-physics modules, MPI modules, and other low-level modules with the Fun3D unstructured-grid code. In addition to internal refactoring, several new features and capabilities have been added, e.g., a GNU standard installation process, parallel load balancing, automatic trajectory point sequencing, free-energy minimization, and coupled ablation and flowfield radiation.
Mazaheri, Alireza; Gnoffo, Peter A.; Johnston, Christopher O.; Kleb, Bil
2011-01-01
This users manual provides in-depth information concerning installation and execution of Laura, version 5. Laura is a structured, multi-block, computational aerothermodynamic simulation code. Version 5 represents a major refactoring of the original Fortran 77 Laura code toward a modular structure afforded by Fortran 95. The refactoring improved usability and maintainability by eliminating the requirement for problem dependent re-compilations, providing more intuitive distribution of functionality, and simplifying interfaces required for multi-physics coupling. As a result, Laura now shares gas-physics modules, MPI modules, and other low-level modules with the Fun3D unstructured-grid code. In addition to internal refactoring, several new features and capabilities have been added, e.g., a GNU-standard installation process, parallel load balancing, automatic trajectory point sequencing, free-energy minimization, and coupled ablation and flowfield radiation.
ACHP | News | Laura Bush Announces Preserve America Grants Budget
Search skip specific nav links Home arrow News arrow Laura Bush Announces Preserve America Grants Budget Laura Bush Announces Preserve America Grants Budget First Preserve America Communities Also Announced ) Jan. 15, 2004, Washington, DCÂMrs. Laura Bush announced today that the President's budget for FY 2005
Ain Kivisaar : äärelinn pole kvaliteetne investeering / Ain Kivisaar ; interv. Enn Tosso
Kivisaar, Ain, 1978-
2007-01-01
Ilmunud ka: Delovõje Vedomosti : Nedvizhimost 24. okt. lk. 2-3. Küsimustele kinnisvaraturu olukorra ja investeeringute kohta vastab Metro Capital Managementi finantsjuht Ain Kivisaar. CV: Ain Kivisaar
Energy Technology Data Exchange (ETDEWEB)
Cho, Sung Chul; Han, Jun Hyun [Chungnam National University, Daejeon (Korea, Republic of); Ko, Se-Hyun [Korea Institute of Industrial Technology, Incheon (Korea, Republic of); Kim, Hye Sung [Pusan National University, Miryang (Korea, Republic of); Han, Jun Hyun [Korea Institute of Science and Technology, Seoul (Korea, Republic of)
2015-12-15
AIN/Cu composite powders with a core-shell structure were synthesized by a new technique using electroless plating of Cu on AIN particles and consolidated by spark plasma sintering (SPS). Dependence of the thermal conductivity and coefficient of thermal expansion (CTE) of the AIN/Cu composites on the particle size of AIN were studied. The thermal conductivity and coefficient of thermal expansion were significantly dependent on the existence of both boundary pores surrounding the Cu-coated AIN particles and the internal pores of the AIN particles. In order to eliminate the pores, the temperature and pressure of SPS were increased and the AIN particles were heat-treated at high temperature. Adoption of the core-shell AIN/Cu composite powders facilitated the fabrications of AIN/Cu composites with low porosity and uniform distribution in the AIN in Cu matrix.
Laura Kallasvee ei aja kärbseid pähe / Laura Kallasvee ; intervjueerinud Margit Tõnson
Kallasvee, Laura, 1979-
2010-01-01
Laura Kallasvee fotostuudiost, postkaardiseeriast "Lubadused", raamatust "Toit. Kirg", digifotograafiast, inspiratsiooniallikatest, moefotode pildistamisest, ebaprofessionaalsusest visuaalses ruumis, fotogeenilisusest
Terve mõistusega ahnuse vastu / Ain Aaviksoo
Aaviksoo, Ain, 1974-
2005-01-01
Dokumentaalfilm "Ülisuur mina" ("Super Size Me") : režissöör Morgan Spurlock : Ameerika Ühendriigid 2004. Turumajandusest, dieedist ja toitumisest, filmi hoiatavast osast eelkõige teistmelistele ja nende kasvatajatele
Laura Ashley - lugu armastusest ja loomejõust
2008-01-01
Laura Ashley (1925-1985) edulugu. 1953. a. hakkasid Bernard ja Laura Ashley käsitsi trükkima tekstiile oma korteris Londonis. 1954. a. asutasid nad firma Ashley Mountney Limitied. 1957. a. importis firma oma toodangut Euroopasse, USA-sse ja Austraaliasse. 1977. a. sai L. Ashley Queen's Award for Export Achievement auhinna. Firma põhitegevuseks on saanud kodusisustamiseks vajalike tekstiilide tootmine
2003-01-01
Küsimusele "missugune oleks nende panus ja plaan esimese aasta jooksul ühiskondlikus leppes fikseeritud eesmärkide saavutamiseks" vastavad Tartu Ülikooli rektor Jaak Aaviksoo, EOK asepresident Jüri Tamm, Eestimaa Talupidajate Keskliidu peadirektor Kaul Nurm, Eesti Kirikute Nõukogu täitevsekretär Eerik Jõks, Eesti Ühistegelise Liidu juhatuse esimees Urmas Laht, Eesti Väike- ja Keskettevõtjate Assotsiatsiooni juhataja Riina Danilson ning Reformierakonna pressinõunik Peep Lillemägi. Samas ka karikatuur
Laura: Soybean variety lacking Kunitz trypsin inhibitor
Directory of Open Access Journals (Sweden)
Srebrić Mirjana
2010-01-01
Full Text Available Grain of conventional soybean varieties requires heat processing to break down trypsin inhibitor's activity before using as food or animal feed. At the same time, protein denaturation and other qualitative changes occur in soybean grain, especially if the temperature of heating is not controlled. Two types of trypsin inhibitor were found in soybean grain the Kunitz trypsin inhibitor and the Bowman-Birk inhibitor. Mature grain of soybean Laura is lacking Kunitz trypsin inhibitor. Grain yield of variety Laura is equal to high yielding varieties from the maturity group I, where it belongs. Lacking of Kunitz-trypsin inhibitor makes soybean grain suitable for direct feeding in adult non ruminant animals without previous thermal processing. Grain of variety Laura can be processed for a shorter period of time than conventional soybeans. This way we save energy, and preserve valuable nutritional composition of soybean grain, which is of interest in industrial processing.
2010-01-01
Küsimusele vastavad Tartu Ülikooli eelmine rektor Jaak Aaviksoo, Eesti Üliõpilaskondade Liidu esimees Maris Mälzer, Riigikogu kultuurikomisjoni esimees Peeter Kreitzberg ja Tallinna Tehnikaülikooli rektor Peep Sürje
Laura Mariani, Sarah Bernhardt, Colette e l'arte del travestimento ...
African Journals Online (AJOL)
User
Laura Mariani, Sarah Bernhardt, Colette e l'arte del travestimento,. Bologna, Il Mulino, 1996. Anche questo secondo libro che Laura Mariani dedica alla storia delle attrici si svolge al confine tra storia del teatro e storia delle donne: un intreccio fertile di suggestioni e spunti teorici. Tema dell'indagine, condotta soprattutto ...
Põletavatest küsimustest / Laura Kuusk
Kuusk, Laura, 1982-
2007-01-01
Eesti Kunstiakadeemia magistrantide põlevkiviteemaline näitus "Depressioon" Rael Arteli galeriis Tartus kuni 4. veebruarini. Laura Pählapuu, Siiri Taimla, Risto Tali, Tõnu Narro, Alina Korsmiku ja Mikk Freibergi töödest
Profilaxis de la úlcera gastrointestinal producida por AINES
Directory of Open Access Journals (Sweden)
Carlos Bustamante Rojas
1998-04-01
Full Text Available Como grupo, los AINES son los fármacos más frecuentemente relacionados con informes acerca de Reacciones Adversas en varios países, se considera que más de 30 millones de personas en el mundo toman a diario AINES por prescripción médica o por autoprescripción y que un alto porcentaje de dichas personas corresponden al grupo de edad mayor de 60 años. Diversos metaanálisis revelan que el riesgo de presentar eventos gastrointestinales graves en consumidores regulares de AINES puede ser de 3 a 4 veces mayor que en no usuarios al cabo de 30 dias y que dicho riesgo relativo estimado puede elevarse a 5.5 en pacientes ancianos (7 y a valores cercanos a 8.0 cuando se usan altas dosis del AINE (I, 8. También se ha relacionado el empleo crónico de AINES con un aumento en la mortalidad en ancianos.
Fotograafid loevad ja tekstlevad / Laura Kuusk
Kuusk, Laura, 1982-
2008-01-01
Kollektiivne näituseprojekt "Minnes vastu lugejate soovidele" Tartu Linnaraamatukogu keldris tegutsevas Rael Artel Gallerys. Ühisnäitusel osalesid noored fotograafid Kristiina Hansen, Taaniel Raudsepp, Krõõt Tarkmeel ja Laura Toots ning projektiruumi moderaator Rael Artel
Baudelaire Eestis : märkmeid. III / Ain Kaalep
Kaalep, Ain, 1926-
2004-01-01
Ants Orase loodud eesti aleksandriinist. Artiklis tuuakse välja Charles Baudelaire luuletuse "Correspondances" eri tõlked (Ants Oras, Ain Kaalep) ja luuletuse "Le rêve d'un curieux" tõlked (Ilmar Laaban, Ain Kaalep)
Baudelaire Eestis : märkmeid. III / Ain Kaalep
Kaalep, Ain, 1926-
2013-01-01
Ants Orase loodud eesti aleksandriinist. Artiklis tuuakse välja Charles Baudelaire luuletuse "Correspondances" eri tõlked (Ants Oras, Ain Kaalep) ja luuletuse "Le rêve d'un curieux" tõlked (Ilmar Laaban, Ain Kaalep)
African Journals Online (AJOL)
Hamaidi-Chergui F, Brahim Errahmani M, Debib A, Hamaidi M.S
2016-05-01
May 1, 2016 ... Water from boreholes in Arib (Ain Defla) was investigated to ... of 100 ml is drawn through a membrane filter (0.45 μm pore size) using a vacuum pump. The .... boreholes are very important as clean and hygienic environment ...
"Operation Exhibition" - fotokunst uues valguses / Laura Lepp
Lepp, Laura
2011-01-01
Šotimaal Glasgow's 22.-27. aprillini avatud Ida-Euroopast pärit noorte fotograafide näitusest, mille korraldasid Glasgow' ülikoolis õppivad kunstiajaloo üliõpilased Laura Lepp (Eesti) ja Jevgenia Judova (Läti). Eestit esindavad näitusel Rene Suurkaev ja Marin Sild
Symbols and Sexual Perversion of Laura Wingfield in Tennesse Willimas’s The Glass Menagerie
Directory of Open Access Journals (Sweden)
Retnowati Retnowati
2015-07-01
Full Text Available The Glass Menagerie, a play written by Tennessee Williams, is full of symbols in which some of them refer to the sexual perversion in the character of the play such as Laura Wingfield. The research applied library research by taking data from the script of the play, then analysed based on the two theories, those were the theory of symbol and psychological theory called sexual perversions. The symbols in this play was analyzed, especially those related to Laura Wingfield. There were symbols like the glass collection, glass unicorn, blue roses, fire escape and Jim O’Connor which explained the sexual perversion of Laura Wingfield. These symbols were clues to understand the psycological problems suffered by Laura. It can be concluded that The cause of the strange sexual desire is because of her being abnormal because she is crippled and suffers from pleurosis.
User's Manual for the Langley Aerothermodynamic Upwind Relaxation Algorithm (LAURA)
Gnoffo, Peter A.; Cheatwood, F. McNeil
1996-01-01
This user's manual provides detailed instructions for the installation and the application of version 4.1 of the Langley Aerothermodynamic Upwind Relaxation Algorithm (LAURA). Also provides simulation of flow field in thermochemical nonequilibrium around vehicles traveling at hypersonic velocities through the atmosphere. Earlier versions of LAURA were predominantly research codes, and they had minimal (or no) documentation. This manual describes UNIX-based utilities for customizing the code for special applications that also minimize system resource requirements. The algorithm is reviewed, and the various program options are related to specific equations and variables in the theoretical development.
Meie igapäevane paanika / Ott Karulin
Karulin, Ott, 1980-
2007-01-01
Kahest Vanemuise teatri lavastusest Tartus - Saksa Kultuuri Instituudis etendunud Ingvar Ambjornseni-Axel Hellsteniuse "Elling" Ain Mäeotsa lavastuses ja Laura Cunninghami "Beautiful Bodies" Vanemuises, lavastaja Jüri Lumiste
77 FR 27253 - Proposed Collection, Laura Bush 21st Century Librarian Grant Program Evaluation
2012-05-09
... Century Librarian Grant Program Evaluation AGENCY: Institute of Museum and Library Services, National... evaluate and make improvements to the Laura Bush 21st Century Librarian (LB21) Grant Program. The... proposes clearance of the Laura Bush 21st Century Librarian Grant Program Evaluation. The 60-day Notice for...
Aastahitt 2008. Chalice "Supervõimed". Laura "Destiny" / Kallervo Karu
Karu, Kallervo
2009-01-01
Aastahitt 2008 valimisest (võitis Kerli Kõivu lugu "Walking on Air") ja kontserdist ETV ja Raadio 2 koostööna Tallinnas Club von Überblingenis. Heliplaadist. Laura Põldvere esitatavast eurolaulust
Building a story: myths and realities in the autobiography of Laura Orvieto
Directory of Open Access Journals (Sweden)
Caterina Del Vivo
2014-01-01
Full Text Available Laura Orvieto (Milan 1876 - Florence 1953, children’s writer, always loved telling stories. She asked everyone to tell her stories and, if she couldn’t find anyone available, she told stories to younger children. These stories were inspired by the many books she read and by the fairy tales told by old women. As an adult, once a writer, her most successful work was inspired by classical mythology and the small adventures of her own children. But in the second half of the 1930s many things changed for a family from the Florentine Jewish middle classes, with the increasing pressure of racial marginalization. In around 1936 Laura decided to abandon her usual themes, and instead to turn to her origins and tell her own story, and that of her husband Angiolo and their respective families. The Storia di Angiolo e Laura is written in a simple and direct style, close to Orvieto’s other work. But in the final pages she allows space for statements that illustrate her painful crisis of conscience. Today we can ask to what extent these pages reflect a real biographical journey: other sources complete, confirm or deny the events and states of mind expressed in the book. A parallel reading of a few chapters and other documents reveals less well-known aspects of the thinking and frame of mind of Laura and her family and illustrates her working methods. Received: 27/05/2013 / Accepted: 20/06/2013 How to reference this article Del Vivo, C. (2014. Costruirsi una storia: miti e realtà nell’autobiografia di Laura Orvieto. Espacio, Tiempo y Educación, 1(1, pp. 55-75. doi: http://dx.doi.org/10.14516/ete.2014.001.001.003
Kus lõpeb maastik? / Laura Põld ; intervjueerinud Kristel Schwede
Põld, Laura, 1984-
2013-01-01
Viinis tegutseva eesti kunstniku Laura Põllu loomingulisest teekonnast, kunstiprojektidest "Katse lavastada maastikku" (Tallinna Kunstihoone galerii, 31.05.-23.06.2013) ja "Das Ende der Landschaft, das Ende der Stadt" (Galerie Gut Gasteil, Prigglitz, Austria, 27.04.-16.06.2013)
The erudite humility of the historian: the 'critical epistemology' of Georges Lantéri-Laura.
Basso Lorini, Elisabetta
2017-06-01
This paper analyses the historical and epistemological work of the French psychiatrist Georges Lantéri-Laura (1930-2004) within the context of the French 'tradition' of history and philosophy of sciences, with special reference to Georges Canguilhem and Michel Foucault. After an introduction devoted to a critical survey of the most recent works on the history and historiography of psychiatry in French, the paper outlines Lantéri-Laura's approach by focusing especially on the role played by the methodological concept of 'semiology' as regards the relation between medicine and psychiatry. The last part of the paper draws attention to the relation between the history and philosophy of psychiatry in light of Lantéri-Laura's 'critical epistemology'.
Electronic structure and optical properties of AIN under high pressure
International Nuclear Information System (INIS)
Li Zetao; Dang Suihu; Li Chunxia
2011-01-01
We have calculated the electronic structure and optical properties of Wurtzite structure AIN under different high pressure with generalized gradient approximation (GGA) in this paper. The total energy, density of state, energy band structure and optical absorption and reflection properties under high pressure are calculated. By comparing the changes of the energy band structure, we obtained AIN phase transition pressure for 16.7 GPa, which is a direct band structure transforming to an indirect band structure. Meanwhile, according to the density of states distribution and energy band structure, we analyzed the optical properties of AIN under high-pressure, the results showed that the absorption spectra moved from low-energy to high-energy. (authors)
Laura Laur, personnage hologramme. De l'intersubjectivité dans la littérature
Directory of Open Access Journals (Sweden)
Isabelle Boisclair
2015-01-01
Full Text Available La construction particulière de Laura Laur, de Suzanne Jacob (1983, effaçant la voix du personnage principal au profit de quatre personnages de son entourage (deux frères et deux amants, est ici prise en exemple pour aborder l’intersubjectivité, selon laquelle tout échange entre deux sujets participe à la production des subjectivités de chacun d’entre eux. Compte tenu du sexe des instances narratives (ce sont quatre hommes qui dessinent, depuis leurs positions respectives, une femme, est aussi considérée la dimension genrée du travail des rapports intersubjectifs dans la constitution du soi. Laura Laur apparaît ainsi comme un hologramme trahissant les attentes des uns et des autres envers le féminin. The singular construction of Suzanne Jacob’s Laura Laur (1983, which effaces the voice of the main character in favour of that of four characters from her entourage (two brothers and two lovers is taken here as an example for approaching intersubjectivity, an approach according to which every exchange between two subjects contributes to the production of their subjectivity. Taking into account the sex of the narrative instances (four men depicting a woman from their various perspectives, the gendered dimension of the role of intersubjective relations in the constitution of the self is also considered. Laura Laur then appears as a hologram that betrays the various expectations associated with the feminine.
arXiv Laura++ : a Dalitz plot fitter
Back, John; Harrison, Paul; Latham, Thomas; O'Hanlon, Daniel; Qian, Wenbin; del Amo Sanchez, Pablo; Craik, Daniel; Ilic, Jelena; Otalora Goicochea, Juan; Puccio, Eugenia; Silva Coutinho, Rafael; Whitehead, Mark
The Dalitz plot analysis technique has become an increasingly important method in heavy flavour physics. The Laura++ fitter has been developed as a flexible tool that can be used for Dalitz plot analyses in different experimental environments. Explicitly designed for three-body decays of heavy-flavoured mesons to spinless final state particles, it is optimised in order to describe all possible resonant or nonresonant contributions, and to accommodate possible CP violation effects.
Oxidation behaviour of Ti2AIN films composed mainly of nanolaminated MAX phase.
Wang, Q M; Garkas, W; Renteria, A Flores; Leyens, C; Kim, K H
2011-10-01
In this paper, we reported the oxidation behaviour of Ti2AIN films on polycrystalline Al2O3 substrates. The Ti2AIN films composed mainly of nanolaminated MAX phase was obtained by first depositing Ti-Al-N films using reactive sputtering of two elemental Ti and Al targets in Ar/N2 atmosphere and subsequent vacuum annealing at 800 degrees C for 1 h. The Ti2AIN films exhibited excellent oxidation resistance and thermal stability at 600-900 degrees C in air. Very low mass gain was observed. At low temperature (600 degrees C), no oxide crystals were observed on film surface. Blade-like Theta-Al2O3 fine crystals formed on film surfaces at 700-800 degrees C. At high temperature (900 degrees C), firstly Theta-Al2O3 formed on film surface and then transformed into alpha-Al2O3. At 700-900 degrees C, a continuous Al2O3 layer formed on Ti2AIN films surface, acting as diffusion barrier preventing further oxidation attack. The mechanism of the excellent oxidation resistance of Ti2AIN films was discussed based on the experimental results.
Ain Hanschmidt jättis küsijad vastuseta / Andrus Karnau
Karnau, Andrus
2005-01-01
Ühispanga endise juhi Ain Hanschmidti 26. septembri pöördumine ei andnud vastuseid tema äritehingutega seoses esile kerkinud olulistele küsimustele: mille eest ta sai osalused laevakompaniis Tallink Grupp ja Haapsalu HRM-is. Lisa: Ain Hanschmidti argumendid. Küsimusele, kas Hanschmidti seletused olid piisavad vastavad Eesti Investorite Liidu juhatuse liige Heldur Meerits ja Sillamäe Soojuselektrijaama juhataja Väino Sarnet
Põhikooli ainesõnastikud / Heiki Jaan Kaalep, Jaan Mikk
Kaalep, Heiki-Jaan, 1962-
2008-01-01
Eesti vene õppekeelega koolidele keskastme ainesõnastike loomise konkursi tulemustest, kirjeldatakse koostatud sõnastike eesmärke ja kirjestruktuuri, samuti loomisprotsessi etappe. Vaadeldakse ka morfoloogiaalase tarkvara kasutamisvõimalusi sõnastiku loomisel
HPV infection, anal intra-epithelial neoplasia (AIN and anal cancer: current issues
Directory of Open Access Journals (Sweden)
Stanley Margaret A
2012-09-01
Full Text Available Abstract Background Human papillomavirus (HPV is well known as the major etiological agent for ano-genital cancer. In contrast to cervical cancer, anal cancer is uncommon, but is increasing steadily in the community over the last few decades. However, it has undergone an exponential rise in the men who have sex with men (MSM and HIV + groups. HIV + MSM in particular, have anal cancer incidences about three times that of the highest worldwide reported cervical cancer incidences. Discussion There has therefore traditionally been a lack of data from studies focused on heterosexual men and non-HIV + women. There is also less evidence reporting on the putative precursor lesion to anal cancer (AIN – anal intraepithelial neoplasia, when compared to cervical cancer and CIN (cervical intraepithelial neoplasia. This review summarises the available biological and epidemiological evidence for HPV in the anal site and the pathogenesis of AIN and anal cancer amongst traditionally non-high risk groups. Summary There is strong evidence to conclude that high-grade AIN is a precursor to anal cancer, and some data on the progression of AIN to invasive cancer.
Ground-water resources of the Laura area, Majuro Atoll, Marshall Islands
Hamlin, S.N.; Anthony, S.S.
1987-01-01
The water system that supplies the heavily populated Dalap-Uliga-Darrit (DUD) area of Majuro atoll, Marshall Island, relies almost entirely upon airstrip catchment of rain water. Droughts cause severe water supply problems and water rationing is required, even during periods of normal rainfall. The Laura area contains a substantial lens of fresh groundwater that could be developed for export to the DUD area 30 mi to the east. Study of the groundwater resource at Laura involved a survey of existing wells, installation of monitoring wells and test holes, compilation of continuous records of rainfall and water level fluctuations, and collection of water quality data. Test hole data permitted the definition of three geohydrologic units which correlate well with similar units in Bikini and Enewetak atolls. The units consist of two layers of unconsolidated reef and lagoon sediments resting on a dense, highly permeable limestone. The potable water zone, or freshwater nucleus, of the lens is contained mostly within the unconsolidated layers, which are much less permeable than the basal limestone. Recharge to the Laura freshwater lens is estimated to be 1.8 mil gal/day, based on an average annual rainfall of 140 in. Sustainable yield is estimated to be about 400,000 gal/day. Shallow skimming wells or infiltration galleries similar to those used on Kwajalein atoll would be appropriate to develop the freshwater lens. The impact of development on the lens can be determined by monitoring the salinity in developed water and in a network of monitor wells. (Author 's abstract)
Fabrication and performance of AIN insulator coatings for application in fusion reactor blankets
International Nuclear Information System (INIS)
Natesan, K.
1995-09-01
The liquid-metal blanket concept for fusion reactors requires an coating on the first-wall structural material to minimize the magnetohydrodynamic pressure drop that occurs during the flow of liquid metal in a magnetic field. Based on the thermodynamics of interactions betwen the coating and the liquid lithium on one side and the structural V-base alloy on the other side, an AIN coating was selected as a candidate. Detailed investigations were conducted on the fabrication, metallurgical microstructure, compatibility in liquid Li, and electrical characteristics of AIN material obtained from several sources. Lithium compatibility was studied in static systems by exposing AIN-coated specimens to liquid Li for several time periods. Electrical resistance was measured at room temperature on the specimens before and after exposure to liquid Li. The results obtained in this study indicate that AIN is a viable coating from the standpoint of chemical compatibility in Li, electrical insulation, and ease of fabrication; for these reasons, the coating should be examined further for fusion reactor applications
Frize, Monique
2013-01-01
This book presents the extraordinary story of a Bolognese woman of the settecento. Laura Maria Caterina Bassi (1711-1778) defended 49 Theses at the University of Bologna on April 17, 1732 and was awarded a doctoral degree on May 12 of the same year. Three weeks before her defense, she was made a member of the Academy of Sciences in Bologna. On June 27 she defended 12 additional Theses. Several of the 61 Theses were on physics and other science topics. Laura was drawn by the philosophy of Newton at a time when most scientists in Europe were still focused on Descartes and Galen. This last set of Theses was to encourage the University of Bologna to provide a lectureship to Laura, which they did on October 29, 1732. Although quite famous in her day, Laura Bassi is unfortunately not remembered much today. This book presents Bassi within the context of the century when she lived and worked, an era where no women could attend university anywhere in the world, and even less become a professor or a member of an academ...
Dozhivjom do võborov / Ain Seppik ; interv. Tatjana Opekina
Seppik, Ain, 1952-
2007-01-01
Riigikogu liige vastab küsimustele, mis puudutavad Keskerakonna poliitikat, parlamendivalimisi, aprillisündmusi, korruptsiooni, riigieelarvet. Ain Seppik leiab, et Keskerakonna missiooniks on arendada riiki ja kaitsta nõrku
Gender Transformations and Colonial Displacements in Laura Antillano's "Tuna de mar"
Reid, Alana
2015-01-01
This paper examines the trajectories of two characters in Laura Antillano's short story, "Tuna de mar" (1991), as they navigate interrelated systems of power and attempt to position themselves closer to, or further away from, the margins. Set in the late eighteenth century, the tale features a female protagonist who escapes prostitution…
Trouble makers : Laura Poitras and the problem of dissent
Danchev, Alex
2015-01-01
This review article considers three works by the distinguished documentary film-maker Laura Poitras: My country, my country (2006); The oath (2010); and the recently released Citizenfour (2014), focusing on the whistle-blower Edward Snowden. Poitras describes these works as a trilogy about American power after 9/11, but they are also about disobedience and resistance, or the problem of dissent. The article argues for the significance (and the virtue) of Poitras's project, as film maker and tr...
Rakesh K. Kapania named Norris and Laura Mitchell Professor of Aerospace Engineering
Crumbley, Liz
2008-01-01
Rakesh K. Kapania, a professor in the Department of Aerospace and Ocean Engineering in the College of Engineering at Virginia Tech, was appointed the Norris and Laura Mitchell Professor of Aerospace Engineering by the Virginia Tech Board of Visitors during the board's quarterly meeting March 31.
Dzhässikavad toovad linna jõulurõõmu / Silja Joon
Joon, Silja, 1966-
2008-01-01
"Jazzkaare" kolm dzhässiõhtut Pärnus - 3. dets. Eliisabeti kirikus Raivo Tafenau, Ain Agan ja Laura Põldvere, 9. dets. Endla teatris Saksamaa vokaalansambel Berlin Voices (Esther Kaiser, Sarah Kaiser, Marc Secara, Kristofer Benn) ja 11. dets. Ammende villas norra laulja Gine Andressen. Berlin Voices soojendusansamblina esineb Pärnu noorte vokaalansambel Greip
F-type centers in neutron-irradiated AIN
International Nuclear Information System (INIS)
Atobe, Kozo; Honda, Makoto; Fukuoka, Noboru; Okada, Moritami; Nakagawa, Masuo.
1990-01-01
The production of point defects by neutron irradiation and thermal decay in sintered AIN polycrystal are investigated. The absorption band at 370 nm is observed after reactor neutron irradiation to a dose of 10 16 n/cm 2 (E > 0.1 MeV). The defect corresponding to the band is tentatively assigned as an F-type center from the optical absorption and electron spin resonance. (author)
DA POÉTICA DO ENGAJAMENTO NA LITERATURA POLICIAL DE LAURA LIPPMAN
Directory of Open Access Journals (Sweden)
Isabella Santos Mundim
2013-04-01
Full Text Available Este artigo propõe investigar como se dá a relação da literatura policial de Laura Lippman com um projeto ético determinado. Com base na leitura de obras selecionadas, pretende-se analisar como essa autora se vale da inventividade da linguagem para traduzir, em narrativa, o fenômeno da violência e a falência das instituições.
Leaky surface acoustic waves in Z-LiNbO3 substrates with epitaxial AIN overlays
International Nuclear Information System (INIS)
Bu, G.; Ciplys, D.; Shur, M.S.; Namkoong, G.; Doolittle, W.A.; Hunt, W.D.
2004-01-01
The properties of leaky surface acoustic waves (LSAW) in MBE grown AIN layer on Z-cut LiNbO 3 structures have been studied by numerical simulation and experimental measurements and compared with those of Rayleigh waves in the same structure. In the range of AIN layer thicknesses studied (0 3 substrate was essentially constant at around 4400 m/s. The measured electromechanical coupling coefficients (K 2 ) for the LSAW are roughly 1/4 of the predicted values, which might be due to the strong attenuation of the leaky wave unaccounted for during the parameter extraction. The thin AIN film slightly improved the measured temperature coefficient of frequency for the LSAW over that attained for the Z-cut, X-propagating LiNbO 3 substrate alone
Kurja lilled / Charles Baudelaire ; prantsuse k. tlk. Ain Kaalep ja Märt Väljataga
Baudelaire, Charles
2000-01-01
Sisu: Õnnistamine ; "Jumaldan Sind ma siin, öist taevavõlvi nägev / tlk. Ain Kaalep ; Palkon / tlk. Märt Väljataga ; Kodukäija ; Kassid / tlk. A. Kaalep ; Armastades valet / tlk. M. Väljataga ; Üksildase vein ; Päeva lõpp / tlk. Ain Kaalep. Orig.: Bénédiction ; "Je t'adore ̉ l'égal de la vo͠te nocturne ; Le balcon ; Les chats ; L'amour du mensonge ; Le vin du solitaire ; La fin de la journée
2008-01-01
Kommentaaride autorid ja sisu: Sissejuhatus / Raul Narits, Lauri Madise, Heinrich Schneider. Preambul / Raul Narits, Heinrich Schneider. I ptk. / Kalle Merusk, Taavi Annus, Madis Ernits, Heiki Lindpere, Lauri Madise. II ptk. / Oliver Kask, Madis Ernits, Taavi Annus, Peeter Roosma, Rait Maruste, Eerik Kergandberg, Ivo Pilving, Uno Lõhmus, Merilin Kiviorg, Einar Vene, Ülle Madise. III ptk. / Oliver Kask. IV ptk. / Lauri Madise, Aaro Mõttus, Jüri Põld, Tiina Runthal. V ptk. / Eerik-Juhan Truuväli, Ülle Madise, Jüri Põld, Urmas Reinsalu. VI ptk. / Kalle Merusk, Jüri Põld. VII ptk. / Eerik-Juhan Truuväli, Jüri Liventaal, Jüri Põld. VIII ptk. / Lasse Lehis. IX ptk. / Kristi Land, Heiki Lindpere, Lauri Madise, Heiki Pisuke. X ptk. / Oliver Kask, Enn Markvart, Jüri Põld. XI ptk. / Ülle Madise, Janek Laidvee, Heinrich Schneider. XII ptk. / Berit Aaviksoo, Mihkel Allik, Enn Markvart, Raul Narits, Aare Reenumägi, Peeter Roosma. XIII ptk. / Raul Narits, Uno Lõhmus, Madis Ernits, Jüri Põld. XIV ptk. / Vallo Olle, Arno Almann, Jüri Liventaal, Ülle Madise. XV ptk. / Eerik-Juhan Truuväli, Aaro Mõttus. Eesti Vabariigi põhiseaduse rakendamise seadus / Oliver Kask, Raul Narits, Peeter Roosma. Eesti Vabariigi põhiseaduse täiendamise seadus / Berit Aaviksoo, Julia Laffranque, Ülle Madise, Jüri Põld. Eesti Vabariigi põhiseadus 1990-2008 : bibliograafia (seisuga september 2008) / koost. Maia Ruttu
ISO sertifikaat kuulutab tootja mainet üle maailma / Ain Alvela
Alvela, Ain, 1967-
2006-01-01
Ilmunud ka: Delovõje Vedomosti 12. apr. lk. 24-25. ISO standardi rakendamine tagab toodangu kvaliteedi ja annab firmale usaldusväärsuse. Kommenteerib Ain Noormägi. Vt. samas: ISO 9001; ISO 14 001; Universaalne standard kohandub ettevõtte vajadustega
Teaching Laura Kipnis's "Love's Labors" in "Ways of Reading"
Fike, Matthew A.
2013-01-01
This essay describes a method of teaching a very challenging anthology piece: Laura Kipnis's "Love's Labors" (chapter 1 of her 2003 "Against Love: A Polemic"). The method, although designed for a critical thinking course, should also provide resources for those who teach Kipnis's work in writing courses. Using…
Farias Santos, Juliana; Suruagy Amaral, Monique; Lima Oliveira, Suzana; Porto Barbosa, Júnia; Rego Cabral, Cyro; Sofia Melo, Ingrid; Bezerra Bueno, Nassib; Duarte Freitas, Johnatan; Goulart Sant'ana, Antônio; Rocha Ataíde, Terezinha
2015-05-01
There are several standard diets for animals used in scientific research, usually conceived by scientific institutions. The AIN-93 diet is widely used, but there are some reports of fatty liver in Wistar rats fed this diet. We aimed to evaluate the hepatic repercussions of the AIN-93 diet intake in Wistar rats. Forty newly-weaned 21-day-old male Wistar rats were fed either the AIN-93 diet or a commercial diet for either 1 month or 4 months. Weight gain, serum biochemistry, hepatic histology, and hepatic fatty acid profile were analyzed. Hepatic steatosis was observed, especially in the group fed the AIN-93 diet. Serum blood glucose, absolute and relative liver weight and hepatic levels of oleic, palmitoleic, stearic, and palmitic fatty acids were related to the observed steatosis, while lipidogram and serum markers of liver function and injury were not. AIN-93 diet induced acute hepatic steatosis in Wistar rats, which may compromise its use as a standard diet for experimental studies with rodents. The hepatic fatty acid profile was associated with steatosis, with possible implications for disease prognosis. Copyright AULA MEDICA EDICIONES 2014. Published by AULA MEDICA. All rights reserved.
Keila Tervisekeskus. Ujula = Keila Health Club. Swimming Pool / Ain Padrik
Padrik, Ain, 1947-
2001-01-01
Projekteerija: Arhitektuuribüroo Künnapu & Padrik. Arhitektid Ain Padrik ja Kristi Alamaa, sisearhitekt Sirje Männik. Konstruktsioonid: Jaan Laks, A-Grupp. Ujulas on võistlus- ja lastebassein, suvel on avatud välibassein. 5 ill.: I korruse plaan, ristlõige, vaated
Tumedad ained kirjanduses ja päriselt / Mare Müürsepp
Müürsepp, Mare
2007-01-01
Analüüsitud on Philip Pullmani triloogiasse "Tema tumedad ained" kuuluvaid romaane : Pullman, Philip. Kuldne kompass. Tallinn : Tiritamm, 2002; Pullman, Philip. Inglite torn. Tallinn : Tiritamm, 2004; Pullman, Philip. Vaigust kiiker. Tallinn : Tiritamm, 2005
Unusta, säilita, mäleta : kunstnikud materialiseerivad mälu / Laura Põld
Põld, Laura, 1984-
2015-01-01
Rahvusvaheline näitus "Tracing the Memory" Vaal galeriis 17. detsembrist 2014 kuni 17. jaanuarini 2015, kuraatorid Annika Toots ja Slavomira Ondrušová. Eksponeeriti Daniela Krajčová, Jan Nálevka, Katarina Poliačiková, Laura Tootsi ja Milan Vagač'i installatsioone. Kunstnike eluloolisi andmeid
Directory of Open Access Journals (Sweden)
Ferrán Catalá-López
2014-09-01
Conclusiones: Existe poca evidencia para sugerir que alguno de los AINE estudiados es seguro en términos de riesgo cardiovascular. Naproxeno parece ser menos perjudicial que el resto. El riesgo cardiovascular asociado al uso de AINE debe ser tenido en cuenta en la prescripción de cualquiera de estos medicamentos.
Poolsajandi õnnesoovid Jaak Aaviksoole / Ain Heinaru, Jaak Kangilaski, Tõnu Lehtsaar...[jt.
2004-01-01
Mõtteid Tartu Ülikooli rektorist tema 50. sünnipäeva puhul : Ain Heinaru, Jaak Kangilaski, Tõnu Lehtsaar, Indrek Reimand, Toomas Kiho, Leelo Kriisa, Peeter Olesk, Risto Tammelo, Birute Klaas, Peeter Saari, Andrus Ansip, Mait Klaassen, Marika Kullamaa, Kaupo Bend
Directory of Open Access Journals (Sweden)
Eva Parrondo Coppel
2016-11-01
Full Text Available «Placer visual y cine narrativo», de Laura Mulvey (Screen, 1975, es un artículo nuclear en la configuración de la teoría feminista del cine y su notable influencia ha excedido este ámbito teórico. En el presente trabajo historiográfico nos proponemos realizar una lectura crítica del mismo a la luz de la creciente institucionalización del feminismo a partir de la década de 1980. Para ello nos aproximamos a este texto clásico desde tres ángulos interrelacionados: su contexto histórico, su con-texto teórico y la cuestión de las premisas metodológicas sobre las que se sostiene. En la primera parte de este trabajo, situamos «Placer visual y cine narrativo» en el contexto del movimiento feminista británico post-mayo del 68, el cual se caracterizó por el antagonismo entre las feministas funcionalistas, las marxistas-culturalistas y las psicoanalíticas. Asimismo, nos ocupamos de los primeros textos psicoanalíticos de la teoría feminista del cine, escritos por Claire Johnston y Pam Cook (1973-1975, frente a los cuales Mulvey se posiciona en su artículo. Por medio de esta doble contextualización proponemos, en la segunda parte, que si bien Mulvey dice utilizar el psicoanálisis y, de hecho, hace un amplio uso de terminología psicoanalítica, las bases conceptuales de «Placer visual y cine narrativo» son realmente sociológicas, lo cual (tal y como concluimos es sobre todo palpable en su particular combate contra el Inconsciente, piedra angular del psicoanálisis.Palabras clave: teoría del cine, feminismo, historiografía, Inconsciente, Laura Mulvey, Claire Johnston, Pam Cook.AbstractLaura Mulvey’s «Visual Pleasure and narrative Cinema» (Screen, 1975 is a key essay in the configuration of feminist film theory and its outstanding influence has exceeded this theoretical field. The aim of this historiographical paper is to undertake a critical reading of it in the light of the increasing institucionalization of feminism from
Tõhk, Laura
2006-01-01
Saaremaa Ühisgümnasiumi abituriendid Laura Tõhk ja Marili Pärtel pälvisid oma filmiga "Fallen Angel" Rakveres toimunud noorte filmipäevadel parima dokumentaalfilmi ja Pärnu rahvusvahelise dokumentaal- ja antropoloogiafilmide festivali tunnustuse
The Scientific Method Ain't What It Used to Be
Herreid, Clyde Freeman
2010-01-01
Remember the time when all you had to do was memorize these five steps: ask a question, formulate a hypothesis, perform experiment, collect data, and draw conclusions? And you received full credit for defining the scientific method. Well, those days are gone. This article discusses why the "scientific method ain't what it used to be." (Contains 2…
Fiedler, John L; Villalobos, Carlos A; De Mattos, Annette C
2008-11-01
The Honduras AIN-C programme is a preventive health and nutrition programme of the Honduras Ministry of Health (MOH) that relies on volunteers to help mothers monitor and maintain the adequate growth of young children. A quasi-experimental, design-based evaluation found that the programme achieved near-universal coverage and was effective in improving mothers' child-rearing knowledge, attitudes and practices, including feeding and appropriate care-giving and care-seeking practices for children with diarrhoea and acute respiratory illness. The programme is widely regarded as a model. This study was undertaken to provide the first comprehensive estimates of the cost of the AIN-C programme, with the goal of providing a programme and financial planning tool for Honduras. An additional comparison of study findings was also undertaken to determine the cost of the AIN-C programme's community-based services relative to a similar facility-based service. Expressed in mid-2005 US dollars, the study found that after the programme is phased-in: (1) the annual, recurrent cost per child under 2 years participating in the programme is $6.43; (2) the annual, incremental budget requirements per child under 2 years participating in the programme are $3.90; (3) the cost of an AIN-C monthly growth monitoring and counselling session per child is 11% of the cost of a traditional MOH, facility-based growth and development consultation per child; and (4) the effect of mothers substituting AIN-C monitor care for MOH facility-based care 'saves' 203 000 outpatient visits a year, with a potential cost saving of $1.66 million, the equivalent of 60% of the recurrent cost of the programme and roughly equal to the annual incremental budget requirements of the programme. Sensitivity analysis of the cost estimates is performed to provide insight, for countries considering introducing a similar programme, into how modifications of key characteristics of the programme affect its costs.
Directory of Open Access Journals (Sweden)
Augusto García-Poma
2007-03-01
Full Text Available Objetivo: Evaluar la terapia con pamidronato, en pacientes con espondilitis anquilosante (EA activa, con respuesta subóptima o falla a los antiinflamatorios no-esteroideos (AINES y sulfasalazina. Diseño: Estudio clínico comparativo. Lugar: Hospital Nacional Edgardo Rebagliati Martins, EsSalud, Lima, Perú. Participantes: Pacientes con espondilitis anquilosante. Intervenciones. Se incluyó 9 pacientes con EA (6 varones, con enfermedad activa (BASDAI > o = 4, actividad axial y falta de respuesta a los Aines y sulfasalazina a dosis de 3g/d. Todos los pacientes recibieron 60 mg de pamidronato mensual, en infusión endovenosa, durante 6 meses, y continuaron tomando AINES y sulfasalazina. La mejoría clínica fue evaluada usando el ASAS 20. En forma secundaria se evaluó el ASAS 40, BASDAI 50, BASDAI, BASFI Y BASMI, a las 24 y 48 semanas (32 a 86 semanas. La diferencia entre el índice de pre y postratamiento fue evaluada usando la prueba de Wilcoxon. Principales medidas de resultados: Evaluación del ASAS 20. Resultados: El 67% alcanzó un Asas 20 a las 24 semanas y 78% a las 48 semanas; 33,3% y 55,6% tuvieron ASAS 40 y 33,3%; y 44,4% alcanzó BASDAI 50 a las 24 y 48 semanas, respectivamente. Un paciente recayó a la semana 20. Tres pacientes (33,3% permanecieron sin cambios. A las 24 y 48 semanas, la media de BASDAI disminuyó en 45,1% (p=0,007 y en 52,1% (p=0,01, la media de BASFI en 38,2% (p=0,007 y en 52,3% (p=0,007, y la media de BASMI en 39,2% (p=0,01 y 39,2% (p=0,01, respectivamente. Los eventos adversos no fueron importantes con esta terapia. Conclusiones: El tratamiento con pamidronato demostró ser efectivo en este grupo de pacientes con EA, refractaria a AINES y a sulfasalazina.
Una musa de la modernidad: Laura Méndez de Cuenca (1853-1928
Directory of Open Access Journals (Sweden)
Mílada Bazant
2013-01-01
Full Text Available Este trabajo aborda la trayectoria biográfica, magisterial y literaria de una de las primeras feministas de México, Laura Méndez de Cuenca. Mujer liberal y moderna, madre soltera, quien se atrevió a transgredir las normas sociales católicas de su tiempo y vivió una vida libre, pagando un precio muy alto por esa libertad. Su legado de 2000 páginas es un tratado de educación y un compendio literario de todos los géneros.
Una musa de la modernidad: Laura Méndez de Cuenca (1853-1928)
Mílada Bazant
2013-01-01
Este trabajo aborda la trayectoria biográfica, magisterial y literaria de una de las primeras feministas de México, Laura Méndez de Cuenca. Mujer liberal y moderna, madre soltera, quien se atrevió a transgredir las normas sociales católicas de su tiempo y vivió una vida libre, pagando un precio muy alto por esa libertad. Su legado de 2000 páginas es un tratado de educación y un compendio literario de todos los géneros.
Laura Jensen. Patriots, Settlers and the Origins of American Social Policy.
Directory of Open Access Journals (Sweden)
Evelyne Thévenard
2006-04-01
Full Text Available Dans son ouvrage sur les origines de l’Etat-Providence aux Etats-Unis, Laura Jensen réfute la thèse de l’historiographie classique, qui privilégie le New Deal et la Great Society dans le processus d’élaboration de la protection sociale américaine. Mais surtout, elle s’applique à démontrer que, contrairement à la thèse de Theda Skocpol (Protecting Soldiers and Mothers, les droits sociaux et leur contribution à la construction de la nation et à la définition de la citoyenneté ne datent pas des...
Valik arvamusi läbi aastate / Ain-Elmar Kaasik
Kaasik, Ain-Elmar, 1934-
2008-01-01
Valik Eesti Teaduste Akadeemia Aastaraamatus rubriigis "Arvamusi akadeemikutelt" ilmunud kirjutisi, kus vabas vormis käsitletakse mitmesuguseid aktuaalseid küsimusi, eelkõige hariduse, teadustöö ning ühiskonna suhteid. Kokku on rubriigis avaldatud ligi kaks ja poolsada kirjutist. Siinse valiku autoriteks akadeemikud Raimund Hagelberg, Mart Saarma, Boris Tamm, Ene Ergma, Arvo Krikmann, Agu Laisk, Hans-Voldemar Trass, Harald Keres, Anto Raukas, Rein Küttner, Enn Tõugu, Raimund-Johannes Ubar, Ain-Elmar Kaasik
Combined LAURA-UPS solution procedure for chemically-reacting flows. M.S. Thesis
Wood, William A.
1994-01-01
A new procedure seeks to combine the thin-layer Navier-Stokes solver LAURA with the parabolized Navier-Stokes solver UPS for the aerothermodynamic solution of chemically-reacting air flowfields. The interface protocol is presented and the method is applied to two slender, blunted shapes. Both axisymmetric and three dimensional solutions are included with surface pressure and heat transfer comparisons between the present method and previously published results. The case of Mach 25 flow over an axisymmetric six degree sphere-cone with a noncatalytic wall is considered to 100 nose radii. A stability bound on the marching step size was observed with this case and is attributed to chemistry effects resulting from the noncatalytic wall boundary condition. A second case with Mach 28 flow over a sphere-cone-cylinder-flare configuration is computed at both two and five degree angles of attack with a fully-catalytic wall. Surface pressures are seen to be within five percent with the present method compared to the baseline LAURA solution and heat transfers are within 10 percent. The effect of grid resolution is investigated and the nonequilibrium results are compared with a perfect gas solution, showing that while the surface pressure is relatively unchanged by the inclusion of reacting chemistry the nonequilibrium heating is 25 percent higher. The procedure demonstrates significant, order of magnitude reductions in solution time and required memory for the three dimensional case over an all thin-layer Navier-Stokes solution.
Aineüleste pädevuste koolitus Pestalozzi programmi raames / Tiia Pukk, Tiiu Vaher
Pukk, Tiia
2011-01-01
1969 alguse saanud Pestalozzi koolitusprogramm on suunatud Euroopa kultuurikonventsiooniga ühinenud 49 riigi haridustöötajatele. Seekordne üritus toimus Tartus, koolituse teemaks aineülesed pädevused
GarcÍa Lorca luulest ja Ain Kaalepi tõlkest / Jüri Talvet
Talvet, Jüri, 1945-
1998-01-01
Arvustus: GarcÍa Lorca, Federico. Mu kätes põleb tuli : valitud luuletused / tlk. ja saateks: Ain Kaalep. 2. tr. Tallinn : Vagabund, 1997. Ilmunud ka kogumikus: Talvet, Jüri. Tõrjumatu äär. Tartu : Ilmamaa, 2005, lk. 442-453
New frameshift CF mutation 3729delAinsTCT in a Tunisian cystic
Indian Academy of Sciences (India)
Home; Journals; Journal of Genetics; Volume 92; Issue 1. New frameshift CF mutation 3729delAinsTCT in a Tunisian cystic fibrosis patient. Sondess Hadj Fredj Monia Boudaya Sabrine Oueslati Safa Sahnoun Chaima Sahli Hajer Siala Khedija Boussetta Amina Bibi Taieb Messaoud. Research Note Volume 92 Issue 1 April ...
COxSwAIN: Compressive Sensing for Advanced Imaging and Navigation
Kurwitz, Richard; Pulley, Marina; LaFerney, Nathan; Munoz, Carlos
2015-01-01
The COxSwAIN project focuses on building an image and video compression scheme that can be implemented in a small or low-power satellite. To do this, we used Compressive Sensing, where the compression is performed by matrix multiplications on the satellite and reconstructed on the ground. Our paper explains our methodology and demonstrates the results of the scheme, being able to achieve high quality image compression that is robust to noise and corruption.
Rodríguez, Daniela C; Peterson, Lauren A
2016-05-06
Factors that influence performance of community health workers (CHWs) delivering health services are not well understood. A recent logic model proposed categories of support from both health sector and communities that influence CHW performance and program outcomes. This logic model has been used to review a growth monitoring program delivered by CHWs in Honduras, known as Atención Integral a la Niñez en la Comunidad (AIN-C). A retrospective review of AIN-C was conducted through a document desk review and supplemented with in-depth interviews. Documents were systematically coded using the categories from the logic model, and gaps were addressed through interviews. Authors reviewed coded data for each category to analyze program details and outcomes as well as identify potential issues and gaps in the logic model. Categories from the logic model were inconsistently represented, with more information available for health sector than community. Context and input activities were not well documented. Information on health sector systems-level activities was available for governance but limited for other categories, while not much was found for community systems-level activities. Most available information focused on program-level activities with substantial data on technical support. Output, outcome, and impact data were drawn from various resources and suggest mixed results of AIN-C on indicators of interest. Assessing CHW performance through a desk review left gaps that could not be addressed about the relationship of activities and performance. There were critical characteristics of program design that made it contextually appropriate; however, it was difficult to identify clear links between AIN-C and malnutrition indicators. Regarding the logic model, several categories were too broad (e.g., technical support, context) and some aspects of AIN-C did not fit neatly in logic model categories (e.g., political commitment, equity, flexibility in implementation). The
Creation and (Re)presentation of Historical Discourse in Isle of Passion by Laura Restrepo
Daniela Melis
2011-01-01
Published in Colombia in 1989, but neglected until the author’s later distinction, Laura Restrepo’s first novel, Isle of Passion , focuses on historical facts, as well as on the issues that arise when the impact of events is articulated in official discourse. This study—drawing from Walter Mignolo’s idea of decolonial theory—explores how Restrepo’s attempt to rewrite history following “an-other logic, an-other language, an-other thinking” contributes to the decolonization of knowledge, being...
Monsieur Philippe Galli Préfet de l’Ain France
Maximilien Brice
2011-01-01
Photo 35: Le chef du département Physique P. Bloch, le porte-parole de la Collaboration CMS G. Tonelli,le Sous-Préfet de Gex O. Laurens-Bernard, le chef du département Technologie F. Bordry, le Péfet de l'Ain P. Galli et le Directeur-général R. Heuer. Photo 62: signature du livre d'or avec le Directeur de la recherche et de l'informatique S. Bertolucci.
Application of electrical geophysics to the release of water resources, case of Ain Leuh (Morocco
Directory of Open Access Journals (Sweden)
Zitouni A.
2018-01-01
In the present work, which concerns only the methodology of the electric resistivity, we treat the adopted methodological approach and the study of the case of application in the tray of Ajdir Ain Leuh.
Anna Pantelia
2013-01-01
17 September 2013 - Estonian Minister of Education and Research J. Aaviksoo signing the guest book with CERN Director-General R- Heuer; visiting the TOTEM facility with TOTEM Collaboration Spokesperson S. Giani; in the LHC tunnel at Point 5 with International Relations Adviser T. Kurtyka and visiting the CMS cavern with CMS Collaboration Spokesperson J. Incandela. International Relations Adviser R. Voss present.
Directory of Open Access Journals (Sweden)
R. Ortiz
2017-09-01
Full Text Available The leaching tower is located in the Santa Laura saltpeter works office in Chile. In recent years studies have been carried out, using Non Destructive Techniques (TND, which have determined that the tower is in good condition. However, there are doubts regarding the actual dimensions of the construction elements affected by the desfibration. The present study had the objective of evaluate defibred wood elements, from the leaching tower of the Santa Laura saltpeter works office, using the resistography technique. Additional studies of ultrasound and xylohigrometry were also developed. The obtained results establish that the reduction of the dimensions of the evaluated elements does not present significant difference and that there are no deep damages in the woods. The study confirms that the building is not at risk.
Averis, Kate
2016-01-01
This article explores and analyses the representation of violence in contemporary Colombian culture. Violence has come to characterise Colombian society since the onset of the current armed conflict, with devastating consequences for its population. Within this context, this article examines tendencies in contemporary literary representations of violence, with a focus on La multitud errante (2001) by Laura Restrepo, one of Colombia’s foremost writers. It begins with an outline of the origins ...
Autoficción y trabajo de memoria en La casa de los conejos de Laura Alcoba
Directory of Open Access Journals (Sweden)
Bruno Ragazzi
2014-02-01
Full Text Available The article explores discursive representations within the field of memory in La casa de los conejos by Laura Alcoba. The choice of autofiction as a genre allows discovering new mnemic narratives around the unequal confrontation between Montoneros and right-wing repressive forces. These novel ways of viewing the past are connected to what Ricoeur has called “work of memory”, a therapeutic elaboration on memory that enables a community to reach hope and forgiveness.
Ain't Gonna Study War No More? Explorations of War through Picture Books
Crawford, Patricia A.; Roberts, Sherron Killingsworth
2009-01-01
At the height of the Vietnam War, Down by the Riverside was transformed from a traditional folk song to a popular anti-war anthem. The raucous and repetitive chorus, "I ain't gonna study war no more ...," became a rallying cry for those who wanted nothing to do with the war and the pain and controversy that surrounded it. Although it seems…
Derdour Abdessamed; Bouanani Abderrazak; Babahamed Kamila
2018-01-01
Ain Sefra is one of the Algerian cities that had been experienced several devastating floods during the past 100 years. The purpose of this study is to simulate runoff in the semi-arid region of Ain Sefra watershed through the employing of the Hydrologic Engineering Center – Hydrologic Modelling System (HEC-HMS). In this paper, the frequency storm is used for the meteorological model, the Soil Conservation Service – curve number (SCS-CN) is selected to calculate the loss rate and Soil Conserv...
International Nuclear Information System (INIS)
Ben Ammar, Safouan
2007-01-01
In the semiarid central part of Tunisia the water resources are becoming increasingly rare because of the scarcity and irregularity of the precipitation and a steadily growing need for fresh water. This study addresses the use of geochemical and isotopic data to analyze the relationship between the El Haouareb dam and the Ain El Beidha and the Kairouan alluvial plain aquifers systems for durable groundwater management. In the Ain El Beidha basin the hydrogeological and geochemical investigations showed that: - The general direction of the groundwater flow is mainly from the SW to the NE, i.e. towards the hydraulic sill of El Haouareb which allows the connection between the Ain El Beidha basin and the Kairouan plain, - The salinity distribution displays a zonation in apparent relationship with the lithological variation of the aquifer formation, - Mineral exchange between groundwater and the aquifer matrix is the dominant process in determining groundwater salinity. The isotopic data confirm the flow directions of groundwater and shows that the recharge of Ain El Beidha aquifers takes place from the floods of the Khechem and Ben Zitoun wadies and also by preferential infiltration of runoff at the front of hill slopes area. Close to preferential recharge areas, groundwater 3H contents reflect a recent input of surface water, whereas the radiocarbon data indicate a longer residence time downstream. The isotopic characteristics of Ain El Beidha groundwater (small space and temporal changes) authorize the use of averaged values for the dam-aquifer water exchange. Under natural conditions, groundwater recharge of the alluvial aquifer of Kairouan plain occurs by infiltration of the Merguellil floods and from the Ain el Beidha groundwater flow close the karstic hydraulic sills. Since the construction of the El Haouareb dam, these natural mechanisms have been strongly modified: the dam waters infiltrate into the karst, mix with the Ain el Beidha groundwater, and feed the
Puertas, Mario Munoz
2016-01-01
En esta tesis analizo La isla de la pasión de Laura Restrepo cimentando mi cuadro argumentativo, esencialmente, en conceptos teóricos de narratología (Gérard Genette), de historiografía (Hayden White) y de la Teoría Decolonial (Enrique Dussel, Walter Mignolo y Aníbal Quijano). El objetivo de la presente investigación es analizar si la novela La isla de la pasión (1989), de Laura Restrepo, corresponde a una utopía novelada o una historia ficcional perteneciente a la modernidad, colonialismo y ...
T his article is m ainly about using sim ple trigonom etric identities ...
Indian Academy of Sciences (India)
T his article is m ainly about using sim ple trigonom etric identities and basic calculus to deduce som e new and interesting series. In particular, I use basic aspects of. G am m a and B eta integrations to deduce these series. T hese lead to interesting series for ¼ or functions of ¼ . O ne form ofbeta integration w hich is often ...
Sverdlik, Risto
2009-01-01
Autori hinnangul on Eesti tervishoiusüsteem sotsialistlik ning suhteliselt sarnase tervishoiusüsteemiga riikides on samad probleemid: ravijärjekorrad ja kulude kasv. Singapuri tervishoiumudelist. Autor leiab, et keskse planeerimisega tervishoiusüsteemi puhul kannatavad kõige rohkem vaesed, turumajanduslikus süsteemis aga ravihinnad järjest väheneksid
Husband, Judith
2013-05-01
Judith Husband speaks to the BDJ about current challenges facing dentistry, the new BDA PEC and her love of social media site Twitter. The only catch is she has accepted the challenge issued by interviewer and fellow Twitter enthusiast Laura Pacey of answering every question, in 140 characters or less. Follow on Twitter @Judith_Husband and @The_BDJ.
National Research Council Canada - National Science Library
2006-01-01
.... The Center was to be funded by the Department of Defense, Office of Naval Research (ONR). The TDRI AINS Center's objectives were to advance ONR's technologies and to improve exposure and participation in science, math, and engineering (SME...
International Nuclear Information System (INIS)
Aly, A.I.M.; Nada, A.; Awad, M.; Salman, A.B.; Hamza, M.S.
1991-01-01
Groundwater samples collected from some localities in the vicinity of Moghra and Ain El-Sharip in the north western desert were subjected to chemical and to isotopic analyses. The combination of the hydrochemical data with the isotopic compositions of deuterium, oxygen-18 and tritium shows that the groundwater in this region represents a mixture of water recharged from different sources including : Nile, sea and paleo-waters.5 fig.,2 tab
Shatz, Marilyn
1994-01-01
Jeni Yamada's "Laura" and Michael Tomasello's "First Verbs" continue a tradition of providing useful information on the language ability of individuals in a depth rarely found in multisubject studies; however, these efforts are unusual for case studies in that both take strong theoretical positions on the essence of language and language learning.…
2012-01-01
Tartus Sadama 1 auva Ahhaa teaduskeskuse arhitektuurist ja sisearhitektuurist. Arhitektid: Ain Padrik ja Vilen Künnapu, kaasa töötasid Kristjan Tõlk, Kristiin Keernik, Siim Tuksam, Hannes Tilk (Künnapu & Padrik). Sisearhitektid: Tea Tammelaan, Krista Lepland ja Malle Jürgenson (Laika, Belka & Strelka). Infograafika: Alar Pikkorainen
Language’s Configurations in La casa de los conejos by Laura Alcoba
Directory of Open Access Journals (Sweden)
Estefanía Luján Di Meglio
2018-01-01
Full Text Available This article studies a novel written in the argentinean posdictatorship, in French, La casa de los conejos (2007 by Laura Alcoba. The main concept of the paper is the mother and second tongue and its multiples links with the history –the history of state violence– that novel relates. First of all, it is studied the fact that text is written in French in spite of author’s mother tongue is Spanish: Alcoba had to go into exile during the period of the “Triple A” in Argentina. In second place, it is observed that beyond this fact, there are several words written in Spanish. Such words work as metonymy of a whole language (Spanish, as a symbol of a history (the state terrorism and at the same time, they work as a metonymy of posdictatorship argentinean literature: those words represent the capital fact to telling a history in another way of that one of the oficial history.
Autoficción y trabajo de memoria en La casa de los conejos de Laura Alcoba
Directory of Open Access Journals (Sweden)
Bruno Ragazzi
2013-11-01
Full Text Available Este artículo se propone indagar acerca de las representaciones discursivas en el campo de memoria que se presentan en La casa de los conejos de Laura Alcoba. Se cree que la elección del género de la autoficción es una herramienta genérica que permite descubrir nuevas narrativas mnémicas en torno al enfrentamiento desigual entre Montoneros y las fuerzas represivas de la derecha. Estas novedosas maneras de ver el pasado se vinculan con lo que Ricoeur ha denominado “trabajo de memoria”, una elaboración terapéutica sobre el recuerdo que permite a un pueblo abrirse hacia la esperanza y el perdón.
International Nuclear Information System (INIS)
Jubeli, Y.; Al-Hilal, M.; Al-Ali, A.
1998-06-01
A combination of several exploration techniques was carried out at the main phosphatic outcrop of Ain Laylon in the Syrian coastal region. The survey was extended along an E-W profile parallel to Wadi Al-Mzeraa over a distance of about 23 km from Ain Laylon site towards the shoreline of the Mediterranean Sea. The techniques used in this survey included soil radon emanometry, gamma ray spectrometry and soil geochemistry, with the purpose of evaluating the effects of weathering and erosion on the uranium-hearing phosphate formations in the study ares. Soil radon concentration and gamma ray total count rates found to be ranging between 115-472 pCi/l and 52-520 cps over the main phosphate deposit of Ain Layton and between 16-241 pCi/l and 15-300 cps along the profile of Wadi Al-Mzeraa - Rwemiyeh respectively. Some suitable elements such as U, Zn, Pb, Cr, Fe and Sr were also analyzed to trace the dispersion pattern of uranium and its controls throughout the area. The results showed that the distribution of both radon emission and gamma ray activity, in accordance with chemical uranium and some associated trace elements, were almost identical over the study area. The anomalously high values in all cases were basically found to be related to the main phosphatic outcrop and to the reprecipitation processes at their vicinity following the alteration of the phosphates. The prevailing topographic conditions of the drainage system has probably played a crucial role in carrying the uraniferous solutions from its phosphatic source down to the nearby sedimentary environment. This appears to be sufficient enough to produce an anomalous halo resulting in the detection of some relatively high radon and gamma values of about 7 and 15 times the background respectively, especially close to the main phosphate outcrop. A notable gradual decrease was then observed at the following sampling sites along the pathway west of Ain Laylon site approaching the background level at a distance of
2007-01-01
Eripedagoogide vestlusringis osalevad: Tartu Ülikooli eripedagoogika osakonna juhataja Kaja Plado, emeriitdotsent pedagoogikadoktor Karl Karlep, Tartu Kroonuaia Kooli direktor Ain Ostrat ja õppealajuhataja Meelike Maila, Tartu Hiie Kooli õppealajuhataja Hene Binsol ning Tartu Nõustamis- ja õpiabi keskuse juhataja Ana Kontor
Sedimentary facies and Holocene depositional processes of Laura Island, Majuro Atoll
Yasukochi, Toru; Kayanne, Hajime; Yamaguchi, Toru; Yamano, Hiroya
2014-10-01
The depositional processes that formed Laura Island, Majuro Atoll, Marshall Islands, were reconstructed based on a facies analysis of island sediments and spine ratios, and radiocarbon ages of foraminifera. Sedimentary facies were analyzed from trenches and drill cores excavated on the island and its adjacent reef flat. Depositional ages were obtained using benthic foraminifera (Calcarina) whose spines had not been abraded. The facies were classified into two types: gravelly and sandy. The initial sediments of these sites consisted of gravelly facies in the lower horizon and sandy facies in the upper horizon. Their ages were approximately 2000 cal BP and coincident with the onset of a 1.1-m decline in regional relative sea level, which enabled deposition of the gravelly facies. Half of the sand fraction of the sediment was composed of larger benthic foraminifera. The spine ratio showed that their supply source on the reef flat was located oceanside of the island. The supply source appears to have been caused by the relative sea-level fall. This indicates that the studied island was formed by a relative reduction in wave energy and enhanced foraminiferal supply, both of which were triggered by the late Holocene relative sea-level fall.
International Nuclear Information System (INIS)
Kattan, Z.
2003-01-01
This work is an attempt to estimate the mean residence time of groundwater in the Ain Al-Tanour and Ain-Samak, which are the major karst springs in the Upper Orontes Basin (Central Syria). This estimate, which consists on the application of a mathematical modeling approach, was based on the use of tritium, as a natural radioisotope tracer and a tool for ground water age dating. By adopting a completely mixed reservoir model, linked with exponential time distribution function, the mean residence time (turnover time) of these two springs was evaluated to be about 50 years. This result is in good agreement with previous estimation obtained for the Figeh main spring, which belongs to the same aquifer (Cenomanian-Turonian complex) in the Damascus Basin. On the basis of this evaluation, a value of about 800 million m 3 was obtained for the maximum groundwater reservoir size
Ortiz, R.; Jamet, A.; Moya, A.; González, M.; Varela, M. Paz; Hernández, M.; Fuentes, R.; Díaz, P.; Navarrete, J.
2015-01-01
La oficina salitrera Santa Laura, que es actualmente el lugar donde se mantiene la infraestructura industrial más completa del periodo del procesamiento del salitre, posee una Torre de Lixiviación que es considerada, por su singularidad, el ícono de la otrora industria salitrera en Chile. Esta impresionante estructura, construida casi en su totalidad con madera de Pino Oregón (Pseudotsuga menziesii) y elementos metálicos en sus uniones, sobrelleva desafortunadamente, después del cese del proc...
2008-01-01
Vastavad restoranklubi Atlantis tegevjuht Olga Aasav, ametiühingute keskliidu osakonnajuhataja Arno Arukuusk, AS Estiko Investeeringud juhataja Ain Tammvere, Tartu Ülikooli ametiühingu esimees Aleksander Jakobson, AS Samelin tegevdirektor Leida Kikka, AS Enics Eesti tegevjuht Kalle Kuusik, personalispetsialist Lea Oras ja Tartu Tarbijate Kooperatiivi juhatuse esimees Tarmo Punger
Abou Zakhem, Boulos; Kattaa, Bassam
2017-10-01
The effects of climate change and overexploitation are being strongly perceived in the studied area and the springs discharge is obviously affected. In this paper, Ras El Ain spring discharge and precipitation were analyzed by normalized methods on an yearly timescale. The deficit of Ras El Ain spring discharge due to overexploitation factors and drought effects was estimated. Cumulative drought analyses were carried out using SPI10 and SQI10. Finally, the decreasing trends of the spring discharge due to the deficiency in rainfall were analyzed. The main results reveal that the annual mean deficit of Ras El Ain spring discharge due to overpumping was between 32 and 45%, whereas, annual mean deficit related to drought was between 22 and 35% on average, during the last 30 years (post-1984). The moving averages of SPI and SQI delineate very well the drought periods during last three decades. The cumulative droughts using SPI10 and SQI10 reveal that wet period (pre-1984) with positive values was characterized by high precipitation and spring discharge. Overexploitation period (1984-1989) is distinguished by decreasing SQI10 values whereas, SPI10 is almost stable. The response of the karst system to the precipitation signal has been changed, during the drought period (1990-2000), and the spring behaviour has been modified due to the first overexploitation period. Finally, overexploitation period (2001-2008) is related to the second phase of groundwater intensive pumping for irrigation purposes. Consequently, this period is completely catastrophic causing the drying up of the spring. The decreasing trends analyzed using DPI and DQI showed annual decreasing rates relative to the mean values of -0.268% and -0.105%, respectively. Thus, the results of theoretical model reveal that precipitation will decrease by about DPI = -20.7% and the discharge will decline by about -9.2% by 2050. Consequently, the declining discharge due to climatic variation under natural conditions as
Directory of Open Access Journals (Sweden)
Derdour Abdessamed
2018-03-01
Full Text Available Ain Sefra is one of the Algerian cities that had been experienced several devastating floods during the past 100 years. The purpose of this study is to simulate runoff in the semi-arid region of Ain Sefra watershed through the employing of the Hydrologic Engineering Center – Hydrologic Modelling System (HEC-HMS. In this paper, the frequency storm is used for the meteorological model, the Soil Conservation Service – curve number (SCS-CN is selected to calculate the loss rate and Soil Conservation Service unit hydrograph method have been applied to simulate the runoff rate. After calibration and validation, the simulated peak discharges were very close with observed values. The Nash–Sutcliffe efficiency coefficient was 0.95, indicates that the hydrological modeling results are satisfactory and accepted for simulation of rainfall-runoff. The peak discharges obtained for the 10, 50, 100 and 1000 year storms are respectively 425.8, 750.5, 904.3 and 1328.3 m3∙s−1.
Analysis of Urban Expansion of the Resort City of Al Ain Using Remote Sensing and GIS
Issa, S.; Al Shuwaihi, A.
2009-12-01
The urban growth of AL Ain city has been investigated using remote sensing data for three different dates, 1972, 1990 and 2000. We used three Landsat images together with socio-economic data in a post-classification analysis to map the spatial dynamics of land use/cover changes and identify the urbanization process in Al Ain resort city, United Arab Emirates. Land use/cover statistics, extracted from Landsat Multi-spectral Scanner (MSS). Thematic Mapper (TM) and Enhanced Thematic Mapper plus (ETM +) images for 1972. 1990 and 2000 respectively, revealed that the built-up area has expanded by about 170.53km2. The city was found to have a tendency for major expansion in four different directions: along the Abu Dhabi highway, along Dubai highway, Myziad direction and Hafeet recreational area. Expansion in any direction was found to be governed by the availability of road network, suitability for construction, utilities, economic activities, geographical constraints, and legal factors (boundary with Sultanate of Oman). The road network in particular has influenced the spatial patterns and structure of urban development, so that the expansion of the built-up areas has assumed an accretive as well as linear growth along the major roads. The research concludes that the development is based on conservation of agricultural areas (oases) and reclamation of the desert for farming and agricultural activities. The integration of remote sensing and GIS was found to be effective in monitoring LULC changes and providing valuable information necessary for planning and research.
International Nuclear Information System (INIS)
Bienk, E.J.; Mikkelsen, N.J.
1997-01-01
Two methods of surface improvement widely used in the modern plastics industry are compared, with a view to improving productivity and product quality. Ion implantation of plastics and physical vapour deposition coatings both offer surface engineering advantages. Each method is described and evaluated with reference to plastics moulding. TiAIN coatings are used to protect hard bulk materials, subjected to evenly distributed loads. The more ductile CrN coatings are used for softer materials which give less support to the coatings. (UK)
Lellep, Kaili
2010-01-01
Aine või toote määratlemisest toiduna, kosmeetikatootena, meditsiiniseadmena, ravimina. Määratlustest Eestis ja nende vastavusest Euroopa Liidu õigusega, määratluste tagajärgedest, ettepanekutest vastuolulise õigusakti muutmiseks
Directory of Open Access Journals (Sweden)
Anson Koch-Rein
2012-02-01
Full Text Available Laura Adamietz präsentiert in ihrer Dissertation eine präzise Analyse deutschen und internationalen Antidiskriminierungsrechts und bestehender Rechtsprechung in Sachen Geschlecht, sexuelle Orientierung und Geschlechtsidentität. Verbunden wird dies mit einem – nicht nur für ein juristisches Publikum lohnenden – Überblick über einschlägige, aber in der gängigen Rechtsauslegung unzureichend berücksichtigte geschlechterwissenschaftliche Erkenntnisse. Auf dieser Grundlage entwickelt die Autorin eine Auslegung des antidiskriminierungsrechtlichen Begriffs ‚Geschlecht‘ als „Geschlecht als Erwartung“, wodurch dieser gleichzeitig Komplexität und Anwendbarkeit gewinnt. Die Verbindung von theoretischer Sorgfalt, interdisziplinärer Perspektive und Lösungsorientierung ist ein zentrales Verdienst dieses Buches.Laura Adamietz’s dissertation presents a precise analysis of German and international anti-discrimination law and established jurisdiction regarding gender, sexual orientation, and gender identity. This is combined with an overview of pertinent, yet in current legal interpretation insufficiently considered, findings of gender studies, which is not only valuable for a legal readership. On this basis, the author develops an interpretation of the anti-discrimination juridical term ‘gender’ as “gender as expectation”, which adds both complexity and applicability to it. The combination of theoretical accuracy, interdisciplinary perspective, and solution orientation is a central merit of this book.
Evaluation of the clinical maxim: "If it ain't broke, don't fix it".
Howell-Duffy, Chris; Hrynchak, Patricia K; Irving, Elizabeth L; Mouat, Graham S V; Elliott, David B
2012-01-01
A significant number of patients return to optometric practice dissatisfied with their spectacles. An important question is whether any of these cases are preventable. There are several different clinical maxims that are used to modify the subjective refraction when determining the refractive prescription. These maxims aim to improve patient comfort and adaptation and thereby reduce patient dissatisfaction with new spectacles. They are not based on research evidence, but rather on expert opinion gained from clinical experience. The aim of this study was to retrospectively analyze a large number of case records of dissatisfied patients to assess the possible usefulness of the prescribing maxim "if it ain't broke, don't fix it." Three hundred eighteen non-tolerance cases from a university-based Canadian optometric clinic were categorized by a focus group of optometrists. Three prescribing categories were defined and comprised cases in which application of the proposed maxim may have prevented the recheck eye examination; a more limited application of the maxim for one working distance may have been appropriate; and finally scenarios in which the maxim did not work in that the practitioner was judged to have initially followed the maxim, yet patient dissatisfaction was still reported. The remaining unallocated records comprised prescribing situations outside the scope of this study. Approximately 32% of non-tolerance cases were judged to have been preventable by use of the proposed maxim. Furthermore, an additional 10% reduction in recheck cases may have been possible by a more liberal interpretation of the maxim. Conversely, 4% of cases were deemed to comprise scenarios in which the maxim was followed yet the patient returned later to report problems with their spectacles. The prescribing maxim "if it ain't broke, don't fix it" appears to have a role in reducing recheck eye examinations and improving patient satisfaction with new spectacles.
Directory of Open Access Journals (Sweden)
Didaoui Hayat
2018-03-01
Full Text Available Background and aims: The aim of the current study was to assess the impact of environmental factors; food, socio-economic, and physical activity, on a group of obese children living in Ain-Defla (Center Algeria and Sidi-Bel-Abbes (West Algeria.
Directory of Open Access Journals (Sweden)
Rosa Maria Garcia Camin
2015-03-01
Conclusiones: El tratamiento con IECA, ARA II, diuréticos y/o AINES presenta elevada incidencia de ingreso por FRA, siendo los diuréticos en monoterapia, doble y triple terapia combinada los que ocasionan la mayor incidencia. El FRAETW supone elevados costes sanitarios y muertes evitables.
TEM and XANES study of MOVPE grown InAIN layers with different indium content
International Nuclear Information System (INIS)
Kret, S; Wolska, A; Klepka, M T; Letrouit, A; Ivaldi, F; Szczepańska, A; Carlin, J-F; Kaufmann, N A K; Grandjean, N
2011-01-01
We present structure and spatially resolved composition studies by TEM (Transmission Electron Microscopy) and XANES (X-ray Absorption Near Edge Structure) of InAIN MOVPE (Metal-Organic Vapor Phase Epitaxy) epilayers containing 16-27 at% of indium. Investigations of the In L 3 edge by synchrotron radiation absorption show a significant change of the post-edge structure depending on the indium content. We attribute this to the solubility limit and phase separation in this system. Our measurements suggest that the critical composition is 18% for our growth conditions. HRTEM cross-sectional and EDX investigations confirm such phase separation as well as the changing of the structure from 2D growth to columnar like growth for the sample with the highest indium content.
Creation and (Representation of Historical Discourse in Isle of Passion by Laura Restrepo
Directory of Open Access Journals (Sweden)
Daniela Melis
2011-06-01
Full Text Available Published in Colombia in 1989, but neglected until the author’s later distinction, Laura Restrepo’s first novel, Isle of Passion , focuses on historical facts, as well as on the issues that arise when the impact of events is articulated in official discourse. This study—drawing from Walter Mignolo’s idea of decolonial theory—explores how Restrepo’s attempt to rewrite history following “an-other logic, an-other language, an-other thinking” contributes to the decolonization of knowledge, being, community interests, and cultural heritage. The novel’s plot centers on a minor event in international history: the territorial dispute over the island of Clipperton, which was encountered by an English pirate escaping the Spaniards in the 1700’s, claimed by the Mexicans for its geographical proximity, owned (since 1930 by the French, and occasionally disputed by the English and US governments. Writing while personally experiencing the trauma of exile, Restrepo narrates the forgotten story of the Mexican soldiers—deployed with their families to defend the island—as a metaphor of marginalization. Clipperton, therefore, represents not only a geographical, but also a historical entity. This reading of Isle of Passion describes how its creative dis-order recovers a chapter of national history, finally retold by its silenced protagonists.
Management of toxic cyanobacteria for drinking water production of Ain Zada Dam.
Saoudi, Amel; Brient, Luc; Boucetta, Sabrine; Ouzrout, Rachid; Bormans, Myriam; Bensouilah, Mourad
2017-07-01
Blooms of toxic cyanobacteria in Algerian reservoirs represent a potential health problem, mainly from drinking water that supplies the local population of Ain Zada (Bordj Bou Arreridj). The objective of this study is to monitor, detect, and identify the existence of cyanobacteria and microcystins during blooming times. Samples were taken in 2013 from eight stations. The results show that three potentially toxic cyanobacterial genera with the species Planktothrix agardhii were dominant. Cyanobacterial biomass, phycocyanin (PC) concentrations, and microcystin (MC) concentrations were high in the surface layer and at 14 m depth; these values were also high in the treated water. On 11 May 2013, MC concentrations were 6.3 μg/L in MC-LR equivalent in the drinking water. This study shows for the first time the presence of cyanotoxins in raw and treated waters, highlighting that regular monitoring of cyanobacteria and cyanotoxins must be undertaken to avoid potential health problems.
Performance of the OVERFLOW-MLP and LAURA-MLP CFD Codes on the NASA Ames 512 CPU Origin System
Taft, James R.
2000-01-01
The shared memory Multi-Level Parallelism (MLP) technique, developed last year at NASA Ames has been very successful in dramatically improving the performance of important NASA CFD codes. This new and very simple parallel programming technique was first inserted into the OVERFLOW production CFD code in FY 1998. The OVERFLOW-MLP code's parallel performance scaled linearly to 256 CPUs on the NASA Ames 256 CPU Origin 2000 system (steger). Overall performance exceeded 20.1 GFLOP/s, or about 4.5x the performance of a dedicated 16 CPU C90 system. All of this was achieved without any major modification to the original vector based code. The OVERFLOW-MLP code is now in production on the inhouse Origin systems as well as being used offsite at commercial aerospace companies. Partially as a result of this work, NASA Ames has purchased a new 512 CPU Origin 2000 system to further test the limits of parallel performance for NASA codes of interest. This paper presents the performance obtained from the latest optimization efforts on this machine for the LAURA-MLP and OVERFLOW-MLP codes. The Langley Aerothermodynamics Upwind Relaxation Algorithm (LAURA) code is a key simulation tool in the development of the next generation shuttle, interplanetary reentry vehicles, and nearly all "X" plane development. This code sustains about 4-5 GFLOP/s on a dedicated 16 CPU C90. At this rate, expected workloads would require over 100 C90 CPU years of computing over the next few calendar years. It is not feasible to expect that this would be affordable or available to the user community. Dramatic performance gains on cheaper systems are needed. This code is expected to be perhaps the largest consumer of NASA Ames compute cycles per run in the coming year.The OVERFLOW CFD code is extensively used in the government and commercial aerospace communities to evaluate new aircraft designs. It is one of the largest consumers of NASA supercomputing cycles and large simulations of highly resolved full
Antiinflamatorios no esteroideos (AINES.: Consideraciones para su uso estomatológico
Directory of Open Access Journals (Sweden)
Andrés A. Pérez Ruiz
2002-08-01
Full Text Available Se realiza una revisión extensa y actualizada sobre los antiinflamatorios no esteroideos (AINEs, con el fin de actualizar al estomatólogo en su uso. Para ello se revisan aspectos importantes del proceso inflamatorio en estructuras de la boca que como las pulpitis, presentan sus peculiaridades. Se identifica a una de las 2 familias de autacoides provenientes de los fosfolípidos de membrana celular, es decir, los eicosanoides derivados a partir de algunos ácidos grasos polisaturados, en particular, ácido araquidónico, que tras la acción de enzimas da lugar a la formación de prostaglandinas, prostaciclinas, tromboxeno A2 y leucotrienos. Conocidos estos antecedentes, nos ocupamos de fármacos usados para combatir los síntomas y signos de la inflamación. Casi todos los antiinflamatorios no esteroideos utilizados en la actualidad, casi todos, inhiben las actividades de la ciclooxigenasa 1 constitutiva y la ciclooxigenasa 2, inducida en el sitio de la inflamación y con ello, la síntesis de prostaglandinas y tromboxanos. Se alude a la ventaja terapéutica de los inhibidores de la COX-2 que aparecen hoy en el mercado. Se expone las dosis y frecuencias de los AINEs, sus interacciones, así como las reacciones adversas al medicamento y contraindicaciones, y se proponen aquellos que son de interés en la práctica estomatológica.Non-steroidal anti-inflammatory drugs. Considerations about their dental use. An extensive updated review of non-steroidal anti-inflammatory agents (NSAIN was made to give an updated information to the dentist about their use. To this purpose, important aspects of the inflammatory process in mouth structures like pulpitis that present with their own peculiarities are reviewed. We identified one of the two autacoid families from cell membrane phospholipids, that is, eicosanoids derived from some polysaturated fatty acids, in particular, arachidonic acid, which, after the action of enzymes, give rise to the formation of
Schiller, Friedrich, 1759-1805
2006-01-01
Sisu: Lootus ; Õhtu ; Brutus ja Caesar ; Laura klaveri ees ; Rousseau ; Grupp Tartarosest ; Rõõmule ; Palvekiri ; Hektori lahkumine ; Kunstnikud ; Laulu võim ; Metafüüsik ; Ideaal ja elu ; Maailma jaotamine ; Neiu võõrsilt ; Külvaja ; Odysseus ; Kolumbus ; Antiikkultuur rändurile Põhjast ; Zeus Heraklesele ; Kõrgeim ; Laps hällis ; Surematus ; Võti ; Astronoomilised teosed ; Parim riik ; Minu usk ; Sõber ja vaenlane ; Harv seos ; Nooruse lätted ; Naiste otsus ; Ootus ja täitumine ; Ühine saatus ; Looduseuurijad ja transtsendentaalfilosoofid ; Ohtlik tulemus ; Anonüümne jõgi ; Valgus ja soojus ; Neiu kaebus ; Ühele moralistile ; Goethele ; Pagulane ; Saksa muusa ; Uue sajandi saabumine ; Punshilaul ; Mäelaul ; Polykratese sõrmus ; Rüütel Toggenburg ; Kinnas ; Alpi kütt ; Sõpradele. Eluloolisi andmeid autori kohta lk. 239
Alvela, Ain, 1967-
2011-01-01
Spetsiaalsed jõulutooted aitavad aasta lõpul suurendada toiduainetööstuste käivet. ASi Atria Eesti müügi- ja turundusdirektori Margus Masingu, ASi Fazer Eesti juhatuse esimehe Kristjan Kongo ja ASi Salvest turundusdirektori Ain Nõlvaku kommentaare
Caraban Gonzalez, Noemi
2018-01-01
Madame Olga Givernet Députée 3ème circonscription de l’Ain. Participants CERN, Signature du livre d’or. M. Frédérick Bordry Directeur des accélérateurs et de la technologie Mme Fabiola Gianotti Directrice générale
El cancionero de los romances judeo-Espanoles de Sarajevo de Laura Papo-bojoteta
Directory of Open Access Journals (Sweden)
Muhamed Nezirović
1986-12-01
Full Text Available Los autores e investigadores europeos e americanos que se han ocupado desde principios de este siglo hasta nuestros días del fenómeno de los romances sefardíes de Bosnia, país en el cual vivía antes de la última Guerra Mundial una población judía muy activa y muy importante que Manuel Ortega, en esta época presidente de la Federación de las Asociaciones Sefardíes de Marruecos, caracterizaba en 1930 en estos términos: "Precisamente el grupo de Sefardíes de Sarajevo es uno de los que nos ha preocupado en todo momento por su situación privilegiada en el eje de las corrientes culturales del Oriente europeo, donde tan alto colocan el pabellón de la cultura hispana que ellos f ormaron en su mayor parte'', citan en tre los colectores de esta poesía bien a los judíos originarios de Bosnia como Dan S. Albachary, Maurice Levi o Kalmi Baruch, bien a los extranjeros como Leo Wiener, Manuel Manrique de Lara o Cynthia Crews. Ellos, sin embargo, omiten el nombre de una mujer bosníaca, Laura Papo-Bojoreta, que tiene un lugar destacado en la literatura judeoespañola de Yugoslavia no solamente como autora de unas obras literarias de gran valor, sino también como coleccionadora de los romances judíos de su país natal.
Lepik, Kerli, 1989-
2013-01-01
Suures koguses narkootilise ja psühhotroopse aine käsitlemisest, suure varalise kasu saamise eesmärgist, võrdlus teiste Euroopa riikidega (EL, Läti, Leedu, Soome, Norra, Tšehhi), suurest varalisest kasust kui koosseisutunnusest ja alternatiividest
Ekström, Sandra
2012-01-01
En este trabajo investigamos las funciones de la intertextualidad en la novela La Isla de la Pasión de Laura Restrepo. Concentrándonos en citas y alusiones que refieren a Don Quijote de Cervantes, Robinson Crusoe de Defoe y la Biblia, y tomando en cuenta el contexto en el que aparecen, analizamos las funciones que estas referencias intertextuales cumplen en el nivel del relato en la novela de Restrepo. Constatamos que la intertextualidad entre La Isla de la Pasión y Don Quijote aparece como u...
J.C. Ott (Jan Cornelis)
2017-01-01
markdownabstractIn her book ‘Happiness’ Laura Hyman identifies some discourses, as defined by Foucault, about happiness among 19 middle-class respondents in the UK. A discourse is a way of thinking and communicating about some issue, and comparable to a ‘perception’ or a’ view’. The dominant
Application of electrical geophysics to the release of water resources, case of Ain Leuh (Morocco)
Zitouni, A.; Boukdir, A.; El Fjiji, H.; Baite, W.; Ekouele Mbaki, V. R.; Ben Said, H.; Echakraoui, Z.; Elissami, A.; El Maslouhi, M. R.
2018-05-01
Being seen needs in increasing waters in our contry for fine domestics, manufactures and agricultural, the prospecting of subterranean waters by geologic and hydrogeologic classic method remains inaplicable in the cases of the regions where one does not arrange drillings or polls (soundings) of gratitude (recongnition) in very sufficient (self-important) number. In that case of figure, the method of prospecting geophysics such as the method of nuclear magnetic resonance (NMR) and the method of the geophysics radar are usually used most usually because they showed, worldwide, results very desive in the projects of prospecting and evaluation of the resources in subterranean waters. In the present work, which concerns only the methodology of the electric resistivity, we treat the adopted methodological approach and the study of the case of application in the tray of Ajdir Ain Leuh.
Water-rock interaction and geochemistry of groundwater from the Ain Azel aquifer, Algeria.
Belkhiri, Lazhar; Mouni, Lotfi; Tiri, Ammar
2012-02-01
Hydrochemical, multivariate statistical, and inverse geochemical modeling techniques were used to investigate the hydrochemical evolution within the Ain Azel aquifer, Algeria. Cluster analysis based on major ion contents defined 3 main chemical water types, reflecting different hydrochemical processes. The first group water, group 1, has low salinity (mean EC = 735 μS/cm). The second group waters are classified as Cl-HCO(3)-alkaline earth type. The third group is made up of water samples, the cation composition of which is dominated by Ca and Mg with anion composition varying from dominantly Cl to dominantly HCO(3) plus SO(4). The varifactors obtained from R-mode FA indicate that the parameters responsible for groundwater quality variations are mainly related to the presence and dissolution of some carbonate, silicate, and evaporite minerals in the aquifer. Inverse geochemical modeling along groundwater flow paths indicates the dominant processes are the consumption of CO(2), the dissolution of dolomite, gypsum, and halite, along with the precipitation of calcite, Ca-montmorillonite, illite, kaolinite, and quartz. © Springer Science+Business Media B.V. 2011
Mis on parem - Zaporozhets või Mercedes? / Andres Langemets
Langemets, Andres, 1948-
2007-01-01
Vastukaja Mikko Lagerspetzi artiklile 5. dets. Postimehes, mis oli omakorda vastukaja Jaak Aaviksoo artiklile 19. nov. Postimehes. Sotsioloogiast, sotsiaalteadlastest ja sotsioloogilistest küsitlustest
2007-01-01
Jõekääru Jazz'ile järgneval nädalal tõi ürituse peakorraldaja Allan Liik toimetusse seal esinenud muusikud. Vestlusringis olid: Allan Liik, Hedvig Hanson, Andre Maaker, Ain Agan, Raivo Tafenau ja Sergio Bastos
"Tere! Head teatripäeva!" : Rakveres jagati auhindu mulluste teatriteenete eest / Verni Leivak
Leivak, Verni, 1966-
2009-01-01
Rakvere Teatris toimunud teatriauhindade jagamisest. Lisatud aastaauhindade laureaadid - Tiit Ojasoo ja Ene-Liis Semper parim lavastus ("Ruja"), Lembit Peterson - lavastaja auhind ("Maarja kuulutamine" ja "Linn"), Maria Peterson ja Laura Peterson - naisnäitleja auhind, Marius Peterson - meesnäitleja auhind, Piret Laurimaa - naiskõrvalosa auhind, Rain Simmul - meeskõrvalosa auhind, Liisi Eelmaa - kunstniku auhind, Ain Saviauk - žürii eriauhind, Valle-Sten Maiste - Reet Neimari kriitikaauhind, Arvo Volmer - muusikalavastuse auhind, Eve Andre - balletilavastuse auhind, Jaan Undusk - algupärase dramaturgia auhind, Marius Peterson - sõnalavastuse muusikalise kujunduse auhind, Tiina Tauraite ja Margus Prangel - Ants Lauteri auhind, Lembit Peterson - Priit Põldroosi auhind, Mart Madiste - Georg Otsa auhind, Sigrid Orusaar - Otto Hermanni auhind, Tiit Härm - Rahel Olbrei auhind, Ene-Liis Semper - Natalie Mei auhind, Jevgeni Ibragimov - Salme Reegi auhind, Margus Alver - Aleksander Kurtna auhind, Toomas Suuman - Karl Adra auhind, Sten Karpov ja Uku Uusberg - Kristallkingakese auhind
Directory of Open Access Journals (Sweden)
Ortiz, R.
2015-12-01
Full Text Available The Santa Laura Saltpeter Work, which is nowadays the place where the most complete industrial infrastructure of the nitrate processing period is maintained, has a Leaching Tower that is considered by its uniqueness, the icon of the former nitrate industry in Chile. This impressive structure, built mostly in Oregon Pine wood (Pseudotsuga menziesii with metal junctions, unfortunately bears, after the plant stopped producing nitrate and iodine, the impact of its productive past and subsequent human actions because of neglect and lack of maintenance. This report, based on a visual, instrumental and structural inspection, is a diagnosis of the current condition of the building. The results indicate that the elements of the structure, with some exceptions, are in good condition and without changes in their mechanical properties. Structural analysis determined that the plant behavior is favorable, being able to withstand a seismic event of importance.La oficina salitrera Santa Laura, que es actualmente el lugar donde se mantiene la infraestructura industrial más completa del periodo del procesamiento del salitre, posee una Torre de Lixiviación que es considerada, por su singularidad, el ícono de la otrora industria salitrera en Chile. Esta impresionante estructura, construida casi en su totalidad con madera de Pino Oregón (Pseudotsuga menziesii y elementos metálicos en sus uniones, sobrelleva desafortunadamente, después del cese del proceso de fabricación de salitre y yodo, el impacto de su pasado productivo y posteriores acciones antrópicasambientales producto de su abandono y falta de mantenimiento. El presente informe, que contemplo inspección básica, instrumental y análisis estructural, es un diagnóstico del estado actual de conservación del edificio. Los resultados obtenidos indican que los elementos que conforman la estructura, con algunas excepciones, se encuentran en buen estado y sin alteración de sus propiedades mecánicas. El
Tallinna Sakala keskuse projekt kütab kirgi / Aivo Vahemets
Vahemets, Aivo
2004-01-01
Raine Karbi projekteeritud hoone ümberehituse projekt telliti Inglismaalt büroost Burrow&Cave, OÜ Arhitektuuriagentuuri projektist loobuti. Eesti Arhitektide Liidu esinaise Margit Mutso ja arhitektuurinõukogu esimehe Peep Aaviksoo kommentaar
Harnden, Toby
2011-01-01
Raamatu "Dead Men Risen" autor räägib oma blogis Eesti kaitseministri Jaak Aaviksoo ja president Toomas Hendrik Ilvese reageeringutest teosele, kus on juttu ka Afganistanis teeninud Eesti kaitseväelastest
Teder, Teet
2011-01-01
Toby Harndeni raamatust "Dead Men Risen", kus on juttu ka Afganistanis teeninud Eesti kaitseväelastest. Kaitseminister Jaak Aaviksoo ja president Toomas Hendrik Ilvese reageeringutest. Vt. ka lk. 10: Uudam, Laur. Eetikapomm
Mechergui, M. Mohamed; Henda Saoudi, Mme
2016-04-01
This study aims to assess the impact of water harvesting constructed hydraulic structures (big and small dams, terraces, seuils for recharge…) on the evolution of piezometric head of Ain El Beidha groundwater table. The measurements of depth of water table, taken at the end of rain season and at the end of irrigation season, in many piezometers and monitoring wells, for a long period of observation before and after implementation of all the hydraulic structures, were used with the cumulative rain to the highest water table to diagnostic the effect of natural recharge and constructed hydraulic structures. According to the analysis of curves illustrating the evolution of piezometric head and rainfall over time, it was shown that despite the fact that the same amount of rain fall on the total area in the limits of Ain El Beidha groundwater table, the piezometers respond differently. This is because there are many sources of recharge and many factors affecting the recharge. First of all, the aquifer is divided in four compartments (the calcareous formation of Djebel El Houyareb, the plio-quaternary formation, the Miocene formation: Baglia and Saouaf). All those respond differently to the recharge by their capacity of infiltration and their hydrodynamic characteristics. The recharge of the groundwater table was increased by the implementation of small soil and water conservation structures, artificial lakes, El Haouareb Dam, run off in the natural Oued bads and seuils for recharge installed in the bads of oueds. The different piezometric drown maps were used to determine the flow direction and hydraulic gradient in order to identify the recharge areas, while tracking maps for three equal piezometric heads 210 m 300 m and 370 m established over different years made it possible to assess the impact of hydraulic structures, namely the effect of SWC and Ben Zitoun Lake. To illustrate the impact of El Houareb dam on the groundwater, the piezometric maps and local values
2011-01-01
16. detsembril Tartus toimunud Eesti-Läti koostöökonverentsist võtsid osa ka mõlema riigi peaministrid Andrus Ansip ja Valdis Dombrovskis. Kohal olid ka haridusministrid Jaak Aaviksoo ja Roberts Kilis
Climate change and their consequences on coastal zone of Ain el Turck in Oran
Directory of Open Access Journals (Sweden)
Mohammed Tewfik Bouroumi
2017-12-01
Full Text Available Algeria does not escape the problem of the climate change, its geographical position in zone of transition, and its dry and semi-arid climate, in fact a very vulnerable space. In Algeria, approximately two thirds of the population is concentrated on the coast which represents only 4 % of the territory. The Mediterranean coast, in particular in Algeria, is subjected to pressures: financial stakes, climatic risks, pollutions and conservation of the water. It is on the basis of the critical and objective report with regard to a wild urbanization of the Algerian coast as well as the influence of the demographic pressure that the choice of the search for this article was held. This publication has for objective to raise (to draw up a current situation (inventory of fixtures of the sector of the environment in Algeria and to present through the case of the coastal city of Oran the consequences of climate change. We propose, to review the situation through the case of the municipality of Ain El Türck, by basing itself on data relative to the evolution of the temperatures and the sea level.
Estudio biofarmacéutico de geles antiinflamatorios no esteroideos (AINES
Directory of Open Access Journals (Sweden)
Margarita Restrepo
2000-02-01
Full Text Available
Los antiinflamatorios no esteroideos (AINES son un grupo heterogéneo de compuestos con actividad analgésica, antipirética y antiinflamatoria que comparten efectos secundarios indeseables, tales como: ulceración gástrica e intestinal, anemia, bloqueo de la agregación plaquetaria, inhibición de la motilidad uterina e hipersensibilidad. Los AINES se utilizan por vía tópica con el fin de aliviar lesiones en tejidos blandos a los cuales puede llegarse directamente a través de la piel, evitando así los efectos colaterales indeseables.
Actualmente para la gran mayoría de los medicamentos se exige valorar la Biodisponibilidad como criterio de calidad. Biodisponibilidad se define como la cantidad de fármaco que llega a sangre o plasma después de la administración del medicamento que lo contiene y la velocidad a la cual este proceso ocurre; esta determinación de Biodisponibilidad no resulta útil en el caso de medicamentos que se administran a través de la piel y no alcanzan circulación sistémica; la biodisponibilidad relativa o Bioequivalencia es la comparación de las biodisponibilidades de dos medicamentos para determinar si son similares en su comportamiento farmacocinético dentro del organismo.
El presente trabajo pretende estandarizar y validar un método que permita determinar concentraciones de fármaco en tejidos, en este tipo de medicamentos administrados por vía tópica, que no alcanzan circulación sistémica y por lo tanto no pueden ser cuantificados en sangre o plasma; además pretendemos que esta metodología pueda ser propuesta como una técnica para determinar biodisponibilidad y/o bioequivalencia para este tipo de productos. Para lograr estos objetivos, inicialmente, se induce la inflamación a un grupo
Samaja bolshaja stroiploshtshadka v Estonii / Konstantin Morenko
Morenko, Konstantin
2004-01-01
Tallinna linnavalitsus korraldas ümarlaua linna rannaalade hetkeseisu ja arenguvõimaluste hindamiseks, mille töös osalesid ka Euroopa tuntud linnaplaneerimise konsultandid. Arvamust avaldavad Peep Aaviksoo, Lutz Schleich, Giorgio Risicaris ja Stefan Boltz
Vene kriis kukutas Norma juhid / Raul Ranne
Ranne, Raul
1998-01-01
AS Norma vallandas ettevõtte tegevjuhi Peep Aaviksoo, sest ei olnud rahul ettevõtte tegevusega Venemaal. Tabelid: Norma aktsia on kukkunud, Norma kuukasum miinuses. Ilmunud ka: Delovõje Vedomosti, 9. sept. 1998, lk. 10
Eestikeelne doktoriõpe ähvardab kaduda / Eva Kübar
Kübar, Eva
2005-01-01
Eestikeelse doktoriõppe võimalikku kadumist kommenteerivad Tallinna Tehnikaülikooli õppeprorektor Jakob Kübarsepp, Tartu Ülikooli rektor Jaak Aaviksoo, Eesti Põllumajandusülikooli õppeprorektor Hardi Tullus ja Tallinna Ülikooli rektor Mati Heidmets
Vabadussõja võidusammas valmib Tšehhi klaasitehases / Dannar Leitmaa, Urmas Jaagant
Leitmaa, Dannar, 1982-
2008-01-01
Eesti kaitseminister Jaak Aaviksoo ja Tšehhi klaasivabriku Sans Souci esindaja Martin Chab allkirjastasid lepingu, mille kohaselt tšehhid projekteerivad, valmistavad ja püstitavad 15. oktoobriks Tallinna Vabaduse väljakule võidusamba
Vitamin D deficiency among healthy adolescents in Al Ain, United Arab Emirates
2013-01-01
Background Although vitamin D deficiency has been studied in various adult populations, there are few data on the prevalence of this nutritional deficiency among healthy adolescents in the United Arab Emirates (UAE). This study was conducted to determine the prevalence of vitamin D deficiency and to examine its correlates in adolescents aged 15 to 18 years. Methods This was a cross-sectional study in urban schools. Healthy adolescents (N=315) from a sample of 8 schools were randomly selected from the 142 schools in Al Ain, Abu Dhabi Emirate. Outcomes measured included serum concentrations of 25-hydroxy vitamin D (25OHD), plasma lipids, blood sugar, blood pressure and anthropometric data, nutrition and lifestyle variables. Results Fourty-one participants (19.7%) were vitamin D deficient (serum 25OHD level ≤15 ng/mL [≤37.5 nmol/L]. Using a cutoff level of 25(OH) D of ≤20 ng/ml [≤50 nmol/l] 143 participants (45.4%) were vitamin D insufficient. Overall 65.1% of study participants were either vitamin D deficient or insufficient. The prevalence of vitamin D deficiency varied between boys (10%) and girls (28%). In a final multivariate model, serum 25(OH) D concentrations were inversely correlated with female gender, consumption of fast food per week, and body mass index and positively correlated with physical activity scores after adjustment for age. Conclusions Vitamin D deficiency and insufficiency were highly prevalent in adolescents, and more common in girls. PMID:23311702
Energy Technology Data Exchange (ETDEWEB)
Montes de Oca, J.; Gonzalez, H. J. [Centro de Investigacion en Ciencia Aplicada y Tecnologia Avanzada, IPN, Unidad Altamira, Km. 14.5 Carretera Tampico-Puerto industrial Altamira, 89600 Altamira, Tamaulipas (Mexico); Solis, E. [Hy-Teck Fluid Power, Blvd. A. Lopez Mateos No. 310, Col. Nuevo Aeropuerto, 89337 Tampico, Tamaulipas (Mexico); Moreno, J. [Departamento de Ingenieria Metalurgica, Escuela Superior de Ingenieria Quimica e Industrias Extractivas, IPN, UPALM Unidad Zacatenco, 07730 Mexico D. F. (Mexico); Munoz S, J. [Centro de Investigacion y de Estudios Avanzados, Unidad Queretaro, Libramiento Norponiente No. 2000, Fracc. Real de Juriquilla, 76230 Santiago de Queretaro, Queretaro (Mexico)], e-mail: jmontedeocav@ipn.mx
2009-07-01
The present work reports a study to increase wear resistance of a ball passage floodgate (steel type T9) trough the application of a thick film (coating). This study have included a material and process selection, synthesis of the coating on steel plates as substrates and spherical device, assembling of the coated floodgate on the ball valves, and finally an evaluation of the valves in the process of a thermoelectric power station. Taking into account the different requirements, a TiAIN coating prepared by cathodic arc evaporation was finally retained. The crystal structure, morphology and chemical composition of the coating were evaluated by x-ray diffraction (XRD) and scanning electron microscopy equipped with an energy dispersive spectrometer (SEM-EDS). Finally, mechanical properties such as hardness and Young modulus were determined by nano indentation. (Author)
International Nuclear Information System (INIS)
Montes de Oca, J.; Gonzalez, H. J.; Solis, E.; Moreno, J.; Munoz S, J.
2009-01-01
The present work reports a study to increase wear resistance of a ball passage floodgate (steel type T9) trough the application of a thick film (coating). This study have included a material and process selection, synthesis of the coating on steel plates as substrates and spherical device, assembling of the coated floodgate on the ball valves, and finally an evaluation of the valves in the process of a thermoelectric power station. Taking into account the different requirements, a TiAIN coating prepared by cathodic arc evaporation was finally retained. The crystal structure, morphology and chemical composition of the coating were evaluated by x-ray diffraction (XRD) and scanning electron microscopy equipped with an energy dispersive spectrometer (SEM-EDS). Finally, mechanical properties such as hardness and Young modulus were determined by nano indentation. (Author)
Taas teadmusühiskonna infopoliitikast / Silvi Metsar
Metsar, Silvi
2004-01-01
RRis toimunud II infopoliitika foorumil "Riiklik infopoliitika - müüt või tegelikkus" arutleti, kas Eestis on infoühiskond, milline on riiklik infopoliitika jne. Teiste seas osalesid Anu Toots, Tiiu Valm, Peeter Tulviste, Jaak Aaviksoo, Raul Malmstein
Directory of Open Access Journals (Sweden)
B BENRACHI
2002-12-01
Full Text Available La construction d’un édifice de qualité standard et répondant aux exigences techniques est obtenue grâce au développement du savoir-faire et au respect des règles de l’art et de la réglementation en vigueur. Une étude détaillée sur les exigences techniques et le respect de la réglementation d’un logement en collectif nouvellement construit et inhabité à Ain-Smara, nous a montré qu’il y a une satisfaction pour certaines d'entre-elles et une non-conformité pour d’autres. Il en résulte que le degré de satisfaction de ce logement est inférieur à celui recommandé dans le cadre de la réglementation, ce qui diminue sa qualité par rapport au standard exigé.
Kirss, Tiina, 1957-
2005-01-01
aktusega Tartu Collegéis 27. novembril 2005. Ülikooli rektor Jaak Aaviksoo analüüsis oma kõnes TÜ arenguvõimalusi ja päevamuresid, Tiina Kirss esitas sissevaate ülikooli ajalukku, muusikalises osas esinesid Kaili ja Riho Maimets
USA moos määrib Eesti naabritest mõjukamaks / Raimo Poom
Poom, Raimo
2007-01-01
Sel sügisel on toimunud mitu Eesti ja USA poliitikute kohtumist. Peaminister Andrus Ansipi ja kaitseminister Jaak Aaviksoo USA-visiitide korraldamisega kursis olevad ametnikud ei nõustu, et kohtumiste taga oleks olnud USA lobitöö Iraagi missiooni pikendamiseks
Klaasist võidusammas tuleb kõigi kirgede kiuste
2008-01-01
Tallinna Harjumäele kavandatava Vabadussõja võidusamba projekteerib, valmistab ja püstitab Tšehhi klaasifirma Sans Souci oktoobri keskpaigaks. Monument on plaanis avada 28. novembril 2008. Kommenteerib Jaak Aaviksoo. Vaata ka juhtkirja "Ässitajad arhitektid" lk. 2
Eesti rahvusliku tahte triumf? / Tarmo Jüristo
Jüristo, Tarmo
2010-01-01
Autor analüüsib kaitseminister Jaak Aaviksoo Tartu rahu aastapäevale pühendatud kõnet, milles kaitseminister viitas tahtmatult 1934. aasta propagandafilmile "Tahte triumf" ("Triumph des Willens"), mis kujutas Adolf Hitleri saabumist natsionaalsotsialistliku partei Nürnbergi konverentsile
Associations of cardiovascular risk factors in Al Ain- United Arab Emirates
Directory of Open Access Journals (Sweden)
Nazirudeen Mohammad K
2009-04-01
Full Text Available Abstract Background Over the last 30 years the citizens of the United Arab Emirates have experienced major changes in life-style secondary to increased affluence. Currently, 1 in 5 adults have diabetes mellitus, but the associations (clustering among risk factors, as well as the relevance of the concept of the metabolic syndrome, in this population is unknown. Aim To investigate the prevalence and associations among cardiovascular risk factors in this population, and explore to what extent associations can be explained by the metabolic syndrome according to ATP-III criteria. Method A community based survey, of conventional risk factors for cardiovascular disease was conducted among 817 national residents of Al Ain city, UAE. These factors were fasting blood sugar, blood pressure, lipid profile, BMI, waist circumference, smoking, or CHD family history. Odds ratios between risks factors, both unadjusted and adjusted for age and sex as well as adjusted for age, sex, and metabolic syndrome were calculated. Results Various risk factors were positively associated in this population; associations that are mostly unexplained by confounding by age and sex. For example, hypertension and diabetes were still strongly related (OR 2.5; 95% CI 1.7–3.7 after adjustment. An increased waist circumference showed similar relationship with hypertension (OR 2.3; 95% CI 1.5–3.5. Diabetes was related to an increased BMI (OR 1.5; 96% CI 1.0–2.3. Smoking was also associated with diabetes (OR 1.9, 95% CI 1.0–3.3. Further adjustment for metabolic syndrome reduced some associations but several remained. Conclusion In this population risk-factors cluster, but associations do not appear to be explained by the presence/absence of the ATP-III metabolic syndrome. Associations provide valuable information in planning interventions for screening and management.
Associations of cardiovascular risk factors in Al Ain- United Arab Emirates
Baynouna, Latifa M; Revel, Anthony D; Nagelkerke, Nico JD; Jaber, Tariq M; Omar, Aziza O; Ahmed, Nader M; Nazirudeen, Mohammad K; Al Sayed, Mamdouh F; Nour, Fuad A; Abdouni, Sameh
2009-01-01
Background Over the last 30 years the citizens of the United Arab Emirates have experienced major changes in life-style secondary to increased affluence. Currently, 1 in 5 adults have diabetes mellitus, but the associations (clustering) among risk factors, as well as the relevance of the concept of the metabolic syndrome, in this population is unknown. Aim To investigate the prevalence and associations among cardiovascular risk factors in this population, and explore to what extent associations can be explained by the metabolic syndrome according to ATP-III criteria. Method A community based survey, of conventional risk factors for cardiovascular disease was conducted among 817 national residents of Al Ain city, UAE. These factors were fasting blood sugar, blood pressure, lipid profile, BMI, waist circumference, smoking, or CHD family history. Odds ratios between risks factors, both unadjusted and adjusted for age and sex as well as adjusted for age, sex, and metabolic syndrome were calculated. Results Various risk factors were positively associated in this population; associations that are mostly unexplained by confounding by age and sex. For example, hypertension and diabetes were still strongly related (OR 2.5; 95% CI 1.7–3.7) after adjustment. An increased waist circumference showed similar relationship with hypertension (OR 2.3; 95% CI 1.5–3.5). Diabetes was related to an increased BMI (OR 1.5; 96% CI 1.0–2.3). Smoking was also associated with diabetes (OR 1.9, 95% CI 1.0–3.3). Further adjustment for metabolic syndrome reduced some associations but several remained. Conclusion In this population risk-factors cluster, but associations do not appear to be explained by the presence/absence of the ATP-III metabolic syndrome. Associations provide valuable information in planning interventions for screening and management. PMID:19371412
USA kaitseminister Robert Gates süüdistas liitlasvägesid oskamatuses / Evelyn Kaldoja
Kaldoja, Evelyn, 1980-
2008-01-01
USA kaitseminister Robert Gates väitis ajalehes The Los Angeles Times avaldatud intervjuus, et Lõuna-Afganistani olukord on halvenenud seal võitlevate USA liitlasvägede puuduliku väljaõppe tõttu. Liitlasriikide reageeringuid. Arvamust avaldavad Jaak Aaviksoo, Kaarel Kaas
Tagurpidi pööratud poliitika / Ivar Tallo
Tallo, Ivar, 1964-
2009-01-01
Autor näeb vastuolu seoses vaidlusega kaitseväelaste õiguse üle määrata enda hukkumishüvitise saaja: konservatiivse IRL-i minister Jaak Aaviksoo kaitseb sõdurite valikuvabadust ning liberaalist Reformierakonna minister Jürgen Ligi tahaks sõdurite eest otsustada
Ilves lennutati käepigistuseks hiiglaslikule sõjalaevale / Rasmus Kagge
Kagge, Rasmus, 1977-
2007-01-01
President Toomas Hendrik Ilves, Riigikogu esimees Ene Ergma, kaitseväe juht Ants Laaneots, kaitseminister Jaak Aaviksoo ja mitu parlamendiliiget külastasid Vahemeres seilavat maailma esimest tuumajõu abil liikuvat lennukikandjat USS Enterprise. Vabariigi Presidendi visiit Ameerika Ühendriikide sõjalaevastiku lennukikandjale USS Enterprise
Riigijuhtide riskialdis õhulend / Oliver Rand
Rand, Oliver, 1971-
2007-01-01
President Toomas Hendrik Ilves, Riigikogu esimees Ene Ergma, kaitseminister Jaak Aaviksoo, kaitseväe juhataja Ants Laaneots, Riigikogu riigikaitsekomisjoni esimees Mati Raidma koos kaaskonnaga lendasid USA lennukikandjale USS Enterprise ühes lennukis. Riigi võtmeisikute üheskoos reisimisega kaasnevatest turvariskidest. Vt. samas: Mujal karmimad meetmed
Jaagant, Urmas
2009-01-01
Tšehhi firma Sans Souci ei suutnud Vabadussõja võidusamba ristiosa valgustust rahuldaval määral tööle saada. Uue valguslahenduse leidmiseks on kaitseminister Jaak Aaviksoo palunud algatada riigihanke. Vabadussamba autori Rainer Sternfeldi arvamus tšehhide kehva töö kohta
Pediatric and youth traffic-collision injuries in Al Ain, United Arab Emirates: a prospective study.
Grivna, Michal; Eid, Hani O; Abu-Zidan, Fikri M
2013-01-01
To study the mechanism of road traffic collisions (RTC), use of safety devices, and outcome of hospitalized pediatric and youth RTC injured patients so as to give recommendations regarding prevention of pediatric RTC injuries. All RTC injured children and youth (0-19-year-olds) who were admitted to Al Ain City's two major trauma centers or who died after arrival to these centers were prospectively studied from April 2006 to October 2007. Demography of patients, road-user and vehicle types, crash mechanism, usage of safety devices, injured body regions, injury severity, Revised Trauma Score, Glasgow Coma Scale, intensive care unit admissions, hospital stay and mortality were analyzed. 245 patients were studied, 69% were vehicle occupants, 15% pedestrians, 9% motorcyclists and 5% bicyclists. 79% were males and 67% UAE citizens. The most common mechanism of RTC was rollover of vehicle (37%) followed by front impact collision (32%). 32 (13%) of vehicle occupants were ejected from car. 63% of ejected occupants and 70% of motorcyclists sustained head injuries. Only 2% (3/170) vehicle passengers used seatbelts and 13% (3/23) motorcyclists a helmet. Male drivers and UAE nationals were at high risk of RTC as drivers and as motorcyclists. Ejection rate was high because safety restraint use was extremely low in our community. More education and law enforcement focusing especially on car/booster seat use is needed.
El-Fakharani, Abdelhamid; Hamimi, Zakaria
2013-04-01
Ain Shams area, Western Arabian Shield, Saudi Arabia, is occupied by four main rock units; gneisses, metavolcanics, metasediments and syn- to post-tectonic granitoids. Field and structural studies reveal that the area was subjected to at least three phases of deformation (D1, D2 and D3). The structural features of the D1 are represented by tight to isoclinal and intrafolial folds (F1), axial plane foliation (S1) and stretching lineations (L1). This phase is believed to be resulted from an early NW-SE contractional phase due to the amalgamation between Asir and Jeddah tectonic terranes. D2 deformation phase progressively overprinted D1 structures and was dominated by thrusts, minor and major F2 thrust-related overturned folds. These structures indicate a top-to-the-NW movement direction and compressional regime during the D2 phase. Emplacement of the syn-tectonic granitoids is likely to have occurred during this phase. D3 structures are manifested F3 folds, which are open with steep to subvertical axial planes and axes moderately to steeply plunging towards the E, ENE and ESE directions, L3 is represented by crenulation lineations and kink bands. These structures attest NE-SW contractional phase, concurrent with the accretion of the Arabian-Nubian Shield (ANS) to the Saharan Metacraton (SM) and the final assembly between the continental blocks of East and West Gondwana.
Aaviksoo võistleb Donald Trumpiga
2007-01-01
Peep Aaviksoole ja tema äripartneritele kuuluv IPC Investment tegeleb Rumeenias lisaks kinnisvarainvesteeringutele ka ehitusmaterjalide tootmisega. USA kinnisvaramagnaat Donald Trump on otsustanud riiki investeerida miljard eurot
Pediatric and youth traffic-collision injuries in Al Ain, United Arab Emirates: a prospective study.
Directory of Open Access Journals (Sweden)
Michal Grivna
Full Text Available AIM: To study the mechanism of road traffic collisions (RTC, use of safety devices, and outcome of hospitalized pediatric and youth RTC injured patients so as to give recommendations regarding prevention of pediatric RTC injuries. METHODS: All RTC injured children and youth (0-19-year-olds who were admitted to Al Ain City's two major trauma centers or who died after arrival to these centers were prospectively studied from April 2006 to October 2007. Demography of patients, road-user and vehicle types, crash mechanism, usage of safety devices, injured body regions, injury severity, Revised Trauma Score, Glasgow Coma Scale, intensive care unit admissions, hospital stay and mortality were analyzed. RESULTS: 245 patients were studied, 69% were vehicle occupants, 15% pedestrians, 9% motorcyclists and 5% bicyclists. 79% were males and 67% UAE citizens. The most common mechanism of RTC was rollover of vehicle (37% followed by front impact collision (32%. 32 (13% of vehicle occupants were ejected from car. 63% of ejected occupants and 70% of motorcyclists sustained head injuries. Only 2% (3/170 vehicle passengers used seatbelts and 13% (3/23 motorcyclists a helmet. CONCLUSIONS: Male drivers and UAE nationals were at high risk of RTC as drivers and as motorcyclists. Ejection rate was high because safety restraint use was extremely low in our community. More education and law enforcement focusing especially on car/booster seat use is needed.
Estonian living in safest of times / Ella Karapetyan
Karapetyan, Ella
2010-01-01
Peaminister Andrus Ansip ütles kevadisi riigikaitsekursuseid avades, et tema hinnangul elab Eesti julgeoleku seisukohalt oma ajaloo ilmselt kõige turvalisemat etappi, olles NATO ja Euroopa Liidu liige. Kursuste avamistseremooniast võtsid osa ka kaitseminister Jaak Aaviksoo, välisminister Urmas Paet, siseminister Marko Pomerants ja kaitseväe juhataja kindralleitnant Ants Laaneots
Varjamine: samba salalepingud tõid tšehhidele lisamiljoneid / Raimo Poom
Poom, Raimo
2010-01-01
Kaitseminister Jaak Aaviksoo ja Tšehhi klaasifirma sõlmisid 2009. a. lepingu muutmise lepingu koos paljude uute lisadega. Lepingu lisas nõudis kaitseminister kollase tooniga risti ringiosa paneelide väljavahetamist, kuid tookord teatas ministeerium, et paneelid vastavad esialgsel hinnangul kokkulepitule. Ministeeriumi avalike suhete osakonna juhataja Martin Jaško ja vandeadvokaat Martin Tamme selgitusi
Elamusi ujuvast linnast / Krister Kivi
Kivi, Krister, 1975-
2007-01-01
Reportaaž Eesti presidendi Toomas Hendrik Ilvese külaskäigust maailma pikimale ja maailma esimesele tuumajõul töötavale lennukikandjale USS Enterprise. Delegatsiooni kuulusid veel Riigikogu esimees Ene Ergma, kaitseväe juht Ants Laaneots, kaitseminister Jaak Aaviksoo, Riigikogu liikmed Sven Mikser ja Mati Raidma ning USA suursaadik Eestis Stanley Davis Phillips
Directory of Open Access Journals (Sweden)
Laura Rorato
2018-01-01
Full Text Available This article analyses the representation of the impact of migration on family dynamics in three autobiographical works: Laura Pariani’s Il piatto dell’angelo (2013, Mary Melfi’s Italy Revisited. Conversations with my Mother (2009, and Antonella Di Pietrantonio’s Mia madre è un fiume (2011. All three authors were directly or indirectly affected by the wave of emigration that took place in Italy between the end of the 19th century and the first half of the 20th century. Pariani extends her observations to the present by focusing also on those South American women who are currently moving to Italy to work as cares for old people, often leaving their families behind. Motherhood and mothering are central themes in all three books. These works problematise the patriarchal notion of motherhood and highlight the need to move towards alternative concepts of motherhood that do not imply the subordination of women. Additionally, this article offers a reflection on the role that creative writing can play in challenging some of the most engrained stereotypes, such as those of the good mother versus the bad mother, partially related to our Christian tradition. Building on Podnieks and O’Reilly’s notion of “maternal texts” (1-2, this article argues that through fiction women are less inhibited in exploring the thornier aspects of motherhood as a social construction than they seem to be in everyday life.
Piégay, H.; Hupp, C.R.; Citterio, A.; Dufour, S.; Moulin, B.; Walling, D.E.
2008-01-01
Floodplain development is associated with lateral accretion along stable channel geometry. Along shifting rivers, the floodplain sedimentation is more complex because of changes in channel position but also cutoff channel presence, which exhibit specific overflow patterns. In this contribution, the spatial and temporal variability of sedimentation rates in cutoff channel infill deposits is related to channel changes of a shifting gravel bed river (Ain River, France). The sedimentation rates estimated from dendrogeomorphic analysis are compared between and within 14 cutoff channel infills. Detailed analyses along a single channel infill are performed to assess changes in the sedimentation rates through time by analyzing activity profiles of the fallout radionuclides 137Cs and unsupported 210Pb. Sedimentation rates are also compared within the channel infills with rates in other plots located in the adjacent floodplain. Sedimentation rates range between 0.65 and 2.4 cm a−1 over a period of 10 to 40 years. The data provide additional information on the role of distance from the bank, overbank flow frequency, and channel geometry in controlling the sedimentation rate. Channel infills, lower than adjacent floodplains, exhibit higher sedimentation rates and convey overbank sediment farther away within the floodplain. Additionally, channel degradation, aggradation, and bank erosion, which reduce or increase the distance between the main channel and the cutoff channel aquatic zone, affect local overbank flow magnitude and frequency and therefore sedimentation rates, thereby creating a complex mosaic of sedimentation zones within the floodplain and along the cutoff channel infills. Last, the dendrogeomorphic and 137Cs approaches are cross validated for estimating the sedimentation rate within a channel infill.
MR imaging findings of anterior interosseous nerve lesions
Energy Technology Data Exchange (ETDEWEB)
Dunn, Andrew J. [Royal Liverpool University Hospital, Department of Medical Imaging, Liverpool (United Kingdom); Salonen, David C. [University of Toronto, Toronto Western Hospital, Department of Medical Imaging, Toronto, Ontario (Canada); Anastakis, Dimitri J. [University of Toronto, Toronto Western Hospital, Division of Plastic Surgery, Toronto, Ontario (Canada)
2007-12-15
To study and characterise the MR imaging findings of lesions of the anterior interosseous nerve (AIN). Magnetic resonance imaging (MRI) findings of the forearm of ten patients referred to our institution with suspected AIN lesions were retrospectively studied. Five healthy volunteers with normal forearm MRI findings formed a control group. Two musculoskeletal radiologists assessed the forearm musculature for oedema in the distribution of the AIN, median, posterior interosseous and radial nerves on T2-weighted (T2W) fat-saturated sequences. T1-weighted (T1W) images were assessed and graded for the presence of muscle atrophy and fatty involution. Six patients had undergone surgical exploration; five of these had surgically confirmed AIN compression. Four patients had diagnoses other than AIN compression made on imaging features. Of the cases of proven AIN compression, oedema within the pronator quadratus (PQ) muscle was identified in all cases. PQ atrophy and fatty involution were seen in three (43%) surgically confirmed cases. Cases 2 and 3 also demonstrated oedema in the flexor digitorum profundus (FDP)1 and FDP2 muscles. These cases also showed oedema in the flexor-carpi radialis (FCR) and FDP3/FDP4 muscles, respectively. The four cases of non-AIN compression demonstrated muscle oedema patterns that were atypical for the AIN distribution. They included a rupture of the flexor pollicis longus (FPL) tendon, brachial neuritis, amyotrophic lateral sclerosis and compression of the proximal median nerve. MRI is a useful investigation in the diagnostic workup of AIN syndrome. AIN syndrome is likely when there is diffuse oedema of AIN innervated muscles on T2W fat-saturated images. The most reliable sign of an AIN lesion is oedema within the PQ. Oedema in the flexor carpi radialis, FDP3 and FDP4, although not in the classical distribution of the AIN, does not preclude the diagnosis of AIN syndrome. (orig.)
MR imaging findings of anterior interosseous nerve lesions
International Nuclear Information System (INIS)
Dunn, Andrew J.; Salonen, David C.; Anastakis, Dimitri J.
2007-01-01
To study and characterise the MR imaging findings of lesions of the anterior interosseous nerve (AIN). Magnetic resonance imaging (MRI) findings of the forearm of ten patients referred to our institution with suspected AIN lesions were retrospectively studied. Five healthy volunteers with normal forearm MRI findings formed a control group. Two musculoskeletal radiologists assessed the forearm musculature for oedema in the distribution of the AIN, median, posterior interosseous and radial nerves on T2-weighted (T2W) fat-saturated sequences. T1-weighted (T1W) images were assessed and graded for the presence of muscle atrophy and fatty involution. Six patients had undergone surgical exploration; five of these had surgically confirmed AIN compression. Four patients had diagnoses other than AIN compression made on imaging features. Of the cases of proven AIN compression, oedema within the pronator quadratus (PQ) muscle was identified in all cases. PQ atrophy and fatty involution were seen in three (43%) surgically confirmed cases. Cases 2 and 3 also demonstrated oedema in the flexor digitorum profundus (FDP)1 and FDP2 muscles. These cases also showed oedema in the flexor-carpi radialis (FCR) and FDP3/FDP4 muscles, respectively. The four cases of non-AIN compression demonstrated muscle oedema patterns that were atypical for the AIN distribution. They included a rupture of the flexor pollicis longus (FPL) tendon, brachial neuritis, amyotrophic lateral sclerosis and compression of the proximal median nerve. MRI is a useful investigation in the diagnostic workup of AIN syndrome. AIN syndrome is likely when there is diffuse oedema of AIN innervated muscles on T2W fat-saturated images. The most reliable sign of an AIN lesion is oedema within the PQ. Oedema in the flexor carpi radialis, FDP3 and FDP4, although not in the classical distribution of the AIN, does not preclude the diagnosis of AIN syndrome. (orig.)
Directory of Open Access Journals (Sweden)
Katre Talviste
2013-12-01
Full Text Available This article positions the translations of French verse works (plays and selected collections of individual poets that August Sang, Jaan Kross and Ain Kaalep made in the 1960s, onto the background of their own original works. At that time, August Sang translated four plays by Molière (The Misanthrope, Tartuffe, The School for Wives in 1961; Amphitryon in 1961, which have already been discussed in relation to the tradition of translating the French syllabic verse into Estonian, because these translations form a considerable part of the body of Estonian translations of French verse poetry. For Jaan Kross and Ain Kaalep, the wider context is created by the so-called free verse battles in the 1950s, to which we can link Kross’ translation of a selected collection of Éluard (Veel enne kostma peab, 1969 and Kaalep’s translation of a selected collection of Prévert (Kuidas portreteerida lindu, 1965. One of the two remaining translations by Kross, (Rostand’s Cyrano de Bergerac, 1964, can also be examined in relation to the problems of translating verse, but the other, (Béranger’s Laulud, 1963, should be discussed in the framework of intellectual and cultural resistance, a part of which was also the struggle put up for the existence of free verse in the 1950s and 1960s. Of August Sang’s original work, the article examines his collection of poems Võileib suudlusega (1963, written simultaneously with his translations of Molière’s plays and published right after them. Both the translations and the collection of original poems have attracted critics’ attention with their remarkable lack of linguistic constraint and simplicity. Although Sang has rarely voiced theoretical ideas about translation or explained his method, both his poetic image, outlined in the collection Võileib suudlusega, and his search for right words, reflected in the drafts of his translations, let us believe that the simplicity of expression and the avoidance of marked
NATO "röövib" Eestilt kogu jõueliidi / Tuuli Koch
Koch, Tuuli
2008-01-01
Bukarestis toimuvatel NATO tippkohtumisega seotud üritustel esindavad Eestit president Toomas Hendrik Ilves, peaminister Andrus Ansip, välisminister Urmas Paet, kaitseminister Jaak Aaviksoo ja kaitseväe juhataja kindralmajor Ants Laaneots. Poliitikute päevakavast. President T. H. Ilves esineb NATO temaatikaga tegelevate noorteorganisatsioonide esindajate konverentsil ning mõttekoja German Marshall Fund korraldataval konverentsil "The Bucharest Conference". Vabariigi President töövisiidil Bukarestis 1.-3.04.2008
Biokeemilised kõnelused katseklaasis / Laura Herm ; Herm, Laura; Rinken, Ago
Herm, Laura
2007-01-01
Artiklis räägitakse suhtlemise biokeemiast, sellistest biokeemilistest kõnelustest, mida peavad meid moodustavad närvirakud omavahel ja iseeneste sees, ning mida oma katseklaasides uurivad Tartu Ülikooli keemia instituudi bioorgaanilise keemia õppetooli õppurid ja teadurid
Overcoming Endocrine Resistance by Targeting ER/FoxA1/IL-8 Axis
2015-10-01
Creighton, Fugen Li, Martin Shea, Agostina Nardone, Tao Wang, Laura M. Heiser , Pavana Anur, Nicholas Wang, Catie Grasso, Paul Spellman, Carolina...Xiaoyong Fu, Rinath Jeselsohn, Resel Pereira, Emporia F. Hollingsworth, Chad J. Creighton, Fugen Li, Martin Shea, Agostina Nardone, Laura M. Heiser , Pavana...Rinath Jeselsohn, Emporia F. Hollingsworth, Dolores Lopez-Terrada, Chad J. Creighton, Agostina Nardone, Martin Shea, Laura M. Heiser , Pavana Anur
International Nuclear Information System (INIS)
Yohannan, Jinu P.; Vidyasagar, Kanamaluru
2016-01-01
Ten AInM′S 4 (A=alkali metals, Tl; M′= Ge, Sn) compounds with diverse structure types have been synthesized and characterized by single crystal and powder X-ray diffraction and a variety of spectroscopic methods. They are wide band gap semiconductors. KInGeS 4 (1-β), RbInGeS 4 (2), CsInGeS 4 (3-β), TlInGeS 4 (4-β), RbInSnS 4 (8-β) and CsInSnS 4 (9) compounds with three-dimensional BaGa 2 S 4 structure and CsInGeS 4 (3-α) and TlInGeS 4 (4-α) compounds with a layered TlInSiS 4 structure have tetrahedral [InM′S 4 ] − frameworks. On the other hand, LiInSnS 4 (5) with spinel structure and NaInSnS 4 (6), KInSnS 4 (7), RbInSnS 4 (8-α) and TlInSnS 4 (10) compounds with layered structure have octahedral [InM′S 4 ] − frameworks. NaInSnS 4 (6) and KInSnS 4 (7) compounds undergo facile topotactic ion-exchange, at room temperature, with various mono-, di- and tri-valent cations in aqueous medium to give rise to metastable layered phases. - Graphical abstract: NaInSnS 4 and KInSnS 4 compounds undergo, in aqueous medium at room temperature, facile topotactic ion-exchange with mono, di and trivalent cations. Display Omitted - Highlights: • Ten AInM′S 4 compounds with diverse structure types were synthesized. • They are wide band gap semiconductors. • NaInSnS 4 and KInSnS 4 compounds undergo facile topotactic ion-exchange at room temperature.
Energy Technology Data Exchange (ETDEWEB)
Qi-Chu Zhang [The University of Sydney (Australia). School of Physics; Shen, Y.G. [City University of Hong Kong (Hong Kong). Department of Manufacturing Engineering and Engineering Management
2004-01-25
High solar performance W-AIN cermet solar coatings were designed using a numerical computer model and deposited experimentally. In the numerical calculations aluminium oxynitride (AlON) was used as ceramic component. The dielectric functions and then complex refractive index of W-AlON cermet materials were calculated using the Sheng's approximation. The layer thickness and W metal volume fraction were optimised to achieve maximum photo-thermal conversion efficiency for W-AlON cermet solar coatings on an Al reflector with a surface AlON ceramic anti-reflection layer. Optimisation calculations show that the W-AlON cermet solar coatings with two and three cermet layers have nearly identical solar absorptance, emittance and photo-thermal conversion efficiency that are much better than those for films with one cermet layer. The optimised calculated AlON/W-AlON/Al solar coating film with two cermet layers has a high solar absorptance of 0.953 and a low hemispherical emittance of 0.051 at 80{sup o}C for a concentration factor of 2. The AlN/W-AlN/Al solar selective coatings with two cermet layers were deposited using two metal target direct current magnetron sputtering technology. During the deposition of W-AlN cermet layer, both Al and W targets were run simultaneously in a gas mixture of argon and nitrogen. By substrate rotation a multi-sub-layer system consisting of alternating AlN ceramic and W metallic sub-layers was deposited that can be considered as a macro-homogeneous W-AlN cermet layer. A solar absorptance of 0.955 and nearly normal emittance of 0.056 at 80{sup o}C have been achieved for deposited W-AlN cermet solar coatings. (author)
Anna Pantelia
2013-01-01
18 octobre 2013 - Le Préfet de l’Ain L. Touvet signe le livre d'or avec le Directeur général du CERN R. Heuer et le Chef du Département Technologie F. Bordry. Photo de groupe, de gauche à droite: T. Kupisz,\tSecrétaire général de la sous préfecture de Gex; L. Miralles, Chef du Département Infrastructure et services généraux; F. Eder, Délégué aux Relations avec les Etats hôtes; S. Donnot, Sous-préfet de Gex; L. Touvet, Préfet de l'Ain; E. Sches, Sous-préfète de Nantua; E.Gröniger-Voss, Conseiller juridique du CERN; R. Heuer, Directeur général; F. Bordry, Chef du Département Technologie et P. Bloch, Chef du Département Physique.
Directory of Open Access Journals (Sweden)
Μαρίνα ΚΟΥΜΑΝΟΥΔΗ
2012-03-01
Full Text Available Βιβλιοκρισία του: Martin da Canal, Les Estoires de Venise, αγγλική μετάφραση, εισαγωγή και σχόλια LAURA K. MORREALE [Archivio del Litorale Adriatico XII], Padova 2009, σσ. xxii + 175 [ΙSBN 978-88-8098-267-8].
African Journals Online (AJOL)
Professor of Genetics (Cytogenetics), Faculty of Medicine, Ain Shams University, Cairo, Egypt. Hosam A Abdel-Ghany. Consultant of Medical Human Genetics, Medical Genetic Center, Ain Shams University, Cairo, Egypt. Nermin S Elsayed. Consultant of Medical Human Genetics, Medical Genetics Center, Ain Shams ...
Directory of Open Access Journals (Sweden)
Issam Sellika
2016-10-01
Full Text Available Au Maroc, l’utilisation des eaux souterraines pour l’irrigation a permis un développement agricole rapide dans de nombreuses régions, mais a aussi fait émerger des situations de baisse des niveaux piezométriques des nappes qui menacent la durabilité de cette agriculture irriguée. L’article présente une action de recherche portant sur la conception d’un projet de territoire agricole durable alliant développement agricole et usage pérenne des ressources en eau souterraine. L’étude a eu lieu dans la zone d’Ain Timguenay (province de Séfrou, qui connait un fort développement de la production de pommes et de prunes depuis une quinzaine d’années. Le programme de recherche a impliqué les agriculteurs, la commune rurale d’Ain Timguenay, les institutions du Ministère de l’Agriculture et l’Agence de bassin hydraulique du Sébou. Une analyse des dynamiques agricoles locales et des tendances nationales a servi de support aux discussions. L’étude de l’aquifère et de ses usages a permis d’établir un bilan sommaire et un ordre de grandeur des surfaces qui pourraient encore être plantées sans que les consommations en eau soient supérieures à la recharge de l’aquifère en année pluviométrique moyenne. Une réflexion prospective menée avec les agriculteurs a mis en évidence deux scénarios possibles à l’échelle locale: 1 un scénario où les difficultés économiques que rencontrent actuellement les exploitations de la zone se renforcent, conduisant à un ralentissement des nouvelles plantations, d’où une pression limitée sur la nappe ; 2 un scénario où les exploitations réussissent à faire face aux défis actuels de production et de commercialisation et de ce fait continuent à planter, ce qui conduit à une consommation en eau bien supérieure à la recharge de la nappe. L’ensemble des acteurs impliqués a participé à l’élaboration d’un troisième scénario permettant de concilier d
HIV/AIDS misconceptions may be associated with condom use ...
African Journals Online (AJOL)
HIV/AIDS misconceptions may be associated with condom use among black South Africans: an exploratory analysis. Laura M Bogart, Donald Skinner, Lance S Weinhardt, Laura Glasman, Cheryl Sitzler, Yoesrie Toefy, Seth C Kalichman ...
Lee, Su Young; Kim, Sang Ho
2014-12-01
The purpose of this study is to investigate the friction and wear behaviors of CrN, TiN, CrAlN, and TiAIN coated onto SKD61 for application to Al 7000 series extrusion dies. On the wear test, the experimental parameters are the load and the counter material's temperature. The results showed that the friction coefficient increased with load but decreased with the counter material's temperature, and the friction coefficients of CrN and CrAIN were lower than the friction coefficients of TiAIN and TIN, especially at a higher temperature. The wear track with different coatings identified different wear behaviors; the wear behavior of CrAIN was found to be abrasive, but the wear behavior of TiN, CrN, and TiAIN was adhesive. Therefore, CrAIN showed the least wear loss with a lower friction coefficient and less adhesion with counter materials at the highest range of wear load and temperature. This resulted in the easy formation of aluminum oxide in the wear track and less Al adhesion; moreover during the hard second phase, AIN dispersed in the film during deposition.
Allergic Interstitial Nephritis Manifesting as a Striated Nephrogram
Directory of Open Access Journals (Sweden)
Irfan Moinuddin
2015-01-01
Full Text Available Allergic interstitial nephritis (AIN is an underdiagnosed cause of acute kidney injury (AKI. Guidelines suggest that AIN should be suspected in a patient who presents with an elevated serum creatinine and a urinalysis that shows white cells, white cell casts, or eosinophiluria. Drug-induced AIN is suspected if AKI is temporally related to the initiation of a new drug. However, patients with bland sediment and normal urinalysis can also have AIN. Currently, a definitive diagnosis of AIN is made by renal biopsy which is invasive and fraught with risks such as bleeding, infection, and hematoma. Additionally, it is frequently unclear when a kidney biopsy should be undertaken. We describe a biopsy proven case of allergic interstitial nephritis which manifested on contrast enhanced Magnetic Resonance Imaging (MRI as a striated nephrogram. Newer and more stable macrocyclic gadolinium contrast agents have a well-demonstrated safety profile. Additionally, in the presentation of AKI, gadolinium contrast agents are safe to administer in patients who demonstrate good urine output and a downtrending creatinine. We propose that the differential for a striated nephrogram may include AIN. In cases in which the suspicion for AIN is high, this diagnostic consideration may be further characterized by contrast enhanced MRI.
Risk Factors for the presence of anal intraepithelial neoplasia in HIV+ men who have sex with men
Richel, Olivier; de Vries, Henry J. C.; Dijkgraaf, Marcel G. W.; van Noesel, Carel J. M.; Prins, Jan M.
2013-01-01
Anal Intraepithelial Neoplasia (AIN) is present in the majority of HIV+ men who have sex with men (MSM) and routine AIN-screening is subject of discussion. In this study we analysed a wide range of potential risk factors for AIN in order to target screening programs. We screened 311 HIV+ MSM by high
Anterior interosseous nerve syndrome diagnosis and intraoperative findings: A case report
Directory of Open Access Journals (Sweden)
Abdulla Aljawder
2016-01-01
Conclusion: Clinical suspicion should arise in the presence of isolated paralysis of the AIN-supplied muscles. MRI and electrodiagnostic studies will confirm the diagnosis and identify the etiology. The optimal treatment of AIN syndrome has not been established. We recommend surgical intervention in confirmed AIN syndrome from compression neuropathy, refractive to conservative therapy.
Eesti väärib paremat / Jaak Aaviksoo
Aaviksoo, Jaak, 1954-
2006-01-01
Ilmunud ka: Virumaa Teataja, Põhjarannik, Severnoje Poberezhje, Meie Maa, Vooremaa 3. okt. lk. 11,2,2,2,2, Sakala, Pärnu Postimees, Sõnumitooja 4. okt. lk. 2,15,2, Lõunaleht 5. okt. lk. 2, Kuulutaja, Vali Uudised 6. okt. lk. 6,2, Järva Teataja 7. okt. lk. 2. Autori sõnul on Eestis tajutav usalduskriis, mille põhjuseks on eetiliste piiride kadumine meie poliitilistest otsustest. Ta toob välja kolm arenguprioriteeti riigi edasiseks arenguks
Giusti, Christian; Louchet, André; Beuzen-Waller, Tara; Ragala, Rachid; Pavlopoulos, Kosmas; Fouache, Éric; Cohen, Marianne; Desruelles, Stéphane; Gramond, Delphine
2015-04-01
human settlements and occupation, it is possible to characterize a threefold transition: first, the former transition between the pre-Islamic prehistoric societies and the development of Muslim societies; second, the more recent transition between the traditional historical society (farmers) and the contemporary society, characterized by the growth of urbanization, the creation of modern transport infrastructure and the concomitant growth of tourist flows; third, the current transition between the yesterday and tomorrow Al Ain City, due to the transformation of a local town centred on national economics all along the second half of the twentieth century, into an international town more open to the wider world with the management of a possible increased 20 % of tourist flow because of the inscription of Cultural Sites of Al Ain on the UNESCO's World Heritage List. It is not possible to completely ignore the fact that the Jebel Hafit and its foothills are partly crossed by an international boundary. In case of political tensions, this may cause some difficulties for the management of this territory, with contradictory requirements between security, tourism, traditional land use, and scientific research.
Acute interstitial nephritis with acetaminophen and alcohol intoxication
Directory of Open Access Journals (Sweden)
Alexopoulou Iakovina
2011-04-01
Full Text Available Abstract Drug-induced acute interstitial nephritis (AIN represents a growing cause of renal failure in current medical practice. While antimicrobials and non-steroidal anti-inflammatory drugs are typically associated with drug-induced AIN, few reports have been made on the involvement of other analgesics. We report our experience in managing a 17-year-old female with AIN and subsequent renal injury following an acetaminophen overdose in conjunction with acute alcohol intoxication. It is well established that acetaminophen metabolism, particularly at high doses, produces reactive metabolites that may induce renal and hepatic toxicity. It is also plausible however, that such reactive species could instead alter renal peptide immunogenicity, thereby inducing AIN. In the following report, we review a possible mechanism for the acetaminophen-induced AIN observed in our patient and also discuss the potential involvement of acute alcohol ingestion in disease onset. The objective of our report is to increase awareness of healthcare professionals to the potential involvement of these commonly used agents in AIN pathogenesis.
PÖFFil esilinastub animafilm "Kärbeste veski" / Eva Samolberg
Samolberg, Eva
2011-01-01
PÖFFi raames toimuval 15. animafilmide festivalil Animated Dreams esilinastub Eesti Kunstiakadeemia animatsiooniosakonna magistrandi Anu-Laura Tuttelbergi lõputöö - animafilm "Kärbeste veski". Tallinna Ülikooli Akadeemilises raamatukogus on avatud Anu-Laura Tuttelbergi esilinastuva nukufilmi dekoratsioonide ja nukkude näitus
Energy Technology Data Exchange (ETDEWEB)
Yohannan, Jinu P.; Vidyasagar, Kanamaluru, E-mail: kvsagar@iitm.ac.in
2016-06-15
Ten AInM′S{sub 4} (A=alkali metals, Tl; M′= Ge, Sn) compounds with diverse structure types have been synthesized and characterized by single crystal and powder X-ray diffraction and a variety of spectroscopic methods. They are wide band gap semiconductors. KInGeS{sub 4}(1-β), RbInGeS{sub 4}(2), CsInGeS{sub 4}(3-β), TlInGeS{sub 4}(4-β), RbInSnS{sub 4}(8-β) and CsInSnS{sub 4}(9) compounds with three-dimensional BaGa{sub 2}S{sub 4} structure and CsInGeS{sub 4}(3-α) and TlInGeS{sub 4}(4-α) compounds with a layered TlInSiS{sub 4} structure have tetrahedral [InM′S{sub 4}]{sup −} frameworks. On the other hand, LiInSnS{sub 4}(5) with spinel structure and NaInSnS{sub 4}(6), KInSnS{sub 4}(7), RbInSnS{sub 4}(8-α) and TlInSnS{sub 4}(10) compounds with layered structure have octahedral [InM′S{sub 4}]{sup −} frameworks. NaInSnS{sub 4}(6) and KInSnS{sub 4}(7) compounds undergo facile topotactic ion-exchange, at room temperature, with various mono-, di- and tri-valent cations in aqueous medium to give rise to metastable layered phases. - Graphical abstract: NaInSnS{sub 4} and KInSnS{sub 4} compounds undergo, in aqueous medium at room temperature, facile topotactic ion-exchange with mono, di and trivalent cations. Display Omitted - Highlights: • Ten AInM′S{sub 4} compounds with diverse structure types were synthesized. • They are wide band gap semiconductors. • NaInSnS{sub 4} and KInSnS{sub 4} compounds undergo facile topotactic ion-exchange at room temperature.
Berreur, B; Guerin, F; Christophe, B; Limido, G; Paubel, P
2018-01-01
To evaluate the economic impact of future prescriptions of etanercept and adalimumab biosimilars at the territorial scale covered by PharmAlp'Ain, a hospitals grouping of orders for health products. Determination of the number and status of patients (naive or in continuation of treatment) from the National Database "Datamart de Consommation Inter-Régimes" of health insurance, concerned by a dispensation in a pharmacy of etanercept or adalimumab in 2015. Calculation of potential savings in case of biosimilar requirements according to 3 hypotheses: 63% (rate observed in a previous study) of initiations are treated with biosimiliaries and the others by princeps (H 1 ); all initiations under biosimilars and continuation therapy with the princeps (H 2 ) or all patients are treated with biosimilars (H 3 ). The annual savings are estimated at 237,000 € with the H 1 hypothesis. In the case of H 2 , the expected savings would be 376,200 € per year. In the case of H 3 , savings for the community could reach almost 1,282,800 € per year. The arrival of biosimilars allows significant savings for medicines market. According to the French recommendations in 2016, the expected savings are between the H 1 and H 2 hypothesis. The rate of penetration of biosimilars depends on many factors such as the involvement of health professionals, patient adherence, or health authority recommendations. Copyright © 2017 Académie Nationale de Pharmacie. Published by Elsevier Masson SAS. All rights reserved.
LENUS (Irish Health Repository)
Garvey, J P
2009-11-01
Acute interstitial nephritis (AIN) secondary to trimethoprim-sulfamethoxazole (TMP-SMX) is well documented as a cause of acute renal failure in native kidneys. TMP-SMX is the standard prophylactic agent against pneumocystis carinii (PCP) used in the early post-transplant period, however, it has to date only been indirectly associated with AIN in renal allografts. DESIGN, SETTING, PARTICIPANTS AND MEASUREMENTS: We describe eleven renal transplant patients with acute allograft dysfunction in whom a transplant biopsy demonstrated primary histopathologic features of allergic AIN, all of whom were receiving TMP-SMX in addition to other medications known to cause AIN.
DEFF Research Database (Denmark)
svendsen, erik
2010-01-01
refleksioner over filmteoretiske tekster af Benjamin, John Ellis, , Todd McGowan, Barbara Klinger, Laura Mulvej og Slavoj Zizek Udgivelsesdato: 09-06-10......refleksioner over filmteoretiske tekster af Benjamin, John Ellis, , Todd McGowan, Barbara Klinger, Laura Mulvej og Slavoj Zizek Udgivelsesdato: 09-06-10...
Non-native acylated homoserine lactones reveal that LuxIR quorum sensing promotes symbiont stability
Ho, Jessica S.; Geske, Grant D.; Blackwell, Helen E.; Ruby, Edward G.
2014-01-01
SUMMARY Quorum sensing, a group behavior coordinated by a diffusible pheromone signal and a cognate receptor, is typical of bacteria that form symbioses with plants and animals. LuxIR-type acyl homoserine-lactone (AHL) quorum sensing is common in Gram-negative proteobacteria, and many members of this group have additional quorum-sensing networks. The bioluminescent symbiont Vibrio fischeri encodes two AHL signal synthases: AinS and LuxI. AinS-dependent quorum sensing converges with LuxI-dependent quorum sensing at the LuxR regulatory element. Both AinS- and LuxI-mediated signaling are required for efficient and persistent colonization of the squid host, Euprymna scolopes. The basis of the mutualism is symbiont bioluminescence, which is regulated by both LuxI- and AinS-dependent quorum sensing, and is essential for maintaining a colonization of the host. Here, we used chemical and genetic approaches to probe the dynamics of LuxI- and AinS-mediated regulation of bioluminescence during symbiosis. We demonstrate that both native AHLs and non-native AHL analogs can be used to non-invasively and specifically modulate induction of symbiotic bioluminescence via LuxI-dependent quorum sensing. Our data suggest that the first day of colonization, during which symbiont bioluminescence is induced by LuxIR, is a critical period that determines the stability of the V. fischeri population once symbiosis is established. PMID:24191970
Cleary, Michelle; Horsfall, Jan; O'Hara-Aarons, Maureen; Mannix, Judy; Jackson, Debra; Hunt, Glenn E
2012-04-01
Undergraduate nurses are employed as assistants in nursing (AIN) in inpatient mental health settings; however, there is a paucity of published research exploring registered nurses' (RN) views about the AIN role in these settings. This qualitative study documents the views and experiences of RN working with undergraduate AIN. Fifty structured face-to-face interviews were analysed, and the results are discussed in three sections. The first section outlines RN perceptions of qualities and skills required of AIN in mental health, and the responses primarily focus on communication skills, initiative, and willingness to learn. The second section targets factors in the workplace that might enhance the interest of AIN in a mental health nursing career; the responses emphasize their need to work with experienced staff. The last section outlines RN expectations of AIN, most of which are met and involve physical observations and technical tasks; less fulfilled activities primarily cluster around interactions with patients. Findings highlight the advantages and disadvantages of drawing on undergraduate nursing students as AIN in mental health settings. Communication skills, personal initiative, safety training to prevent violence, and education to increase knowledge and awareness about mental illness, diagnosis, and mental status-related skills were all important concerns articulated by RN. © 2011 The Authors. International Journal of Mental Health Nursing © 2011 Australian College of Mental Health Nurses Inc.
Research Biologist with the EPA. Her current work involves linking natural and built infrastructure to human health and well-being at multiple spatial scales, in order to develop interpretive maps and analytical tools for an interactive, web-based Atlas.
Economic Analysis of National Nuclear Security Administration (NNSA) Modernization Alternatives
2007-11-01
S. Helwig Rob Mahoney Joshua A. Minix David J. Nicholls Paul H. Richanbach Robert W. Thomas Laura M. Williams Approved for public release...Helwig Rob Mahoney Joshua A. Minix David J. Nicholls Paul H. Richanbach Robert W. Thomas Laura M. Williams iii PREFACE The Institute for Defense
African Journal of AIDS Research - Vol 10, No 2 (2011)
African Journals Online (AJOL)
HIV/AIDS misconceptions may be associated with condom use among black South Africans: an exploratory analysis · EMAIL FULL TEXT EMAIL FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. Laura M Bogart, Donald Skinner, Lance S Weinhardt, Laura Glasman, Cheryl Sitzler, Yoesrie Toefy, Seth C ...
2012-04-04
...: Direct all written comments to Laura Bloodgood, Project Leader, U.S. International Trade Commission, 500... leader Laura Bloodgood ( [email protected] or 202-708-4726) or deputy project leader Andrea Boron..., volume, and value of, and foreign markets of significance for, exports of used electronic products from...
Azab, Sonya M S; Hirshon, Jon Mark; Hirshon, John Mark; Hayes, Bryan D; El-Setouhy, Maged; Smith, Gordon S; Sakr, Mahmoud Lotfy; Tawfik, Hany; Klein-Schwartz, Wendy
2016-01-01
Pediatric poisonings represent a major and preventable cause of morbidity and mortality throughout the world. Epidemiologic information about poisoning among children in many lower- and middle-income countries is scarce. This study describes the epidemiology of acute poisonings in children presenting to Ain Shams University's Poisoning Treatment Center (ASU-PTC) in Cairo and determines the causative agents and characteristics of acute poisoning in several pediatric age groups. This retrospective study involved acutely poisoned patients, 0-18 years of age, who presented to the ASU-PTC between 1 January 2009 and 31 December 2013. Data were extracted from electronic records maintained by the ASU-PTC. Collected data included demographics, substance of exposure, circumstances of the poisoning, patient disposition, and outcome. During the 5-year study period, 38 470 patients meeting our criteria were treated by the ASU-PTC; 19 987 (52%) were younger than 6 years of age; 4196 (11%) were 6-12 years; and 14 287 (37%) were >12 years. Unintentional poisoning accounted for 68.5% of the ingestions, though among adolescents 84.1% of ingestions were with self-harm intent. In all age groups, the most frequent causative drugs were non-opioid analgesics, antipyretics, and antirheumatics. The most common nonpharmaceutical agents were corrosives in preschool children and pesticides in adolescents. Most patients had no/minor effects (29 174 [75.8%]); hospitalization rates were highest among adolescents. There were 119 deaths (case fatality rate of 0.3), primarily from pesticide ingestion. Poisoning in preschool children is mainly unintentional and commonly due to nonpharmaceutical agents whereas poisoning in adolescents is mainly intentional (self-harm). Pesticides, mainly organophosphorous compounds and carbamates, were the most frequent agents leading to morbidity and mortality.
Directory of Open Access Journals (Sweden)
Ahmad Saleh Al Khatib
2014-05-01
Full Text Available The objective of the present study was to investigate the relationship between time management, perceived stress, gender and academic achievement among United Arab Emirates college students. The respondents were 352 college students from Al Ain University of Science and Technology. The sample was stratified by sex. Among the respondents, 52.5% were female students and 47.5% were male students. The mean age of the sample was 23.4 years ranging from 18 to 39. Time management was measured by Time Management Questionnaire” developed by Britton and Tesser (1991, while perceived stress was measured by The Perceived Stress Scale developed by Cohen (1985. The findings of the study showed that there was statistically significant negative relationship between time management and perceived stress. Females reported higher time management compared to their males counter mates. Higher time management and lower perceived stress were associated with high levels of academic achievement. However, time management was the most significant predictor of academic achievement accounting for 26 % of the variance while perceived stress accounted for an additional 11.2% of the variance in academic achievement. All three predictors explained 29.4% (R = .543 of total variance. The implications and limitations are reviewed as are the suggestions for future research. Keywords: Time management, perceived stress, academic achievement, college students.
Zeng, Huawei; Ishaq, Suzanne L; Liu, Zhenhua; Bukowski, Michael R
2018-04-01
The increasing worldwide incidence of colon cancer has been linked to obesity and consumption of a high-fat Western diet. To test the hypothesis that a high-fat diet (HFD) promotes colonic aberrant crypt (AC) formation in a manner associated with gut bacterial dysbiosis, we examined the susceptibility to azoxymethane (AOM)-induced colonic AC and microbiome composition in C57/BL6 mice fed a modified AIN93G diet (AIN, 16% fat, energy) or an HFD (45% fat, energy) for 14 weeks. Mice receiving the HFD exhibited increased plasma leptin, body weight, body fat composition and inflammatory cell infiltration in the ileum compared with those in the AIN group. Consistent with the gut inflammatory phenotype, we observed an increase in colonic AC, plasma interleukin-6, tumor necrosis factor-α, monocyte chemoattractant protein-1 and inducible nitric oxide synthase in the ileum of the HFD-AOM group compared with the AIN-AOM group. Although the HFD and AIN groups did not differ in bacterial species number, the HFD and AIN diets resulted in different bacterial community structures in the colon. The abundance of certain short-chain fatty acid (SCFA) producing bacteria (e.g., Barnesiella) and fecal SCFA (e.g., acetic acid) content were lower in the HFD-AOM group compared with the AIN and AIN-AOM groups. Furthermore, we identified a high abundance of Anaeroplasma bacteria, an opportunistic pathogen in the HFD-AOM group. Collectively, we demonstrate that an HFD promotes AC formation concurrent with an increase of opportunistic pathogenic bacteria in the colon of C57BL/6 mice. Published by Elsevier Inc.
"Kurja lillede" kuus ärakeelatud luuletust / Charles Baudelaire ; saatesõna: Marek Tamm
Baudelaire, Charles
2000-01-01
Sisu: Kalliskivid / tlk. Ain Kaalep ; Lethe / tlk. Märt Väljataga ; Temale, kes on liiga rõõmus / tlk. Ain Kaalep ; Lesbos / tlk. Ilmar Laaban ; Äraneetud naised (Delphine ja Hyppolyte) / tlk. Ain Kaalep ; Vampiiri metamorfoosid / tlk. August Sang. Orig.: Les Bijoux ; Le Léthé ; A celle qui est trop gaie ; Lesbos ; Femmes damnées. Delphine et Hippolyte ; Les Métamorphoses du vampire
Fractal dimension and image statistics of anal intraepithelial neoplasia
International Nuclear Information System (INIS)
Ahammer, H.; Kroepfl, J.M.; Hackl, Ch.; Sedivy, R.
2011-01-01
Research Highlights: → Human papillomaviruses cause anal intraepithelial neoplasia (AIN). → Digital image processing was carried out to classify the grades of AIN quantitatively. → The fractal dimension as well as grey value statistics was calculated. → Higher grades of AIN yielded higher values of the fractal dimension. → An automatic detection system is feasible. - Abstract: It is well known that human papillomaviruses (HPV) induce a variety of tumorous lesions of the skin. HPV-subtypes also cause premalignant lesions which are termed anal intraepithelial neoplasia (AIN). The clinical classification of AIN is of growing interest in clinical practice, due to increasing HPV infection rates throughout human population. The common classification approach is based on subjective inspections of histological slices of anal tissues with all the drawbacks of depending on the status and individual variances of the trained pathologists. Therefore, a nonlinear quantitative classification method including the calculation of the fractal dimension and first order as well as second order image statistical parameters was developed. The absolute values of these quantitative parameters reflected the distinct grades of AIN very well. The quantitative approach has the potential to decrease classification errors significantly and it could be used as a widely applied screening technique.
International Nuclear Information System (INIS)
Kleinman, L.E.; Maloberti, A.L.; Gayone, M.R.; Kaufmann, C.; Sruoga, P.
2013-01-01
Radiometric surveys are a rapid tool to measure uranium (U), thorium (Th) and potassium (K) concentrations in rocks and are very useful in the exploration for radioactive minerals. The distribution of uranium in Jurassic volcanic rocks of the province of Santa Cruz is evaluated in this work using ground gamma-ray spectrometry and rock geochemistry in order to assess its potential to form uranium deposits. Five areas were selected, which had some previous data of high radiometric values and detailed geological information. Measurements were carried out with a portable gamma-ray spectrometer (Exploranium-GR 320®) in andesites, ignimbrites, rhyolites, silicified areas, ash-fall tuffs and lacustrine sediments corresponding to the Bahía Laura and to El Quemado complexes. The results were similar in the five surveyed areas: radiometric concentrations show good positive correlations with chemical composition of the studied rocks for both K and Th, and a relatively poorer correlation for U. Different processes such as magmatic differentiation, vapor phase crystallization, hydrothermal alteration and supergene alteration are reflected in the distribution of these elements. U concentrations increase in the more glassy rocks, in areas with hydrothermal silicification, and in fracture zones, features that should be considered in future surveys. The calkalkaline composition and arc-signatures of the Jurassic magmatism are not the most favorable for uranium enrichment and for concentration of significant mineralizations. However, the extensional tectonic setting; the occurrence of calderas with facies slightly enriched in U and Th, in addition to hydrothermal activity are positive factors for U exploration. (authors) [es
Directory of Open Access Journals (Sweden)
Saula Goulart Chaud
2007-06-01
Full Text Available Os índices séricos de glicose e lipídios, a microbiota intestinal e a produção de ácidos graxos voláteis de cadeias curtas (AGV foram determinados em ratos Wistar submetidos às dietas: padrão (AIN-P, padrão modificada (AIN-M e às dietas contendo frações de parede celular de levedura: glicana insolúvel (GI, manana (M e glicana mais manana (G+M, como única fonte de fibra alimentar. O fracionamento da parede celular (PC foi realizado por processos físicos e químicos de extração, centrifugação e secagem em "spray dryer". Os índices séricos foram dosados através de "kits" comerciais. A microbiota e a produção de AGV foram determinadas nos conteúdos intestinais, incluindo cólon, ceco e reto. Considerando os níveis de colesterol no tempo (T0 e no tempo 28 (T28, as dietas AIN-P, AIN-M e M apresentaram efeito hipocolesterolêmico, tendo em vista que a composição das dietas eram de natureza hipercolesterolêmica. Em relação à glicose sérica, no tempo (T0 observou-se uma elevação geral da glicemia, sugerindo um efeito hiperglicêmico das dietas estudadas. A dieta G+M foi a que apresentou valores significantemente mais elevados de lipídios séricos no tempo T14, e os níveis mais baixos foram observados na dieta M e na dieta GI no T14 e nas dietas AIN-M e AIN-P. A dieta AIN-P foi a que apresentou valor significantemente mais elevado de triacilgliceróis nos tempos T14 e T28. Os níveis mais baixos nos tempos T14 foram constatados para as dietas G+M e GI e no tempo T28 para as dietas AIN-M e M. De um modo geral, não houve modificações significativas na microbiota intestinal dos animais em nenhuma das dietas. Dentre os AGV, o ácido acético foi o predominante, seguido do propiônico e do butírico, em todas as dietas estudadas.The blood serum indexes of glucose and lipids, the intestinal microbiota and the production of volatile fatty acids (VFA were determined in Wistar rats which were fed a standard (AIN-P diet, a
Kebbouche-Gana, Salima; Gana, Mohamed Lamine; Ferrioune, Imen; Khemili, Souad; Lenchi, Nesrine; Akmouci-Toumi, Sihem; Bouanane-Darenfed, Nabila Amel; Djelali, Nacer-Eddine
2013-11-01
A bacterial strain E21 was isolated from a sample of water collected in the salt lake located close to Ain Salah, Algeria. The analysis of 16S rRNA gene sequence had indicated that the strain had 93 % sequence similarity with the genus Natrialba sp. strain E21 (GenBank, FR750525.1) and was considered extremely halophilic. Production of biosurfactant by the strain E21 with free and entrapped cells was investigated using soluble starch in the saline conditions. Biosurfactant synthesis was followed by measuring the surface tension and emulsifying index 9 days under optimal conditions (40 °C, pH 7). Some diffusional limitations in alginate and agar beads affected the kinetics of biosurfactant production when compared to that obtained with free cells culture. The minimum values of surface tension were 27 and 30 mN m(-1) achieved after 9 days with free and immobilized cells, respectively, while the corresponding maximum E24 values were 65.3 and 62.3 %, respectively. The re-use of bacterial cells along with the limited cell losses provided by the immobilized system might lead to significant reduction of the biosurfactant production cost.
Microstructure of Nitrided Aluminum Alloys Using an Electron-Beam-Excited-Plasma (EBEP)
Institute of Scientific and Technical Information of China (English)
L. Liu; A. Yamamoto; T. Hishida; H. Shoyama; T. Hara; T. Hara
2004-01-01
Nitriding of surface of aluminum alloys was carried out with using an electron-beam-excited-plasma (EBEP)technique. The EBEP is sustained by electron impact ionization with energetic electron beam. Two kinds of substrates,aluminum alloys AA5052 and AA5083, were exposed to the down flow of EBEP source at 843 K for 45min. The specimens were characterized with respect to following properties: crystallographic structure (XRD), morphology (SEM) and the cross sectional microstructures of the nitrided layer was observed using a scanning electron microscopy (SEM). There are some Al2O3 particles on the surface of the nitrided AA5052 and AA5083. The AIN layers were formed on the substrates with the thickness of 4.5 μ m for AA5052 and 0.5 μ m for AA5083. A relatively uniform nitrided surface layer composed of AIN can be observed on the AA5052 substrate. The grains size near the interfaces between the substrate and AIN layer were smaller than that near the surface. On the surface of AIN layer, the concentration of nitrogen was high and in the middle of AIN layer it had a constant concentration like the aluminum and the concentration was decreased with approaching to the interface. On the surface of nitrided AA5083, a uniform AIN layer was not formed as the reason for the high nitriding temperature.
Azab, Sonya M. S.; Hirshon, Jon Mark; Hayes, Bryan D.; El-Setouhy, Maged; Smith, Gordon S.; Sakr, Mahmoud Lotfy; Tawfik, Hany; Klein-Schwartz, Wendy
2016-01-01
Introduction Pediatric poisonings represent a major and preventable cause of morbidity and mortality throughout the world. Epidemiologic information about poisoning among children in many lower- and middle-income countries is scarce. This study describes the epidemiology of acute poisonings in children presenting to Ain Shams University's Poisoning Treatment Center (ASU-PTC) in Cairo and determines the causative agents and characteristics of acute poisoning in several pediatric age groups. Methods This retrospective study involved acutely poisoned patients, 0 to 18 years of age, who presented to the ASU-PTC between 1/1/2009 and 12/31/2013. Data were extracted from electronic records maintained by the ASU-PTC. Collected data included demographics, substance of exposure, circumstances of the poisoning, patient disposition, and outcome. Results During the 5-year study period, 38,470 patients meeting our criteria were treated by the ASU-PTC; 19,987 (52%) were younger than 6 years of age; 4,196 (11%) were 6 to 12 years; and 14,287 (37%) were >12 years. Unintentional poisoning accounted for 68.5% of the ingestions, though among adolescents 84.1% of ingestions were with self-harm intent. In all age groups, the most frequent causative drugs were non-opioid analgesics, antipyretics, and antirheumatics. The most common nonpharmaceutical agents were corrosives in preschool children and pesticides in adolescents. Most patients had no/minor effects (29,174 [75.8%]); hospitalization rates were highest among adolescents. There were 119 deaths (case fatality rate of 0.3), primarily from pesticide ingestion. Conclusion Poisoning in preschool children is mainly unintentional and commonly due to nonpharmaceutical agents while poisoning in adolescents is mainly intentional (self-harm). Pesticides, mainly organophosphorous compounds and carbamates, were the most frequent agent leading to morbidity and mortality. PMID:26653953
Leedu kunst on integratsioonivõimeline / Eha Komissarov
Komissarov, Eha, 1947-
2004-01-01
Leedu kaasaegse kunsti näitus "Omas mahlas" Tallinna Kunstihoones (Evaldas Jansas, Egle Rakauskaite) ja Rotermanni soolalaos (Loreta Bilinskaite-Burke, Laura Barbshtiene & Arturas Bumshteinas (G-Lab), Jonas Gasiunas, Arunas Gudaitis, Linas Jablonskis, Dainius Lishkevicius, Mindaugas Lukoshaitis, Gintaras Makarevicius, Deimantas Narkevicius, Egle Ridikaite, Irma Stanaityte, Laura Stasiulyte, Mindaugas Shimkus, Arturas Valiauga, Rimaldas Vikshraitis, Darius Zhiura). Kuraator Anders Kreuger leedu kunstniku kuvandiloomest
In situ EELS and TEM observation of Al implanted with nitrogen ions
International Nuclear Information System (INIS)
Hojou, K.; Furuno, S.; Kushita, K.N.; Otsu, H.; Izui, K.
1995-01-01
Formation processes of Aluminum nitride (AIN) in Aluminum (AI) implanted with nitrogen were examined by in situ EELS and TEM observations during nitrogen ion implantation in an electron microscope at room temperature and 400 deg C. AIN phase was identified both by EDP and EELS after nitrogen ion implantation to 6 x 10 20 (N + )/m 2 . The observed peak (20.8 eV) in EELS spectra was identified as plasmon loss peak of AIN formed in AI. The binding energy of N ls in AI was found to shift by about 4 eV to the lower side with increasing nitrogen-ion fluence. Unreacted AI was also found to remain in the AIN films after high fluence implantation both at room temperature and 400 deg C. (authors). 11 refs., 5 figs., 2 tabs
Teatrilugu nendest, kes teatris ei käi / Tuuli Koch
Koch, Tuuli
2000-01-01
Nr. 52/1999. Martin McDonaghi "Mägede iluduskuninganna" Vanemuises, lavastaja Ain Mäeots. Esietendus oli 5. nov. Ka Ain Mäeotsa ja näitlejate Liina Tennosaare ning Margus Jaanovitsi arvamusi näidendist
Richel, Olivier; de Vries, Henry J C; van Noesel, Carel J M; Dijkgraaf, Marcel G W; Prins, Jan M
2013-04-01
Anal cancer is an increasing issue in HIV-positive men who have sex with men (MSM). Screening for its precursor, anal intraepithelial neoplasia (AIN), is subject of discussion. Current treatment options are suboptimum and have not been compared in a prospective trial. We compared efficacy and side-effects of imiquimod, topical fluorouracil, and electrocautery for the treatment of AIN. In this open-label randomised trial, we included HIV-positive MSM older than 18 years visiting the HIV outpatient clinic of the Academic Medical Center, Amsterdam, Netherlands. Patients with histologically confirmed AIN were randomly assigned to receive either 16 weeks of imiquimod (three times a week), 16 weeks of topical fluorouracil (twice a week), or monthly electrocautery for 4 months. Randomisation was done with random block sizes of three and six, stratified for AIN grade (AIN grades 1, 2, or 3) and AIN location (peri-anal or intra-anal). Participants were assessed by high-resolution anoscopy 4 weeks after treatment. Responding patients returned for follow-up 24 weeks, 48 weeks, and 72 weeks after treatment. The primary endpoint was histological resolution of AIN measured 4 weeks after treatment and AIN recurrence at week 24, week 48, and week 72 after treatment. The primary analysis was done in a modified intention-to-treat population, including all patients who had received their assigned treatment at least once. The trial is registered at the Netherlands Trial Register, number NTR1236. Between Aug 12, 2008, and Dec 1, 2010, we screened 388 HIV-positive MSM for AIN by high resolution anoscopy. Of the 246 (63%) patients who had AIN, 156 (63%) were randomly assigned to either receive imiquimod (54 patients), topical fluorouracil (48 patients), or electrocautery (46 patients) following withdrawing of consent by eight patients. Modified intention-to-treat analysis showed a complete response in 13 (24%, 95% CI 15-37) patients in the imiquimod group, eight (17%, 8-30) of patients
Determination of aluminium nitride or free nitrogen in low carbon steel
International Nuclear Information System (INIS)
Guetaz, V.; Soler, M.; Massardier, V.; Merlin, J.; Ravaine, D.
2001-01-01
As the aluminium nitrides play an important role in the manufacturing of steel sheets, a specific methodology was developed based on the thermoelectric power (TEP) technique, in order to determine the AIN nitrogen by an indirect method. The free nitrogen was determined and then the AIN nitrogen was calculated by the difference between the total nitrogen and the free nitrogen. Indeed, it is easier to determine the dissolved nitrogen, the content of which gradually decreases during the AIN precipitation, than the AIN nitrogen. A low carbon aluminium killed steel was employed with 580 ppm of aluminium and 50 ppm of nitrogen. A comparison of the results obtained by TEP with those obtained by other techniques (hot hydrogen extraction, electrochemical dissolution followed by a mineralization, electrochemical dissolution followed by a sodic decomposition and the Beeghly method) was conducted, in order to determine a reliable technique likely to quantify the amount of aluminium nitrides in aluminium killed steels. With these techniques, it is possible to determine either free nitrogen or precipitated nitrogen. From an experimental point of view, the precipitation kinetics of AIN was followed during an annealing performed at 973 K (700 C) by TEP and then different precipitation states of AIN were investigated to compare the different techniques: three annealing states (when no nitrogen, half the nitrogen and the total nitrogen has precipitated) and two soaking states (1403 and 1523 K). Thus, it was possible to compare states where the AIN precipitates are in various forms (different shapes, crystallographic structures, sizes, distributions in the matrix). This work showed that the quantification by TEP, hot hydrogen extraction and electrochemical dissolution followed by a mineralization seem reliable whereas the Beeghly method gives good results only for the precipitates formed at high temperatures. In contrast, the quantification by electrochemical dissolution followed by
Directory of Open Access Journals (Sweden)
Guillaume Jannot
2016-12-01
Full Text Available MicroRNAs and Argonaute form the microRNA induced silencing complex or miRISC that recruits GW182, causing mRNA degradation and/or translational repression. Despite the clear conservation and molecular significance, it is unknown if miRISC-GW182 interaction is essential for gene silencing during animal development. Using Caenorhabditis elegans to explore this question, we examined the relationship and effect on gene silencing between the GW182 orthologs, AIN-1 and AIN-2, and the microRNA-specific Argonaute, ALG-1. Homology modeling based on human Argonaute structures indicated that ALG-1 possesses conserved Tryptophan-binding Pockets required for GW182 binding. We show in vitro and in vivo that their mutations severely altered the association with AIN-1 and AIN-2. ALG-1 tryptophan-binding pockets mutant animals retained microRNA-binding and processing ability, but were deficient in reporter silencing activity. Interestingly, the ALG-1 tryptophan-binding pockets mutant phenocopied the loss of alg-1 in worms during larval stages, yet was sufficient to rescue embryonic lethality, indicating the dispensability of AINs association with the miRISC at this developmental stage. The dispensability of AINs in miRNA regulation is further demonstrated by the capacity of ALG-1 tryptophan-binding pockets mutant to regulate a target of the embryonic mir-35 microRNA family. Thus, our results demonstrate that the microRNA pathway can act independently of GW182 proteins during C. elegans embryogenesis.
Wireless intelligent network: infrastructure before services?
Chu, Narisa N.
1996-01-01
The Wireless Intelligent Network (WIN) intends to take advantage of the Advanced Intelligent Network (AIN) concepts and products developed from wireline communications. However, progress of the AIN deployment has been slow due to the many barriers that exist in the traditional wireline carriers' deployment procedures and infrastructure. The success of AIN has not been truly demonstrated. The AIN objectives and directions are applicable to the wireless industry although the plans and implementations could be significantly different. This paper points out WIN characteristics in architecture, flexibility, deployment, and value to customers. In order to succeed, the technology driven AIN concept has to be reinforced by the market driven WIN services. An infrastructure suitable for the WIN will contain elements that are foreign to the wireline network. The deployment process is expected to seed with the revenue generated services. Standardization will be achieved by simplifying and incorporating the IS-41C, AIN, and Intelligent Network CS-1 recommendations. Integration of the existing and future systems impose the biggest challenge of all. Service creation has to be complemented with service deployment process which heavily impact the carriers' infrastructure. WIN deployment will likely start from an Intelligent Peripheral, a Service Control Point and migrate to a Service Node when sufficient triggers are implemented in the mobile switch for distributed call control. The struggle to move forward will not be based on technology, but rather on the impact to existing infrastructure.
Rodríguez Bernardino, Ángel
2003-01-01
La insuficiencia cardiaca congestiva (ICC) es una patología con una alta prevalencia en nuestro medio. Se ha establecido una posible relación entre la acción de los antiinflamatorios no esteroideos (AINEs) sobre la síntesis de prostaglandinas y la aparición de ICC en individuos susceptibles. Nuestro objetivo fue evaluar la asociación entre el ingreso hospitalario por ICC y el consumo previo de AINEs, estimado la contribución individual de los distintos de AINEs. Se realizó un estudio multicén...
Indian Academy of Sciences (India)
Admin
word possibly having its origin in Sanskrit). W hat is ... History and Some Perspectives on Intermolecular Forces. E Arunan. Keywords van der Waals forces, hydrogen bonding. ... A tom s have rem ained a dom ain of physics, rather than.
Lood toimivad ajas / Laura Kuusk
Kuusk, Laura, 1982-
2006-01-01
Andres Härmi kureeritud näitusesari "Story" Tallinna Linnagaleriis: 14. IX-1. X "Story I: Katse ja eksitus. Monument massidele. Janna Holmstedt & Po Hagström"; 5.-22. X "Story II: 9. detsember 2005: minu märkmik. Tõnis Saadoja"; 26. X-12. XI "Story III: Aja sund. Minna Hint ja Jane Remm" ja 7.-31. XII "Story IV: Cinemagic Tour. Elsebeth Jorgensen"
Pärast kõike / intervjueerinud Veiko Märka
1998-01-01
Vestlusring: Ain Mäeots, Merle Jääger, Helena Merzin, Margus Jaanovits, Riho Kütsar. Madis Kõivu võrukeelse näidendi 'Omavahelisi jutuajamisi tädi Elliga' lavastamisest Vanemuise teatris, lavastaja Ain Mäeots. Ka Kauksi Ülle kommentaar
Kaalep, Ain, 1926-
2003-01-01
Sisu: Eeslid ; Luuletaja Koghazi ; Elav kuningas ; Neli legendi : Mungasuudlus ; Dorzhiin ; Legend meister Albrechtist ; Aafrika muld. Ballaad kombaini armastusest ; Kuningakatse ; Rapsoodiad : Draakoni talveuni ; Klaassepa poeg. Kaks indiaani metamorfoosi : Roti metamorfoos ; Ahvnaine. Paani surm ; Valgjärve legend ; Katsikõsõ'
Turundusteenistus / Ain Kaljurand
Kaljurand, Ain, 1965-
2004-01-01
Ilmunud ka: 2003 : annual report : [Eesti Raudtee]. - Tallinn, 2004, lk. 15-20; 2003 : godovoi ottshjot : [Eesti Raudtee]. - Tallinn, 2004, lk. 15-20. Ülevaade AS-i Eesti Raudtee 2003. a. kaubaveost veomahtude ja kaubagruppide järgi, turundusteenistusest, hinnapoliitikast
ACT-R/E: An Embodied Cognitive Architecture for Human-Robot Interaction
2013-01-01
Threaded Cognition: An Integrated Theory of Concurrent Multitasking . Psychological Review, 115(1), 101–130, http://dx.doi.org/10.1037/0033-295X...Trafton, Naval Research Laboratory, Washington, DC, USA Email : greg.trafton@nrl.navy.mil Laura Hiatt, Naval Research Laboratory, Washington, DC, USA Email ...laura.hiatt@nrl.navy.mil Anthony Harrison, Naval Research Laboratory, Washington, DC, USA Email : anthony.harrison@nrl.navy.mil Frank Tamborello, Naval
Overcoming Endocrine Resistance by Targeting ER/FoxA1/IL 8 Axis
2016-10-01
Nardone, Carmine De Angelis, Laura M. Heiser , Pavana Anur, Nicholas Wang, Catherine S. Grasso, Paul Spellman, Obi L. Griffith, Anna Tsimelzon...presentations Publications Fu X, Jeselsohn R, Pereira R, Hollingsworth EF, Creighton CJ, Li F, Shea M, Nardone A, Angelis CD, Heiser LM, Anur P, Wang N...performed the bioinformatics analysis of RNA-Seq and ChIP-Seq data. Name: Laura Heiser Project Role: Collaborator Nearest person month worked: 1
Anemia prevalence and treatment practice in patients with non-myeloid tumors receiving chemotherapy
Merlini,; Cartenì,; Iacobelli,; Stelitano,; Airoldi,Mairoldi; Balcke,Peter; Keil,Felix; Haslbauer,Ferdinand; Belton,Laura; Pujol,
2013-01-01
Laura Merlini,1 Giacomo Cartenì,2 Stefano Iacobelli,3 Caterina Stelitano,4 Mario Airoldi,5 Peter Balcke,6 Felix Keil,7 Ferdinand Haslbauer,8 Laura Belton,9 Beatriz Pujol10 1Department of Medical Oncology, Ospedale Civile S, Bortolo, Vicenza, 2Department of OncoHematology, Azienda Ospedaliera di Rilievo Nazionale "Antonio Cardarelli", Napoli, 3Department of Medical Oncology, Ospedale Clinicizzato SS Annunziata, Chieti, 4Department of Hematology, Azienda Ospedali...
Exegi monumentum ehk palee Tallinnas / Siim Sultson
Sultson, Siim
2007-01-01
Tallinnas Narva mnt. 7 endisest Tsentrosojuzprojektist ümber ehitatud Triumph Plazast (arhitektid Vilen Künnapu ja Ain Padrik). Maja kavandati 1981. a. büroohooneks (arhitektid Olga Bruns ja Mart Kalling). Kommenteerivad Mart Port, Dmitri Bruns, Kristiina Möldre ja Ain Padrik
Automating the AFROTC Four-Year Scholarship Program.
1986-04-01
ATCH 2 b1 C -d C4 4" %C N 0" cl4 es C4 CN 1 onin %DG C1 06 0 -0 40 V 44-4 LIU-4- c4 A: U. -4 La 4 E vt a-’ iv El "l 04 0 0.I t b U El 4 V do v 0 CoU. -4...CEEB CLAS~S BOARD 1ST 2ND DCF QEP/ STRT,"’ HWFADC CfI3; PEL SCORES SCORE COMP SCOPE STAND RAMK".,H~DC ’ PREF PREF RACE PREY" rTL B1 = 46/1 C hiroms...A/N 88 Fencing 4 AIN 89 La Crosse 4 AIN 90 Rifle/Pistol 4 AIN 91 Rugby 4 AIN 92 Track 4 A/N 93 Wrestling 4 A/N 94 Others (Name and Codes) 15 A/N 95
NUOVO, Gerard J.; GRINSZTEJN, Beatriz; FRIEDMAN, Ruth K.; VELOSO, Valdiléa G.; CUNHA, Cynthia B.; COUTINHO, José R.; VIANNA-ANDRADE, Cecilia; OLIVEIRA, Nathalia S.; WOODHAM, Andrew W.; DA SILVA, Diane M.; KAST, W. Martin
2016-01-01
Objective The aim of the current study was to evaluate secretory leukocyte protease inhibitor (SLPI) expression in anal biopsies from HIV-positive (HIV+) individuals, and compare that to anal intraepithelial neoplasia (AIN) diagnoses and human papillomavirus (HPV) status. Design This is a cross-sectional study of a cohort of 54 HIV+ (31 males and 23 females) from an AIDS clinic in Rio de Janeiro, Brazil. Methods The study material consisted of anorectal tissue biopsies obtained from HIV+ subjects, which were used to construct tissue microarray paraffin blocks for immunohistochemical analysis of SLPI expression. Biopsies were evaluated by an expert pathologist and classified as low-grade anal intraepithelial neoplasia (AIN1), high-grade anal intraepithelial neoplasia (AIN2/3), or normal squamous epithelium. Additionally, DNA from the biopsies was extracted and analyzed for the presence of low- or high-risk HPV DNA. Results Histologically normal squamous epithelium from the anorectal region showed strong positive SLPI staining in 17/20 (85%) samples. In comparison, 9/17 (53%) dysplastic squamous epithelial samples from AIN1 patients showed strong SLPI staining, and only 5/17 (29%) samples from AIN2-3 patients exhibited strong SPLI staining, which both were significantly fewer than those from normal tissue (p=0.005). Furthermore, there was a significantly higher proportion of samples in which oncogenic high-risk HPV genotypes were detected in low SLPI expressing tissues than that in tissues with high SLPI expression (p=0.040). Conclusion Taken together these results suggest that low SLPI expression is associated with high-risk HPV infections in the development of AIN. PMID:27149102
Richel, Olivier; Quint, Koen D.; Lindeman, Jan; van Noesel, Carel J. M.; de Koning, Maurits N. C.; van den Munckhof, Henk A. M.; de Vries, Henry J. C.; Prins, Jan M.; Quint, Wim G. V.
2014-01-01
High-grade anal intraepithelial neoplasia (AIN) is present in many human immunodeficiency virus (HIV)-positive men who have sex with men. The major etiologic factor is infection with an oncogenic human papillomavirus (HPV) genotype. We investigated whether individual components of high-grade AIN are
Veronezi, Regina de Cássia [UNESP
2007-01-01
Os antiinflamatórios não esteroidais (AINEs) são rotineiramente usados na medicina eqüina como analgésicos e antiinflamatórios, sendo potentes controladores da dor. Entretanto, estes fármacos provocam alguns efeitos indesejáveis, como por exemplo, lesões renais e gastrointestinais. Os efeitos adversos dos AINEs ocorrem com a inibição da COX-1, enquanto os efeitos benéficos são observados com a inibição da enzima COX-2. Com o surgimento dos AINEs seletivos para COX-2, os efeitos adversos são c...
International Nuclear Information System (INIS)
Yue, Ruirui; Zhang, Qiang; Wang, Caiqin; Du, Yukou; Yang, Ping; Xu, Jingkun
2013-01-01
Highlights: • Electropolymerization of 5-aminoindole (AIn) in the presence of graphene (GE). • Significant catalytic effect of GE on the polymerization of AIn. • PAIn/GE/GC used as Pt catalyst support. • The enhanced catalytic activity of Pt/PAIn/GE/GC for methanol electrooxidation. -- Abstract: 5-Aminoindole (AIn) was electropolymerized on graphene (GE) modified glass carbon (GC) electrode in 0.5 M H 2 SO 4 aqueous solution containing 0.01 M AIn. Because of the catalytic effect of GE, the polymerization efficiency of AIn and the electrochemical activity of as-formed poly(5-aminoindole) (PAIn) were significantly improved on GE/GC electrode as compared to that on the bare GC electrode. The prepared PAIn/GE/GC electrode was used as substrate for Pt particle electrodeposition. SEM, EDX and Raman spectral were used to characterize the prepared electrodes. Electrocatalytic experiments demonstrate that the Pt/PAIn/GE/GC electrode possesses high catalytic activity toward methanol electrooxidation in alkaline medium, due to the good dispersion of Pt particles on PAIn/GE/GC and the electronic interactions between the metal particles and the polymer matrixes. Thus, PAIn can be a promising alternative for polymeric catalyst support in direct alcohol fuel cells
DEFF Research Database (Denmark)
Nielsen, Ann; Plum, Christian Edinger Munk; Kjaer, Susanne K
2012-01-01
The aim of the study was to determine the incidences of anal cancer and high-grade anal intraepithelial neoplasia (AIN2/3) over time in Danish women and men. Describing the burden of anal cancer and AIN may be valuable in future evaluations of the human papillomavirus (HPV) vaccine. We included all...... anal cancers in the Danish Cancer Register in the period 1978-2008 and all cases of AIN2/3 in the Danish Registry of Pathology. Overall and age-, period- and histology-specific incidence rates were estimated. During the 30-year period, 2187 anal cancers were identified, two thirds of which were...... in women. Between 1978-1982 and 2003-2008, the age-standardized incidence rate of anal cancer increased from 0.68 to 1.48 per 100 000 person-years in women and from 0.45 to 0.80 per 100 000 person-years in men. Although there is no systematic screening for AIN in Denmark, we nevertheless identified 608...
Surface morphology of Al0.3Ga0.7N/Al2O3-high electron mobility transistor structure.
Cörekçi, S; Usanmaz, D; Tekeli, Z; Cakmak, M; Ozçelik, S; Ozbay, E
2008-02-01
We present surface properties of buffer films (AIN and GaN) and Al0.3Gao.zN/Al2O3-High Electron Mobility Transistor (HEMT) structures with/without AIN interlayer grown on High Temperature (HT)-AIN buffer/Al2O3 substrate and Al2O3 substrate. We have found that the GaN surface morphology is step-flow in character and the density of dislocations was about 10(8)-10(9) cm(-2). The AFM measurements also exhibited that the presence of atomic steps with large lateral step dimension and the surface of samples was smooth. The lateral step sizes are in the range of 100-250 nm. The typical rms values of HEMT structures were found as 0.27, 0.30, and 0.70 nm. HT-AIN buffer layer can have a significant impact on the surface morphology of Al0.3Ga0.7N/Al2O3-HEMT structures.
Feng, C; Wang, S G; Yang, M Y; Zhang, E; Zhan, Q; Jiang, Y; Li, B H; Yu, G H
2012-02-01
Based on interfacial manipulation of the MgO single crystal substrate and non-magnetic AIN compound, a L1(0)-FePt perpendicular ultrathin film with the structure of MgO/FePt-AIN/Ta was designed, prepared, and investigated. The film is comprised of L1(0)-FePt "magnetic islands," which exhibits a perpendicular magnetic anisotropy (PMA), tunable coercivity (Hc), and interparticle exchange coupling (IEC). The MgO substrate promotes PMA of the film because of interfacial control of the FePt lattice orientation. The AIN compound is doped to increase the difference of surface energy between FePt layer and MgO substrate and to suppress the growth of FePt grains, which takes control of island growth mode of FePt atoms. The AIN compound also acts as isolator of L1(0)-FePt islands to pin the sites of FePt domains, resulting in the tunability of Hc and IEC of the films.
Pap smears for men: a vision of the future?
LENUS (Irish Health Repository)
Oon, S F
2012-02-01
BACKGROUND: Anal intraepithelial neoplasia (AIN) rarely receives as much publicity as its neighbouring orifice, the cervix. As in the cervix, intraepithelial neoplasias are precursors to cancer in the anal canal. AIN and cervical interstitial neoplasia (CIN) undergo dysplasia as a consequence of human papillomavirus (HPV) infection. Since the advent of screening with the Pap smear in CIN, cervical cancer has plummeted to a fifth of its initial incidence. Anal cancer, however, has been rising, with a predilection for human immunodeficiency virus-infected men. HPV causes a squamous epithelial dysplasia and converts healthy tissue into AINs of increasing severity until anal cancer manifests. CLINICAL CASE: This article describes a clinical case of anogenital HPV infection refractory to medical and surgical therapy. It also describes an effective surgical excision technique associated with a good cosmetic outcome. CONCLUSIONS: The paper concludes by briefly discussing the implications of a national screening programme against AIN in the future.
Hypothyroidism could be the only manifestation of mitochondrial ...
African Journals Online (AJOL)
Hoda Tomoum
2012-11-24
Nov 24, 2012 ... Hypothyroidism could be the only manifestation of mitochondrial T8993C mutation in Leigh syndrome. Hoda Tomoum a. , Solaf M. Elsayed b,. *, Elizabeth Berry-Kravis c a Department of Pediatrics, Ain Shams University, Cairo, Egypt b Genetics Unit, Department of Pediatrics, Ain Shams University, Cairo, ...
AVALIAÇÃO DA DISPENSAÇÃO DE FÁRMACOS PARCIALMENTE SELETIVOS PARA COX-2
Directory of Open Access Journals (Sweden)
Cícero Cardoso VALLE FILHO
2015-12-01
Full Text Available Uma pesquisa foi realizada com o objetivo de avaliar um potencial aumento na venda de fármacos anti-inflamatórios não esteroidais (AINEs parcialmente seletivos para a COX-2 durante o período de julho de 2009 a junho de 2011, em uma drogaria localizada no município de Itaperuna, estado do Rio de Janeiro. Durante o período estudado foi dispensado um total de 802 AINEs parcialmente seletivos para a COX-2, dentre os quais 59,85% foram de nimesulida, 5,74% de etodolaco e 34,41% de meloxicam. No primeiro semestre avaliado a dispensação total de AINEs parcialmente seletivos foi equivalente a 92, no segundo semestre a dispensação total foi equivalente a 159, no terceiro semestre a dispensação total foi de 219 AINEs parcialmente seletivos para COX-2 e no quarto semestre foram dispensados 332. Os resultados indicaram maior dispensação dos medicamentos desta classe no mês de abril de 2011 sendo que tanto a nimesulida, quanto o meloxicam e o etodolaco foram mais dispensados no último semestre do estudo. De acordo com a metodologia utilizada pode-se concluir que a dispensação dos AINEs parcialmente seletivos vem crescendo a cada ano e que a nimesulida apresenta o maior índice de crescimento; a maior indicação da nimesulida tem sido para crianças; os meses correspondentes ao período de inverno apresentam maior dispensação de AINEs parcialmente seletivos para a COX-2.
The Carolina Autism Transition Study (CATS)
2017-07-01
AWARD NUMBER: W81XWH-15-1-0093 TITLE: The Carolina Autism Transition Study (CATS) PRINCIPAL INVESTIGATOR: Laura Carpenter, MD RECIPIENT...Carolina Autism Transition Study (CATS) 5b. GRANT NUMBER W81XWH-15-1-0093 5c. PROGRAM ELEMENT NUMBER 6. AUTHOR(S) 5d. PROJECT NUMBER Laura Carpenter...provides a description of the Year 2 progress made and plans for Year 3 for the project entitled “The Carolina Autism Transition Study (CATS).” The goal of
Data to DecisionsTerminate, Tolerate, Transfer, or Treat
2016-07-25
and resources. Degradation of current capability continues. Transfer – Opportunities and Consequences: Requires a surgical knowledge of what...I N S T I T U T E F O R D E F E N S E A N A L Y S E S Data to Decisions—Terminate, Tolerate, Transfer , or Treat Laura A...Data to Decisions—Terminate, Tolerate, Transfer , or Treat For more information Laura Odell(lodell@ida.org, 703-845-2009 The Department
Hydrogeological and isotopic studies for selected springs in Sinai Peninsula
Energy Technology Data Exchange (ETDEWEB)
Hamza, M S; Awad, M A; El-gamal, S A [Atomic Energy Authority, Cairo Egypt and Middle Eastern Regional Radioisotope Center for The Arab Countries, Dokki, 12311, Cairo (Egypt); Hammad, F A [Desert Research Centre, Materia, Cairo, (Egypt)
1995-10-01
This paper deals with the hydrogeology and isotopic composition of water samples collected from selected spring in sinai (e.g. Algudierate, Alqusiema, qidis and Isram) in order to identify their genesis, their interaction with the host rocks and mixing trend. Results of isotopic composition have indicated the similarity in the hydrogeologic situation of Ain qidis and Ain-al-gudierate, while Ain Isram has shown a marked difference in its stable isotope and this could be due to evaporation effect. The isotopic and hydrochemical constituents of the studied springs reflect eater of a meteoric origin with a possible contamination from surficial materials (evaporates) and deeper aquifers. 6 figs., 2 tabs.
Directory of Open Access Journals (Sweden)
YOUCEF BENMOUSSA
2015-07-01
Full Text Available Resources And Water Sharing In The Oasis Of Kenadsa (Southwest Algeria; Historical Approach And Findings. Kenadsa, a peaceable oasis in southwestern Algeria, with the discovery and exploitation of coal (1917 - 1956, underwent graft of Western models for its development. That has cleared the oasis of the spatial dimension and tr ansformed into a mining village by excellence. These networks of foggaras draining groundwater, enclosed in a multilayer aquifer, which becomes free on the northern border of the Ksar. There were 25 foggaras of sources (Ain, each of which had its own drai nage channels to downstream gardens of Ksar. The distribution of water from these sources was ensured by a complex network, fed by drainage galleries that meander the alleys of Ksar and gives place to access points for domestic uses. The right to water is generally private property; one could dispose of according to modes of transmission of a property. It’s sharing for irrigation is governed by the volume and time. Currently, only some ten foggaras of sources that are still alive (Ain Sidi Mbarek, Ain Dir, Belkaid Ain, Ain Sheikh ..... These waters are characterized by mediocre quality (pH 7.31, CE: 4.88 ms / cm, RS 2420 mg / l Ca ++: 288.2 mg / l, SO4 -- : 468 83 mg / l..
Looking outside the (voice)box.
Gartrell, Nanette; Rothblum, Esther
2014-01-01
Laura S. Brown, PhD, is a clinical and forensic psychologist in independent practice in Seattle, Washington. The bulk of her scholarly work has been in the fields of feminist therapy theory, trauma treatment, lesbian and gay issues, assessment and diagnosis, ethics and standards of care in psychotherapy, and cultural competence. She has authored or edited ten professional books, including the award-winning Subversive Dialogues: Theory in Feminist Therapy, as well as more than 140 other professional publications. She has also recently published her first book for general audiences, Your turn for care: Surviving the aging and death of the adults who harmed you. Laura has been featured in five psychotherapy training videos produced by the American Psychological Association. She was President of American Psychological Association Divisions 35 (Society for the Psychology of Women), 44 (Society for the Psychological Study of Lesbian, Gay and Bisexual Issues), and 56 (Trauma Psychology). Laura was also President of the Washington State Psychological Association. She is the founder and Director of the Fremont Community Therapy Project, a low-fee psychotherapy training clinic in Seattle. In the fall of 2000, she was the on-site psychologist for the reality show Survivor: The Australian Outback. In 1987, Laura lost her voice and was diagnosed with spasmodic dysphonia. In 1988, she found her voice again.
Bulletin of Materials Science | Indian Academy of Sciences
Indian Academy of Sciences (India)
Laboratoire de Physique Fondamentale et Applique (LPFA), Faculté des Sciences Ain Chock, Université Hassan II, B.P. 5366 Mâarif, Casablanca, Maroc; Laboratoire de Physique des Matériaux, Micro-électronique, Automatique et Thermique (LPMMAT), Faculté des Sciences Ain Chock, Université Hassan II, B.P. 5366 ...
Feminist film studies 40 years after ‘Visual Pleasure and Narrative Cinema’, a triologue
Laura Mulvey; Anna Backman Rogers; Annie van den Oever
2015-01-01
Forty years after the publication of her seminal essay ‘Visual Pleasure and Narrative Cinema’ in Screen, Laura Mulvey, together with Anna Backman Rogers, has edited Feminisms: Diversity, Difference, and Multiplicity in Contemporary Film Cultures, which is the latest instalment of The Key Debates series. NECSUS invited Laura Mulvey and Anna Backman Rogers to join Annie van den Oever, editor of NECSUS and series editor of The Key Debates, in a ‘triologue’, which in part reflects and re-empha...
A Strong Impact of Genetic Background on Gut Microflora in Mice
Directory of Open Access Journals (Sweden)
R. Steven Esworthy
2010-01-01
Full Text Available Genetic background affects susceptibility to ileocolitis in mice deficient in two intracellular glutathione peroxidases, GPx1 and GPx2. The C57BL/6 (B6 GPx1/2 double-knockout (DKO mice have mild ileocolitis, and 129S1/Sv (129 DKO mice have severe inflammation. We used diet to modulate ileocolitis; a casein-based defined diet with AIN76A micronutrients (AIN attenuates inflammation compared to conventional LabDiets. Because luminal microbiota induce DKO ileocolitis, we assessed bacterial composition with automated ribosomal intergenic-spacer analysis (ARISA on cecal DNA. We found that mouse strain had the strongest impact on the composition of microbiota than diet and GPx genotypes. In comparing AIN and LabDiet, DKO mice were more resistant to change than the non-DKO or WT mice. However, supplementing yeast and inulin to AIN diet greatly altered microflora profiles in the DKO mice. From 129 DKO strictly, we found overgrowth of Escherichia coli. We conclude that genetic background predisposes mice to colonization of potentially pathogenic E. coli.
Análisis coste-efectividad del empleo de celecoxib en el tratamiento de la artrosis
Directory of Open Access Journals (Sweden)
Moreno A.
2003-01-01
Full Text Available Antecedentes: Los antiinflamatorios no esteroideos (AINE, utilizados en el tratamiento de la artrosis, pueden producir reacciones adversas gastrointestinales (GI graves. Celecoxib, un inhibidor específico de la ciclooxigenasa 2 (COX-2, ha demostrado una eficacia equivalente a los AINE convencionales con un mejor perfil de tolerabilidad y seguridad. Objetivo: La finalidad de este estudio ha sido realizar un análisis coste-efectividad sobre el uso de celecoxib frente a los AINE clásicos en el tratamiento de la artrosis. Material y métodos: El análisis coste-efectividad se ha diseñado mediante un modelo farmacoeconómico, definiéndose como unidad de efectividad a cada año de vida ganado tras la toma de celecoxib o AINE. La probabilidad de que aparezcan los diferentes resultados clínicos se ha obtenido de artículos publicados y de asunciones incorporadas. Sólo se han valorado los costes directos médicos (medicación, hospitalización, pruebas complementarias, analíticas, visitas extras, etc., sin haberse incluido otros costes. La perspectiva del estudio ha sido la del Sistema Nacional de Salud y el horizonte temporal elegido ha sido de 6 meses. Resultados: El coste adicional por cada año de vida ganado secundario al uso de celecoxib frente a los AINE clásicos asciende a 8.017 ? (1.333.834 ptas.. El análisis de sensibilidad muestra cómo estos valores son sensibles a la modificación del coste de AINE y gastroprotector, así como a la inclusión de grupos poblacionales con edades más bajas. Conclusiones: Celecoxib puede ser considerado como una opción coste-efectiva en el tratamiento de la artrosis, ya que va a evitar muertes y a ganar años de vida para los pacientes con un coste adicional razonable y moderado, cuando se compara con los AINE. Su eficiencia aumenta a medida que se utiliza en poblaciones con menor edad media y, probablemente, en aquellas con mayor riesgo de desarrollar complicaciones GI.
Há uma associação entre anti-inflamatórios não-esteroides e nefropatia induzida por contraste?
Directory of Open Access Journals (Sweden)
Luciano Passamani Diogo
Full Text Available FUNDAMENTO: A associação entre o uso de anti-inflamatórios não-esteroides (AINEs e insuficiência renal aguda ou crônica é bem documentada, mas evidências sobre a associação entre AINEs e nefropatia induzida por contraste (NIC não são encontradas na literatura. OBJETIVO: Avaliar uma possível associação entre AINEs e NIC. MÉTODOS: Em um estudo de coorte, através da entrevista clínica de pacientes que foram submetidos à cateterização cardíaca, analisamos o uso de AINEs e sua associação com desenvolvimento de NIC, através da alteração dos níveis de creatinina sérica ou taxa de filtração glomerular em 48 ou 72 horas. RESULTADOS: No período de julho de 2005 a julho de 2006, 236 pacientes foram incluídos no estudo, dos quais 29 foram posteriormente excluídos. A incidência de NIC foi 10,37% (20 de 207 e 42% dos pacientes estavam recebendo AINEs até o momento da avaliação. Não houve associação entre o uso de AINEs e o desenvolvimento de NIC com OR de 1,293; IC95% (0,46-4,2. O estudo detectou fatores de risco conhecidos para o desenvolvimento de NIC, tais como diabete, com OR de 2,77; IC95% (1,05-7,47 e insuficiência renal crônica com OR de 3,48; IC95% (1,1-11,07 e também sugeriu uma ação protetora da hidratação com solução salina com OR de 0,166; IC95% (0,03-0,92. CONCLUSÃO: Com base nos dados obtidos, concluímos que não houve associação entre NIC e uso prévio de AINEs, pelo menos com um OR > 2,85, o qual nossa amostra detectou.
[Variation im heutigen Deutsch...] / Laura Tidrike
Tidrike, Laura
2008-01-01
Arvustus: Variation im heutigen Deutsch : Perspektiven für den Sprachunterricht / hrsg. v. Eva Neuland. Frankfurt am Main : Lang, 2006. (Sprache - Kommunikation - Kultur. Soziolinguistische Beiträge ; Vol. 4)
Indrek Saar kehastub Pilistveres Rasputiniks / Aarne Mäe
Mäe, Aarne, 1967-
2008-01-01
7. aug. esietendub Pilistvere vanas rehehoones Ain Saviaugu kirjutatud ja lavastatud suvetükk "Rasputin". Suvelavastuse tõi välja Põltsamaa Teater Ellunäod koos professionaalsete näitlejatega. Nimiosas mängib näitlejast riigikogulane Indrek Saar. Lisaks lühike intervjuu lavastajaga "Lavastaja Ain Saviauk : "Ajalugu on karm" ja fakte Rasputinist - "Grigori Jefimovitsh Rasputin-Novõhh"
Pose de la première pierre du bâtiment SMA18 du Cern
CERN Press Office. Geneva
1999-01-01
On 30 April 1999, Jean Pépin, Sénateur for the Department of the Ain and President of the Conseil Général, and Professor Luciano Maiani the Director-General of CERN will lay the foundation stone of Building SMA18, financed by the Department of the Ain in the framework of France's special contribution to CERN's Large Hadron Collider (LHC) project.
Wrox SharePoint 2010 SharePoint911 three-pack
Klindt, Todd; Mason, Jennifer; Rogers, Laura; Drisgill, Randy; Ross, John; Riemann, Larry; Perran, Amanda; Perran, Shane; Sanford, Jacob J; Stubbs, Paul; Caravajal, Steve
2012-01-01
The Wrox SharePoint 2010 SharePoint911 Three-Pack combines the contents of three full e-books written by the experts from SharePoint911. That's over 1800 pages of hands-on advice from Todd Klindt, Shane Young, Laura Rogers, Randy Drisgill, Jennifer Mason, John Ross, and Larry Riemann, among others. In Beginning SharePoint 2010: Building Business Solutions with SharePoint (ISBN 978-0-470-61789-2) by Amanda Perran, Shane Perran, Jennifer Mason, and Laura Rogers, readers learn the core concepts, terminology, and features of SharePoint 2010. In Professiona
Feminist film studies 40 years after ‘Visual Pleasure and Narrative Cinema’, a triologue
Directory of Open Access Journals (Sweden)
Laura Mulvey
2015-04-01
Full Text Available Forty years after the publication of her seminal essay ‘Visual Pleasure and Narrative Cinema’ in Screen, Laura Mulvey, together with Anna Backman Rogers, has edited Feminisms: Diversity, Difference, and Multiplicity in Contemporary Film Cultures, which is the latest instalment of The Key Debates series. NECSUS invited Laura Mulvey and Anna Backman Rogers to join Annie van den Oever, editor of NECSUS and series editor of The Key Debates, in a ‘triologue’, which in part reflects and re-emphasises the topics publicly discussed during the Feminisms symposia.
Hirm, raha ja armastus / Margot Visnap, Kadi Herkül, Immo Mihkelson
Visnap, Margot, 1959-
1999-01-01
Teleteatri aastaringist - ETV kaheksa lavastust seitsmelt lavastajalt : Toomas Hussar/Ervin Õunapuu "Linnapea ehk Hirmu põhivormid". Rezh. T. Hussar. Eetris 1. jaan. 1998; A.H. Tammsaare/Ain Prosa "Ma armastasin sakslast". Rezh. A. Prosa. Eetris 24. veebr. 1998; Dennis Potter "Sa oled koor minu kohvis". Rezh. Vilja Palm. Eetris 1. jaan. 1999; Ain Prosa/Karl Ristikivi "lihtne lugu, lõpuga". Rezh. Ain Prosa. Eetris 28. nov. 1998; Betti Alver/Margus Kasterpalu "Tuulearmuke". Rezh. Elo Selirand. Eetris 23. mail 1998; Faama Filmi ja ETV teleteatri koostöö "Isa", sts. ja rezh. Mart Kivastik. Eetris 28. märtsil 1998; "Lilled Leale", sts. ja rezh. Olle Mirme Toomas Vindi novelli põhjal; Rein Saluri "Andke neile andeks", lav. Talvo Pabut. Eetris 19. okt. 1998
Rahvusvaheline turismikonverents / Ain Hinsberg
Hinsberg, Ain
2011-01-01
Radisson Blu Hotel Olümpias 28. aprillil korraldatud konverentsist "Läänemere regiooni turismiteadmuse toetus turismimajandusele ja -ettevõtlusele 2011-2026", millega tähistati Eesti Hotelli- ja Turismikõrgkooli EHTE 15. sünnipäeva. Thomas Mielke, Maritta Hiltuneni, Kristian Sieversi, Pauli Santala, Inese Šīrava, Maija Rozite ja Kestutis Ambrozaitise konverentsil peetud ettekannetest ja paneeldiskussioonist
DEFF Research Database (Denmark)
Di Nucci, Ezio
2016-01-01
I argue against various versions of the 'attitude' view of consent and of the 'action' view of consent: I show that neither an attitude nor an action is either necessary or sufficient for consent. I then put forward a different view of consent based on the idea that, given a legitimate epistemic ...
Oit, Ave
2012-01-01
Öko- ja looduskosmeetikas keelatud või piirangutega lubatud koostisainetest: silikoonid, etoksüleeritud emulgaatorained (PEG-ühendid), toorõli baasil valmistatud rasvained ja emulgaatorid s.h mineraalõlid ja -vahad
Edquist, Karl T.
2006-01-01
Comparisons are made between the LAURA Navier-Stokes code and Viking Lander Capsule hypersonic aerodynamics data from ground and flight measurements. Wind tunnel data are available for a 3.48 percent scale model at Mach 6 and a 2.75 percent scale model at Mach 10.35, both under perfect gas air conditions. Viking Lander 1 aerodynamics flight data also exist from on-board instrumentation for velocities between 2900 and 4400 m/sec (Mach 14 to 23.3). LAURA flowfield solutions are obtained for the geometry as tested or flown, including sting effects at tunnel conditions and finite-rate chemistry effects in flight. Using the flight vehicle center-of-gravity location (trim angle approx. equals -11.1 deg), the computed trim angle at tunnel conditions is within 0.31 degrees of the angle derived from Mach 6 data and 0.13 degrees from the Mach 10.35 trim angle. LAURA Mach 6 trim lift and drag force coefficients are within 2 percent of measured data, and computed trim lift-to-drag ratio is within 4 percent of the data. Computed trim lift and drag force coefficients at Mach 10.35 are within 5 percent and 3 percent, respectively, of wind tunnel data. Computed trim lift-to-drag ratio is within 2 percent of the Mach 10.35 data. Using the nominal density profile and center-of-gravity location, LAURA trim angle at flight conditions is within 0.5 degrees of the total angle measured from on-board instrumentation. LAURA trim lift and drag force coefficients at flight conditions are within 7 and 5 percent, respectively, of the flight data. Computed trim lift-to-drag ratio is within 4 percent of the data. Computed aerodynamics sensitivities to center-of-gravity location, atmospheric density, and grid refinement are generally small. The results will enable a better estimate of aerodynamics uncertainties for future Mars entry vehicles where non-zero angle-of-attack is required.
Directory of Open Access Journals (Sweden)
Jorge Enrique Machado-Alba
Full Text Available Con el objetivo de determinar la frecuencia de uso prolongado de antiinflamatorios no esteroideos (AINES en pacientes colombianos de alto riesgo cardiovascular (ARC se desarrolló un estudio retrospectivo en el cual se identificaron pacientes de ARC que usaron AINES por más de cinco meses continuos entre enero de 2011 y marzo de 2013. Se identificó a los pacientes que recibían crónicamente nitratos, digitálicos, y clopidogrel y ácido acetil salicílico (ASA, quienes fueron identificados como de ARC. Se realizó un análisis de frecuencias de uso según la comedicación recibida. Se encontró uso concomitante de AINES en el 0,35% de los consumidores de nitratos (tiempo promedio: 9,5 ± 4,4 meses, en el 0,36% de los consumidores de clopidogrel y ASA (tiempo promedio: 9,3 ± 3,4 meses, y en el 0,4% de los consumidores de digitálicos (10,2 ± 4,6 meses. Se concluye que existe una baja proporción de uso de AINES de manera crónica en pacientes de alto riesgo cardiovascular.
LENUS (Irish Health Repository)
Mansur, Abdurrezagh
2011-01-01
Acute interstitial nephritis (AIN) is a common cause of acute kidney injury and is characterised by a dense interstitial cellular infiltrate, which has not been well defined. Previous studies have demonstrated a correlation between Epstein-Barr virus (EBV) infection and AIN. The purpose of our study was to define the nature of the interstitial immune infiltrate and to investigate the possibility of renal infection with EBV.
Directory of Open Access Journals (Sweden)
Monsalve, A.
2005-10-01
Full Text Available An important feature of aluminium killed steels is the strong influence that aluminium nitride precipitates produce in both the mechanical properties and the final microstructural characteristics of the steel. This influence is related to the different stages of the fabrication process. This paper deals with a study of the effects of aluminium nitrides on the kinetics of recrystallisation. Different heat treatments were carried out, in one case to dissolve AIN, and in the other in order to precipitate AIN. These steels were subjected to cold rolling, followed by a batch annealing process. The recrystallised fraction was measured, thus obtaining the kinetic curves. The activation energy for recrystallisation was computed in each case. The results showed that AIN precipitation during recrystallisation produces a delay in recrystallisation kinetics through a change in the activation energy value.
Los aceros calmados con aluminio presentan como característica importante, la gran influencia que ejercen los nitruros de aluminio en las propiedades mecánicas y características microestructurales finales. Esta influencia está, a su vez, relacionada con cada una de la etapas del proceso de fabricación. En el presente trabajo se ha abordado el estudio del efecto de los nitruros de aluminio sobre la cinética de recristalización. Para ello, se han llevado a cabo diversos tipos de tratamientos térmicos, con el objeto de disolver todo el AIN y, en el otro caso, de precipitar todo el AIN. A continuación, los aceros estudiados se deformaron en frío y se les realizó un recocido convencional. Se midió la fracción recristalizada evaluando la energía de activación para la recristalización. Los resultados mostraron que la precipitación de AIN durante la recristalización produce un retraso en la cinética de recristalización, a través del cambio en el valor de la energía de activación
Teatriekspressiga Äksist Põltsamaale / Riina Mägi
Mägi, Riina, 1957-
2007-01-01
Jõgevamaa harrastus- ja projektitruppide vabaõhulavastuste esietendustest 2006. aastal : Priit Aimla "Saadjärve saamise lugu" (Tabivere Harrastusteater, lavastaja Tõnis Lepp), Oskar Lutsu loomingust inspireeritud Veiko Märka "Sabani sõlmes Luts" (Palamuse Amatöörteater, lavastaja Raivo Adlas), Marina Carri "Kassirabal" projektitrupi esituses, lavastaja Ain Saviauk, Mati Tiku "Legend" (Saare Valla Metsateater, lavastaja autor), Ain Saviaugu "Ulm ehk Unistus Liivimaast" (Põltsamaa teater Ellunäod, lavastaja autor)
AnAnalytical Study of Chinese Salt (MSG: Is it Halal or Haram (Urdu
Directory of Open Access Journals (Sweden)
Dr. Junaid Akbar
2017-01-01
Full Text Available Monosodium Glutamate is the scientific name of Chinese salt, which also called Ajinomoto. Monosodium Glutamate was first discovered by the Japanese chemist Ikeda Kibunae in 1908. The MSG was firstly derived from seaweed. Later on MSG was got from meat, gluten,and vegetables etc. It can be derived from Najasul‘ain and GherNajasul‘ain things. If it was got from Najasul ‘ain, then there is a question about MSG that is it Halal(permissible/ lawful or Haram(non-permissible/unlawful. This research in this article is concluded that if the culture of MSG is Halal or the properIsti Halah has been done in Najas; MSG will be Halal(permissible/ lawful. However, where no such details are available about the culture of MSG, it should be avoid, although it cannot be declared Haram as per Islamic Jurisprudence rules
Tawfik, Hatem A; Fouad, Yousef A; Hafez, Rashad
2015-01-01
Hatem A Tawfik,1 Yousef A Fouad,2 Rashad Hafez3 1Department of Ophthalmology, Oculoplastics Service, Ain Shams University, 2Faculty of Medicine, Ain Shams University, 3Eye Subspecialty Centre, Cairo, Egypt Objective: To introduce and evaluate the safety of a novel dual-sided electrosurgery handpiece design for simultaneous tissue cutting and coagulation. Methods: We designed a prototype double-sided handpiece allowing automatic switching between two electrodes with a simple handpiece flip. T...
Directory of Open Access Journals (Sweden)
Juan Villa
2014-11-01
Conclusiones: Algunos AINE pueden disminuir la efectividad del tratamiento antihipertensivo cuando se utilizan simultáneamente con antihipertensivos, en especial con inhibidores de la enzima conversora de angiotensina, diuréticos, bloqueadores beta y antagonistas de los receptores de angiotensina. No se encontró evidencia de la modificación del efecto de los antagonistas de los canales de calcio, especialmente dihidropiridínicos, por el uso simultáneo con AINE.
Synthesis of TiCuAg thick film inks for glass frit free metallization of aluminium nitride
International Nuclear Information System (INIS)
Adlassnig, A.; Schuster, J. C.; Smetana, W.; Reicher, R.
1997-01-01
A glas frit free screen printing ink for metallization of AIN was developed. Bonding to the substrate is achieved by active metal additives. The metallic component consists of Cu and Ag powder synthesized from inorganic salts by the polyol process, and Cu-Ti powder synthesized by arc melting, milling and ultracentrifugation. This ternary powder mixture was introduced to a specifically developed organic vehicle and screen printed onto AIN. The detailed development process and the results will be presented. (author)
Talendid, kes tulid tagasi koju / Laura Mallene
Mallene, Laura
2010-01-01
IsePankuri asutajast Pärtel Tombergist, start-up firmaga Cutefund tegelevast Enn Metsarist, riigikantselei EL-i sekretariaadi konsultandist Katrin Juhandist, Küberkaitse Kompetentsikeskuse töötajast Anna-Maria Talihärmist, LHV Turunduse töötajast Ellen Murulast, Elioni finantsanalüütikust Artur Elmest
International Nuclear Information System (INIS)
Wong, R.K.
2000-01-01
After implantation of As, As + Be, and As + Ga into GaN and annealing for short durations at temperatures as high as 1500 C, the GaN films remained highly resistive. It was apparent from c-RBS studies that although implantation damage did not create an amorphous layer in the GaN film, annealing at 1500 C did not provide enough energy to completely recover the radiation damage. Disorder recovered significantly after annealing at temperatures up to 1500 C, but not completely. From SIMS analysis, oxygen contamination in the AIN capping layer causes oxygen diffusion into the GaN film above 1400 C. The sapphire substrate (A1203) also decomposed and oxygen penetrated into the backside of the GaN layer above 1400 C. To prevent donor-like oxygen impurities from the capping layer and the substrate from contaminating the GaN film and compensating acceptors, post-implantation annealing should be done at temperatures below 1500 C. Oxygen in the cap could be reduced by growing the AIN cap on the GaN layer after the GaN growth run or by depositing the AIN layer in a ultra high vacuum (UHV) system post-growth to minimize residual oxygen and water contamination. With longer annealing times at 1400 C or at higher temperatures with a higher quality AIN, the implantation drainage may fully recover
Energy Technology Data Exchange (ETDEWEB)
Wong, Raechelle Kimberly [Univ. of California, Berkeley, CA (United States)
2000-04-01
After implantation of As, As + Be, and As + Ga into GaN and annealing for short durations at temperatures as high as 1500 C, the GaN films remained highly resistive. It was apparent from c-RBS studies that although implantation damage did not create an amorphous layer in the GaN film, annealing at 1500 C did not provide enough energy to completely recover the radiation damage. Disorder recovered significantly after annealing at temperatures up to 1500 C, but not completely. From SIMS analysis, oxygen contamination in the AIN capping layer causes oxygen diffusion into the GaN film above 1400 C. The sapphire substrate (A1203) also decomposed and oxygen penetrated into the backside of the GaN layer above 1400 C. To prevent donor-like oxygen impurities from the capping layer and the substrate from contaminating the GaN film and compensating acceptors, post-implantation annealing should be done at temperatures below 1500 C. Oxygen in the cap could be reduced by growing the AIN cap on the GaN layer after the GaN growth run or by depositing the AIN layer in a ultra high vacuum (UHV) system post-growth to minimize residual oxygen and water contamination. With longer annealing times at 1400 C or at higher temperatures with a higher quality AIN, the implantation drainage may fully recover.
Directory of Open Access Journals (Sweden)
Luciano Passamani Diogo
2010-12-01
Full Text Available FUNDAMENTO: A associação entre o uso de anti-inflamatórios não-esteroides (AINEs e insuficiência renal aguda ou crônica é bem documentada, mas evidências sobre a associação entre AINEs e nefropatia induzida por contraste (NIC não são encontradas na literatura. OBJETIVO: Avaliar uma possível associação entre AINEs e NIC. MÉTODOS: Em um estudo de coorte, através da entrevista clínica de pacientes que foram submetidos à cateterização cardíaca, analisamos o uso de AINEs e sua associação com desenvolvimento de NIC, através da alteração dos níveis de creatinina sérica ou taxa de filtração glomerular em 48 ou 72 horas. RESULTADOS: No período de julho de 2005 a julho de 2006, 236 pacientes foram incluídos no estudo, dos quais 29 foram posteriormente excluídos. A incidência de NIC foi 10,37% (20 de 207 e 42% dos pacientes estavam recebendo AINEs até o momento da avaliação. Não houve associação entre o uso de AINEs e o desenvolvimento de NIC com OR de 1,293; IC95% (0,46-4,2. O estudo detectou fatores de risco conhecidos para o desenvolvimento de NIC, tais como diabete, com OR de 2,77; IC95% (1,05-7,47 e insuficiência renal crônica com OR de 3,48; IC95% (1,1-11,07 e também sugeriu uma ação protetora da hidratação com solução salina com OR de 0,166; IC95% (0,03-0,92. CONCLUSÃO: Com base nos dados obtidos, concluímos que não houve associação entre NIC e uso prévio de AINEs, pelo menos com um OR > 2,85, o qual nossa amostra detectou.FUNDAMENTO: La asociación entre el uso de antiinflamatorios no esteroides (AINEs e insuficiencia renal aguda o crónica está bien documentada, pero evidencias sobre la asociación entre AINEs y nefropatía inducida por contraste (NIC no son encontradas en la literatura. OBJETIVO: Evaluar una posible asociación entre AINEs y NIC. MÉTODOS: En un estudio de cohorte, a través de la entrevista clínica de pacientes que fueron sometidos a cateterismo cardíaco, analizamos el
Impôts Français : CRDS - French version only
2003-01-01
Avis de dégrèvements IMPORTANT : Cette note d'information concerne uniquement : - les membres du personnel de nationalité française ou résidents permanents1 , domiciliés en France dans le département de l'Ain et rémunérés par le CERN (titulaires, boursiers, attachés payés et de projet) ; - Les anciens membres du personnel de l'Organisation, bénéficiaires de la Caisse de Pensions du CERN, domiciliés ou ayant été domiciliés en France dans le département de l'Ain. Ces personnes ont récemment reçu, ou sont sur le point de recevoir, un avis de dégrèvement émanant de la Direction des Services Fiscaux de l'Ain (DSFA) et portant sur la Contribution au Remboursement de la Dette Sociale (CRDS). I. Informations général...
Hinsberg, Ain
2001-01-01
Helsingi ja Tallinna vahel liikuvate laevafirmade konkurents: Silja Line, Nordic Jet Line, Tallink ja Linda Line. Tabelid: reisijad laevaliinil Helsingi-Tallinn 1998-2001; Helsingi-Tallinna liinil kiirlaevade turuosad 1999-2000
Piperazine side-effects in a patient with pre-existing renal insufficiency
Directory of Open Access Journals (Sweden)
Majid Malaki
2014-01-01
Full Text Available Piperazine as an antihelminth has many adverse effects, especially on patients with renal insufficiency. We report the use of piperazine in a girl with a moderately severe kidney disease due to Biedl Bardet syndrome. She developed coma and acute kidney injury due to acute interstitial nephritis (AIN, anemia and thrombocytopenia. The presence of fever, proteinuria, acidosis, anemia, sterile pyuria and non-oliguric renal failure strongly suggested AIN. Her problems abated mostly by discontinuing of piperazine and supportive therapy, except anemia and thrombocytopenia.
Iga maastik on hingeseisund = Every landscape is a condition of the spirit / Piret Karro
Karro, Piret, 1991-
2016-01-01
Laura Põllu isiknäitus "Sada ulma keset merd" Tartu Kunstimuuseumis (Tartmusis). Ruumiinstallatsioonis on kombineeritud maali-, video-, skulptuuri- ja tekstilahendusi. Helikujunduse autor on Juhan Vihterpal, kuraator Peeter Talvistu
Gene : CBRC-GGOR-01-1448 [SEVENS
Lifescience Database Archive (English)
Full Text Available ain Friedlin] 1e-79 49% MCLALGSAGTADDVKLHPVACADTARSTPGTSAPSTPGTSAPSTPGTSAPSTSGISAPSTSGTSAPSTLGTSAPSKPGTSAPSKPGISAPSTSGISAPSTSGTSA...PSTSGTSAPSTPGTSAPSKPGTSAPSKPGISAPYTPGTSAPSTLGTSAPSTPGTSAPSTPGTSAPSKPGTSAPSKPGTSA...PSTPGTSAPSTLGTSAPSTPGTTAPSTAGTSAPSTSGTSAPSTSGTSAPSKPTTSAPYTPGTSAPSIPGTSAPSTTGTSAPSTPGTSAPSTPGTSAPSKPGTSAPSTPGTSA...PSTLGTSAPSTPGTSAPSTPGTSAPSKPGTSAPSMSGTSAPSTPGTSVPSKAGTSAPVDPGVLWGLERPLTDTEGRWLPPYVLL
Noortenäidend kulgeb teismeliste tempos / Sandra Sillaots
Sillaots, Sandra
2009-01-01
Pärnu Endla teatris etendunud lavastusest "Oma elu superstaarid". Autorid Triinu ja Laura-Marie Ojalo, lavastaja Enn Keerd, kunstnik Tuulikki Ojalo. Ka peategelase Eliis Vaiksaare (Lenna) osatäitmisest
Aluminium nitrate ceramics: A potential UV dosemeter material
DEFF Research Database (Denmark)
Trinkler, L.; Bøtter-Jensen, L.; Berzina, B.
2002-01-01
The ceramic material AIN-Y2O3 is proposed as a potential ultraviolet radiation (UVR) dosemeter using optically stimulated luminescence (OSL) and thermally stimulated luminescence (TL). Experimental studies have shown that AIN ceramics exhibit attractive characteristics suitable for practical UV...... dosimetry applications. The features are: (1) the spectral sensitivity covers the 200-350 nm range, in the UV-B region it is similar to that of human skin: (2) the angular dependence of the incident radiation follows the cosine law; (3) high yields of both UVR-induced OSL and TL signals compared to those...
Cavicchi, Elizabeth Mary
Physics is conventionally taught as a fixed curriculum which students must master. This thesis changes that: curriculum emerges from what learners try and question in experiments they invent. The thesis narrates: three adult students exploring wires, batteries and bulbs with me as teacher; nineteenth century investigations of electromagnetism; my laboratory work replicating historic instruments. In each case, learning arose through activity with materials. Evidences of this are analyzed within narratives and reflections. I used teaching-research, a method developed by Duckworth from Piaget's clinical interviewing, to research and simultaneously extend students' evolving understandings. What I learned through questioning students informed my next interactions; what they learned extended their experimenting. Similarly, I researched historical accounts interactively: improvising experiments to develop my understandings. Studying my own learning deepened my interpretations of students' learning. My students Laura, David and Jamie experimented by: soldering bulbs to wires, making series and parallel circuits, inserting resistive wire that dimmed bulbs, conducting electricity through salt water They noticed bulb brightness and battery heat, compared electricity's paths, questioned how voltage and current relate. They inferred electricity's effects manifest magnitudes of material properties. They found their experiences while learning were inseparable from what they learned. I researched investigations connected with Cavendish's leather fish, Galvani's frogs, Schweigger's wire spiraled around a compass needle, Henry's electromagnets, Faraday's induction ring, induction devices of Page, Callan, Hearder. Experimentally, I made galvanometers, electromagnets, induction rings, induction coil. I observed effects of electromagnetism, internal resistance, induced sparking. Across these investigations, learning developed with instrumental innovations; confusions were productive
Gutierrez, K; Kasimanickam, R; Tibary, A; Gay, J M; Kastelic, J P; Hall, J B; Whittier, W D
2014-04-15
The objective was to determine the effects of reproductive tract score (RTS) on reproductive performance in beef heifers bred by timed artificial insemination followed by natural service (AI-NS) or by natural service only (NSO). Angus cross beef heifers (n = 2660) in the AI-NS group were artificially inseminated at a fixed time (5- or 7-day CO-Synch + controlled internal drug release protocol) once, then exposed to bulls 2 weeks later (bull-to-heifer ratio = 1:40-1:50) for the reminder of the 85-day breeding season. Angus cross beef heifers (n = 1381) in NSO group were submitted to bulls (bull-to-heifer ratio = 1:20-1:25) for the entire 85-day breeding season. Heifers were reproductive tract scored from 1 (prepubertal) to 5 (cyclic) 4 weeks before, and were body condition scored (BCS) from 1 (emaciated) to 9 (obese) at the beginning of breeding season. Pregnancy diagnosis was performed 70 days after AI for AI-NS group and 2 months after the end of breeding season for both groups. Heifers in both groups were well managed and of similar age (14.9 ± 0.4 [AI-NS] and 14.7 ± 0.8 [NSO] months). Pregnancy rates (PRs) and number of days to become pregnant were calculated using PROC GLIMMIX and PROC LIFETEST procedures of SAS. Adjusting for BCS (P = 0.07), expressed estrus (P < 0.05), year (P < 0.05), and BCS by year interaction (P < 0.05), the AI-PR was greater for heifers in AI-NS group with higher RTS (P < 0.0001; 40.7%, 48.3%, 57.6%, and 64.6% for RTS of 2 or less, 3, 4, and 5, respectively). Controlling for BCS (P < 0.05), year (P < 0.05) and the breeding season pregnancy rates (BS-PRs) were greater for heifers in the AI-NS group with higher RTS (P < 0.01; 81.2%, 86.5%, 90.4%, and 95.2% for RTS of 2 or less, 3, 4, and 5, respectively). Similarly, adjusting for BCS, year (P < 0.05), the BS-PR was greater for heifers in NSO group with higher RTS (P < 0.01; 79.7%, 84.3%, 88.4%, and 90.2% for RTS of 2 or less, 3, 4, and 5, respectively). Heifers with higher RTS
Veterinary and human medicine: learning from each other.
Honey, Laura
2016-03-26
A well-attended session at this year's joint SPVS/VPMA congress considered what lessons the medical and veterinary professions might learn from one another. Laura Honey reports. British Veterinary Association.
Charting Transnational Native American Studies
Directory of Open Access Journals (Sweden)
Hsinya Huang
2012-06-01
Full Text Available Introduction to the Special Forum entitled "Charting Transnational Native American Studies: Aesthetics, Politics, Identity," edited by Hsinya Huang, Philip J. Deloria, Laura M. Furlan, and John Gamber
Ülemaaline ilulugejate 15. võistulausumine
2008-01-01
Vabariiklikust etlejate konkursist. 4.-6. klasside arvestuses võitis Grand Prix'i Markkus Pulk, laureaatideks tulid Maria Pihlak, Kenneth Norden ja Laura Elisabeth Konsand. Eripreemiad said Laura Oolup, Maria Zaitseva, žürii aitähi said Sander Aavik ja Liisa Lutter. 7.-9. klasside arvestuses võitis Grand Prix' Anna Talvi, laureaatideks tulid Liisa Saaremäel, Karmen Kozma, Riko Osila. Eripreemiad said Indrek Jõe, Eliise Seedre, žürii aitähi sai Kirke Algma. 10.-12. klasside arvestuses võitis Grand Prix' Doris Tääker, laureaatideks tulid Jörgen Liik, Virgo Ernits ja Ilja Massalov. eripreemiad said Marian Heinat ja Kadri Toomsalu. Kuressaare Gümnaasiumi õpilasžürii preemiad läksid Kenneth Nordenile, Riko Osilale ja Doris Tääkerile
Violence, Oppression, and Double Standards in Three Colombian Films
Directory of Open Access Journals (Sweden)
Melissa R. Meade
2011-08-01
Full Text Available This article compares three Colombian films that tell distinct stories of violence, personal and political oppression, and double standards. The films Confesión a Laura (Confessing to Laura, Jaime Osorio, 1991, La Primera Noche (The First Night, Luis Alberto Restrepo, 2003 and El Rey (The King, José Antonio Dorado, 2004 each highlight the characters’ struggles in the Colombian socio-political landscape. Each film’s content and themes do not merely offer representations of national culture, but also provide a way in which to discuss the political and social struggles of Colombia. The directors explore these stories of violence and socio-political struggle through the use of mis-en-scène, cinematography, sound, and editing.
2001-01-01
Kuraator Rael Artel. Väljas on Laura Kallasvee "I love labels", Maiu Kurvitsa kontseptuaalne projekt "Odav jutt", Peeter Lauritsa "Paabeli torn" (1991), tundmatu kunstniku tekstiilist käsitöötoode.
Low Median Nerve Palsy as Initial Manifestation of Churg-Strauss Syndrome.
Roh, Young Hak; Koh, Young Do; Noh, Jung Ho; Gong, Hyun Sik; Baek, Goo Hyun
2017-06-01
Anterior interosseous nerve (AIN) syndrome is typically characterized by forearm pain and partial or complete dysfunction of the AIN-innervated muscles. Although the exact etiology and pathophysiology of the disorder remain unclear, AIN syndrome is increasingly thought to be an inflammatory condition of the nerve rather than a compressive neuropathy because the symptoms often resolve spontaneously following prolonged observation. However, peripheral neuropathy can be 1 of the first symptoms of systemic vasculitis that needs early systemic immunotherapy to prevent extensive nerve damage. Churg-Strauss syndrome (CSS; eosinophilic granulomatosis with polyangiitis) is 1 type of primary systemic vasculitis that frequently damages the peripheral nervous system. CSS-associated neuropathy usually involves nerves of the lower limb, and few studies have reported on the involvement of the upper limb alone. We report on a rare case of low median nerve palsy as the initial manifestation of CSS. The patient recovered well with early steroid treatment for primary systemic vasculitis. Copyright © 2017 American Society for Surgery of the Hand. Published by Elsevier Inc. All rights reserved.
ORF Alignment: NC_003212 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available ain Clip11262) ... Length = 200 ... Query: 88 ... NAGLIKIGISEPSASLVLPQILKQFLTDFP...KLMVNVSVDDANTCSQKLIDGEIDFAICGE 147 ... NAGLIKIGISEPSASLVLPQILKQFLTDFPKLMVNVSVDDANTCSQKLIDGEIDFAICGE Sbjct: 1 ... NAGLIKIGISEPS
Directory of Open Access Journals (Sweden)
Michel Batlouni
2010-04-01
Full Text Available Os anti-inflamatórios não esteroides (AINEs encontram-se entre os medicamentos mais prescritos em todo o mundo. Essa classe heterogênea de fármacos inclui a aspirina e vários outros agentes inibidores da ciclo-oxigenase (COX, seletivos ou não. Os AINEs não seletivos são os mais antigos, e designados como tradicionais ou convencionais. Os AINEs seletivos para a COX-2 são designados COXIBEs. Nos últimos anos, tem sido questionada a segurança do uso dos AINEs na prática clínica, particularmente dos inibidores seletivos da COX-2. As evidências sobre o aumento do risco cardiovascular com o uso de AINEs são ainda incompletos, pela ausência de ensaios randomizados e controlados com poder para avaliar desfechos cardiovasculares relevantes. Entretanto, os resultados de estudos clínicos prospectivos e de meta-análises indicam que os inibidores seletivos da COX-2 exercem importantes efeitos cardiovasculares adversos, que incluem aumento do risco de infarto do miocárdio, acidente vascular cerebral, insuficiência cardíaca, insuficiência renal e hipertensão arterial. O risco desses efeitos adversos é maior em pacientes com história prévia de doença cardiovascular ou com alto risco para desenvolvê-la. Nesses pacientes, o uso de inibidores da COX-2 deve ser limitado àqueles para os quais não há alternativa apropriada e, mesmo assim, somente em doses baixas e pelo menor tempo necessário. Embora os efeitos adversos mais frequentes tenham sido relacionados à inibição seletiva da COX-2, a ausência de seletividade para essa isoenzima não elimina completamente o risco de eventos cardiovasculares, de modo que todos os fármacos do largo espectro dos AINEs somente devem ser prescritos após consideração do balanço risco/benefício.Los antiinflamatorios no esteroides (AINEs se encuentran entre los medicamentos más prescriptos en todo el mundo. Esta clase heterogénea de fármacos incluye la aspirina y varios otros agentes
Südames on armastuse kodu / Lembit Peterson, Marius Peterson
Peterson, Lembit, 1953-
2006-01-01
Theatrumis tuleb lavale Karol Wojtyla (Paavst Johannes Paulus II) kirjutatud näidend "Juveliiri poe ees". Lavastuses osaleb pea kogu perekond Petersonid. Laura, Marius, Mare, Maria ja Lembit Peterson endast ja peresidemetest
PENi kirjandusauhinnad selgunud : [sõnum
2002-01-01
Nabokovi-preemia Mario Vargas Llosale; Laura Pelsi auhind Tony Kushnerile ja Maria Irene Fornesile; uudsena noortele kirjanike määratava Robert Binghami auhinna saavad Carolyn Cooke, Matthew Klam ja Manil Suri
Tartust pärit eurolauljate võiduvõimalused vähenesid / Karin Palo
Palo, Karin
2005-01-01
Tänavusest Eesti Eurovisiooni finaalist, lauljast Laura Põldverest lauludega "Moonwalk ja "Let's Get Loud" (viimane ansambli Suntribe koosseisus)" ja Julia Bomani esitatud laulu "Nevermore Island" väljajätmisest finaalvõistlusest
Kaila, Jan
2013-01-01
Paul Kuimeti ja Mika Rikala ühisnäitusest "Clouds and Waves" Hobusepea galeriis. Aliina Astrova kuraatoriettekanne Paul Kuimeti ja Laura Tootsi ühisnäitusel "Not Necessarily So" Temnikova & Kasela galeriis
Heard, Isabelle; Etienney, Isabelle; Potard, Valérie; Poizot-Martin, Isabelle; Moore, Catherine; Lesage, Anne-Carole; Ressiot, Emmanuelle; Crenn-Hebert, Catherine; Fléjou, Jean-François; Cubie, Heather; Costagliola, Dominique; Darragh, Teresa M
2015-05-15
Although human immunodeficiency virus (HIV)-infected women are at high risk for anal cancer, few data have been published on prevalence of and risk factors for anal precancer and potential screening strategies in this risk group. A cross-sectional anal screening study was nested in a gynecological cohort of HIV-infected women. Anal swab specimens were collected for cytology and human papillomavirus (HPV) testing. High-resolution anoscopy, with biopsy when indicated, was systematically performed. Among the 171 enrolled women, median age was 47.3 years and 98% were receiving combination antiretroviral therapy. Median CD4(+) count was 655 cells/µL and HIV load was associated with increased risk of HG-AIN+. Abnormal anal cytology and HPV-16 infection performed best as a screening strategy for HG-AIN+ histology, with positive likelihood ratios of 3.4 (95% CI, 2.3-5.1) and 4.7 (95% CI, 2.5-8.7) and negative likelihood ratios of 0.2 (95% CI, .07-.8) and 0.4 (95% CI, .2-.9), respectively. HIV-infected women with a history of HPV-associated cervical disease are at increased risk for HG-AIN+ and should be offered anal cancer screening. Anal cytology and HPV-16 genotyping had the best screening performance. Anal cytology is easy to perform routinely; it may be the best candidate for screening for HG-AIN among HIV-infected women. © The Author 2015. Published by Oxford University Press on behalf of the Infectious Diseases Society of America. All rights reserved. For Permissions, please e-mail: journals.permissions@oup.com.
Dun, Wang-Huan; Yang, Jing; Yang, Ling; Ding, Dun; Ma, Xue-Ying; Liang, Feng-Li; von Deneen, Karen M; Ma, Shao-Hui; Xu, Xiao-Ling; Liu, Jixin; Zhang, Ming
2017-12-01
Neuroimaging studies have demonstrated the critical role of the insula in pain pathways and its close relation with the perceived intensity of nociceptive stimuli. We aimed to identify the structural and functional characteristics of the insula during periovulatory phase in women with primary dysmenorrhea (PDM), and further investigate its association with the intensity of perceived pain during menstruation. Optimized voxel-based morphometry and functional connectivity (FC) analyses were applied by using 3-dimensional T1-weighted and resting functional magnetic resonance imaging (fMRI) in 36 patients at the peri-ovulation phase and 29 age-, education-, and gender-matched healthy controls (HC). A visual analogue scale (VAS) was used to examine the intensity of the abdominal pain at periovulation and menstruation. In our results, PDM patients had significant higher VAS-rating during menstruaion than periovulation. Compared with the HC, PDM patients had lower gray matter density in the left anterior insula (aINS). Taken the left aINS as a seed region, we further found hypoconnectivity between aINS and medial prefrontal cortex (mPFC), which showed negative relation with the VAS during menstruation. As the aINS is a key site of the salience network (SN) and the mPFC is a critical region in the default mode network (DMN), it's implicated a trait-related central-alteration that communications between pain attention and perception networks were disrupted without the ongoing menstrual pain. Moreover, result of correlation analysis, at least in part, suggested a possible role of altered FC (pain-free period) in predicting pain perception (menstruation).
The Rethorics of Gaze in Luhrmann's "Postmodern Great Gatsby"
Directory of Open Access Journals (Sweden)
Paola Fallerini
2014-05-01
Adopting the perspective suggested by the rhetoric of the gaze (Laura Mulvey it is highlighted the metalinguistic and metatextual reflection through which this movie contributes to the critical interpretation of Fitzgerald’s novel.
Avestik, Rait, 1974-
2007-01-01
Vastukaja "Eesti Ekspressi" kultuurilisas "Areen" ilmunud Liina Jürgeni kirjutisele, kus autor veebipäeviku vormis kajastas Vanemuises etendunud ameerika kirjaniku Laura Cunninghami tragikomöödiat "Beautiful Bodies", lavastaja Jüri Lumiste
Directory of Open Access Journals (Sweden)
О С Чеснокова
2008-03-01
Full Text Available The article focuses on the comparison of the translations of the novel «Como agua para chocolate» (1989 by Laura Esquivel into Russian and English and their semiotic manifestations.
75 FR 48880 - Approval and Promulgation of Gila River Indian Community's Tribal Implementation Plan
2010-08-12
... in August 1995 by then-Governor Mary Thomas. Beginning in 1998, the GRIC DEQ, with assistance from.... See Letter dated June 22, 2009, from Margaret Cook, Executive Director, GRIC DEQ, to Laura Yoshii...
KRYMCHANTOWSKI, ABOUCH V.; BARBOSA, JACKELINE
1999-01-01
Alguns antinflamatórios não esteroidais (AINE) orais são eficientes para o tratamento dos ataques de migrânea ou enxaqueca. A despeito de sua eficiência para o tratamento destas cefaléias e de outras dores, existem comercialmente poucos antinflamatórios não esteroidais disponíveis para administração parenteral. O clonixinato de lisina (CL) é um AINE derivado do ácido nicotínico que foi comprovadamente eficiente em vários tipos de síndromes álgicas como cólica renal, dor de compressão nervosa,...
Tissot, B; Lamy, A; Perraudeau, F; Manouvrier, J L; Imbert, Y
2002-07-13
We report the case of severe colitis occurring during treatment with non-steroid anti-inflammatories (NSAI). A 57 year-old woman was hospitalized for lumbar pain that had not been relieved by AINS, tramadol and then morphine. The patient presented with septic shock and peritonitis by rectal perforation, followed by acute rectorrhagia. The endoscopic aspect evoked Crohn's disease with a recto-vaginal fistula. Progression was further complicated by two episodes of collapse because of acute rectorrhagia, requiring hemostasis colectomy and abdominal-perineal amputation. The diagnosis retained was AINS-induced colitis complicated by acute colectasia on a fecaloma with recto-vaginal fistula.
Directory of Open Access Journals (Sweden)
Siti Hajariah
2017-08-01
Full Text Available Abstrak. Action telah memantapkan dirinya sebagai salah satu genre terkemuka yang telah hadirdi industri film untuk waktu yang lama. Meskipun film aksi sering kali diidentifikasi dengan filmproduksi Hollywood, dan disebut sebagai state-of-the-art dari film aksi, film Jmaes Bond,bagaimanapun, adalah pertama dan terutama adalah produk Inggris. Bergenre action, film iniditandai sebagai film berorientasi laki-laki (Tasker 2004: 8 sementara itu melalui esainya VisualPleasure and Narrative Cinema” oleh Laura Mulvey (1975 mengingatkan kita pada bagianpenting yang dimainkan oleh isu gender dan kritik film yang feminis, dalam analisis film aksi.Makalah ini membahas perkembangan film laga atau aksi dalam proses untuk membangunkarakter heroik perempuan, yang menunjukkan gagasan perempuan 'maskulinitas', istilah yangdiciptakan oleh Tasker (1993. Penguatan kode biner gender telah diteliti pada film-film aksiyang mengarah ke argumen pada identifikasi pemberdayaan atau eksploitasi dalam aksi yangdipilih teks filmis dari 2010 dan 2011. Perempuan Berdasarkan teori Laura Mulvey padapandangan laki-laki, analisis skrining tubuh di film action berkisar pada aspek narasi, dansinematografi film yang dipilih: Salt (Phillip Noyce, 2010.Abstrak. Action telah memantapkan dirinya sebagai salah satu genre terkemuka yang telah hadirdi industri film untuk waktu yang lama. Meskipun film aksi sering kali diidentifikasi dengan filmproduksi Hollywood, dan disebut sebagai state-of-the-art dari film aksi, film Jmaes Bond,bagaimanapun, adalah pertama dan terutama adalah produk Inggris. Bergenre action, film iniditandai sebagai film berorientasi laki-laki (Tasker 2004: 8 sementara itu melalui esainya VisualPleasure and Narrative Cinema” oleh Laura Mulvey (1975 mengingatkan kita pada bagianpenting yang dimainkan oleh isu gender dan kritik film yang feminis, dalam analisis film aksi.Makalah ini membahas perkembangan film laga atau aksi dalam proses untuk membangunkarakter heroik
Toomas Kalve : Kontakt-impressioonid = Contact-impressions / Laura Kuusk
Kuusk, Laura, 1982-
2007-01-01
1990-ndatel hakkas fotograafia omandama täisväärtusliku kunstiliigi rolli. Kunstnikuna tegeleb Toomas Kalve mustvalge fotoga ning tema tööde puhul on oluline roll kasutataval autoritehnoloogial. Ta pildistab plaatkaameraga, mille vanimad negatiivid on aastast 1939 ja Pariisis käsitsi lihvitud objektiiv kannab aasta numbrit 1872. Näitusele jõuavad negatiividest tehtud kontaktkoopiad. Fotografeerimine on tema jaoks rituaal, tema tehika ja töömeetodid on olnud kasutusel fotograafia leiutamisest alates ja samasugune staatilisus õhkub ka tema pruunitoonilistest piltidest. Tema tööd on läbimõeldud, ülimalt komponeeritud, lavastuslikud ning mängulised, hetk ei ole tema jaoks kahanev väärtus, vaid lõpmatu konstant
Walter Benjamin i l'aura de l'autobiografia
Martí Monterde, Antoni, 1968-
2006-01-01
És la biblioteca una forma d'autobiografia? Només caldria un sol escrit que ho demostrés de manera plena per a afirmar que sí, i aquest text el va escriure Walter Benjamin, qui el 17 de juliol de 1931 va publicar, a Die literarische Welt, 'un discurs sobre el col·leccionisme' sota el títol 'Tot desembolicant la meua biblioteca'.
ORF Alignment: NC_003212 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available ain ... Clip11262) ... Length = 73 ... Query: 8 ... ASALLELIGGKENISSVTHCATRMRFV...LLDPDNADVEAIEDIPAVKGTFTQAGQFQVIIG 67 ... ASALLELIGGKENISSVTHCATRMRFVLLDPDNADVEAIEDIPAVKGTFTQAGQFQ...VIIG Sbjct: 1 ... ASALLELIGGKENISSVTHCATRMRFVLLDPDNADVEAIEDIPAVKGTFTQAGQFQVIIG 60 ...
Kohastumus eluks vee ääres / Laura Kuusk
Kuusk, Laura, 1982-
2007-01-01
4. "Ars Baltica" fototriennaal Kumu Kunstimuuseumis kuni 30. IX. Tellervo Kalleineni ja Oliver Kochta-Kalleineni, Alexander Vaindorfi, Coloneli (Thierry Geoffroy) ja Khaled D. Ramadani, Kaspars Goba, Tanja Nellemann Poulseni, Katrin Teesi, Anu Pennaneni, Petra Baueri, Talleiv Taro Manumi (sünd. 1968 Jaapanis, elab Norras), Olga Tshernõsheva, Kristina Inciuraite, Julita Wojciki, Sven Johne, Anna Baumgarti, Arturas Valiauga ja duo J&K (Janne Schäfer, Kristine Agergaard) töödest
Pedro Meyer vastutab oma piltide eest / Laura Kuusk
Kuusk, Laura, 1982-
2007-01-01
Mehhiko fotograafi Pedro Meyeri tutvustus. P. Meyeri ettekande tekst "Kui dokumentaalne teile meeldis, siis digitaalset hakkate armastama", esitatud Soomes Jyväskyläs 2006. a. oktoobris toimunud fotograafiakonverentsil
People, art and the human environment / Laura Kuusk
Kuusk, Laura, 1982-
2009-01-01
Tutvustatakse Eestis toimunud kunstiprojekte, mis on seotud kunstipraktika, igapäevase elu, inimsuhete ja avaliku ruumiga. Sirja-Liisa Vahtra ja Otto von Buschi kunstiprojektist (2004), Martin Pääsukese plakatitest "Vabadus" linnaruumis (2008), Ave Teeääre ja Kertu Ehala projektist "Painting Club" Ravila hooldekodus (2007), rühmituse Johnson&Johnson "Paldiski projektist" (2006-2008), Riin Kranna-Rõõsi ja Eve Arpo projektist "Päev ilma mobiilita". Kunstnikest, kes on dokumenteerinud Tallinnas toimunud aktsioone. Kunsti ja sotsiaalset praktikat ühendavatest institutsioonidest (kultuuritehas Polymer, Kultuurikatel, Linnalabor jt.)
Notes on Paul Kuimet / Pille Epner
Epner, Pille
2011-01-01
Fotograaf Paul Kuimetist, tema loomingust, Tallinnas Hobusepea galeriis toimunud isikunäitusest "In Vicinity" (2010), mis uuris valglinnastumist, kohaspetsiifilisest installatsioonist "Untitled" (2010) ja näitusest "Not Necessarily So" (koos Laura Tootsiga, 2010) Linzis
Ernesto Preatoni soovis end 100 miljoni eest vabaks osta / Risto Berendson
Berendson, Risto, 1975-
2004-01-01
Prokurör Laura Vaik põhjendab, miks ta loobus tema enda ja Itaalia ärimehe Ernesto Preatoni advokaatide vahel sõlmitud esialgsest kokkuleppest, mille kohaselt oleks Preatoni maksnud riigile kokku 100 mln krooni
Kurjade bakterite kõrvalmõju / Villu Zirnask
Zirnask, Villu, 1966-
2012-01-01
Alessandra Fogli Minnesota ülikoolist ning Laura Veldkamp Sterni ärikoolist kirjeldasid oma uuringus "Germs, social networks and growth" inimkontakti kaudu levivate haiguste esinemissageduse abil ühiskonna sotsiaalset struktuuri ning selle seost tehnoloogiate levimisega
Living with Crohn's Disease | NIH MedlinePlus the Magazine
... courtesy of Laura King Benjamin King, star of Disney Channel's hit TV series Liv and Maddie , helps ... root in so many homes that watch the Disney Channel and have children—especially considering the number ...
Comentario bibliográfico de La revisión judicial de las políticas sociales. Estudio de Caso
Directory of Open Access Journals (Sweden)
Bulit Goñi, Magdalena
2011-12-01
Full Text Available Comentario bibliográfico de ABRAMOVICH, Víctor y PAUTASSI, Laura (comp.: La revisión judicial de las políticas sociales. Estudio de casos, Editores del Puerto, Buenos Aires, 2009.
Directory of Open Access Journals (Sweden)
Khadija OUAISSA
2017-05-01
Full Text Available The objective of our study is to test the efficacy of an extruded food on the growth performance of rainbow trout (Oncorhynchus mykiss Walbaum, 1792 at the fish farm Ain Aghbal in Azrou (Morocco. Generally, only the biochemical composition (percentages of moisture, proteins, lipids and carbohydrates and the (digestible and crude energies of the food are previously known, which is insufficient for the choice of the food in terms of growth performance and quality/environment. The rainbow trout breeding tanks used for this test are 222 days (15 June 2015 - 28 February 2016 are fed with water directly taken from the water of the Oum Er-Rbia sources according to an open circuit with a Renewal of water every half hour. The flow rate is 11.04m3/h. The initial breeding conditions, the density (Kg per volume 1.58kg/m3 and the initial charge with respect to the flow rate is 1.05 m3 / h. Fish are fed by ratios two to three times per day depending on the rearing stage. The frequency of sampling is biweekly where we measured the zootechnical performances of the fish and taken water samples for physicochemical analyzes in order to assess the quality of the waters of exit of the basins before their rejection in the Oum-Er-Rbia river. The results show that the test food shows a better growth of the rainbow trout and a conversion index not exceeding 0.9 for a size of 1043 g of trout.
SHORTER MENSTRUAL CYCLES ASSOCIATED WITH CHLORINATION BY-PRODUCTS IN DRINKING WATER
Shorter Menstrual Cycles Associated with Chlorination by-Products in Drinking Water. Gayle Windham, Kirsten Waller, Meredith Anderson, Laura Fenster, Pauline Mendola, Shanna Swan. California Department of Health Services.In previous studies of tap water consumption we...
Entre el activismo y la intervención: El trabajo de organizaciones de ...
International Development Research Centre (IDRC) Digital Library (Canada)
2017-05-31
May 31, 2017 ... This book brings together the experiences and lessons learned from five civil ... Laura Georgina Freyermuth Joffre graduated in political science from the Universidad Nacional Autónoma de México. ... Project description ...
Smart power flows at the island edge
DEFF Research Database (Denmark)
Watts, Laura
2016-01-01
Ethnographer of Futures and Associate Professor at IT University of Copenhagen, Laura Watts, talks about her response to the UK National Infrastructure Commission’s vision for the future of the electricity grid in her guest blog....
Determination of chilling temperature effects on nutrient elements ...
African Journals Online (AJOL)
PRECIOUS
2009-12-01
Dec 1, 2009 ... (Brassica oleracea L. Cv. Acephala) using the WDXRF spectroscopic ... considerably yield reductions in the cultivation areas at higher latitudes (Laura et al., ..... help us change usual plant fertilization regimes resis- tance of ...
Directory of Open Access Journals (Sweden)
Jeremiah T. Steed
2017-01-01
Full Text Available Arthroscopic rotator cuff tendon repair is a common elective procedure performed by trained orthopaedic surgeons with a relatively low complication rate. Specifically, isolated neuropraxia of the anterior interosseous nerve (AIN is a very rare complication of shoulder arthroscopy. An analysis of peer-reviewed published literature revealed only three articles reporting a total of seven cases that describe this specific complication following standard shoulder arthroscopic procedures. This article reports on three patients diagnosed with AIN neuropraxia following routine shoulder arthroscopy done by a single surgeon within a three-year period. All three patients also underwent open biceps tenodesis immediately following completion of the arthroscopic procedures. The exact causal mechanism of AIN neuropraxia following shoulder arthroscopy with biceps tenodesis is not known. This case report reviews possible mechanisms with emphasis on specific factors that make a traction injury the most likely etiology in these cases. We critically analyze our operating room setup and patient positioning practices in light of the existing biomechanical and cadaveric research to propose changes to our standard practices that may help to reduce the incidence of this specific postoperative complication in patients undergoing elective shoulder arthroscopy with biceps tenodesis.
Non-nitric oxide based metallovasodilators: synthesis, reactivity and biological studies.
Sá, Denise S; Fernandes, André F; Silva, Carlos D S; Costa, Paula P C; Fonteles, Manassés C; Nascimento, Nilberto R F; Lopes, Luiz G F; Sousa, Eduardo H S
2015-08-14
There is an increasing number of compounds developed to target one or more pathways involved in vasodilation. Some studies conducted with azaindole and indazole derivatives showed cardiovascular activity associated with these compounds. Fast and easy structural modification of these organic molecules can be achieved using metal complexes promoting a much larger spatial change than organic strategies, potentially leading to novel drugs. Here, we have prepared a series of complexes with a formula cis-[RuCl(L)(bpy)(2)]PF(6), where L = 7-azaindole (ain), 5-azaindole (5-ain), 4-azaindole (4-ain), indazole (indz), benzimidazole (bzim) or quinoline (qui), which were characterized by spectroscopic and electrochemical techniques (CV, DPV). These compounds showed reasonable stability exhibiting photoreactivity only at low wavelength along with superoxide scavenger activity. Cytotoxicity assays indicated their low activity preliminarily supporting in vivo application. Interestingly, vasodilation assays conducted in rat aorta exhibited great activity that largely improved compared to free ligands and even better than the well-studied organic compound (BAY 41-42272), with IC(50) reaching 55 nM. These results have validated this strategy opening new opportunities to further develop cardiovascular agents based on metallo-bicyclic rings.
IDRC hosts the Science Writers and Communicators of Canada ...
International Development Research Centre (IDRC) Digital Library (Canada)
2017-09-20
Sep 20, 2017 ... Marie Lambert-Chan, editor-in-chief of Québec Science, Scott Hannant, former ... Although Canada's Periodical Fund provides financial assistance to ... During the IDRC World Café, IDRC Program Management Officer Laura ...
Full Text Available ... Laura Butler of Parkersburg, W.Va., had "extreme pain in both eyes," she said. "Because I had ... with a corneal abrasion. "I was in severe pain and on medication for four weeks, and couldn' ...
Kõik on nii nagu enne, aga miski pole enam endine / Martin Rünk
Rünk, Martin
2010-01-01
Anders Härmi kuraatoriprojekt "Next to Nothing" ("Eimillestki edasi") Eesti Kaasaegse Kunsti Muuseumis 22. augustini 2010. Pikemalt Martin Creedi (Suurbritannia), Laura Tootsi, Triin Tamme, Dénes Farkasi, Neeme Külma ja Kaido Ole töödest
Translational selection in human: More pronounced in housekeeping genes
Ma, Lina; Cui, Peng; Zhu, Jiang; Zhang, Zhihua; Zhang, Zhang
2014-01-01
by Yuan Yuan, Baylor College of Medicine; Han Liang, University of Texas MD Anderson Cancer Center (nominated by Dr Laura Landweber) Eugene Koonin, NCBI, NLM, NIH, United States of America Sandor Pongor, International Centre for Genetic Engineering
Indian Academy of Sciences (India)
Polysulphone composite membranes modified with two types of carbon additives as a potential material for bone tissue regeneration · ALICJA WEDEL-GRZENDA ANETA FRACZEK-SZCZYPTA MAURICIO TERRONES ANA LAURA ELÍAS MALGORZATA LEKKA ELZBIETA MENASZEK STANISLAW BLAZEWICZ.
Dragotsennaja osen / Tatjana Barmakova
Barmakova, Tatjana
2004-01-01
Moefirmade Dior, Yves Saint Laurent (jumestuskunstnik Linda Cantello), Guerlain (kunstnik Olivier Echaudemaison), Shiseido (kunstnik Tom Pecheux) meigikollektsioonidest. Diori, Kenzo ja Thierry Mugleri uutest parfüümidest. "Kenzoairi" parfüümipudeli disainis klaasikunstnik Laura de Santillana
Investorid on dilemma ees / Ain Kivisaar
Kivisaar, Ain, 1978-
2007-01-01
Keskmise kuupalga eest ei saa enam ruutmeetritki elamispinda ei meil ega mujal. Aktiivsel investoril pole muud teha, kui heita kõrvale tavatarkus ja usaldada enda sisetunnet. Diagramm: Keskmise kuupalga ja korteri ruutmeetri hinna suhe
Euroopa abiraha igatseb taotlejaid / Ain Alvela
Alvela, Ain, 1967-
2008-01-01
Aastatel 2007-2013 saab Eesti Euroopa Liidult toetusi 78 miljardit krooni, millele toetudes on võimalik rasked ajad üle elada. Vt. samas: Tuhahoidlast asula jäätmepunktini; Suurima toetuse saab keskkond. Kommenteerivad Antti Tooming ja Kai Niels Willadsen
Teacher Tenure "Ain't" the Problem.
Hansen, Kenneth; Ellena, William J.
The concept of "tenure," with all its clumsy and confusing burden of historic and current misinterpretation, will probably soon disappear. However, what tenure laws intended, and have failed to do, will almost surely be preserved in other forms of administrative procedure. To be effective, administrative procedures must be (1) clear and detailed,…
VJ annab muusikale visuaalsuse / Ain Kivesti
Kivesti, Ain
2008-01-01
Videograafikast. Video jockey ehk videokunstnik maalib kunstiteoseid piltide ja visuaalsete elementide abil, tehes seda muusika taustal, tavaliselt paralleelselt disco jockey'ga. Toomas Altnurme, Taavi Varmi, Sten Saluveeri ja Erki Kannuse kommentaare
Makita kalmistu antropoloogiline aines / Luule Heapost
Heapost, Luule
1993-01-01
Tabel : Makita koljude keskmised mõõtmed ; Tabel : 13.-15. sajandi Makita koljud ja võrdlusmaterjalid Eestist ; Tabel 3 : 13. -15. sajandi Makita koljud ning võrdlusandmeid soome-ugri hõimude asualadelt ; Tabel 4 : 15.- 17. sajandi Makita koljud ja võrdlusandmed ; Tabel 5 : Makita koljude võrdlusandmed (Pernose'i meetodil) ; Tabel 6 : Makita luustike pikkade luude keskmine pikkus ; Tabel 7 : Kehapikkuse võrdlusandmed
Globaalsus + lennundus = Star Alliance? / Ain Hinsberg
Hinsberg, Ain
2002-01-01
Erinevad koostöövormid lennufirmade vahel, alliansside teke ja areng maailmas. Maailma juhtivad lennundusalliansid ja nende poolt kaetud riigid ja sihtkohad. Kommenteerib Estonian Airi president Erki Urva
Walhof, Gert
Omtrent technologiebedrijven konden we in december 2016 veel lezen over wat artificial intelligence, virtual reality, machine-to-machine automation, machine-to-machine learning en chatbots ons de komende jaren gaan brengen. Als inkoper zou je kunnen wachten tot duidelijk wordt wat de blijvertjes
Brain damage associated with apraxia of speech: evidence from case studies.
Moser, Dana; Basilakos, Alexandra; Fillmore, Paul; Fridriksson, Julius
2016-08-01
The site of crucial damage that causes acquired apraxia of speech (AOS) has been debated in the literature. This study presents five in-depth cases that offer insight into the role of brain areas involved in AOS. Four of the examined participants had a primary impairment of AOS either with (n = 2) or without concomitant mild aphasia (n = 2). The fifth participant presented with a lesion relatively isolated to the left anterior insula (AIns-L), damage that is rarely reported in the literature, but without AOS. Taken together, these cases challenge the role of the AIns-L and implicate the left motor regions in AOS.
Full Text Available ... Life in a Wheelchair Lisa Rosen, MS Spasticity, Physical Therapy-Lokomat T. George Hornby, PhD, PT Empowering ... Rogers, SW Marguerite David, MSW Kathy Hulse, MSW Physical Therapy after Spinal Cord Injury Laura Wehrli, PT ...
Full Text Available ... Life in a Wheelchair Lisa Rosen, MS Spasticity, Physical Therapy-Lokomat T. George Hornby, PhD, PT Empowering ... Rogers, SW Marguerite David, MSW Kathy Hulse, MSW Physical Therapy after Spinal Cord Injury Laura Wehrli, PT ...
Full Text Available ... Life in a Wheelchair Lisa Rosen, MS Spasticity, Physical Therapy-Lokomat T. George Hornby, PhD, PT Empowering ... Rogers, SW Marguerite David, MSW Kathy Hulse, MSW Physical Therapy after Spinal Cord Injury Laura Wehrli, PT ...
Full Text Available ... Life in a Wheelchair Lisa Rosen, MS Spasticity, Physical Therapy-Lokomat T. George Hornby, PhD, PT Empowering ... Rogers, SW Marguerite David, MSW Kathy Hulse, MSW Physical Therapy after Spinal Cord Injury Laura Wehrli, PT ...
2011-06-24
... to the U.S. Department of the Treasury, Financial Management Service, Financial Accounting and...: June 16, 2011. Laura Carrico, Director, Financial Accounting and Services Division, Financial...; Termination; Clearwater Insurance Company AGENCY: Financial Management Service, Fiscal Service, Department of...
77 FR 553 - Surety Companies Acceptable on Federal Bonds: Termination; Western Bonding Company
2012-01-05
.... Department of the Treasury, Financial Management Service, Financial Accounting and Services Division, Surety..., 2011. Laura Carrico, Director, Financial Accounting and Services Division, Financial Management Service...: Termination; Western Bonding Company AGENCY: Financial Management Service, Fiscal Service, Department of the...
Kaitstud magistri- ja doktoritööd 2014
2015-01-01
Magistritööd kaitsesid: Ekaterina Ermolaeva, Helena Haller, Kadri Kallast, Ville-Matti Aleksi Kataja, Laura Kiiroja, Alina-Ruxanda Mircea, Tatjana Pilipoveca, Liina Sieberk, Katsiaryna Suryna, Fatemeh Tavakoli, Ele Viskus; doktoritööd kaitses Vadim Verenitš
Fermi and the Art of Estimation
Indian Academy of Sciences (India)
IAS Admin
The balance wheel will now shed some ... work best when used by someone with the ... [1] Laura Fermi, Atoms in the Family: My Life with Enrico Fermi, The. University of Chicago ... Geneva, European Organization for Nuclear Research, 1969.
HPV Prevention (A Cup of Health with CDC)
Centers for Disease Control (CDC) Podcasts
Human papillomavirus, or HPV, is a virus that can cause certain cancers and is the most commonly sexually transmitted infection in the U.S. In this podcast, Dr. Laura Viens discusses the importance of getting vaccinated against HPV.
Fine5 tantsuteater võitis Vitebskis teise preemia
2006-01-01
22. - 26. XI Valgevenes toimunud kaasaegse koreograafia konkursil "International Festival of Modern Choreography" võitsid Laura Kvelstein ja Dmitri Kruus lühiteostega "1 spot, 2 shadows" teise preemia. Konkursi raames toimunud meistriklasse juhendas Fine5 koreograaf Tiina Ollesk
76 FR 37891 - Surety Companies Acceptable on Federal Bonds; Termination; Western Insurance Company
2011-06-28
... the U.S. Department of the Treasury, Financial Management Service, Financial Accounting and Services.... Laura Carrico, Director, Financial Accounting and Services Division, Financial Management Service. [FR...; Termination; Western Insurance Company AGENCY: Financial Management Service, Fiscal Service, Department of the...
Kristiina Uslar Londoni klaasivõistluse finaalis
2006-01-01
Londonis avati rahvusvahelise klaasikonkursi "The Bombay Sapphire Prize" 2006. aasta finalistide näitus. Eestit esindab Kristiina Uslar tööga "Data Turbine". Konkursi peaauhinna võitis hispaania kunstnik Jaune Plensa, parima uustulnuka auhinna inglise klaasikunstnik Laura Birdsall
2012-04-26
... the EIS could be completed, the funding reality is such that the project could not be designed or... and Construction (A, B). Authority: 23 U.S.C. 315; 49 CFR 1.48. Issued on: April 16, 2012. Laura S...
Data of evolutionary structure change: 1ONAD-2GDFC [Confc[Archive
Lifescience Database Archive (English)
Full Text Available 1ONAD-2GDFC 1ONA 2GDF D C ADTIVAVELDTYPNTDIGDPSYPHIGIDIKSVRSKKTAK...WNMQNGKVGTAHIIYNSVDKRLSAVVSYPNADSATVSYDVDLDNVLPEWVRVGLSASTGLYKETNTILSWSFTSKLKT-NALHFMFNQFSKDQKDLILQGDATTGTDG...ain> 1ONA D 1ONAD
Data of evolutionary structure change: 1ONAD-2GDFA [Confc[Archive
Lifescience Database Archive (English)
Full Text Available 1ONAD-2GDFA 1ONA 2GDF D A ADTIVAVELDTYPNTDIGDPSYPHIGIDIKSVRSKKTAK...WNMQNGKVGTAHIIYNSVDKRLSAVVSYPNADSATVSYDVDLDNVLPEWVRVGLSASTGLYKETNTILSWSFTSKLKT-NALHFMFNQFSKDQKDLILQGDATTGTDG...ain> 1ONA D 1ONAD
Fruit and vegetable phytochemicals: chemistry, nutritional value, and stability
National Research Council Canada - National Science Library
González-Aguilar, Gustavo A; Rosa, Laura A. de la; Alvarez-Parrilla, Emilio
2010-01-01
... and Their Relation to Human Health Alma E. Robles-Sardin, Adriana Ver´ o nica Bola˜ n os-Villar, Gustavo A. Gonz´ a lez-Aguilar, and Laura A. de la Rosa 155 Chapter 7. Chemistry, Stability, and Biological Actions ...
2012-03-28
... directed to the U.S. Department of the Treasury, Financial Management Service, Financial Accounting and...: March 18, 2012. Laura Carrico, Director, Financial Accounting and Services Division, Financial...: Financial Management Service, Fiscal Service, Department of the Treasury. ACTION: Notice. SUMMARY: This is...
2011-06-30
... directed to the U.S. Department of the Treasury, Financial Management Service, Financial Accounting and...: June 22, 2011. Laura Carrico, Director, Financial Accounting and Services Division, Financial...: Financial Management Service, Fiscal Service, Department of the Treasury. ACTION: Notice. SUMMARY: This is...
2007-01-01
Sisu: Kuked ja kanad / Laura Trull ; "Ma igatsen õnne..." / Kattre Adramees ; Usk / Riinu Ansperi ; Talveüllatus / Aile Eldemeel ; Vastutus / Riinu Ansperi ; Pisike peni / Indrek Kuka ; Tere, talv! / Villi Brandt ; Minu kool / Kaisa Tamm ; Selle teeraja mälestuseks / Anni Vanin
Cannes südames / Mirkka Maikola
Maikola, Mirkka
2011-01-01
Nicolas Winding Refni filmist "Drive" (USA 2011). Lisaks tegid oma pingerea Cannes´is nähtud filmidest Eesti filmikriitikud ja -tegijad Jaan Ruus, Jaak Lõhmus, Tristan Priimägi, Jaak Kilmi, Andris Feldmanis, Maria Ulfsak-Šeripova ja Laura Talvet
"Puhastuse" esimesed osatäitjad teada / Kaarel Kressa
Kressa, Kaarel, 1983-
2011-01-01
Eesti-Soome koostöös valmiva Antti Jokise filmis "Puhastus" mängib vana Aliidet Liisi Tandefelt, Aliidet nooruspäevil Laura Birn, Hansu Peter Franzén, Martinit Tommi Korpela, Aliide vanemaid Anne Reemann ja Elmo Nüganen
Directory of Open Access Journals (Sweden)
Helena Lúcia Alves Pereira
2006-06-01
Full Text Available Os antiinflamatórios não-esteroidais (AINEs orais são eficazes no alívio da dor na osteoartrite (OA, porém têm o risco de efeitos adversos sistêmicos. Para diminuir a toxicidade é necessário reduzir a concentração plasmática uma vez que os efeitos adversos são dose-dependentes. Os AINEs de uso tópico, em teoria, alcançam altas concentrações nos tecidos-alvo com concentrações plasmáticas baixas, sendo portanto uma alternativa terapêutica, especialmente para pacientes de risco. Nossa revisão dos ensaios clínicos randomizados mostrou que os AINEs tópicos foram mais efetivos que o placebo e tão eficazes quanto os AINEs orais. Porém, o pequeno número de ensaios e falhas na metodologia nos impossibilita de fazer conclusões definitivas, sendo necessários estudos bem desenhados e de maior duração.Oral non-steroidal anti-inflammatories drugs (NSAIDs are effective in pain relief in osteoarthritis (OA, but are also associated with risks of adverse systemic side effects. In order to reduce its toxicity, it would be desirable to decrease the plasmatic levels of NSAIDs since those side effects are dose-dependent. Topical NSAIDs would be a therapeutic alternative in theory, because while they reach high levels in local tissues, they also produce low plasmatic levels. Our review analyzed clinical randomized and shown that topical NSAIDs were superior to placebo and have similar efficacy to oral NSAIDs, but due a few number of trials and methodological weaknesses we can't make definitive conclusions. Further well designed, long term studies are required.
Onodera, Rie; Kurita, Emi; Taniguchi, Kikuyo; Karakawa, Shuhei; Okada, Satoshi; Kihara, Hirotaka; Fujii, Teruhisa; Kobayashi, Masao
2017-11-01
Anti-human neutrophil antigen (HNA) antibodies have been implicated in the development of neonatal alloimmune neutropenia (NAN) and autoimmune neutropenia (AIN). There are many conventional assay methods that detect anti-HNA antibodies. However, a method to measure multiple samples and detect several anti-HNA antibodies simultaneously is needed. We developed a new method, the extracted granulocyte antigen immunofluorescence assay (EGIFA), to analyze anti-HNA-1a, -1b, and -2 antibodies in sera. The results obtained by EGIFA were evaluated in comparison with those from several standard assay methods. Anti-HNA antibodies in serum samples from nine familial cases with suspected NAN (n = 19) and children with suspected AIN (n = 88) were also measured by EGIFA. The evaluation of nine serum samples with anti-HNA antibodies suggested that EGIFA demonstrated equivalent specificity and superior sensitivity to monoclonal antibody-specific immobilization of granulocyte antigens and had comparable sensitivity to the granulocyte indirect immunofluorescence test. EGIFA successfully detected anti-HNA-1a or -1b antibodies in seven of nine familial cases with suspected NAN. EGIFA detected anti-HNA antibodies in 40.9% of children with suspected AIN. Among them, isolated anti-HNA-1a or -1b antibody was detected in 4.5 or 12.5% of children, respectively, and anti-HNA-2 antibody was identified in 3.4% of children. The 30.8% (16 of 52) of children negative for anti-HNA antibody by EGIFA were positive for anti-HLA antibody. EGIFA facilitated the measurement of anti-HNA-1a, -1b, and/or -2 antibodies in sera. The prompt measurement of anti-HNA antibodies will improve the diagnosis and clinical management of patients with suspected NAN or AIN. © 2017 AABB.
Sikora, Elżbieta; Bodziarczyk, Izabela
2013-01-01
Organism's lipid peroxidation is one of the most often examined and known physiological process evoked by free radicals. It concerns oxidation reaction of unsaturated fatty acid and/or other lipids leading to lipid oxidation products (LOP), which as a result of further changes generate among others the malondialdehyde molecules. The aim of the work was an estimation if raw or cooked kale addition to rat's diet influences antioxidant defense efficiency in their organisms in comparison to rats fed with standard AIN-93G diet. The experiment was conducted with 36 Wistar strain, male rats over 21 days. The rats were divided into 3 groups (each 12 stuck) which were fed with: standard diet AIN-93G (2 groups), AIN-93G diet with 10% addition of raw kale (2 groups), and AIN-93G with 10% addition of cooked lyophilised kale. The total content of polyphenols (FC method) and antioxidant activity (ABTS+•) were previously determined in raw and then in cooked kale. On the 20th day of experiment, half of rats (6 stuck) of each kind of the diet were injected intraperitoneally by the solution of paraquat (PQ) in physiological salt to evoke the oxidative stress. The next day animals were stunned and blood from their hearts was sampled. In the obtained serum, the levels of lipid oxidation products (LOP) and malondialdehyde (MDA) were assessed. It was observed that in blood serum of rats fed with modified diet with raw and cooked lyophilised kale addition the lipid oxides level was lower in comparison to control group fed with standard diet (p kale addition. Diet with kale, both raw and cooked, efficiently inhibited the lipid peroxidation process in rats' organisms, ongoing during natural metabolism and during evoked oxidative stress.
Directory of Open Access Journals (Sweden)
R Ramachandran
2015-01-01
Full Text Available Steroids are used in the management of drug-induced acute interstitial nephritis (AIN. The present study was undertaken to compare the efficacy of pulse methyl prednisolone with oral prednisolone in the treatment of drug-induced AIN. Patients with biopsy-proven AIN with a history of drug intake were randomized to oral prednisolone (Group 1 1 mg/kg for 3 weeks or a pulse methyl prednisolone (Group II 30 mg/kg for 3 days followed by oral prednisolone 1 mg/kg for 2 weeks, tapered over 3 weeks. Kidney biopsy scoring was done for interstitial edema, infiltration and tubular damage. The response was reported as complete remission (CR (improvement in estimated glomerular filtration rate [eGFR] to ≥60 ml/min/1.73 m 2 , partial remission (PR (improvement but eGFR <60 ml/min/1.73 m 2 or resistance (no CR/PR. A total of 29 patients, Group I: 16 and Group II: 13 were studied. Offending drugs included nonsteroidal anti-inflammatory drugs, herbal drugs, antibiotics, diuretic, rifampicin and omeprazole. There was no difference in the baseline parameters between the two groups. The biopsy score in Groups I and II was 5.9 1.1 and 5.1 1.2, respectively. At 3 months in Group I, eight patients each (50% achieved CR and PR. In Group II, 8 (61% achieved CR and 5 (39% PR. This was not significantly different. Percentage fall in serum creatinine at 1 week (56% was higher in CR as compared to (42% those with PR. ( P = 0.14. Patients with neutrophil infiltration had higher CR compared to patients with no neutrophil infiltration ( P = 0.01. Early steroid therapy, both oral and pulse steroid, is equally effective in achieving remission in drug-induced AIN.
Kaks debüüti / Lilian Vellerand
Vellerand, Lilian, 1932-
1997-01-01
"Shakespeare'i kogutud teosed" ("The Complete Works of William Shakespeare") Rakvere Teatris, lavastaja Ain Prosa ja Friedebert Tuglase - Ingomar Vihmari "Hei, Luciani!" Ugalas, lavastaja Ingomar Vihmar
Physical and mental health: from youth to age in Ohio prisons.
Lynd, Alice
2014-01-01
Who cares about health care in prisons? You do if you have a son or a granddaughter in prison. Maybe you care anyway if you have had to wait a long time to see a doctor or if you could not have the treatment you needed because it cost too much. Maybe you have run into the attitude, "You ain't bleedin', you ain't needin'." Maybe you have found it hard to face the future with little or no hope that you could ever be in a better place. Or maybe you, like some older prisoners, have been able to develop new interests, new skills, to review your life and review it, and to redefine what matters.
Feminist Film Theory and Criticism.
Mayne, Judith
1985-01-01
Discusses Laura Mulvey's 1975 essay, "Visual Pleasure and Narrative Cinema," and the ideas about feminist film theory and psychoanalysis as a critical tool which it raises. Suggests contradiction is the central issue in feminist film theory. Explores definitions of women's cinema. (SA)
TRIHALOMETHANE LEVELS IN HOME TAP WATER AND SEMEN QUALITY
Trihalomethane Levels in Home Tap Water and Semen QualityLaura Fenster, 1 Kirsten Waller, 2 Gayle Windham, 1 Tanya Henneman, 2 Meredith Anderson, 2 Pauline Mendola, 3 James W. Overstreet, 4 Shanna H. Swan51California Department of Health Services, Division of Environm...
2016-03-01
As noted in the report, we found that different stakeholders within the Navy used the guaranty to accomplish differing and, at times, contradictory...staff members made key contributions to this report: Diana Moldafsky, Assistant Director; Laurier Fish; Joseph Franzwa; Ronald Freeman ; Laura
Full Text Available ... PhD Sigmund Hough, PhD Laura Tuck, PsyD Terrie Price, PhD Heather Taylor, PhD Michelle Meade, PhD Jonathon ... the most important thing for families to know right away? play_arrow What are the main concerns ...
Full Text Available ... PhD Sigmund Hough, PhD Laura Tuck, PsyD Terrie Price, PhD Heather Taylor, PhD Michelle Meade, PhD Jonathon ... arrow Why are high-dose steroids often used right after an injury? play_arrow What is meant ...
"Never Enough": Bridging the Chasm between College Women's Achievements and Their Anguish
Choate, Laura A.
2017-01-01
Laura H. Choate demonstrates a disconnect between what female undergraduates are achieving and how they actually feel about themselves and their accomplishments; she suggests a variety of interventions to counterbalance the cultural pressures that undermine college women's overall self-esteem and mental health.
2012-07-10
.... obligations under applicable international trade law, including the World Trade Organization (WTO) Agreement... CONTACT: Laura Cimo, Trade and Marine Stewardship Division, Office of International Affairs, NMFS, at (301... organizations calling for international restrictions on the fishing activities or practices described in the...
Reval, Kreete
2003-01-01
Heliplaatidest: Lõkõrig "Süä kisk", Laura Pausini "From The Inside", Gary Moore "Back To The Blues", Ayako Lister "The Japanese Koto", Massive Attack "100th Window", ERSO & Arvo Volmer "Eduard Tubin: 2. ja 5. sümfooniad", Claire's Birthday "Future Is Now!"
Reval, Kreete
2003-01-01
Heliplaatidest: Laura Pausini "From The Inside", Gary Moore "Back To The Blues", Ayako Lister "The Japanese Koto", Massive Attack "100th Window", Erso & Arvo Volmer "Eduard Tubin: 2. ja 5. sümfooniad", Claire's Birthday "Future Is Now!", Lõkõriq "Süa kisk"
Postimehe fotograaf võitis konkursi "Eesti foto 2004" / Neeme Korv
Korv, Neeme, 1974-
2004-01-01
Pärnu Uue Kunsti Muuseumi ja fotoajakirja "Cheese" fotokonkursil osales 67 fotograafi. Grand prix' võitis Ove Maidla broomõlitehnikas fotodega, millel kujutatakse maastikke, aega ja inimesi. Järgnesid Kristo Rihm, Anu Vahtra ja Märten Kross. Parim noor fotograaf oli Laura Nõmmik
Kampen om Kinas medier: Fri presse eller socialistisk propaganda
DEFF Research Database (Denmark)
Dombernowsky, Laura Møller
2012-01-01
Mens unge kinesere sætter deres lid til, at kommercielle medier vil øge den journalistiske frihed, råber kritikere vagt i gevær. De frygter, at de socialistiske idealer ryger i svinget. ANALYSE af Laura Dombernowsky, Beijing, Kina...
Data of evolutionary structure change: 1ONAD-2D3PB [Confc[Archive
Lifescience Database Archive (English)
Full Text Available 1ONAD-2D3PB 1ONA 2D3P D B ADTIVAVELDTYPNTDIGDPSYPHIGIDIKSVRSKKTAK...WNMQNGKVGTAHIIYNSVDKRLSAVVSYPNADSATVSYDVDLDNVLPEWVRVGLSASTGLYKETNTILSWSFTSKLKT------NALHFMFNQFSKDQKDLILQGDAT...ain> 1ONA D 1ONAD TR
Keratosis reduces sensitivity of anal cytology in detecting anal intraepithelial neoplasia.
ElNaggar, Adam C; Santoso, Joseph T; Xie, Huiwen Bill
2012-02-01
To identify factors that may contribute to poor sensitivity of anal cytology in contrast to the sensitivity of anoscopy in heterosexual women. We analyzed 324 patients with biopsy confirmed diagnosis of genital intraepithelial neoplasia (either vulva, vaginal, or cervical) from 2006 to 2011 who underwent both anal cytology and anoscopy. Cytology, anoscopy, and biopsy results were recorded. Biopsy specimens underwent independent analysis for quality of specimen. Also, biopsy specimens were analyzed for characteristics that may contribute to correlation, or lack thereof, between anal cytology and anoscopic directed biopsy. 133 (41%) patients had abnormal anoscopy and underwent directed biopsy. 120 patients with normal anal cytology had anoscopy directed biopsies, resulting in 58 cases of AIN (sensitivity 9.4%; 0.039-0.199). This cohort was noted to have extensive keratosis covering the entire dysplastic anal lesion. 18 patients yielded abnormal anal cytology. Of these patients, 13 had anoscopic directed biopsies revealing 6 with AIN and absent keratosis (specificity 88.6%; 0.78-0.95). The κ statistic for anal cytology and anoscopy was -0.0213 (95% CI=-0.128-0.086). Keratosis reduces the sensitivity of anal cytology. Furthermore, anal cytology poorly correlates with anoscopy in the detection of AIN (κ statistic=-0.0213). Copyright © 2011 Elsevier Inc. All rights reserved.
Directory of Open Access Journals (Sweden)
Megan C. Hallam
2016-01-01
Full Text Available The Thrifty Phenotype Hypothesis proposes that the fetus takes cues from the maternal environment to predict its postnatal environment. A mismatch between the predicted and actual environments precipitates an increased risk of chronic disease. Our objective was to determine if, following a high fat, high sucrose (HFS diet challenge in adulthood, re-matching offspring to their maternal gestational diet would improve metabolic health more so than if there was no previous exposure to that diet. Animals re-matched to a high prebiotic fiber diet (HF had lower body weight and adiposity than animals re-matched to a high protein (HP or control (C diet and also had increased levels of the satiety hormones GLP-1 and PYY (p < 0.05. Control animals, whether maintained throughout the study on AIN-93M, or continued on HFS rather than reverting back to AIN-93M, did not differ from each other in body weight or adiposity. Overall, the HF diet was associated with the most beneficial metabolic phenotype (body fat, glucose control, satiety hormones. The HP diet, as per our previous work, had detrimental effects on body weight and adiposity. Findings in control rats suggest that the obesogenic potential of the powdered AIN-93 diet warrants investigation.
Heat Transfer Characteristics in High Power LED Packaging
Directory of Open Access Journals (Sweden)
Chi-Hung Chung
2014-03-01
Full Text Available This study uses the T3Ster transient thermal resistance measuring device to investigate the effects to heat transfer performances from different LED crystal grains, packaging methods and heat-sink substrates through the experimental method. The experimental parameters are six different types of LED modules that are made alternatively with the crystal grain structure, the die attach method and the carrying substrate. The crystal grain structure includes the lateral type, flip chip type and vertical type. The die attach method includes silver paste and the eutectic structure. The carrying substrates are aluminum oxide (Alumina and aluminum nitride (AIN ceramic substrates and metal core PCB (MCPCB. The experimental results show that, under the conditions of the same crystal grain and die attach method, the thermal resistance values for the AIN substrate and the Alumina substrate are 2.1K/W and 5.1K/W, respectively and the total thermal resistance values are 7.3K/W and 10.8K/W. Compared to the Alumina substrate, the AIN substrate can effectively lower the total thermal resistance value by 32.4%. This is because the heat transfer coefficient of the AIN substrate is higher than that of the Alumina substrate, thus effectively increasing its thermal conductivity. In addition, under the conditions of the same crystal grain and the same substrate, the packaging methods are using silver paste and the eutectic structure for die attach. Their thermal resistance values are 5.7K/W and 2.7K/W, respectively, with a variance of 3K/W. Comparisons of the crystal grain structure show that the thermal resistance for the flip chip type is lower than that of the traditional lateral type by 0.9K/W. This is because the light emitting layer of the flip chip crystal grain is closer to the heat-sink substrate, shortening the heat dissipation route, and thus lowering the thermal resistance value. For the total thermal resistance, the crystal grain structure has a lesser
Prügiveo hind hakkab olenema inimesest endast / Peep Aaviksoo ; interv. Jaan Rõõmussaar
Aaviksoo, Peep, 1956-
2004-01-01
Ilmunud ka: Stolitsa, 5. nov. 2004, lk. 3. AS-i Tallinna Prügila taotles prügi ladestamishinna tõstmist, ettevõtlusameti hinna ja tarbijakaitse osakond pidas taotletavat hinda liiga kõrgeks. Tallinna abilinnapea vastab küsimustele prügimajanduse kota
(Konstitutsiooniline) renvoi: kas põhiseaduslik nõue või kaera Trooja hobusele? / Berit Aaviksoo
Aaviksoo, Berit, 1978-
2015-01-01
Võrdsuspõhiõiguse ning pöörddiskrimineerimise kaotamise nõude mõjust Eesti õiguskorras. Artikkel põhineb 3. oktoobril 2014 Tartus 33. Eesti õigusteadlaste päevadel „Kümme aastat õiguslõimet“ peetud ettekandel
Sõjaraamatu hävitamisel on seos Eestiga / Hendrik Vosman, Tuuli Koch ; kommenteerinud Jaak Aaviksoo
Vosman, Hendrik
2011-01-01
Suurbritannia ajakirjaniku Toby Harndeni Afganistani sõda käsitlevast raamatust "Dead Men Risen: The Welsh Guards and the Real Story of Britain's War in Afganistan" ("Ülestõusnud surnud: Walesi kaardivägi ja tegelik lugu brittide sõjast Afganistanis"). Briti kaitseministeerium lükkab ümber Harndeni väite raamatu ümber puhkenud skandaali poliitilisest tagamaast, autori arvates kartis kaitseministeerium, et raamatus leiduv info võiks Eestit ärritada
Case C-182/15, Proceedings Relating to the Extradition of Aleksei Petruhhin / Filippo Fontanelli
Fontanelli, Fillippo
2017-01-01
Euroopa Kohtu lahendist, mis puudutab Venemaa ametiasutuste poolt Läti ametiasutustele saadetud Eesti kodaniku Aleksei Petruhhini väljaandmise taotlust seoses narkootilise aine turustamise süüteoga
Arenguabistajad süüdistavad Eestit jalalohistamises / Evelyn Kaldoja
Kaldoja, Evelyn, 1980-
2008-01-01
Ilmunud ka: Postimees : na russkom jazõke 1. juuli 2008, lk. 10. Valitsusväliseid ühendusi koondavas raportis kritiseeritakse Eestit väheste summade eraldamises rahvusvahelisele arenguabile. Lisa: Baltimaade arenguabi aastal 2007; Vt. samas raporti koostamisel osalenud ActionAidi esindaja Laura Sullivani kommentaari
Mälestusmärk iseendale / Rein Veidemann
Veidemann, Rein, 1946-
2009-01-01
Lembit Petersonist ja tema lavastusest "Maarja kuulutamine", mille eest ta pälvis aastapreemia ja osatäitmiste eest samas lavastuses said aasta naisnäitlejapreemiad tema tütred Maria ja Laura Peterson. Poeg Marius Peterson sai preemia osatäitmise eest lavastuses "Linn"
Naised leedu kunstnike pilgu läbi
2002-01-01
Hansapanga galeriis leedu kaasaegse kunsti näitus "Õppides ja lauldes". Kuraator Kestutis Kuizinas. Osalevad Laura Stasiulyte, Gediminas ja Nomeda Urbonas, Vita Zaman. Videod ja slaidiprogrammid näitavad tõelisi või lavastatud episoode naiste elust tänapäeva Leedus
Saaremaa noored said hakkama eduka filmiga! / Minni Saapar
Saapar, Minni
2006-01-01
Saaremaa Ühisgümnaasiumi abituriendid Laura Tõhk ja Marili Pärtel said oma filmiga "Fallen Angel" 11. ja 12. novembrini Rakvere Teatrikinos toimunud "Noorte filmipäevadel Rakveres 2006" parima dokumentaalfilmi auhinna. Konkursi 21 filmi seast said viis filmi auhinna ja kolm eriauhinna.
Omas mahlas / Raineras Vilumaa
Vilumaa, Raineras
2004-01-01
Leedu kaasaegse kunsti näitus "Omas mahlas" Tallinna Kunstihoones kuni 11. VII ja Rotermanni soolalaos kuni 8. VIII. Kuraatorid Anders Härm, Eha Komissarov ja Hanno Soans. 26. VI esitlesid kunstnikud Arturas Bumshteinas, Laura Garbshtiene (G-Lab) ja helilooja Antanas Jasenka oma heliinstallatsioone
75 FR 35815 - Ocean Transportation Intermediary License Applicants
2010-06-23
..., TX 76011. Officers: Omar Kolaghassi, Manager (Qualifying Individual), Laura Alicia, Manager. Application Type: New OFF & NVO License. CALS Logistics USA, Inc. (OFF & NVO), 755 North Route 83, Suite 215.... Premium Star Logistics LLC dba O.P. Premium Star Logistics (OFF & NVO), 4200 Lightning Court, Bakersfield...
Journal of Chemical Sciences | Indian Academy of Sciences
Indian Academy of Sciences (India)
Lotfali Saghatforoush1 Laura Valencia Matarranz2 Firoozeh Chalabian3 Shahriare Ghammamy4 Fatemeh Katouzian5. Department of Chemistry, Payame Noor University, 19395-4697, Tehran, I.R. of Iran; Departamento de Quimica Inorganica, Facultad de Quimica, Universidade de Vigo, 36310 Vigo Pontevedra, Spain ...
African Journal of AIDS Research - Vol 5, No 2 (2006)
African Journals Online (AJOL)
Talking about sex in Botswana: social desirability bias and possible implications for HIV-prevention research · EMAIL FULL TEXT EMAIL FULL TEXT DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. Kata Chillag, Greg Guest, Arwen Bunce, Laura Johnson, Peter H Kilmarx, Dawn K Smith, 123-131.
Klaasis on pinget / Reet Varblane ; kommenteerinud Kati Kerstna, Kairi Orgusaar
Varblane, Reet, 1952-
2009-01-01
Klaasi kui (kunsti)materjali kasutamisest, mitmete erialade sümbioosist. Laura Mattioli Rossi, Rosa Barovier Mentasti ja Adriano Berengo kureeritud näitusest "Glass Stress" ("Klaasipinge") tänavusel Veneetsia biennaalil. Eesti klaasikunstist, Kai Koppeli eestvedamisel toimunud Haapsalu klaasipäevadest "Kasuta päeva"
Gombrowicz tra esilio e straduzione
Directory of Open Access Journals (Sweden)
Vera Horn
2006-12-01
Full Text Available L'esilio argentino dello scrittore polacco Witold Gombrowicz raccontato da Laura Pariani nel romanzo La straduzione; il tentativo di tradursi; il tentativo di tradurre il Ferdyduke in spagnolo e conquistare pubblico; critica e traduzione nel mondo argentino; la straduzione come fallimento.
Moonutatult ja vahendatult nüüdiskunstist / Laura Kuusk
Kuusk, Laura, 1982-
2016-01-01
Liikumisest kujuteldava ja füüsilise ruumi vahel. Kristina Õlleki magistritööst "Kunstiteos, selle fotodokumentatsioon ja representatsioon digiajastul. When you have the object itself in front of your eyes protsess ja analüüs". Magistritöös uuritakse näitluse vaatamisel tekkivate kujutluspiltide teemat
Leijen, Äli, 1979-
2013-01-01
Aineõpetaja magistriõppe üliõpilaste seas läbi viidud uurimusest, milles vaadeldakse, kuidas üliõpilased koordineerivad personaalset ja professionaalset mina-positsiooni erialaste ambivalentsete olukordade kontekstis
2008-01-01
Artikkel kirjeldab õpetajakoolituse olukorda Eestis aastal 2003. Aineõpetajate, klassiõpetajate ja koolieelsete lasteasutuste õpetajate ettevalmistusest Tallinna Ülikoolis ning nende karjääriperspektiive tööturul
Esteet Hartshenko contra mehed punases / Heili Vaus-Tamm
Vaus-Tamm, Heili, 1961-
2007-01-01
Tantsuetendustest Kumu Kunstimuuseumis: "Red ain't dead", koreograaf - lavastajad Kaarel Väli, Kristjan Rohioja; tantsuteatri Zick esituses "Piaf", koreograaf - lavastaja Dmitri Harchenko. Dominiiklaste kloostri klausuuris "Reisijuht", koreograaf - lavastaja Dmitri Harchenko
Stirlitzi leitmotiivist rõõmsalt süüdimatu jäneste lauluni / Jüri Aarma
Aarma, Jüri, 1951-
2010-01-01
Vene filmimuusika kontserdist "Seitseteist kevadist hetke", mis toimub Vanemuise kontserdimajas 2. aprillil, Jõhvi kontserdimajas 4. aprillil ja Estonia kontserdisaalis 6. aprillil, lavastaja Ain Mäeots. Näidatakse vastavaid filmilõike
Vahemets, Aivo
2006-01-01
Uutest heliplaatidest Waltari "Blood Sample", Anthony Hamilton "Ain't Nobody Worrying", Kismabande "Polüpale", Siiri Sisask "Kuu lõhn", Les Diamants "Fortune Fools", "The Voice Clubbin", Nits "Les Nuits"
Politicians spin attacks against methadone, syringe replacement / Milda Seputyte
Seputyte, Milda
2005-01-01
Leedu parlamendiliikmed osalevad kampaanias, millega võideldakse narkomaanidele tasuta süstalde jagamise ja sõltuvuse vastase aine metadooni vastu, kuna nende arvates need meetmed pigem süvendavad narkomaaniat
Kõnnivad köiel ja hoiavad kätt / Iir Hermeliin, Jaanus Vahtra ; intervju Sven Karja
Iir Hermeliin, pseud., 1973-
2000-01-01
Teatrikunstnikud Iir Hermeliin ja Jaanus Vahtra ning nende looming. Kunstnikud lavastajatest ja lavastajad Mati Unt ja Ain Mäeots koostööst kunstnikega lavastustes "Jacques ja tema isand"; "Laulatus"
CERN firemen share their expertise
Maximilien Brice
2002-01-01
Firemen from local fire brigades have been coming to CERN to learn modern fire-fighting techniques. The CERN fire brigade has some unique training equipment for two particularly dangerous fire hazards, flashover and backdraft. Flashover occurs when a room that is on fire reaches a temperature of 400 to 500°. Beyond this point, a fully developed fire breaks out. This series of photos shows recruits from the fire services of Ain (Service Départemental Incendie et Secours (SDIS)) taking part in a flashover training exercise at CERN. Photo 01: Christopher Griggs, Chief Instructor of the CERN fire brigade (seated in the centre), explains the technique of using a fire-hose during a flashover to the recruits from the Ain SDIS.
2006-01-01
Vanemuise teatri draamanäitlejad tunnistasid möödunud aasta parimaks lavastuseks augustis Setumaal Obinitsas etendunud "Taarka", mille lavastas Ain Mäeots. Parimaks naispeaosatäitjaks valiti Merle Jääger, parimaks meespeaosatäitjaks Indrek Taalmaa, parimaks naiskõrvalosatäitjaks Karin Tammaru, parimaks meeskõrvalosatäitjaks Tanel Jonas. Eesti Draamateatri 2005. aasta Antsud ehk kolleegipreemiate laureaadid : Ingomar Vihmar (parim lavastaja), Ervin Õunapuu (parim kunstnik), Ülle Kaljuste (parim naisnäitleja), Ain Lutsepp (parim meesnäitleja), Väikesed Antsud pälvisid Elina Reinold ja Taavi Teplenkov, Abi-Antsuks kuulutati teatri kirjandusala juhataja Ene Paaver. Endla 2005. aasta kolleegipreemiad said Lii Tedre (parim naisnäitleja), Tambet Seling (parim meesnäitleja), Tiit Palu (parim lavastaja) ja Silver Vahtre (parim kunstnik)
Harvard Education Letter. Volume 26, Number 5, September-October 2010
Walser, Nancy, Ed.
2010-01-01
"Harvard Education Letter" is published bimonthly at the Harvard Graduate School of Education. This issue of "Harvard Education Letter" contains the following articles: (1) Scenes from the School Turnaround Movement: Passion, Frustration, Mid-Course Corrections Mark Rapid Reforms (Laura Pappano); (2) The Media Savvy Educator:…
Hillary Clinton, and Mrs. Laura Bush on stage at the Sewall-Belmont House. Mrs. Bush was joined by Secretary of the Interior Dirk Kempthorne and Senators Hillary Clinton (NY) and Pete Domenici (NM), who Save America's Treasures established by the Clinton Administration. Secretary Dirk Kempthorne, Senator
Reasoning about Independence in Probabilistic Models of Relational Data (Author’s Manuscript)
2014-01-06
computer vision and information retrieval. Näıvely specifying a joint distribution by hand requires an exponential number of states; however, Bayesian...Journal of the Royal Statistical Society. Series B (Methodological), pages 267–288, 1996. Ioannis Tsamardinos, Laura E. Brown, and Constantin F. Aliferis
Um diálogo entre Ocidente e Oriente
Directory of Open Access Journals (Sweden)
Marco Catalão
2011-10-01
Full Text Available Entrevista realizada em agosto de 2011 com a professora Laura Cerrato, em que se debatem alguns elementos da poética do escritor argentino Roberto Juarroz (1925-1995, especialmente sua relação com o Budismo e a tradição oriental.
2013-09-09
... site. The URL for this survey site will also be advertised separately through media and social media... information on the proposed project, contact: Laura M. Koehly, Ph.D., Senior Investigator, Social and... in health conditions and associated risk factors; The role of friends, family, media, and health...
Directory of Open Access Journals (Sweden)
Jhon Rozo Mila
2015-12-01
Full Text Available Los superhéroes, el deber moral y la obligación; El caso de Spider-Man y los X-Men. Laura Victoria Bolaño Pérez; Universidad del Rosario, colección Ópera Prima, Bogotá, 2012, 309 págs.
Russell, Michele, Ed.
Papers on aspects of college admission, records, and institutional research functions are: "How To Improve Office Morale" (Victor Swenson); "Staff Meetings: How To Save Hours per Month and Develop Your Staff" (LuAnn Harris, Shelley Olsen); "Selling SPEED/ExPRESS" (Laura Patterson, Thomas Scott); "Advisement and…
Women Warriors: Why the Robotics Revolution Changes the Combat Equation
2016-03-01
Secretary Leon Panetta and General Martin Dempsey, U.S. Department of Defense, “Elimination of the 1994 Direct Ground Combat Definition and Assignment... Feminism and International Relations, eds. J. Ann Tickner and Laura Sjoberg, (London: Routledge, 2011): 146 and 162. Photos Page 100. Photo by IDF
2007-01-01
USAs Bostoni Berklee muusikakolledzhis tudeeriv Laura Põldvere annab Eestis kolm heliplaadi "Muusa" esitluskontserti (26. okt. Pärnu klubis Mirage). 28. nov. Tallinna linnahallis esinevast Rootsi popbändist Ace Of Base. Wembley staadionil hümne laulnud Hannahi heliplaat "Everything is Changing" sai Inglismaal kriitika osaliseks
Inimene kronesteetilise kaameraga / Andreas W
Andreas W, pseud., 1969-
2011-01-01
Fotofilmifestival 14. oktoobril kinos Sõprus. Fotofilmist. Rahvusvahelisest fotofilmi konkursist "Ajatu lugu". Grand prix' pälvis Anu-Laura Tuttelberg, 2. koha Andri Allas ja Krõõt Tarkmeel, 3. koha Gerald Assouline (Prantsusmaa). Lühidalt festivalil näidatud Gusztáv Hámosi fotofilmidest (Saksamaa)
Ultrasonic recording and display techniques for the inspection of nuclear power plant
International Nuclear Information System (INIS)
Ely, R.W.; Hall, G.D.; Johnson, A.; Pascoe, P.T.
1985-01-01
This paper describes four systems: MDU, PURDIE, LAURA and DRUID, under development as ultrasonic recording and display techniques for the inspection of nuclear power plant. The MDU system plots either plan or sectional views of the component under test onto a bistable storage screen. PURDIE is a system based around a video cassette recorder which has been modified to record ultrasonic A-scan waveforms and probe positional information. MDU and PURDIE are portable systems, for use under difficult site conditions. They may be manufactured in quantity to satisfy the demanding inspection programmes of nuclear power stations. LAURA is a desk top replay system for the video cassette tapes produced on site by PURDIE. DRUID is a digital desk top replay/display system incorporating a high resolution colour graphics terminal and therefore offering more flexibility and improved display formats. The systems are compatible with each other and some component units are directly interchangeable between the various systems
Public Lecture Collide@CERN Pro Helvetia | 23 July | Main Auditorium
2015-01-01
You are very warmly invited to the opening presentation of Fragment.In’s residency at CERN. Fragment.In: Simon de Diesbach, Laura Perrenoud and Marc Dubois. 23 July 2015 - 7 p.m. Main Auditorium The lecture will be followed by a drinks reception at 8.30 p.m. Doors open at 6.30 p.m. Opening address by Rolf Heuer, CERN Director-General, Michel Vust, project leader at the Swiss Arts Council Pro Helvetia, and Monica Bello, Head of Arts@CERN. Fragment.In are the winners of Collide@CERN Pro Helvetia, formed by Laura Perrenoud, Simon de Diesbach, and Marc Dubois. They will present their artistic work along with their CERN scientific inspiration partner, who will present his/her scientific work. In their proposal, Fragment.In took a unique, original and creative approach to data visualization. We look forward to having them at CERN. Fragment.In Collide@CERN is the three month residency programme providing artists with time and...
Kummitusmaja ja fusion-köök = Haunted House and Fusion Cuisine / Kai Lobjakas
Lobjakas, Kai, 1975-
2003-01-01
Tallinnas Rataskaevu 16 asuva jaapani toitu pakkuva restorani "Sushihouse" kujundus, ruumide restaureermine. Sisekujundajad Ain Nurmela ja Liina Link. Projekt 2001-2003, valmis 2003. Kõige muinsusteadlikumalt restaureeritud maja 2002. a. 3 ill
Materjalide jagamisest võidavad kõik / Maarja Soone
Soone, Maarja
2011-01-01
Koolitusest Colchesteris - Content and Language Integrated Learning, mis tähendab võõrkeelset aineõpet, kus vajadusel võetakse kasutusele ka emakeel, mistõttu viidatakse sellele tihti kui kakskeelsele õppele
Märkmeid uusima Preisi tsensuuriinstruktsiooni kohta / Karl Marx
Marx, Karl
2000-01-01
Preisi uue (1841. aasta) tsensuuriinstruktsiooni tõusikliku vaimu vastuolust vana (1818. aasta) tsensuurimääruse ratsionalismiga. Moraali ja religiooni vastuolust. Vt. ka Ain Kaalepi artiklit "Veel Karl Marxist ja tsensuurist
Tallinn pokupajet zemlju dlja prokladki shosse Põhjaväil
2007-01-01
Seoses Russalkast Ahtri tänavani ulatuva tee-ehitusega seisab linnal ees 16 maaküsimuse lahendamine. Probleemidest seoses väila osaliselt merre ehitamisega. Kommenteerivad Alo Brandt ja Ain Valdmann
Lifescience Database Archive (English)
Full Text Available oencephalopathy (CADASIL) CADASIL is a chronic cerebrovascular disorder characterized by recurrent ischemic attacks and frequent migr...aines associated with diffuse white-matter abnormalities. CADASIL is caused by muta
AHHAA keskus Tartus = The Ahhaa Science Centre in Tartu / Triin Ojari
Ojari, Triin, 1974-
2011-01-01
2011. a. valminud AHHAA teaduskeskuse arhitektid on Ain Padrik ja Vilen Künnapu (AB Künnapu & Padrik), sisearhitektid Tea Tammelaan, Krista Lepland ja Malle Jürgenson (Laika, Belka & Strelka). Projekt: 2008
Vene elu hõng Pilistvere rehealuses / Margot Visnap
Visnap, Margot, 1959-
2008-01-01
Pilistvere rehehoones etendunud Ain Saviaugu kirjutatud ja lavastatud suvetükist "Rasputin". Suvelavastuse tõi välja Põltsamaa Teater Ellunäod koos professionaalsete näitlejatega. Nimiosas Indrek Saar
Vek lovi - vek utshis / Hillar Jõõts ; interv. Kalju Hook
Jõõts, Hillar
2005-01-01
Keskkonnainspektsiooni Pärnumaa osakonna juhtivspetsialist Hillar Jõõts keskkonnaministeeriumi kalavarude osakonna juhataja Ain Soome, Eesti Kalurite Liidu juhatuse esimehe Andres Variku ja Eesti Mereinstituudi direktori Toomas Saati kohtumisest Pärnumaa kaluritega
Yeast Interacting Proteins Database: YOR171C, YOR034C [Yeast Interacting Proteins Database
Lifescience Database Archive (English)
Full Text Available ain base phosphates, which function as signaling molecules, regulates synthesis of ceramide from exogenous l...chain base phosphates, which function as signaling molecules, regulates synthesis of ceramide from exogenous
Bez kota mõsham razdolje / Jevgeni Kapov
Kapov, Jevgeni
2004-01-01
Sillamäe linnapea Ain Kiviorgi ja Vaivara vallavanema Veiko Luhalaidi kohtumisest Politseiameti peadirektori Robert Antropovi ja Ida politseiprefekti Kalev Prillopiga, kus arutati seoses politseireformiga Sillamäe regioonis tekkinud korrakaitse probleeme
President Meri annetas aumärke
1996-01-01
Riigivapi I klassi orden Jaan Krossile ja Kalju Lepikule; Riigivapi III klassi orden Ain Kaalepile, Hilja Rüütlile (Aili Helm); Riigivapi IV klassi orden Voldemar Millerile, Juhan Peeglile ja Ants Viiresele
Partii Reform ne bezrazlitshna sudba russkogo obrazovanija / Sergei Ivanov
Ivanov, Sergei, 1958-
2005-01-01
Riigikogu liige vastab küsimustele, mis puudutavad Tallinna Pedagoogikaülikoolis algavat vene koolide jaoks aineõpetajate ettevalmistamist ja selleks ettenähtud rahasummat, vene akadeemilise keskuse loomiseks eraldatud raha kulutamist
Lifescience Database Archive (English)
Full Text Available aine ... D01152 ... Oxethazaine (JP17/USAN); Oxetacaine (INN) ... D08311 ... Oxetacaine hydrochloride ... DG00801 ... Bupivacaine ... D07552 ... Bupiva...caine (USAN/INN) ... D01450 ... Bupivacaine hydrochloride (USP); Bupivacaine hydrochl
Biznes i obshtshestvo : Sillamäe võhodit iz desjatiletnei spjatshki / Artur Tooman
Tooman, Artur, 1971-
2006-01-01
Sillamäe linna eluolu, sadama mõju linna arengule. Arvamust avaldavad linnavolikogu liige Sergei Rjabkov, linnapea Ain Kiviorg ja kohalikud ettevõtjad. Lisa: diagrammid linna eelarve ja ettevõtluse kasvu kohta
Luuk, Erkki, 1971-
2004-01-01
Heliplaatidest: Current 909 "The price for existence is eternal warfare", Aapo Ilves "Pilpaküla kontsert", Yello "The Eye", Maian Kärmas, Ain Agan, Riho Sibul, Arvo Haasma "Tuigutuled", Manatark "Chaos Engine"
Üliohtliku laadungiga rongid plaanitakse Tallinnast välja saata / Signe Kalberg
Kalberg, Signe, 1959-
2006-01-01
Valitsusele esitatakse kolm Tallinna raudteeümbersõidu varianti, analüüsi koostamisse kaasati AS Deloitte&Touche Eesti. Kaart: Tallinna raudteeümbersõit. Kommenteerivad: Raivo Uukkivi, Ain Kaljurand, Toomas Vitsut
Лившиц, Лев, 1924-2013
2006-01-01
Ain Järvega Kadrioru pargist. Kadrioru Lastepargi tekkimise ajaloost ja uue Lastepargi rajamisest. Ehitatakse uus Lastemuuseumi hoone kuhu kolib Kotzebue tänavalt Tallinna Nukumuuseum. Nukumuuseumist ja muuseumidest Kadriorus, ka KUMU hoonest
Runoff Characterization and Variations at McMurdo Station, Antarctica
2014-05-13
Boulevard Arlington, VA 22230 Laura Elliot and Corey Chan Antarctic Support Contract 7400 S. Tucson Way Centennial , CO 08112 Michael Diamond...then along the road and down Hut Point Road. Sub-basin 2 has the largest area and encompasses the majority of the snowfield and the depression above
Keddie, Amanda
2009-01-01
This paper presents the philosophies and practices of "Laura", a young English community liaison worker and former religious studies teacher who has recently converted to Islam. Drawing on data generated from a qualitative and predominantly interview-based research project that investigated issues of pedagogy and social justice in…
Journal of Endocrinology, Metabolism and Diabetes of South Africa ...
African Journals Online (AJOL)
Sleep: a serious contender for the prevention of obesity and non-communicable diseases · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. Dale E. Rae, Irshaad Ebrahim, Laura C. Roden, 48-49. http://dx.doi.org/10.1080/16089677.2016.1150574 ...
Vastutada lustides ja vastupidi / interv. Eva-Liisa Linder
2006-01-01
Lavakunstikooli XXII lend räägib kooliajast, õpetajatest ja õppetööst. Kõnelevad Mihkel Kabel, Martin Kõiv, Risto Kübar, Lauri Lagle, Tõnn Lamp, Mari-Liis Lill, Markus Luik, Ragne Pekarev, Laura Peterson, Ursula Ratasepp, Inga Salurand, Veiko Tubin, Nero Urke, Britta Vahur ja Sergo Vares
2011-09-01
NIOC Sugar Grove LT Stephen Gray , NATO Training Mission Afghanistan CTTC Andrew Hodyl, NIOC Colorado IT3 Adam Kissinger, SUSLA Korea LCDR Sven...Gauthier, NCTS Naples CTR1 Laura Geigel, NIOC Maryland IT3 Stephen Gerrald, NIOC Norfolk CTTC Derrick Gillespie, NIOC Texas CTR1 Eileen Girardy NIOC
Food for rumination : developing novel feeding strategies to improve the welfare of veal calves
Webb, L.E.
2014-01-01
Summary of thesis entitled: “Food for Rumination – Developing novel feeding strategies to improve the welfare of veal calves”, Laura Webb
Veal calves are typically fed high levels of milk replacer supplemented with solid feed, which tends to contain a relatively small roughage component.
Maalimine lubatud! 2014 A.D. = Painting allowed! 2014 A.D. / Jaan Elken
Elken, Jaan, 1954-
2014-01-01
Kaasaegsest maalikunstist Eestis. Vaadeldakse eredamaid hetki 2014. a. maalinäitustelt: Merike Estna isiknäitus Kumus, Eesti Kunstnike Liidu "Kevadnäitus", näitus "Sund" ja noorte maalikunstnike näitus "Cant go on, must go on" Tallinna Kunstihoones, Laura Põllu isiknäitus Hobusepea galeriis
77 FR 25510 - GPS Funds I, et al.; Notice of Application
2012-04-30
...] GPS Funds I, et al.; Notice of Application April 24, 2012. AGENCY: Securities and Exchange Commission... the Act to invest in certain financial instruments. Applicants: GPS Funds I, GPS Funds II (each a.... FOR FURTHER INFORMATION CONTACT: Laura L. Solomon, Senior Counsel, at (202) 551-6915 or Daniele...
Marrah, Arleezah; Mills, Roxanne
2011-01-01
This article describes the Librarianship Upgrades for Children and Youth Services (LUCY), a multifaceted multicultural continuing education program for librarians developed by the Library and Information Science Program at Old Dominion University. The Institute of Museum and Library Services (IMLS) funds LUCY through the Laura Bush 21st century…
Fooling the feeling of doing: a goal perspective on illusions of agency
Dannenberg, L.A.
2012-01-01
Machtige en succesvolle mensen zijn ongevoelig voor de illusie van agency (sturend vermogen). Dit komt omdat mensen die hun doel hebben bereikt of weten hoe ze dat kunnen bereiken, zich minder op de uitkomst van hun handelen hoeven te focussen. Dit blijkt uit onderzoek van Laura Dannenberg. Als
2011-02-23
... UNESCO (IO/UNESCO). Form Number: DS-7646. Respondents: U.S. college and university students applying for... students at U.S. colleges and universities, will submit descriptions of self-designed proposals for brief... Collection: DS-7652, U.S. National Commission for UNESCO Laura W. Bush Traveling Fellowship ACTION: Notice of...
PV Module Reliability Workshop | Photovoltaic Research | NREL
Gok, Cara Fagerholm, David M. Burns, Timothy J. Peshek, Laura S. Bruckman, Roger H. French Backsheet Chen, C. H. Hsueh, W. J. Hsieh Accurately Measuring PV Power Loss Due to Soiling-Michael Gostein and Walters, Stephen Barkaszi Tracking PV Changes: Bridging Between Thin-Film Cells and Modules-Russell
INHIBITION OF TOBACCO SMOKE-INDUCED LUNG INFLAMMATION BY A CATALYTIC ANTIOXIDANT
AMathematical Model for the Kinetics of the Male Reproductive Endocrine SystemLaura K. Potter1,2, H.A. Barton2 and R.W. Setzer21Curriculum in Toxicology, UNC-Chapel Hill, NC; 2US EPA, ORD, NHEERL, ETD, RTP, NCIn this presentation a model for the hormonal regul...
Wangai et al., Afr. J. Infect. Dis. (2011) 5(1): 1 - 6 SENSITIVITY OF ...
African Journals Online (AJOL)
AJTCAM
Wangai et al., Afr. J. Infect. Dis. (2011) 5(1): 1 - 6. 1. SENSITIVITY OF MICROSCOPY COMPARED TO MOLECULAR DIAGNOSIS OF P. FALCIPARUM: IMPLICATIONS ON MALARIA TREATMENT IN EPIDEMIC AREAS IN. KENYA. Laura Nyawira Wangai 1,2, Muriira Geoffrey Karau 3, Paul Nthakanio Njiruh 4, Omar Sabah 5 ...
Weiner, Jennie Miles; Burton, Laura J.
2016-01-01
In this study of nine participants in a turnaround principal preparation program, Jennie Miles Weiner and Laura J. Burton explore how gender role identity shaped participants' views of effective principal leadership and their place within it. The authors find that although female and male participants initially framed effective leadership…
the Cecil John Adams Travelling Fellowship
African Journals Online (AJOL)
1994-09-14
Sep 14, 1994 ... 1886 it boasted a coffee-shop, two chemists and a branch of the Standard Bank. ... him a son in 1898 but the infant died at the age of 6 months. By 1900 Florence ... By this time, he had married Laura Green. She was carrying ...
Gerli Padar läheb Eurovisioonile. Eurolaulu valiti 1,3 miljoni miljoni eest
2007-01-01
3. veebr. toimunud laulukonkursi Eurolaul 2007 võitis . Gerli Padar lauluga "Partners in Crime" (helilooja Hendrik Sal-Saller, sõnad Berit Veiber), teisele kohale jäi "Romeo ja Julia" Hele Kõre ja Kristjan Kasearu esituses, kolmandale Laura looga "Sunflowers". Telefonihääletusest ETV saates Eurolaul 2007
Toodangu maht sõltub impordist / Ain Alvela
Alvela, Ain, 1967-
2002-01-01
Saematerjali tootjate TOP 30. Käibe TOP 10. Käibe kasvu TOP 10. Kasumi TOP 10. Kasumi kasvu TOP 10. Rentaabluse TOP 10. Varade tootlikkuse TOP 10. Kahjumi TOP 5. Saematerjali tootjate finantsnäitajad. Saematerjali tootjate üldandmed. Tabelid
Rumsfeldi ei ole kunagi unustatud / Ain Lember
Lember, Ain
2004-01-01
Väljaandes Teheran Times ilmunud Kian Mokhtari artiklist, milles käsitletakse USA kaitseministri Donald Rumsfeldi poliitikukarjääri, tema süüdistamist Iraagile massihävitusrelvade ja nendega seotud tehnoloogia müümise soodustamises 1980-ndatel aastatel, Iraagi-poolset keemiarelva kasutamist Iraani vastu
Puti povõshenija effektivnosti proizvodstva / Ain Alvela
Alvela, Ain, 1967-
2008-01-01
Kulude kokkuhoid aitab saavutada kõrgemat tootlikkust. Vt. samas: Indeks rosta proizvoditelnosti za period 2000-2007gg., %. Kommenteerivad: Aleksandr Miina, Ants Pak, Kaul Aulasmägi, Veljo Haube ja Kuido Kuntro
Norma Maja astub kindlalt tulevikku / Ain Alvela
Alvela, Ain, 1967-
2000-01-01
AS Norma Maja saavutas kõrged kasumi ja kasumi kasvu näitajad töötajate koondamisega. Tabel: Norma Maja valdused, AS Norma Maja areng, AS ETK Majad areng. Arvamused: Ero Toom, Ivar Lahi ja Rein Loo
Extensive Degradation and Low Bioavailability of Orally Consumed Corn miRNAs in Mice
Directory of Open Access Journals (Sweden)
Haiqiu Huang
2018-02-01
Full Text Available The current study seeks to resolve the discrepancy in the literature regarding the cross-kingdom transfer of plant microRNAs (miRNAs into mammals using an improved miRNA processing and detection method. Two studies utilizing C57BL/6 mice were performed. In the first study, mice were fed an AIN-93M diet and gavaged with water, random deoxynucleotide triphosphates (dNTP or isolated corn miRNAs for two weeks (n = 10 per group. In the second study, mice were fed an AIN-93M diet, or the diet supplemented with 3% fresh or autoclaved corn powder for two weeks (n = 10 per group. Corn miRNA levels were analyzed in blood and tissue samples by real-time PCR (RT-PCR following periodate oxidation and β elimination treatments to eliminate artifacts. After removing false positive detections, there were no differences in corn miRNA levels between control and treated groups in cecal, fecal, liver and blood samples. Using an in vitro digestion system, corn miRNAs in AIN-93M diet or in the extracts were found to be extensively degraded. Less than 1% was recovered in the gastrointestinal tract after oral and gastric phases. In conclusion, no evidence of increased levels of corn miRNAs in whole blood or tissues after supplementation of corn miRNAs in the diet was observed in a mouse model.
Interpersonal violence in the United Arab Emirates.
Osman, Ossama T; Abbas, Alaa K; Eid, Hani O; Salem, Mohamed O; Abu-Zidan, Fikri M
2014-01-01
We aimed to study the anatomical distribution, severity and outcome of hospitalised interpersonal violence-related injured patients in Al-Ain, United Arab Emirates so as to give recommendations regarding the magnitude of this problem, its causes and priorities of prevention. Data were retrieved from Al-Ain Hospital Trauma Registry, which was prospectively collected over three years. There were 75 patients (males = 85.3%) having a mean age of 30 years. Eighty-one percent had blunt trauma. The estimated annual injury hospitalisation of interpersonal violence in Al-Ain city was 6.7 per 100,000 population. Females were significantly more injured by a family member (p = 0.02), at home (p = 0.005), and had more severe injuries (p = 0.003). There was a trend for children less than 18 years old to have more penetrating trauma (p = 0.06) and to be injured by a family member (p = 0.09). There was only one case of woman sexual assault and two cases of child abuse. The mean (SD) hospital stay was 7.87 (14.1) days. Less than 3% (n = 2) were admitted to the intensive care unit with no deaths. In conclusion, the majority of patients in our study had minor injuries. Nevertheless, the psychological impact may be major. This highlights the need to develop suitable mental health services in support of victims of interpersonal violence.
And now, a word from our sponsor.
Peebles, M Ellen
2003-10-01
Bryant Pharmaceutical's flagship product, a popular arthritis medicine called Seflex, is selling well--but not well enough. With generic versions due on the shelves in a couple of years, the drug company is looking for a dramatic sales increase. No wonder marketing VP Laura Goldenberg feels the pressure. She knows she has to reach more consumers, but in an environment where people bombarded with advertising are using devices such as TiVo to skip ads, her job has suddenly taken on a new intensity. In search of a new, gangbuster campaign, Laura and her ad agency come up with the idea of product placement--not your typical integration of a product into a television or movie script, but a less traditional approach. Their idea is to hire a much-loved, elderly actress to extol the virtues of Seflex on a morning news program. The news segment would be about arthritis, and Seflex would be casually mentioned during the interview. The company would have to pay the actress $1 million, and there are risks: What if it gets out that Bryant is paying her? What if the actress errs and says something about Seflex's side effects? If something goes wrong, Bryant Pharmaceutical's reputation could suffer. Should the company green-light Laura's plan? This fictional case study looks at the pros and cons of traditional product placement and newer, more subtle alternatives to advertising. Commenting on the case are Bob Gamgort, president of Masterfoods USA; Michelle R. Nelson, an assistant professor of journalism and mass communications at the University of Wisconsin, Madison; FTC commissioner Mozelle W. Thompson; and Mike Sheehan, president and CEO of Hill, Holliday, Connors, Cosmopulos.
Structural and frequency dependencies of a.c. and dielectric ...
Indian Academy of Sciences (India)
6Thin Film Laboratory, Department of Physics, Faculty of Education, Ain Shams ... conductivity and its frequency exponents were interpreted in terms of correlated barrier hopping ... cations in high-electron-mobility and heterostructure bipolar.
African Journals Online (AJOL)
EL-HAKIM
Immunology Unit, Department of Pediatrics, Ain Shams University, Cairo ... the case with food allergies).7,8 The parentral route ..... molecular-weight agents. ... and lack positive controls. ..... Immunology; Joint Council of Allergy, Asthma and.
Ainevaldkond "Kehakultuur" / Leila Oja
Oja, Leila, 1966-
2006-01-01
Ainevaldkonnast "Kehakultuur" Tartu Ülikooli õppekava arenduskeskuses väljatöötatud põhikooli ja gümnaasiumi riiklikus õppekavas - ainevaldkonna kirjeldus, läbivad teemad, aineõpetuse struktuur ning vajalikud ressursid
R102G polymorphism of the complement component 3 gene in ...
African Journals Online (AJOL)
Nur Afiqah Mohamad
a Malaysian Research Institute on Ageing, Universiti Putra Malaysia, Serdang 43400, Selangor ... Peer review under responsibility of Ain Shams University. ..... b Student t-test, P < 0.01. ... The International ARM Epidemiological Study Group.
Analytical solutions for one-dimensional advection– dispersion ...
Indian Academy of Sciences (India)
Department of Mathematics, AinShams University, Cairo 0020, Egypt. ∗. Corresponding author. .... Applying Laplace transformation to equations (1 and 2) gives: D d2. ∼ ...... Land, Water & Environmental Management: Integrated. Systems for ...
ETV uus seriaal "Vistrik" kavatseb nime muuta / Anne Vetik
Vetik, Anne
2006-01-01
Toimuvad ETV uue krimisarja "Vistrik" võtted, stsenarist Mihkel Ulman, režissöör Ain Prosa, produtsent Raivo Suviste, kesksetes rollides Marko Matvere, Jaan Rekkor, Elisabet Tamm, tootjaks OÜ Balti Video
[Kirjandusetendusest "Meri kümnele häälele"] / Kätlin Kaldmaa ; küsinud D. K. [Doris Kareva
Kaldmaa, Kätlin, 1970-
2011-01-01
Luulelavastus sisaldab Álvaro de Campose (Fernando Pessoa) "Mereoodi" ning Ain Kaalepi, Kalju Kruusa, fs-i jt. eesti luuletajate tekste. Lavastaja Anne Türnpu, etendused toimuvad kinos Sõprus. Vt. ka kuulutust lk. 30
Ohtlikud lennud / Simo Meinert
Meinert, Simo
2006-01-01
ETV uus algupärane krimisari "Ohtlik lend" : stsenarist Mihkel Ulman : lavastaja Ain Prosa : produtsent Raivo Suviste : peaosades Elisabet Tamm, Marko Matvere : Balti Video. Sama ka : Teleleht nr. 38, lk. 6-7 : ill
Directory of Open Access Journals (Sweden)
Gandra S
2015-01-01
Full Text Available Sumanth Gandra, Aline Azar, Mireya WessolosskyDivision of Infectious Disease and Immunology, University of Massachusetts Medical School, Worcester, MA, USABackground: Although anal high-risk human papillomavirus (HR-HPV infection and anal cytological abnormalities are highly prevalent among human immunodeficiency virus (HIV-infected men who have sex with men (MSM, there are insufficient data on these abnormalities among HIV-infected heterosexual men (HSM and women. In this study, we evaluated the prevalence of anal HR-HPV, cytological abnormalities, and performance of these screening tests in detecting high-grade anal intraepithelial neoplasia (AIN2+ among our cohort of HIV-infected MSM and non-MSM (HSM and women.Methods: A single-center, retrospective cohort study was conducted with HIV-infected individuals who underwent anal cancer screening with anal cytology and HR-HPV testing from January 2011 to January 31, 2013.Results: Screening of 221 HIV-infected individuals for both HR-HPV and anal cytology showed the presence of HR-HPV in 54% (abnormal anal cytology 48% of MSM, 28% (abnormal anal cytology 28% of HSM, and 27% (abnormal anal cytology 34% of women. Among 117 (53% individuals with abnormal results (HR-HPV-positive and/or cytology was atypical squamous cells of undetermined significance or above, 67 underwent high resolution anoscopy. Of these 67 individuals, 22 individuals had AIN2+ (17 MSM, four women, and one HSM. HR-HPV correlated better with AIN2+ than with anal cytology on biopsy in both MSM (r=0.29 versus r=0.10; P=0.05 versus P=0.49 and non-MSM (r=0.36 versus r=-0.34; P=0.08 versus P=0.09.Conclusion: Given the presence of AIN2+ in screened HIV-infected HSM and women, routine anal cancer screening in all HIV-infected individuals should be considered. HR-HPV merits further evaluation for anal cancer screening among non-MSM.Keywords: human immunodeficiency virus, anal human papillomavirus, heterosexual men, women, anal cancer
Evaluación in vitro de tabletas orales de complejos de cobre con antiinflamatorios no esteroideos
Directory of Open Access Journals (Sweden)
Julie Fernanda Benavides Arévalo
Full Text Available Introducción: los antiinflamatorios no esteroideos (AINES, son un grupo diverso y químicamente heterogéneo de fármacos analgésicos, antipiréticos y antiinflamatorios; sin embargo, su funcionamiento se ve afectado por su baja solubilidad acuosa y por la incidencia de efectos secundarios gastrointestinales. Como una alternativa a este problema, la formulación de tabletas orales con complejos de cobre con AINES muestra un adecuado comportamiento in vitro y podría tener efectos secundarios reducidos comparados con el fármaco antiinflamatorio no complejado. Objetivo: evaluar los procesos de desintegración y de disolución de tabletas orales de complejos de cobre con AINES. Métodos: luego de la síntesis y la caracterización instrumental de los complejos, se evaluó por microscopia óptica el efecto de la morfología, el tamaño de partícula y las características superficiales en el proceso de disolución; estos resultados fueron considerados para la formulación de los complejos y permitieron junto con la adecuada elección de un desintegrarte, un modificador de flujo, un lubricante y un aglutinante, la obtención de tabletas por compresión directa. Finalmente, en los comprimidos se evaluaron propiedades fisicomecánicas y los procesos de desintegración y disolución. Resultados: las tabletas de los complejos mostraron tiempos de desintegración entre 5 y 15 min y una liberación in vitro del 75 al 93 %. Conclusiones: la disolución de los AINES se vio favorecida por la formación de complejos, el menor tamaño de partícula, la presencia de poros y grietas en la superficie de las partículas y la inclusión de excipientes para la formulación de tabletas orales.
Zapata, Mara
In this case study of a female science teacher named Laura, numerous observations, field notes, researcher interpretations, and assertions were developed. As meanings were negotiated, intent of actions was defined using significant statements, clustered to produce invariant meaning units. Both the participant's intents and how she interpreted her experiences were central to the understandings sought in this study. Whenever Laura planned for teaching science, taught, or otherwise interacted with students, the following four themes seemed to frame her actions: (1) Responsibility to Nurture/Mother/Mentor (2) Connecting to and Relating (3) Meeting Gender-Specific Expectations (4) Promoting the Fighter/Survivor Within. Each theme is examined in relation to attitudes and beliefs about teaching and learning science, and conclusions and assertions are expressed. The findings of this study point to the tensions between Laura's attitudes and beliefs and her pedagogical practices, disconfirming these as they pertain to gender in relation to teaching and learning science. It was not evident as part of her daily practice that student experiences were used in an attempt to create connections between their lives and science, although Laura always emphasized that science is a way of life. The findings support questioning the role of intentionality and a teacher's perceived ability to adhere to intentions while practicing within the norms established by the social institution of schools operating within the larger structures of society. The major findings and implications are relevant to the manner teachers are prepared and encouraged to enact their practice by departments and boards of education, prepared by institutions of higher education and subsequent participation in professional development. Specifically, calling attention to how these educational frameworks emphasize or de-emphasize the role of teachers and promote cognizance in terms of the culture of schools, reflective
Jänes, Liina, 1977-
2000-01-01
Eesti kolhoosikeskuste arhitektuurist. Vaadeldakse aastail 1957-1990 ehitatud 24 keskusehoonet. Arhitektid Nikolai Kusmin, Harri Kingo, Toomas Rein, Vilen Künnapu, Ain Padrik, Maara Metsal, Meeli Truu jt. 17 välisvaadet, 3 joon., kaart
Mis saab maaärist? / Ester Šank
Šank, Ester, 1956-
2000-01-01
Maaostu piirava seaduseelnõu Riigikogu menetlusest välja arvamist kommenteerib Vootele Hansen. Lisatud ka eelnõu autorite Jaanus Marrandi, Harri Õunapuu ja töörühma liikme Ain Kendra seisukohad
Intel Corporation osaleb Eesti koolitusprogrammis / Raivo Juurak
Juurak, Raivo, 1949-
2001-01-01
Haridusministeeriumis tutvustati infotehnoloogiaalast koolitusprogrammi, milles osaleb maailma suuremaid arvutifirmasid Intel Corporation. Koolituskursuse käigus õpetatakse aineõpetajaid oma ainetundides interneti võimalusi kasutama. 50-tunnised kursused viiakse läbi kõigis maakondades
2008-01-01
Laseringi kauplustes müügilolevatest heliplaatidest: Compromise Blue "Loomad on lahti", Mari Boine "Remixed vol. 2 - It Ain't Necessarily Evil", Me, Myself and I "Aastaajad", Whitesnake "Good To Be Bad", Estelle "Shine"
African Journals Online (AJOL)
Pediatrics Department, Faculty of Medicine, Ain Shams University corresponding author: ..... imaging studies: The diagnosis of CMV pneumonia can be suggested by chest radiograph find- ... dictive value and can aid in identifying children who ...
Lugedes Pilve ja Pazi / Mathura
Mathura, pseud., 1973-
2007-01-01
Võrdlevalt Aare Pilve luulekogust "Näoline" (kirj. Tuum, 2007) ja Octavio Pazi luulekogust "Alati on olevik" (hispaania k. tlk. Ain Kaalep, Jaan Kaplinski, Asta Põldmäe ja Jüri Talvet, kirj. Perioodika, 1984)
Teater valib parimad :"Maarja kuulutamine" püüab viit auhinda
2009-01-01
Eesti teatriauhindade sõnalavastuste nominentide hulgas paistab silma Lembit Petersoni lavastus "Maarja kuulutamine" Theatrumis. See kandideerib nii parima lavastuse kui ka parima lavastaja tiitlile, samuti on parima naisnäitleja nominentidena välja toodud õed Laura ja Maria Peterson ning Lembit Peterson kandideerib ka parima meeskõrvalosa auhinnale samas lavastuses
Sleep: a serious contender for the prevention of obesity and non ...
African Journals Online (AJOL)
Sleep: a serious contender for the prevention of obesity and non-communicable diseases. Dale E. Rae, Irshaad Ebrahim, Laura C. Roden. Abstract. No Abstract. Full Text: EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT · http://dx.doi.org/10.1080/16089677.2016.
The First Reactor, 40th Anniversary (rev.)
Energy Technology Data Exchange (ETDEWEB)
Allardice, Corbin; Trapnell, Edward R; Fermi, Enrico; Fermi, Laura; Williams, Robert C
1982-12-01
This booklet, an updated version of the original booklet describing the first nuclear reactor, was written in honor of the 40th anniversary of the first reactor or "pile". It is based on firsthand accounts told to Corbin Allardice and Edward R. Trapnell, and includes recollections of Enrico and Laura Fermi.
Cultivating Inquiry-Driven Learners: A College Education for the Twenty-First Century
Conrad, Clifton; Dunek, Laura
2012-01-01
Inquiry-driven learners anticipate, embrace, and adapt to disruptive change. Clifton Conrad and Laura Dunek advance a transformative purpose of a college education. They invite stakeholders from across higher education to engage in vigorous dialogue about the aims of a college education--and how to realize those aims. Increasingly influenced by…
Working in the Virtual Stacks: The New Library and Information Science
Kane, Laura Townsend, Ed.
2011-01-01
Thanks in part to technology, the boundaries of library positions are dissolving. It is no longer practical to discuss the profession in terms of traditional library types, and in today's library, the relationship between librarians and technology is stronger than ever. In this informative volume, veteran author Laura Townsend Kane interviews…
77 FR 204 - Federal Acquisition Regulation; Technical Amendments
2012-01-03
... Parts 4, 8, 15, 19, 22, 23, 28, 42, and 52 Government procurement. Dated: December 21, 2011. Laura... paragraph (a)(2) ``http:// www.sba.gov/GC/pcr.html'' and adding ``http://www.sba.gov/content/ procurement-center-representatives'' in its place. PART 22--APPLICATION OF LABOR LAWS TO GOVERNMENT ACQUISITIONS 22...
1993-09-01
AF89-071. Washington: GPO, 1989. 159 14. Diaz , SSgt Laura, 648 Med Sq/SGHL. Personal interview. Brooks AFB, San Antonio TX, 14 July 1993. 15. EA...Training Strateav of the Acauisition Management of Hazardous Materials Program. Draft Report. McLean VA, August 1991. 36. Moore, SSgt Alicia . AL/OEVP
The effects of composition and firing cycle on sintering of aluminium nitride
International Nuclear Information System (INIS)
Hewett, C.; Trigg, M.B.
1992-01-01
A central composite design was used to evaluate the relative effects of temperature, time and Y 2 O 3 content on the densification behaviour of a commercial aluminium nitride (AIN). Over the range of the independent variables studied, temperature was found to exert the dominate influence. Low levels of Y 2 O 3 were found to be effective for the densification of AIN. After firing, cubic 3Y 2 O 3.5 Al 2O3 (YAG) was detected for the lower levels of Y 2 O 3 addition. At the higher levels both YAG and 2Y 2 O 3 .Al 2 O 3 were detected. For a dense sample the values obtained for hardness and fracture toughness were comparable to those reported in the literature. 11 refs., 1 tab
Directory of Open Access Journals (Sweden)
A. Moreno
2003-02-01
Full Text Available Antecedentes: Los antiinflamatorios no esteroideos (AINE, utilizados en el tratamiento de la artrosis, pueden producir reacciones adversas gastrointestinales (GI graves. Celecoxib, un inhibidor específico de la ciclooxigenasa 2 (COX-2, ha demostrado una eficacia equivalente a los AINE convencionales con un mejor perfil de tolerabilidad y seguridad. Objetivo: La finalidad de este estudio ha sido realizar un análisis coste-efectividad sobre el uso de celecoxib frente a los AINE clásicos en el tratamiento de la artrosis. Material y métodos: El análisis coste-efectividad se ha diseñado mediante un modelo farmacoeconómico, definiéndose como unidad de efectividad a cada año de vida ganado tras la toma de celecoxib o AINE. La probabilidad de que aparezcan los diferentes resultados clínicos se ha obtenido de artículos publicados y de asunciones incorporadas. Sólo se han valorado los costes directos médicos (medicación, hospitalización, pruebas complementarias, analíticas, visitas extras, etc., sin haberse incluido otros costes. La perspectiva del estudio ha sido la del Sistema Nacional de Salud y el horizonte temporal elegido ha sido de 6 meses. Resultados: El coste adicional por cada año de vida ganado secundario al uso de celecoxib frente a los AINE clásicos asciende a 8.017 € (1.333.834 ptas.. El análisis de sensibilidad muestra cómo estos valores son sensibles a la modificación del coste de AINE y gastroprotector, así como a la inclusión de grupos poblacionales con edades más bajas. Conclusiones: Celecoxib puede ser considerado como una opción coste-efectiva en el tratamiento de la artrosis, ya que va a evitar muertes y a ganar años de vida para los pacientes con un coste adicional razonable y moderado, cuando se compara con los AINE. Su eficiencia aumenta a medida que se utiliza en poblaciones con menor edad media y, probablemente, en aquellas con mayor riesgo de desarrollar complicaciones GI.Background: Non
Energy Technology Data Exchange (ETDEWEB)
Jiang, Hongxing
2008-10-31
Investigations have been conducted focused on the fundamental material properties of AIN and high AI-content AIGaN alloys and further developed MOCVD growth technologies for obtaining these materials with improved crystalline quality and conductivities.
Sekulariseeruv sakraalarhitektuur / Piret Lindpere
Lindpere, Piret, 1963-
2002-01-01
Moodsatest kirikutest, sajandilõpu eesti sakraalarhitektuurist. Pikemalt Tallinna metodisti kirikust (Vilen Künnapu, Ain Padrik), Püha Brigitta keskusest (projekteerimist juhtis Ra Luhse) ja ehitama hakatavast Viimsi Püha Jaakobi kirikust (Erkki Ristoja, Martin Aunin)
Valme, Valner, 1970-
2006-01-01
Uutest heliplaatidest Graham Coxon "Love Travels At Illegal Speeds", Gabriel Rios "Ghostboy", "Sounds Of India", John Hughes "Wild Ocean", Ain Agan & Tallinn Chamber Orchestra/Toomas Vavilov, Ashanti "Collectables By Ashanti", Liv Kristine "Enter My Religion"
Itaalia seadustab ainuõige pitsa / Kaivo Kopli
Kopli, Kaivo
2004-01-01
Pizza Napolitana ained, valmistusviis ja tulemus peavad vastama nõuetele. Itaalia põllumajandusministeeriumis välja töötatud pitsareeglid on osa Itaalia pingutustest kaitsta oma kuulsat kööki. Lisaks: Pitsavalmistamise reeglid
Sumerki klassitsizma / Iosef Kats
Kats, Iosef
2004-01-01
Tallinna Viru Keskuse juurde püstitatud Mare Mikofi kavandatud hiigelskulptuurist. Kuju on Mikofi versioon Weizenbergi "Hämarikust". Viru Keskuse arhitektide Vilen Künnapu ja Ain Padriku arvates peaks naiseskulptuur mahendama kaubakeskuse kubistlikku ja maskuliinset arhitektuuri
Vahemets, Aivo
2005-01-01
Uutest heliplaatidest The All-American Rejects "Move Along", Devendra Banhart "Criple Crow", Rod Stewart "Thank For The Memory", Him "Dark Light", Status Quo "the Party Ain't Over Yet", Ricky Martin "Life", Barbara Streisand "Guilty Pleasures"
Emajõe äärde kerkib Tartu tulevane sümbol : Kroodo-Tower / Nils Niitra
Niitra, Nils, 1975-
2005-01-01
ASi Linnaehitus nõukogu liige Alar Kroodo plaanib Emajõe äärde 23-korruselise kõrghoone ehitamist, mille ehitusmaksumuseks kujuneb 100 kuni 200 miljonit krooni. Kõrghoone on projekteerinud arhitektid Ain Padrik ja Vilen Künnapu
"Arvuti koolis" ja arvutiõpetus õppekavas / Helen Vanganen, Jevgeni Košelev
Vanganen, Helen
2002-01-01
Ligi 1500 aineõpetajat osales 2001/2002 õppeaastal kursusel "Arvuti koolis". Õpetajad tutvusid Oxfordi Ülikooli jätkukursusega - originaalprogramm kannab nime "Intelʼ Teach to the Future", mis on otseselt seotud infotehnoloogia rakendamisega õppekavas
Kes kaitseks Eesti ohvitsere NKVD-KGB laimu eest? / Peep Varju
Varju, Peep
2008-01-01
Autor polemiseerib Eesti Ekspressis ilmunud artiklitega Eesti endiste ohvitseride kohta, kus käsitletakse nende väidetavat koostööd KGBga. Vaatluse all on ohvitserid Ain Mere, Harald Nugiseks, Alfons Rebane ja Harald Riipalu
Nigel saak ähvardab kalureid pankrotiga / Jüri E Kukk
Kukk, Jüri E., 1961-
2004-01-01
Tänavune kalasaak Võrtsjärvest on jäänud väga kesiseks. Võrtsjärve Limnologiajaama juhataja Ain Järvalt peab kalade vähesuse põhjuseks heitlikke ilmastikuolusid. Lisa: Kalasaagid [1999-2003
Harvard Education Letter. Volume 23, Number 2, March-April 2007
Chauncey, Caroline, Ed.
2007-01-01
"Harvard Education Letter" is published bimonthly at the Harvard Graduate School of Education. This issue of "Harvard Education Letter" contains the following articles: (1) More Than "Making Nice": Getting Teachers to (Truly) Collaborate (Laura Pappano); (2) "Doing the Critical Things First": An Aligned Approach to PreK and Early Elementary Math;…
HPV Prevention (A Cup of Health with CDC)
Centers for Disease Control (CDC) Podcasts
2016-07-07
Human papillomavirus, or HPV, is a virus that can cause certain cancers and is the most commonly sexually transmitted infection in the U.S. In this podcast, Dr. Laura Viens discusses the importance of getting vaccinated against HPV. Created: 7/7/2016 by MMWR. Date Released: 7/7/2016.
2010-04-01
Rubrics for the ASBMB Undergraduate Poster Competition 2007 Dr. David Usher (Dept. of Biological Sciences), Tyler Larsen and Laura Sloofman. A good site...did his research on a genetic disease called Spinal Muscular Atrophy, also known as SMA. "I did research up at the Children’s Hospital because this is a