Monitoring Severe Accidents Using AI Techniques

International Nuclear Information System (INIS)

No, Young Gyu; Kim, Ju Hyun; Na, Man Gyun; Ahn, Kwang Il

2011-01-01

It is very difficult for nuclear power plant operators to monitor and identify the major severe accident scenarios following an initiating event by staring at temporal trends of important parameters. The objective of this study is to develop and verify the monitoring for severe accidents using artificial intelligence (AI) techniques such as support vector classification (SVC), probabilistic neural network (PNN), group method of data handling (GMDH) and fuzzy neural network (FNN). The SVC and PNN are used for event classification among the severe accidents. Also, GMDH and FNN are used to monitor for severe accidents. The inputs to AI techniques are initial time-integrated values obtained by integrating measurement signals during a short time interval after reactor scram. In this study, 3 types of initiating events such as the hot-leg LOCA, the cold-leg LOCA and SGTR are considered and it is verified how well the proposed scenario identification algorithm using the GMDH and FNN models identifies the timings when the reactor core will be uncovered, when CET will exceed 1200 .deg. F and when the reactor vessel will fail. In cases that an initiating event develops into a severe accident, the proposed algorithm showed accurate classification of initiating events. Also, it well predicted timings for important occurrences during severe accident progression scenarios, which is very helpful for operators to perform severe accident management

Reactor noise analysis of experimental fast reactor 'JOYO'

International Nuclear Information System (INIS)

Ohtani, Hideji; Yamamoto, Hisashi

1980-01-01

As a part of dynamics tests in experimental fast reactor ''JOYO'', reactor noise tests were carried out. The reactor noise analysis techniques are effective for study of plant characteristics by determining fluctuations of process signals (neutron signal, reactor inlet temperature signals, etc.), which are able to be measured without disturbances for reactor operations. The aims of reactor noise tests were to confirm that no unstable phenomenon exists in ''JOYO'' and to gain initial data of the plant for reference of the future data. Data for the reactor noise tests treated in this paper were obtained at 50 MW power level. Fluctuations of process signals were amplified and recorded on analogue tapes. The analysis was performed using noise code (NOISA) of digital computer, with which statistical values of ASPD (auto power spectral density), CPSD (cross power spectral density), and CF (coherence function) were calculated. The primary points of the results are as follows. 1. RMS value of neutron signal at 50 MW power level is about 0.03 MW. This neutron fluctuation is not disturbing reactor operations. 2. The fluctuations of A loop reactor inlet temperatures (T sub(AI)) are larger than the fluctuations of B loop reactor inlet temperature (T sub(BI)). For this reason, the major driving force of neutron fluctuations seems to be the fluctuations of T sub(AI). 3. Core and blanket subassemblies can be divided into two halves (A and B region), with respect to the spacial motion of temperature in the reactor core. A or B region means the region in which sodium temperature fluctuations in subassembly are significantly affected by T sub(AI) or T sub(BI), respectively. This phenomenon seems to be due to the lack of mixing of A and B loop sodium in lower plenum of reactor vessel. (author)

The Atomics International (AI) prototype large breeder reactor (PLBR)

International Nuclear Information System (INIS)

McDonald, J.S.; Campise, A.V.; Brunings, J.

1978-01-01

The AI-PLBR breeder plant design prepared for ERDA and EPRI is of 1000 MWe size, utilizing a loop-type sodium system configuration and producing 2200 psig/850 0 F steam. A 'bullseye' core geometry type sodium system configuration and is employed with Pu0 2 -UO 2 fuel and UO 2 fertile material. The reactor outlet coolant temperature is 930 0 F. A modified 'A'-frame refueling system is employed, which is capable of handling 1/3 of a core loading in 12 days. An inducer-type mechanical pump is used in the primary circuit because of its excellent NPSH characteristics. Hockey sticks steam generators are used to produce near-fossil steam conditions at the turbine throttle. The balance of plant (BOP) design was developed by the architectural-engineering firm of Burns and Roe. It includes Allis-Chalmers - KWU 1800-rpm tandem-compound turbine, selected with high-,intermediate-, and two double-flow low-pressure cylinders equipped with two moisture separator cyclones. A design feature to enhance the licensability of the reference design is the three-level Decay Heat Removal System (DHRS), which consists of normal, backup, and diverse decay heat removal paths. The Atomics International PLBR design illustrated the technical soundness of the LMFBR system for meeting the world's long-term electrical energy supply needs. The design includes design features to assure licensability and innovative engineering features to enhance reliability, constructability, economics, and U.S. utility grid compatibility. The design concept provides a sound basis for the future detailed design of a prototype plant and subsequent development of larger LMFBR plants. (author)

Man-machine communication in reactor control using AI methods

International Nuclear Information System (INIS)

Klebau, J.; Lindner, A.; Fiedler, U.

1987-01-01

In the last years the interest in process control has expecially focused on problems of man-machine communication. It depends on its great importance to process performance and user acceptance. Advanced computerized operator aids, e.g. in nuclear power plants, are as well as their man-machine interface. In the Central Institute for Nuclear Research in Rossendorf a computerized operator support system for nuclear power plants is designed, which is involved in a decentralized process automation system. A similar but simpler system, the Hierarchical Informational System (HIS) at the Rossendorf Research Reactor, works with a computer controlled man-machine interface, based on menu. In the special case of the disturbance analysis program SAAP-2, which is included in the HIS, the limits of menu techniques are obviously. Therefore it seems to be necessary and with extended hard- and software possible to realize an user controlled natural language interface using Artificial Intelligence (AI) methods. The draft of such a system is described. It should be able to learn during a teaching phase all phrases and their meanings. The system will work on the basis of a self-organizing, associative data structure. It is used to recognize a great amount of words which are used in language analysis. Error recognition and, if possible, correction is done by means of a distance function in the word set. Language analysis should be carried out with a simplified word class controlled functional analysis. With this interface it is supposed to get experience in intelligent man-machine communication to enhance operational safety in future. (author)

Environmental Information Document: L-reactor reactivation

International Nuclear Information System (INIS)

Mackey, H.E. Jr.

1982-04-01

Purpose of this Environmental Information Document is to provide background for assessing environmental impacts associated with the renovation, restartup, and operation of L Reactor at the Savannah River Plant (SRP). SRP is a major US Department of Energy installation for the production of nuclear materials for national defense. The purpose of the restart of L Reactor is to increase the production of nuclear weapons materials, such as plutonium and tritium, to meet projected needs in the nuclear weapons program

Environmental Information Document: L-reactor reactivation

Energy Technology Data Exchange (ETDEWEB)

Mackey, H.E. Jr. (comp.)

1982-04-01

Purpose of this Environmental Information Document is to provide background for assessing environmental impacts associated with the renovation, restartup, and operation of L Reactor at the Savannah River Plant (SRP). SRP is a major US Department of Energy installation for the production of nuclear materials for national defense. The purpose of the restart of L Reactor is to increase the production of nuclear weapons materials, such as plutonium and tritium, to meet projected needs in the nuclear weapons program.

L-Reactor operation, Savannah River Plant: environmental assessment

International Nuclear Information System (INIS)

1982-08-01

The purpose of this document is to assess the significance of the effects on the human environment of the proposed resumption of L-reactor operation at the Savannah River Plant, scheduled for October 1983. The discussion is presented under the following section headings: need for resumption of L-Reactor operations and purpose of this environmental assessment; proposed action and alternative; affected environment (including, site location and description, land use, historic and archeological resources, socioeconomic and community characteristics, geology and seismology, hydrology, meteorology and climatology, ecology, and radiation environment); environmental consequences; summary of projected L-Reactor releases and impacts; and Federal and State permits and approval. The three appendices are entitled: radiation dose calculation methods and assumptions; floodplain/wetlands assessment - L-Reactor operations; and, conversion table. A list of references is included at the end of each chapter

Artificial intelligence. Fears of an AI pioneer.

Science.gov (United States)

Russell, Stuart; Bohannon, John

2015-07-17

From the enraged robots in the 1920 play R.U.R. to the homicidal computer H.A.L. in 2001: A Space Odyssey, science fiction writers have embraced the dark side of artificial intelligence (AI) ever since the concept entered our collective imagination. Sluggish progress in AI research, especially during the “AI winter” of the 1970s and 1980s, made such worries seem far-fetched. But recent breakthroughs in machine learning and vast improvements in computational power have brought a flood of research funding— and fresh concerns about where AI may lead us. One researcher now speaking up is Stuart Russell, a computer scientist at the University of California, Berkeley, who with Peter Norvig, director of research at Google, wrote the premier AI textbook, Artificial Intelligence: A Modern Approach, now in its third edition. Last year, Russell joined the Centre for the Study of Existential Risk at Cambridge University in the United Kingdom as an AI expert focusing on “risks that could lead to human extinction.” Among his chief concerns, which he aired at an April meeting in Geneva, Switzerland, run by the United Nations, is the danger of putting military drones and weaponry under the full control of AI systems. This interview has been edited for clarity and brevity.

Rapid-L Operator-Free Fast Reactor Concept Without Any Control Rods

International Nuclear Information System (INIS)

Kambe, Mitsuru; Tsunoda, Hirokazu; Mishima, Kaichiro; Iwamura, Takamichi

2003-01-01

The 200-kW(electric) uranium-nitride-fueled lithium-cooled fast reactor concept 'RAPID-L' to achieve highly automated reactor operation has been demonstrated. RAPID-L is designed for a lunar base power system. It is one of the variants of the RAPID (Refueling by All Pins Integrated Design) fast reactor concept, which enables quick and simplified refueling. The essential feature of the RAPID concept is that the reactor core consists of an integrated fuel assembly instead of conventional fuel subassemblies. In this small-size reactor core, 2700 fuel pins are integrated and encased in a fuel cartridge. Refueling is conducted by replacing a fuel cartridge. The reactor can be operated without refueling for up to 10 yr.Unique challenges in reactivity control systems design have been addressed in the RAPID-L concept. The reactor has no control rod but involves the following innovative reactivity control systems: lithium expansion modules (LEM) for inherent reactivity feedback, lithium injection modules (LIM) for inherent ultimate shutdown, and lithium release modules (LRM) for automated reactor startup. All these systems adopt 6 Li as a liquid poison instead of B 4 C rods. In combination with LEMs, LIMs, and LRMs, RAPID-L can be operated without an operator. This reactor concept is also applicable to the terrestrial fast reactors. In this paper, the RAPID-L reactor concept and its transient characteristics are presented

RAPID-L Highly Automated Fast Reactor Concept Without Any Control Rods (1) Reactor concept and plant dynamics analyses

International Nuclear Information System (INIS)

Kambe, Mitsuru; Tsunoda, Hirokazu; Mishima, Kaichiro; Iwamura, Takamichi

2002-01-01

The 200 kWe uranium-nitride fueled lithium cooled fast reactor concept 'RAPID-L' to achieve highly automated reactor operation has been demonstrated. RAPID-L is designed for Lunar base power system. It is one of the variants of RAPID (Refueling by All Pins Integrated Design), fast reactor concept, which enable quick and simplified refueling. The essential feature of RAPID concept is that the reactor core consists of an integrated fuel assembly instead of conventional fuel subassemblies. In this small size reactor core, 2700 fuel pins are integrated altogether and encased in a fuel cartridge. Refueling is conducted by replacing a fuel cartridge. The reactor can be operated without refueling for up to 10 years. Unique challenges in reactivity control systems design have been attempted in RAPID-L concept. The reactor has no control rod, but involves the following innovative reactivity control systems: Lithium Expansion Modules (LEM) for inherent reactivity feedback, Lithium Injection Modules (LIM) for inherent ultimate shutdown, and Lithium Release Modules (LRM) for automated reactor startup. All these systems adopt lithium-6 as a liquid poison instead of B 4 C rods. In combination with LEMs, LIMs and LRMs, RAPID-L can be operated without operator. This is the first reactor concept ever established in the world. This reactor concept is also applicable to the terrestrial fast reactors. In this paper, RAPID-L reactor concept and its transient characteristics are presented. (authors)

AIS authentication

CERN Multimedia

2006-01-01

Users are invited to use the NICE password for AIS authentication. As announced in CNL June-August 2006 (see http://www.cerncourier.com/articles/cnl/3/6/14/1) it is possible to use the NICE username and password to log on to AIS. The procedure is now fully operational and users can themselves reset the AIS password such that the NICE password will be used for authentication required by AIS applications. We strongly recommend CERN users who have a NICE account (this is the case of most users) to do this, with the objective to reduce the number of passwords they need to remember. This can be achieved very easily, directly from the Change Password option on the AIS login (https://aislogin.cern.ch/). Users should just select the '[Change Password]' option displayed at the bottom of the page, provide the 'Old Password' and then click on the button 'Use Nice password' followed by 'Submit'. Change Password option on the AIS login windowSetting the AIS password - Use Nice Password It should be noted that the proce...

Monitoring severe accidents using AI techniques

Energy Technology Data Exchange (ETDEWEB)

No, Young Gyu; Ahn, Kwang Il [Korea Atomic Energy Research Institute, Daejeon (Korea, Republic of); Kim, Ju Hyun; Na, Man Gyun [Dept. of Nuclear Engineering, Chosun University, Gwangju (Korea, Republic of); Lim, Dong Hyuk [Korea Institute of Nuclear Nonproliferation and Control, Daejon (Korea, Republic of)

2012-05-15

After the Fukushima nuclear accident in 2011, there has been increasing concern regarding severe accidents in nuclear facilities. Severe accident scenarios are difficult for operators to monitor and identify. Therefore, accurate prediction of a severe accident is important in order to manage it appropriately in the unfavorable conditions. In this study, artificial intelligence (AI) techniques, such as support vector classification (SVC), probabilistic neural network (PNN), group method of data handling (GMDH), and fuzzy neural network (FNN), were used to monitor the major transient scenarios of a severe accident caused by three different initiating events, the hot-leg loss of coolant accident (LOCA), the cold-leg LOCA, and the steam generator tube rupture in pressurized water reactors (PWRs). The SVC and PNN models were used for the event classification. The GMDH and FNN models were employed to accurately predict the important timing representing severe accident scenarios. In addition, in order to verify the proposed algorithm, data from a number of numerical simulations were required in order to train the AI techniques due to the shortage of real LOCA data. The data was acquired by performing simulations using the MAAP4 code. The prediction accuracy of the three types of initiating events was sufficiently high to predict severe accident scenarios. Therefore, the AI techniques can be applied successfully in the identification and monitoring of severe accident scenarios in real PWRs.

Monitoring severe accidents using AI techniques

International Nuclear Information System (INIS)

No, Young Gyu; Ahn, Kwang Il; Kim, Ju Hyun; Na, Man Gyun; Lim, Dong Hyuk

2012-01-01

After the Fukushima nuclear accident in 2011, there has been increasing concern regarding severe accidents in nuclear facilities. Severe accident scenarios are difficult for operators to monitor and identify. Therefore, accurate prediction of a severe accident is important in order to manage it appropriately in the unfavorable conditions. In this study, artificial intelligence (AI) techniques, such as support vector classification (SVC), probabilistic neural network (PNN), group method of data handling (GMDH), and fuzzy neural network (FNN), were used to monitor the major transient scenarios of a severe accident caused by three different initiating events, the hot-leg loss of coolant accident (LOCA), the cold-leg LOCA, and the steam generator tube rupture in pressurized water reactors (PWRs). The SVC and PNN models were used for the event classification. The GMDH and FNN models were employed to accurately predict the important timing representing severe accident scenarios. In addition, in order to verify the proposed algorithm, data from a number of numerical simulations were required in order to train the AI techniques due to the shortage of real LOCA data. The data was acquired by performing simulations using the MAAP4 code. The prediction accuracy of the three types of initiating events was sufficiently high to predict severe accident scenarios. Therefore, the AI techniques can be applied successfully in the identification and monitoring of severe accident scenarios in real PWRs.

Artificial Intelligence and its Reasonable Application Scenario to Reactor Operation

International Nuclear Information System (INIS)

Im, Ki Hong; Suh, Yong-Suk; Park, Cheol; Lim, In-Cheol

2017-01-01

This paper presents brief but reasonable scenarios for applying AI or machine learning technologies to research reactor from various perspectives. Two less safety critical scenarios for applying AI to reactor operation are introduced in this study. However, the AI assistant will not only be an assistant but it will also be an operator in the future. What is required is big operation data which can represent all the cases requiring operation decision, including normal operation and accident data as well, and enough time to train and fix the AI system with this data. We can predict AI study in this area can begin with a mild and safe application. But in the near future, this technology could be used to handle or automate more severe operations.

Campus 3 méthode de français

CERN Document Server

Pécheur, Jacques; Molinié, Muriel

2003-01-01

Méthode de français pour grands adolescents et adultes sur 3 niveaux. Ce niveau comprend : un livre de l'élève, un cahier d'exercices, un livre du professeur, une vidéo, des cassettes audio collectives au CD, et pour l'élève : une cassette audio individuelle ou CD.

AI-2 signalling is induced by acidic shock in probiotic strains of Lactobacillus spp

DEFF Research Database (Denmark)

Moslehi Jenabian, Saloomeh; Gori, Klaus; Jespersen, Lene

2009-01-01

Survival and ability to respond to various environmental stresses such as low pH are important factors for lactobacilli for their function as probiotics. LuxS-mediated quorum sensing mechanism, which is based on the production of universal signal molecule called autoinducer-2 (AI-2), regulates...... important physiological traits and a variety of adaptive processes in different bacteria. The aim of this study was to investigate the effect of acidic stress on LuxS-mediated quorum sensing (AI-2 signalling) in four probiotic strains of different Lactobacillus species. Initially, the production of AI-2...... concomitant with the reduction of pH, reaching maximum at late exponential phase (L. rhamnosus GG) or at stationary phase (L. salivarius UCC118, L. acidophilus NCFM and L. johnsonii NCC533). Acidic shock experiments were conducted on L. rhamnosus GG and L. acidophilus NCFM after exposure to different acidic...

AI-2 signalling is induced by acidic shock in probiotic strains of Lactobacillus spp.

Science.gov (United States)

Moslehi-Jenabian, Saloomeh; Gori, Klaus; Jespersen, Lene

2009-11-15

Survival and ability to respond to various environmental stresses such as low pH are important factors for lactobacilli for their function as probiotics. LuxS-mediated quorum sensing mechanism, which is based on the production of universal signal molecule called autoinducer-2 (AI-2), regulates important physiological traits and a variety of adaptive processes in different bacteria. The aim of this study was to investigate the effect of acidic stress on LuxS-mediated quorum sensing (AI-2 signalling) in four probiotic strains of different Lactobacillus species. Initially, the production of AI-2-like molecule was investigated in four strains of Lactobacillus spp. at standard growth conditions using Vibrio harveyi bioluminescence assay. Species variation in AI-2 activity was observed. AI-2 activity started at early-exponential growth phase and increased during the mid-exponential phase concomitant with the reduction of pH, reaching maximum at late exponential phase (L. rhamnosus GG) or at stationary phase (L. salivarius UCC118, L. acidophilus NCFM and L. johnsonii NCC533). Acidic shock experiments were conducted on L. rhamnosus GG and L. acidophilus NCFM after exposure to different acidic shocks (pH 5.0, 4.0 and 3.0) and to pH 6.5 as control, measuring AI-2 activity and transcription of the luxS gene. AI-2 activity increased by lowering the pH in a dose dependent manner and was negatively influenced by acid adaptation. In both species, the luxS gene was repressed after exposure to pH 6.5 as control. However, after acidic shock (pH 4.0) a transient response of luxS gene was observed and the transcription augmented over time, reaching a maximum level and decreased subsequently. Acid adaptation of cells attenuated the transcription of this gene. Based on the observations done in the present study, the luxS gene appears to have a clear role in acidic stress response in probiotic lactobacilli. This might be important in the survival of these bacteria during the passage

Taxi ! méthode de français : niveau 3

CERN Document Server

Johnson, Anne-Marie

2004-01-01

Taxi ! 3 est une méthode interactive, qui développe non seulement les connaissances, mais aussi les savoir-faire et les savoir-être de l'apprenant, à l'écrit comme à l'oral. La méthode est très simple à utiliser : une leçon = une double page. Taxi ! 3 couvre le niveau Bl du Cadre européen commun de référence pour l'apprentissage, l'enseignement et l'évaluation des langues. La méthode permet de se préparer aux épreuves A3 et A4 du DELF 1er degré. Une progression et des contenus fonctionnels et langagiers solides permettent à l'apprenant d'atteindre rapidement une autonomie en français dans des situations de la vie courante. Taxi ! 3 permet de mieux connaître la France d'aujourd'hui et les comportements des Français à travers une grande variété de documents authentiques (écrit et audio).

Inertial Fusion Energy reactor design studies: Prometheus-L, Prometheus-H

International Nuclear Information System (INIS)

Waganer, L.M.; Driemeyer, D.E.; Lee, V.D.

1992-03-01

This report contains a review of design studies for inertial confinement reactors. The first of three volumes briefly discusses the following: Introduction; Key objectives, requirements, and assumptions; Systems modeling and trade studies; Prometheus-L reactor plant design overview; Prometheus-H reactor plant design overview; Key technical issues and R ampersand D requirements; Comparison of IFE designs; and study conclusions

Characteristics of D(-3)He fueled FRC reactor: ARTEMIS-L

Science.gov (United States)

Momota, H.; Motojima, O.; Okamoto, M.; Sudo, S.; Tomita, Y.; Yamaguchi, S.; Iiyoshi, A.; Onozuka, M.; Ohnishi, M.; Uenosono, C.

1993-11-01

The characteristics of D(-3)He fueled commercial fusion reactor ARTEMIS-L are discussed. By using favorable characteristics of a field-reversed configuration, the fusion plasma of ARTEMIS-L becomes compact and its veta-value is extremely high. Consequently, it is possible to construct an economical fusion power plant based on this concept. The life of the structural materials is found during the full reactor life (30 years) and the safety of the reactor is intrinsic to D(-3)He fuels. The amount of disposed materials is rather small and the level of the intruder dose is so low that the plant appears to be acceptable in regards to the environment.

D-3He fueled FRC reactor 'ARTEMIS-L'

International Nuclear Information System (INIS)

Momota, Hiromu; Tomita, Yukihiro; Ishida, Akio; Kohzaki, Yasuji; Nakao, Yasuyuki; Nishikawa, Masabumi; Ohi, Shoichi; Ohnishi, Masami.

1992-09-01

A neutron-lean D- 3 He fueled field reversed configuration (FRC) fusion reactor is studied on the bases of former high-efficiency ARTEMIS design. Certain improvements such as effective axial contracting plasma heating and cusp-type direct energy converters as well as an empirical scale of the energy confinement are introduced. The resultant total neutron load onto the first wall of the plasma chamber is as low as 0.1 MW/m 2 , which enable the life of the first wall or the structural materials to be longer than the whole life of the reactor. The attractive characteristics of the neutron-lean reactor follow in the ARTEMIS design: it is socially acceptable in views of radioactivity and fuel resources, and the cost of electricity appears to be cheap compared with that from a light water reactor. Critical physics and engineering issues for performing the ARTEMIS-L reactor are clarified. (author)

LuxS-independent formation of AI-2 from ribulose-5-phosphate

Directory of Open Access Journals (Sweden)

Hardie Kim R

2008-06-01

Full Text Available Abstract Background In many bacteria, the signal molecule AI-2 is generated from its precursor S-ribosyl-L-homocysteine in a reaction catalysed by the enzyme LuxS. However, generation of AI-2-like activity has also been reported for organisms lacking the luxS gene and the existence of alternative pathways for AI-2 formation in Escherichia coli has recently been predicted by stochastic modelling. Here, we investigate the possibility that spontaneous conversion of ribulose-5-phosphate could be responsible for AI-2 generation in the absence of luxS. Results Buffered solutions of ribulose-5-phosphate, but not ribose-5-phosphate, were found to contain high levels of AI-2 activity following incubation at concentrations similar to those reported in vivo. To test whether this process contributes to AI-2 formation by bacterial cells in vivo, an improved Vibrio harveyi bioassay was used. In agreement with previous studies, culture supernatants of E. coli and Staphylococcus aureus luxS mutants were found not to contain detectable levels of AI-2 activity. However, low activities were detected in an E. coli pgi-eda-edd-luxS mutant, a strain which degrades glucose entirely via the oxidative pentose phosphate pathway, with ribulose-5-phosphate as an obligatory intermediate. Conclusion Our results suggest that LuxS-independent formation of AI-2, via spontaneous conversion of ribulose-5-phosphate, may indeed occur in vivo. It does not contribute to AI-2 formation in wildtype E. coli and S. aureus under the conditions tested, but may be responsible for the AI-2-like activities reported for other organisms lacking the luxS gene.

Characteristics of D-3He fueled frc reactor: ARTEMIS-L

International Nuclear Information System (INIS)

Momota, H.; Motojima, O.; Okamoto, M.; Sudo, S.; Tomita, Y.; Yamaguchi, S.; Iiyoshi, A.; Onozuka, M.; Ohnishi, M.; Uenosono, C.

1993-11-01

The paper introduces briefly the scenario and discuss the attractive characteristics of D-3He fueled commercial fusion reactor ARTEMIS-L. By using favorable characteristics of a field-reversed configuration, the fusion plasma of ARTEMIS-L is compact and its beta-value is extremely high. One find consequently a possibility of constructing an economical fusion power power plant on this prospect. The life of the structural materials is sound during the full reactor life (30 years) and the safety of the reactor is intrinsic to D-3He fuels. The amount of disposed materials is rather small and the level of these intruder dose is so low that the plant appears to be acceptable in view of the environment. (author)

Technological differences between açai and juçara pulps and their sorbets

Directory of Open Access Journals (Sweden)

Ana Paula Silva Siqueira

2017-11-01

Full Text Available Abstract Açai and juçara are palm trees that produce similar fruits. However, only the sale of açai is growing on the market for pulps and processed products for human consumption. The aim of this study was to compare açai and juçara pulps from the chemical, bioactive, rheological and technological points of view. Sorbets were elaborated with the pulps and evaluations were carried out regarding the antioxidant activity, polyphenols, anthocyanins, pH, acidity, soluble solids, ratio and colour. The pulps were evaluated rheologically and the sorbets for melting time. Juçara showed better results regarding the bioactive parameters (antioxidants ≈ 151 uM ferrous sulphate/ g and anthocyanins ≈ 77 mg.100g-1 and presented a more intense colour (Chroma 17. The pulps were physicochemically similar. The sorbet preserved much of the nutrients and presented a very intense colour, mainly in the juçara sorbet.

Selective oxidation of methionine residues in apolipoprotein A-I and its potential biological consequences

International Nuclear Information System (INIS)

Panzenboeck, U.; Waldeck, R.; Rye, K.A.; Sloane, T.; Kritharides, L.; Stocker, R.

1998-01-01

The earliest stages of HDL oxidation are accompanied by the oxidation of specific Met residues in apolipoprotein AI and AII and the formation of Met sulfoxides (Met(O)) has been proposed to play a significant role in the reduction and hence detoxification of lipid hydroperoxides associated with HDL. Oxidation of HDL may generally decrease the anti-atherogenic properties of this lipoprotein, although both, the inhibition and the enhancement of cholesterol removal from cells has been reported for different types of oxidation. In light of these findings we have investigated the secondary structure, lipid affinity, LCAT activation and cholesterol-efflux promoting properties of native and selectively oxidized apo A-I(apo A-I +32 , containing Met(O) at Met l12 and Met l48 ) in purified or reconstituted forms. Data obtained by circular dichroism revealed that selective oxidation of Met residues 112 and 148 does not alter alpha helicity of the protein in solution, indicating that this oxidation is not sufficient to influence significantly this type of secondary structure of apo A-I in its 'lipid-free' form. The lipid affinity of native apo A-I and apo A-I +32 was determined as the rate of clearance of DMPC multilamellar to small unilamellar vesicles. Compared with the native protein, apo A-I +32 induced a 2-3 fold faster rate of clearance, suggesting that the increased hydrophilicity due Met(O) increased the rate for protein-lipid interactions. Met residues 112 and 148 reside in the hydrophobic faces of helices 5 and 7, and both these regions have been suggested to be important for both, LCAT activation and cholesterol efflux. Kinetic experiments have revealed that the affinity for LCAT is comparable for HDL reconstituted with either apo A-I or apo A-I +32 . Efflux of [ 3 H]-cholesterol from lipid-laden human monocytederived macrophages to isolated apolipoproteins was enhanced for apo A-I +32 compared with apo A-I, consistent with the DMPC clearance data. Together these

Reactor Materials Program probability of indirectly--induced failure of L and P reactor process water piping

International Nuclear Information System (INIS)

Daugherty, W.L.

1988-01-01

The design basis accident for the Savannah River Production Reactors is the abrupt double-ended guillotine break (DEGB) of a large process water pipe. This accident is not considered credible in light of the low applied stresses and the inherent ductility of the piping material. The Reactor Materials Program was initiated to provide the technical basis for an alternate credible design basis accident. One aspect of this work is to determine the probability of the DEGB; to show that in addition to being incredible, it is also highly improbable. The probability of a DEGB is broken into two parts: failure by direct means, and indirectly-induced failure. Failure of the piping by direct means can only be postulated to occur if an undetected crack grows to the point of instability, causing a large pipe break. While this accident is not as severe as a DEGB, it provides a conservative upper bound on the probability of a direct DEGB of the piping. The second part of this evaluation calculates the probability of piping failure by indirect causes. Indirect failure of the piping can be triggered by an earthquake which causes other reactor components or the reactor building to fall on the piping or pull it from its supports. Since indirectly-induced failure of the piping will not always produce consequences as severe as a DEGB, this gives a conservative estimate of the probability of an indirectly- induced DEGB. This second part, indirectly-induced pipe failure, is the subject of this report. Failure by seismic loads in the piping itself will be covered in a separate report on failure by direct causes. This report provides a detailed evaluation of L reactor. A walkdown of P reactor and an analysis of the P reactor building provide the basis for extending the L reactor results to P reactor

L'ENSEIGNEMENT ET L'APPRENTISSAGE DU FRANÇAIS ...

African Journals Online (AJOL)

Prof

étude sur l'impacte des TIC dans l'enseignement et l'apprentissage du ... de démarchesprécisées par des outils afin d'arriver à un but précis qui est dans notre ..... Pour que les TIC soient des instruments efficaces dans le bon déroulement de.

Engineering the l-Arabinose Isomerase from Enterococcus Faecium for d-Tagatose Synthesis.

Science.gov (United States)

de Sousa, Marylane; Manzo, Ricardo M; García, José L; Mammarella, Enrique J; Gonçalves, Luciana R B; Pessela, Benevides C

2017-12-06

l-Arabinose isomerase (EC 5.3.1.4) (l-AI) from Enterococcus faecium DBFIQ E36 was overproduced in Escherichia coli by designing a codon-optimized synthetic araA gene. Using this optimized gene, two N- and C-terminal His-tagged-l-AI proteins were produced. The cloning of the two chimeric genes into regulated expression vectors resulted in the production of high amounts of recombinant N -His-l-AI and C -His-l-AI in soluble and active forms. Both His-tagged enzymes were purified in a single step through metal-affinity chromatography and showed different kinetic and structural characteristics. Analytical ultracentrifugation revealed that C -His-l-AI was preferentially hexameric in solution, whereas N -His-l-AI was mainly monomeric. The specific activity of the N -His-l-AI at acidic pH was higher than that of C -His-l-AI and showed a maximum bioconversion yield of 26% at 50 °C for d-tagatose biosynthesis, with Km and Vmax parameters of 252 mM and 0.092 U mg -1 , respectively. However, C -His-l-AI was more active and stable at alkaline pH than N -His-l-AI. N -His-l-AI follows a Michaelis-Menten kinetic, whereas C -His-l-AI fitted to a sigmoidal saturation curve.

L-Reactor 186-basin cleaning alternatives

International Nuclear Information System (INIS)

Turcotte, M.D.S.

1983-01-01

Operation of L Reactor will necessitate annual cleaning of the L Area 186 basins. Alternatives are presented for sediment discharge due to 186-basin cleaning activities as a basis for choosing the optimal cleaning method. Current cleaning activities (i.e. removal of accumulated sediments) for the P, C and K-Area 186 basins result in suspended solids concentrations in the effluent waters above the NPDES limits, requiring an exemption from the NPDES permit for these short-term releases. The objective of mitigating the 186-basin cleaning activities is to decrease the suspended solids concentrations to within permit limits while continuing satisfactory operation of the basins

Artificial Intelligence Study (AIS).

Science.gov (United States)

1987-02-01

ARTIFICIAL INTELLIGNECE HARDWARE ....... 2-50 AI Architecture ................................... 2-49 AI Hardware ....................................... 2...ftf1 829 ARTIFICIAL INTELLIGENCE STUDY (RIS)(U) MAY CONCEPTS 1/3 A~NLYSIS AGENCY BETHESA RD R B NOJESKI FED 6? CM-RP-97-1 NCASIFIED /01/6 M |K 1.0...p/ - - ., e -- CAA- RP- 87-1 SAOFŔ)11 I ARTIFICIAL INTELLIGENCE STUDY (AIS) tNo DTICFEBRUARY 1987 LECT 00 I PREPARED BY RESEARCH AND ANALYSIS

AIS ASM Operational Integration Plan

Science.gov (United States)

2013-08-01

Rack mount computer AIS Radio Interface Ethernet Switch 192.168.0.x Firewall Cable Modem 192.168.0.1 VTS Accred. Boundary AIS ASM Operational... AIS ASM Operational Integration Plan Distribution Statement A: Approved for public release; distribution is unlimited. August 2013 Report No...CD-D-07-15 AIS ASM Operational Integration Plan ii UNCLAS//Public | CG-926 R&DC | I. Gonin, et al. | Public August 2013 N O T I C

Use of AI-1024 and AI-4096 analyzers in multiple regimes

International Nuclear Information System (INIS)

Zaika, N.D.; Kovtunenko, I.S.; Savchuk, O.G.

1975-01-01

The operation of pulse multichannel analyzers in the following multidimensional modes: AI-1024-4 - amplitude mode from several transducers; amplitude mode from several transducers at different time intervals; AI-4096-3M - amplitude mode at different time intervals in each of four groups with unit BVI-1

Engineering the l-Arabinose Isomerase from Enterococcus Faecium for d-Tagatose Synthesis

Directory of Open Access Journals (Sweden)

Marylane de Sousa

2017-12-01

Full Text Available l-Arabinose isomerase (EC 5.3.1.4 (l-AI from Enterococcus faecium DBFIQ E36 was overproduced in Escherichia coli by designing a codon-optimized synthetic araA gene. Using this optimized gene, two N- and C-terminal His-tagged-l-AI proteins were produced. The cloning of the two chimeric genes into regulated expression vectors resulted in the production of high amounts of recombinant N-His-l-AI and C-His-l-AI in soluble and active forms. Both His-tagged enzymes were purified in a single step through metal-affinity chromatography and showed different kinetic and structural characteristics. Analytical ultracentrifugation revealed that C-His-l-AI was preferentially hexameric in solution, whereas N-His-l-AI was mainly monomeric. The specific activity of the N-His-l-AI at acidic pH was higher than that of C-His-l-AI and showed a maximum bioconversion yield of 26% at 50 °C for d-tagatose biosynthesis, with Km and Vmax parameters of 252 mM and 0.092 U mg−1, respectively. However, C-His-l-AI was more active and stable at alkaline pH than N-His-l-AI. N-His-l-AI follows a Michaelis-Menten kinetic, whereas C-His-l-AI fitted to a sigmoidal saturation curve.

MassAI

DEFF Research Database (Denmark)

2011-01-01

A software tool for general analysis and data-mining of mass-spectrometric datasets. The program features a strong emphasis on scan-by-scan identification and results-transparency. MassAI also accommodates residue level analysis of labelled runs, e.g. HDX.......A software tool for general analysis and data-mining of mass-spectrometric datasets. The program features a strong emphasis on scan-by-scan identification and results-transparency. MassAI also accommodates residue level analysis of labelled runs, e.g. HDX....

Operational readiness reviews for restart of L reactor

International Nuclear Information System (INIS)

Finley, R.H.

1984-01-01

The L Reactor at the Savannah River Plant is being restarted after being in a standby status since 1968. Operational Readiness Reviews (ORRs) were conducted by DOE-SR and contractor personnel concurrent with the restart activity. This paper summarizes the ORR activity

Characteristics of D-{sup 3}He fueled frc reactor: ARTEMIS-L

Energy Technology Data Exchange (ETDEWEB)

Momota, H.; Motojima, O.; Okamoto, M.; Sudo, S.; Tomita, Y.; Yamaguchi, S.; Iiyoshi, A.; Onozuka, M.; Ohnishi, M.; Uenosono, C.

1993-11-01

The paper introduces briefly the scenario and discuss the attractive characteristics of D-3He fueled commercial fusion reactor ARTEMIS-L. By using favorable characteristics of a field-reversed configuration, the fusion plasma of ARTEMIS-L is compact and its beta-value is extremely high. One find consequently a possibility of constructing an economical fusion power power plant on this prospect. The life of the structural materials is sound during the full reactor life (30 years) and the safety of the reactor is intrinsic to D-3He fuels. The amount of disposed materials is rather small and the level of these intruder dose is so low that the plant appears to be acceptable in view of the environment. (author).

Artificial intelligence in nuclear reactor operation

International Nuclear Information System (INIS)

Da Ruan; Benitez-Read, J.S.

2005-01-01

Assessment of four real fuzzy control applications at the MIT research reactor in the US, the FUGEN heavy water reactor in Japan, the BR1 research reactor in Belgium, and a TRIGA Mark III reactor in Mexico will be examined through a SWOT analysis (strengths, weakness, opportunities, and threats). Special attention will be paid to the current cooperation between the Belgian Nuclear Research Centre (SCK·CEN) and the Mexican Nuclear Centre (ININ) on AI-based intelligent control for nuclear reactor operation under the partial support of the National Council for Science and Technology of Mexico (CONACYT). (authors)

Ai

African Journals Online (AJOL)

:=g=~!Ai~~~~~g~~ ~~~~~~. Jim Taylor, Rob O'Donoghue and Alistair Clacherty. INTRODUCTION. The Department of Environment Affairs, in cooperation with ...

Dicty_cDB: FC-AI01 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available FC (Link to library) FC-AI01 (Link to dictyBase) - - - Contig-U15592-1 FC-AI01E (Li...nk to Original site) - - - - - - FC-AI01E 307 Show FC-AI01 Library FC (Link to library) Clone ID FC-AI01 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AI/FC-AI01Q.Seq.d/ Representative seq. ID FC-AI...01E (Link to Original site) Representative DNA sequence >FC-AI01 (FC-AI01Q) /CSM/FC/FC-AI/FC-AI01Q.Seq....uences producing significant alignments: (bits) Value FC-AI01 (FC-AI01Q) /CSM/FC/FC-AI/FC-AI01Q.Seq.d/ 68 8e

Dicty_cDB: FC-AI13 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available FC (Link to library) FC-AI13 (Link to dictyBase) - - - Contig-U16263-1 FC-AI13F (Li...nk to Original site) FC-AI13F 507 - - - - - - Show FC-AI13 Library FC (Link to library) Clone ID FC-AI13 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AI/FC-AI13Q.Seq.d/ Representative seq. ID FC-AI...13F (Link to Original site) Representative DNA sequence >FC-AI13 (FC-AI13Q) /CSM/FC/FC-AI/FC-AI13Q.Seq....nificant alignments: (bits) Value FC-AI13 (FC-AI13Q) /CSM/FC/FC-AI/FC-AI13Q.Seq.d/ 963 0.0 VSA730 (VSA730Q)

Dicty_cDB: FC-AI17 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available FC (Link to library) FC-AI17 (Link to dictyBase) - - - Contig-U15690-1 FC-AI17P (Li...nk to Original site) FC-AI17F 587 FC-AI17Z 626 FC-AI17P 1212 - - Show FC-AI17 Library FC (Link to library) Clone ID FC-AI...nal site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AI/FC-AI17Q.Seq.d/ Representative seq. ID FC-AI...17P (Link to Original site) Representative DNA sequence >FC-AI17 (FC-AI17Q) /CSM/FC/FC-AI/FC-AI...slated Amino Acid sequence ANIATVGDFLKADTVVPKMIITYNKRKQGTDYLKAVIGPILSNVIKQELNLELKPNLVYA AIISEQEIRTGEKSTLDRNV

Dicty_cDB: FC-AI18 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available FC (Link to library) FC-AI18 (Link to dictyBase) - - - Contig-U15590-1 FC-AI18P (Li...nk to Original site) FC-AI18F 621 FC-AI18Z 703 FC-AI18P 1324 - - Show FC-AI18 Library FC (Link to library) Clone ID FC-AI...nal site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AI/FC-AI18Q.Seq.d/ Representative seq. ID FC-AI...18P (Link to Original site) Representative DNA sequence >FC-AI18 (FC-AI18Q) /CSM/FC/FC-AI/FC-AI...AVWPLIPGYERA DGEKQYPVAAMLCNFTKPTPTTPSLLTHDEVVTFFHEFGHVMHNMSTKVHYSMFSGTSVE RDFVECPSQLFEFWCWNKDVLVNKLSGHXKDHSKKLPTDLVERMIAAKNLNVAI

Dicty_cDB: FC-AI04 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available FC (Link to library) FC-AI04 (Link to dictyBase) - - - Contig-U15121-1 FC-AI04E (Li...nk to Original site) - - - - - - FC-AI04E 772 Show FC-AI04 Library FC (Link to library) Clone ID FC-AI04 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AI/FC-AI04Q.Seq.d/ Representative seq. ID FC-AI...04E (Link to Original site) Representative DNA sequence >FC-AI04 (FC-AI04Q) /CSM/FC/FC-AI/FC-AI04Q.Seq....qvnkhqqvvtktvsd vlvphqvhnqvfphipqqmtlvnkhqpvvtktvsdvlvphqvhnqvfphtpqlkiqvylq vfqvvvvtiisai

Dicty_cDB: FC-AI10 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available FC (Link to library) FC-AI10 (Link to dictyBase) - - - Contig-U16270-1 FC-AI10F (Li...nk to Original site) FC-AI10F 405 - - - - - - Show FC-AI10 Library FC (Link to library) Clone ID FC-AI10 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AI/FC-AI10Q.Seq.d/ Representative seq. ID FC-AI...10F (Link to Original site) Representative DNA sequence >FC-AI10 (FC-AI10Q) /CSM/FC/FC-AI/FC-AI10Q.Seq.... sequence RKKRKSDYTSFSTYIHKLLKQITPPTNAKSNEKGDRKFTISSKAMSVMNSFVHDIFDRIA TEASGLAKKKKRQTLHSRDIQVAVRIILTGELAXHAI

Dicty_cDB: FC-AI23 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available FC (Link to library) FC-AI23 (Link to dictyBase) - - - Contig-U15308-1 FC-AI23Z (Li...nk to Original site) - - FC-AI23Z 603 - - - - Show FC-AI23 Library FC (Link to library) Clone ID FC-AI23 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AI/FC-AI23Q.Seq.d/ Representative seq. ID FC-AI...23Z (Link to Original site) Representative DNA sequence >FC-AI23 (FC-AI23Q) /CSM/FC/FC-AI/FC-AI23Q.Seq....LNTLAKKNEQVVEGEILAKQLTGVTAEELSEFKACFSHFDKDN DNKLNRLEFSSCLKSIGDELTEEQLNQVISKIDTDGNGTISFEEFIDYMVSSRKGTDSVE STKAAFKVMAEDKDFITEAQIRAAI

Dicty_cDB: FC-AI21 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available FC (Link to library) FC-AI21 (Link to dictyBase) - - - Contig-U16254-1 FC-AI21Z (Li...nk to Original site) - - FC-AI21Z 696 - - - - Show FC-AI21 Library FC (Link to library) Clone ID FC-AI21 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AI/FC-AI21Q.Seq.d/ Representative seq. ID FC-AI...21Z (Link to Original site) Representative DNA sequence >FC-AI21 (FC-AI21Q) /CSM/FC/FC-AI/FC-AI21Q.Seq....YPGYMYTDLSTIYERAGRIQGRNGSITQI PILTMPNDDITHPIPDLTGYITEGQIFIDRQINNRQIYPPINVLPSLSRLMKSAI

Vers une approche fonctionnelle de l'enseignment de la terminologie: Action recherche en classe de Français

Directory of Open Access Journals (Sweden)

Mojca Jarc

2015-11-01

Full Text Available L'article se propose d'étudier les différents paramètres de l'enseignement de la terminologie dans le cadre du cours de Français langue étrangère à la Faculté des Sciences Sociales de Ljubljana (FSS afin de jeter des ponts entre l’évolution de théorie dans le domaine de la terminologie descriptive et la pratique de l’enseignement dans un contexte du cours de français sur objectifs spécifiques (FOS. Les résultats d’une action recherche menée au sein d’un groupe d’étudiants en sciences sociales montrent que les solutions théoriques pour la constitution de glossaires thématiques ne sont pas automatiquement transposables dans la pratique pédagogique et que des solutions adaptées, axées sur une approche fonctionnelle s’imposent dans une classe de langue étrangère. ----- The purpose of the paper is to study different parameters in terminology teaching within the framework of a French language course offered at the Faculty of Social Sciences (FSS in Ljubljana, in order to better integrate the theoretical developments in the field of descriptive terminology with the teaching practice of French for specific purposes (FSP. The results of an action research carried out in a group of students of social sciences suggest that the theoretical solutions applied for glossary compilation, and the use of terminological record sheets to describe terms cannot be viewed as automatically transferable into the classroom practice, and that consequently, each classroom situation has direct implications for the use of terminological record sheets in terminology teaching, which calls for adapted solutions, based on the functional approach to teaching foreign language for specific purposes.

Anaerobic treatment of winery wastewater in fixed bed reactors.

Science.gov (United States)

Ganesh, Rangaraj; Rajinikanth, Rajagopal; Thanikal, Joseph V; Ramanujam, Ramamoorty Alwar; Torrijos, Michel

2010-06-01

The treatment of winery wastewater in three upflow anaerobic fixed-bed reactors (S9, S30 and S40) with low density floating supports of varying size and specific surface area was investigated. A maximum OLR of 42 g/l day with 80 +/- 0.5% removal efficiency was attained in S9, which had supports with the highest specific surface area. It was found that the efficiency of the reactors increased with decrease in size and increase in specific surface area of the support media. Total biomass accumulation in the reactors was also found to vary as a function of specific surface area and size of the support medium. The Stover-Kincannon kinetic model predicted satisfactorily the performance of the reactors. The maximum removal rate constant (U(max)) was 161.3, 99.0 and 77.5 g/l day and the saturation value constant (K(B)) was 162.0, 99.5 and 78.0 g/l day for S9, S30 and S40, respectively. Due to their higher biomass retention potential, the supports used in this study offer great promise as media in anaerobic fixed bed reactors. Anaerobic fixed-bed reactors with these supports can be applied as high-rate systems for the treatment of large volumes of wastewaters typically containing readily biodegradable organics, such as the winery wastewater.

Les Pronoms Personnels de Troisième Personne en Français et en Italien

Directory of Open Access Journals (Sweden)

Samuel Bidaud

2015-01-01

Full Text Available Nous étudions dans cet article les pronoms personnels de troisième personne du français et de l'italien dans une perspective psychomécanique. Nous commencerons par voir que les pronoms personnels de troisième personne peuvent être sémiologiquement identiques à des déterminants et qu'ils viennent après ces derniers dans l'idéogénèse, puis nous situerons les pronoms personnels de troisième personne par rapport aux pronoms personnels de première et de deuxième personne, et nous verrons que les pronoms personnels de troisième personne peuvent appartenir au plan nominal ou au plan verbal. Nous étudierons ensuite de façon détaillée les pronoms personnels de troisième personne du français et de l'italien, et nous nous intéresserons plus particulièrement aux pronoms français y et italien ci dans une dernière partie.

Dicty_cDB: FC-AI12 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available FC (Link to library) FC-AI12 (Link to dictyBase) - - - Contig-U15484-1 FC-AI12Z (Li...nk to Original site) - - FC-AI12Z 614 - - - - Show FC-AI12 Library FC (Link to library) Clone ID FC-AI12 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AI/FC-AI12Q.Seq.d/ Representative seq. ID FC-AI...12Z (Link to Original site) Representative DNA sequence >FC-AI12 (FC-AI12Q) /CSM/FC/FC-AI/FC-AI12Q.Seq....EKIVRRI ELLDGITCYRNEKAKDEIVLTGNSLELLSQSCATIQLRSAIKYKDVRKFLDGIYVSERNV LESN*in*riys

Dicty_cDB: FC-AI19 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available FC (Link to library) FC-AI19 (Link to dictyBase) - - - Contig-U15115-1 FC-AI19Z (Li...nk to Original site) - - FC-AI19Z 661 - - - - Show FC-AI19 Library FC (Link to library) Clone ID FC-AI19 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AI/FC-AI19Q.Seq.d/ Representative seq. ID FC-AI...19Z (Link to Original site) Representative DNA sequence >FC-AI19 (FC-AI19Q) /CSM/FC/FC-AI/FC-AI19Q.Seq....lmrqswvkkiesi*lvl krrkkkknnkkkkkkkkkkklfn*lvnkkn*ik*kkllcnqkk Frame B: ---*ekaieilsklfsin*kfn**ysiiigkkstkyq

Dicty_cDB: FC-AI14 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available FC (Link to library) FC-AI14 (Link to dictyBase) - - - Contig-U16280-1 FC-AI14Z (Li...nk to Original site) - - FC-AI14Z 671 - - - - Show FC-AI14 Library FC (Link to library) Clone ID FC-AI14 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AI/FC-AI14Q.Seq.d/ Representative seq. ID FC-AI...14Z (Link to Original site) Representative DNA sequence >FC-AI14 (FC-AI14Q) /CSM/FC/FC-AI/FC-AI14Q.Seq....nqrllv*lvvlskklqllnsnqsfkfkkvq rmkknsvkntkn*rfvllt*nlkslkrmpksknsptkliifilkly Frame B: ---lkdl*krtphl*stcfhhptlcssrrfclwslnai

Dicty_cDB: FC-AI09 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available FC (Link to library) FC-AI09 (Link to dictyBase) - - - Contig-U16149-1 FC-AI09Z (Li...nk to Original site) - - FC-AI09Z 591 - - - - Show FC-AI09 Library FC (Link to library) Clone ID FC-AI09 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AI/FC-AI09Q.Seq.d/ Representative seq. ID FC-AI...09Z (Link to Original site) Representative DNA sequence >FC-AI09 (FC-AI09Q) /CSM/FC/FC-AI/FC-AI09Q.Seq....*tkl ik*ilifykiknnkkkkkk Frame B: ---gt*kvpeflailfkrmasrsvlwy*rcltkakkglkapqtltik

AI 3D Cybug Gaming

OpenAIRE

Ahmed, Zeeshan

2010-01-01

In this short paper I briefly discuss 3D war Game based on artificial intelligence concepts called AI WAR. Going in to the details, I present the importance of CAICL language and how this language is used in AI WAR. Moreover I also present a designed and implemented 3D War Cybug for AI WAR using CAICL and discus the implemented strategy to defeat its enemies during the game life.

RAPID-L: an operator-free reactor for the Moon

International Nuclear Information System (INIS)

Kambe, M.; Tsunoda, Kh.; Misima, K.; Ivamura, T.

2005-01-01

An outlook of using the RAPID-L nuclear energy facility with a fast reactor under conditions of self-contained operation on the Moon is considered in the context of approval of the new space development program in the USA [ru

Dicty_cDB: FC-AI15 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available FC (Link to library) FC-AI15 (Link to dictyBase) - G01730 DDB0214993 Contig-U15123-1 FC-AI...15E (Link to Original site) - - - - - - FC-AI15E 856 Show FC-AI15 Library FC (Link to library) Clone ID FC-AI...3-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AI/FC-AI15Q.Se...q.d/ Representative seq. ID FC-AI15E (Link to Original site) Representative DNA sequence >FC-AI15 (FC-AI15Q) /CSM/FC/FC-AI/FC-AI...AAAAAAAATA sequence update 1996.12.24 Translated Amino Acid sequence kt*riyi*KMMIKYITIAILFIASLVKADLQFSLCPTCV

Dicty_cDB: FC-AI24 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available FC (Link to library) FC-AI24 (Link to dictyBase) - - - - FC-AI24Z (Link to Original site) - - FC-AI...24Z 693 - - - - Show FC-AI24 Library FC (Link to library) Clone ID FC-AI24 (Link to dictyBas...e) Atlas ID - NBRP ID - dictyBase ID - Link to Contig - Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AI/FC-AI...24Q.Seq.d/ Representative seq. ID FC-AI24Z (Link to Original s...ite) Representative DNA sequence >FC-AI24 (FC-AI24Q) /CSM/FC/FC-AI/FC-AI24Q.Seq.d/ XXXXXXXXXXAAATTAGAAAACAAA

Dicty_cDB: FC-AI08 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available FC (Link to library) FC-AI08 (Link to dictyBase) - G01729 DDB0233148 Contig-U14939-1 FC-AI...08P (Link to Original site) FC-AI08F 654 FC-AI08Z 563 FC-AI08P 1217 - - Show FC-AI08 Library FC (Link... to library) Clone ID FC-AI08 (Link to dictyBase) Atlas ID - NBRP ID G01729 dictyBase ID DDB0233148 Link to ...Contig Contig-U14939-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AI/FC-AI...08Q.Seq.d/ Representative seq. ID FC-AI08P (Link to Original site) Representative DNA sequence >FC-AI08 (FC-AI

Grammaire progressive du français niveau intermédiaire

CERN Document Server

Grégoire, Maïa

2017-01-01

Quatrième édition de l'ouvrage de Grammaire de français langue étrangère (FLE), niveau intermédiaire, dans la collection Progressive du français destiné aux grands adolescents et adultes. Ce qui fait le succès de cet ouvrage de Grammaire: une organisation claire : la leçon de grammaire sur la page de gauche; les exercices d'entraînement sur la page de droite 52 chapitres présentant les points généralement abordés aux niveaux A2 et B1 du Cadre européen commun de référence pour les langues un apprentissage progressif : il suit la progression naturelle des méthodes de français un usage souple : pour la classe ou en auto-apprentissage une préparation adaptée aux certifications : un entreînement efficace pour mieux réussir aux examens NOUVEAU! Appli-web de la Grammaire progressive du français incluse Pour s'entraîner et s'évaluer en ligne en sollicitant toutes les compétences écrites et orales : près de 300 exercices interactifs avec dialogues, instructions, exemples et corrigés ora...

Future role of AI/Robotics in physical security

International Nuclear Information System (INIS)

Jacobs, J.

1986-01-01

Manpower requirements for physical security systems place a heavy burden on operating security budgets. Technology innovations which free personnel or which make security personnel more efficient in carrying out their tasks is an important means of dealing with budget and manpower constraints. It is believed that AI/Robotics will be important technologies to alleviate these problems in the future. There are three types of applications for AI and Robotics technology that may: (l) help security personnel perform their tasks more effectively or efficiently, (2) perform tasks that security personnel would otherwise perform (free up people), and (3) perform tasks that cannot be performed by security personnel at this time. This paper discusses the various types of security applications that are presently being considered for the above areas and briefly describes a few examples of the application of this technology

Catalytic Reactor for Inerting of Aircraft Fuel Tanks

Science.gov (United States)

1974-06-01

Aluminum Panels After Triphase Corrosion Test 79 35 Inerting System Flows in Various Flight Modes 82 36 High Flow Reactor Parametric Data 84 37 System...AD/A-000 939 CATALYTIC REACTOR FOR INERTING OF AIRCRAFT FUEL TANKS George H. McDonald, et al AiResearch Manufacturing Company Prepared for: Air Force...190th Street 2b. GROUP Torrance, California .. REPORT TITLE CATALYTIC REACTOR FOR INERTING OF AIRCRAFT FUEL TANKS . OESCRIP TIVE NOTEs (Thpe of refpoft

The BSM-AI project: SUSY-AI-generalizing LHC limits on supersymmetry with machine learning

Energy Technology Data Exchange (ETDEWEB)

Caron, Sascha [Radboud Universiteit, Institute for Mathematics, Astro- and Particle Physics IMAPP, Nijmegen (Netherlands); Nikhef, Amsterdam (Netherlands); Kim, Jong Soo [UAM/CSIC, Instituto de Fisica Teorica, Madrid (Spain); Rolbiecki, Krzysztof [UAM/CSIC, Instituto de Fisica Teorica, Madrid (Spain); University of Warsaw, Faculty of Physics, Warsaw (Poland); Ruiz de Austri, Roberto [IFIC-UV/CSIC, Instituto de Fisica Corpuscular, Valencia (Spain); Stienen, Bob [Radboud Universiteit, Institute for Mathematics, Astro- and Particle Physics IMAPP, Nijmegen (Netherlands)

2017-04-15

A key research question at the Large Hadron Collider is the test of models of new physics. Testing if a particular parameter set of such a model is excluded by LHC data is a challenge: it requires time consuming generation of scattering events, simulation of the detector response, event reconstruction, cross section calculations and analysis code to test against several hundred signal regions defined by the ATLAS and CMS experiments. In the BSM-AI project we approach this challenge with a new idea. A machine learning tool is devised to predict within a fraction of a millisecond if a model is excluded or not directly from the model parameters. A first example is SUSY-AI, trained on the phenomenological supersymmetric standard model (pMSSM). About 300, 000 pMSSM model sets - each tested against 200 signal regions by ATLAS - have been used to train and validate SUSY-AI. The code is currently able to reproduce the ATLAS exclusion regions in 19 dimensions with an accuracy of at least 93%. It has been validated further within the constrained MSSM and the minimal natural supersymmetric model, again showing high accuracy. SUSY-AI and its future BSM derivatives will help to solve the problem of recasting LHC results for any model of new physics. SUSY-AI can be downloaded from http://susyai.hepforge.org/. An on-line interface to the program for quick testing purposes can be found at http://www.susy-ai.org/. (orig.)

The BSM-AI project: SUSY-AI-generalizing LHC limits on supersymmetry with machine learning

International Nuclear Information System (INIS)

Caron, Sascha; Kim, Jong Soo; Rolbiecki, Krzysztof; Ruiz de Austri, Roberto; Stienen, Bob

2017-01-01

A key research question at the Large Hadron Collider is the test of models of new physics. Testing if a particular parameter set of such a model is excluded by LHC data is a challenge: it requires time consuming generation of scattering events, simulation of the detector response, event reconstruction, cross section calculations and analysis code to test against several hundred signal regions defined by the ATLAS and CMS experiments. In the BSM-AI project we approach this challenge with a new idea. A machine learning tool is devised to predict within a fraction of a millisecond if a model is excluded or not directly from the model parameters. A first example is SUSY-AI, trained on the phenomenological supersymmetric standard model (pMSSM). About 300, 000 pMSSM model sets - each tested against 200 signal regions by ATLAS - have been used to train and validate SUSY-AI. The code is currently able to reproduce the ATLAS exclusion regions in 19 dimensions with an accuracy of at least 93%. It has been validated further within the constrained MSSM and the minimal natural supersymmetric model, again showing high accuracy. SUSY-AI and its future BSM derivatives will help to solve the problem of recasting LHC results for any model of new physics. SUSY-AI can be downloaded from http://susyai.hepforge.org/. An on-line interface to the program for quick testing purposes can be found at http://www.susy-ai.org/. (orig.)

Dicty_cDB: FC-AI07 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available FC (Link to library) FC-AI07 (Link to dictyBase) - - - Contig-U15296-1 | Contig-U15756-1 FC-AI...07P (Link to Original site) FC-AI07F 580 FC-AI07Z 723 FC-AI07P 1303 - - Show FC-AI07 Library FC (...Link to library) Clone ID FC-AI07 (Link to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Con...tig-U15296-1 | Contig-U15756-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AI/FC-AI...07Q.Seq.d/ Representative seq. ID FC-AI07P (Link to Original site) Representative DNA sequence >FC-AI07 (FC-AI

Dicty_cDB: FC-AI22 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available FC (Link to library) FC-AI22 (Link to dictyBase) - - - Contig-U15369-1 | Contig-U15732-1 FC-AI...22P (Link to Original site) FC-AI22F 583 FC-AI22Z 683 FC-AI22P 1266 - - Show FC-AI22 Library FC (...Link to library) Clone ID FC-AI22 (Link to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Con...tig-U15369-1 | Contig-U15732-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AI/FC-AI...22Q.Seq.d/ Representative seq. ID FC-AI22P (Link to Original site) Representative DNA sequence >FC-AI22 (FC-AI

Lexique Pove–Français/Français– Pove, Mickala Manfoumbi ...

African Journals Online (AJOL)

rbr

Français/Français–. Pove (Mickala Manfoumbi 2004) fait par Mavoungou (2005). En dehors des réserves sur les ques- tions purement lexicographiques, l'ouvrage de Mickala Manfoumbi suscite des interrogations inté- ressantes qui dépassent le ...

L-Arabinose isomerase and its use for biotechnological production of rare sugars.

Science.gov (United States)

Xu, Zheng; Li, Sha; Feng, Xiaohai; Liang, Jinfeng; Xu, Hong

2014-11-01

L-Arabinose isomerase (AI), a key enzyme in the microbial pentose phosphate pathway, has been regarded as an important biological catalyst in rare sugar production. This enzyme could isomerize L-arabinose into L-ribulose, as well as D-galactose into D-tagatose. Both the two monosaccharides show excellent commercial values in food and pharmaceutical industries. With the identification of novel AI family members, some of them have exhibited remarkable potential in industrial applications. The biological production processes for D-tagatose and L-ribose (or L-ribulose) using AI have been developed and improved in recent years. Meanwhile, protein engineering techniques involving rational design has effectively enhanced the catalytic properties of various AIs. Moreover, the crystal structure of AI has been disclosed, which sheds light on the understanding of AI structure and catalytic mechanism at molecular levels. This article reports recent developments in (i) novel AI screening, (ii) AI-mediated rare sugar production processes, (iii) molecular modification of AI, and (iv) structural biology study of AI. Based on previous reports, an analysis of the future development has also been initiated.

Health Information in French (français)

Science.gov (United States)

... Biopsy - français (French) Bilingual PDF Health Information Translations Breast Biopsy - français (French) Bilingual PDF Health Information Translations Colposcopy - français (French) Bilingual PDF ...

Vers l'integration des textes dans le programme du fran9ais langue ...

African Journals Online (AJOL)

Au Malawi, on enseigne le fran9ais en tant que langue etrangere depuis une quarantaine d'annees .... !'organisation institutionnelle du systeme educatif du Malawi, le palier secondaire en ... Les objectifs du type : rediger une lettre, decrire une .... nouveau (rheme). Charolles souligne qu'il s'agit d'une performance delicate.

Two new Oxalis species (Oxalidaceae) from the Ai-Ais / Richtersveld Transfrontier Park, South Africa

NARCIS (Netherlands)

Roets, F.; Oberlander, K.C.; Dreyer, L.L.

2012-01-01

South Africa has a rich, but scantily surveyed, desert flora. Documenting annual and geophytic species in this biome is challenging, as they usually only flower after adequate precipitation, which is characteristically erratic and infrequent. Recent floristic surveys in the Ai-Ais / Richtersveld

Removal of natural organic matter and arsenic from water by electrocoagulation/flotation continuous flow reactor

International Nuclear Information System (INIS)

Mohora, Emilijan; Rončević, Srdjan; Dalmacija, Božo; Agbaba, Jasmina; Watson, Malcolm; Karlović, Elvira; Dalmacija, Milena

2012-01-01

Highlights: ► A continuous electrocoagulation/flotation reactor was designed built and operated. ► Highest NOM removal according to UV 254 was 77% relative to raw groundwater. ► Highest NOM removal accordance to DOC was 71%, relative to raw groundwater. ► Highest As removal archived was 85% (6.2 μg/l), relative to raw groundwater. ► Specific reactor energy and electrode consumption was 1.7 kWh/m 3 and 66 g Al/m 3 . - Abstract: The performance of the laboratory scale electrocoagulation/flotation (ECF) reactor in removing high concentrations of natural organic matter (NOM) and arsenic from groundwater was analyzed in this study. An ECF reactor with bipolar plate aluminum electrodes was operated in the horizontal continuous flow mode. Electrochemical and flow variables were optimized to examine ECF reactor contaminants removal efficiency. The optimum conditions for the process were identified as groundwater initial pH 5, flow rate = 4.3 l/h, inter electrode distance = 2.8 cm, current density = 5.78 mA/cm 2 , A/V ratio = 0.248 cm −1 . The NOM removal according to UV 254 absorbance and dissolved organic matter (DOC) reached highest values of 77% and 71% respectively, relative to the raw groundwater. Arsenic removal was 85% (6.2 μg As/l) relative to raw groundwater, satisfying the drinking water standards. The specific reactor electrical energy consumption was 17.5 kWh/kg Al. The specific aluminum electrode consumption was 66 g Al/m 3 . According to the obtained results, ECF in horizontal continuous flow mode is an energy efficient process to remove NOM and arsenic from groundwater.

An SDR based AIS receiver for satellites

DEFF Research Database (Denmark)

Larsen, Jesper Abildgaard; Mortensen, Hans Peter; Nielsen, Jens Frederik Dalsgaard

2011-01-01

For a few years now, there has been a high interest in monitoring the global ship traffic from space. A few satellite, capable of listening for ship borne AIS transponders have already been launched, and soon the AAUSAT3, carrying two different types of AIS receivers will also be launched. One...... of the AIS receivers onboard AAUSAT3 is an SDR based AIS receiver. This paper serves to describe the background of the AIS system, and how the SDR based receiver has been integrated into the AAUSAT3 satellite. Amongst some of the benefits of using an SDR based receiver is, that due to its versatility, new...... detection algorithms are easily deployed, and it is easily adapted the new proposed AIS transmission channels....

How Is Pulmonary Function and Exercise Tolerance Affected in Patients With AIS Who Have Undergone Spinal Fusion?

Science.gov (United States)

Jeans, Kelly A; Lovejoy, John F; Karol, Lori A; McClung, Anna M

2017-11-01

Prospectively enrolled AIS patients who underwent spinal fusion, with 2 year follow-up. To evaluate the cardiovascular fitness and activity level in patients with AIS pre- and post-spinal fusion and to determine if initial curve magnitude or pulmonary function is predictive of exercise capacity. Researchers have tried to link pulmonary function testing (PFT) to exercise capacity; the results are mixed. Some report no improvement in PFTs or aerobic activity after surgical correction, and PFT measures were not predictive of exercise capacity. Conflicting results have shown Vo 2max results to fall within normal range in AIS patients while PFTs show minimal impairment. AIS patients underwent PFT and oxygen consumption (VO 2 ) testing during a submaximal graded exercise test (GXT) pre- and post-spinal fusion. Vo 2max was predicted in those patients who completed the test to 85% of maximal heart rate. Pre- to postoperative changes were assessed and then compared to age-matched control subjects. Correlations between Vo 2max and curve severity, pulmonary function, and activity level were assessed. Thirty-seven patients participated. Vo 2max was predicted in 23 patients pre- and postoperation. There was a significant reduction in Vo 2max postfusion (39.5 ± 6.5 mL/kg/min vs 42.1 ± 8.1 mL/kg/min, p = .033); however, compared with controls (40.5 ± 6.5 mL/kg/min), all data were within the normal range (p > .05). AIS patients reporting high activity had significantly greater Vo 2max than those reporting low activity both pre and postoperatively, but this difference only met statistical significance preop (p .05). Vo 2max in patients with AIS is within normal range both pre- and postfusion. Pulmonary limitations are accommodated for with a slightly increased breathing rate and a slightly reduced overall workload. Activity level rather than curve severity affects Vo 2max outcomes following fusion in AIS. Copyright © 2017 Scoliosis Research Society. Published by Elsevier Inc

78 FR 50313 - Physical Protection of Irradiated Reactor Fuel in Transit

Science.gov (United States)

2013-08-19

... Irradiated Reactor Fuel in Transit AGENCY: Nuclear Regulatory Commission. ACTION: Orders; rescission. SUMMARY... the NRC published a final rule, ``Physical Protection of Irradiated Fuel in Transit,'' on May 20, 2013... of Irradiated Reactor Fuel in Transit'' (RIN 3150-AI64; NRC-2009-0163). The final rule incorporates...

Applications of artificial intelligence to reactor and plant control

International Nuclear Information System (INIS)

Bernard, J.A.

1989-01-01

Potential improvements in plant efficiency and reliability are often cited as reasons for developing and applying artificial intelligence (AI) techniques, principally expert systems, to the control and operation of nuclear reactors. Nevertheless, there have been few such applications and then mostly at the prototype level. Therefore, if AI techniques are to contribute to process control, methods must be identified by which rule-based and analytic approaches can be merged. This hypothesis is the basic premise of this article. Presented below are 1. a brief review of the human approach towards process control, 2. a discussion of the suitability of AI methodologies for the performance of control tasks, 3. examples of AI applications to both open- and closed-loop control, 4. an enumeration of unresolved issues associated with the use of AI for control, and 5. a discussion of the possible role of expert system techniques in process control. (orig./GL)

Le français de la communication professionnelle

CERN Document Server

Danilo, Michel; Lincoln, M

A partir de 150 heures de français. - Pour acquérir une bonne maîtrise des pratiques professionnelles. - Pour améliorer ses connaissances de la langue tout en se familiarisant avec les pratiques langagières spécifiques du monde du travail. - Pour préparer les examens de la Chambre de Commerce et d'Industrie de Paris. Dix dossiers : - La communication dans les affaires - Le travail administratif - Le téléphone - La communication interne - Le courrier de l'entreprise - L'offre et la commande - Livraison, transport, assurance - La facturation et le règlement - La communication avec les partenaires - Les nouveaux outils de communication Une cassette audio ainsi que des corrigés accompagnent ce livre.

AI its nature and future

CERN Document Server

Boden, Margaret A

2016-01-01

least - on the Internet. Margaret Boden considers the realistic and unrealistic expectations we have placed on AI, analyses its progress, and considers the value of its byproducts. ations we have placed on AI, analyses its progress, and considers the value of its byproducts.

Grammaire progressive du français avec 400 exercices : niveau avancé

CERN Document Server

Boularès, Michèle

1997-01-01

La Grammaire progressive du français, de niveau avancé, s'adresse à de grands adolescents et adultes ayant suivi environ 250 heures de cours.Par une méthode progressive, des exemples nombreux et pertinents pour renforcer les règles de grammaire, une langue authentique, cet ouvrage a pour objectif de rendre vivant et stimulant l'apprentissage de la grammaire.Elle présente et explique des points complexes (subjonctif, gérondif, adjectif verbal, participe présent...) et relie résolument la forme et le sens afin de ne pas dissocier grammaire et communication. La Grammaire progressive du français est une grammaire pédagogique: les explications grammaticales sont simples, le plus souvent de l'ordre de la phrase, elles utilisent un minimum de métalangage; des exemples clairs et nombreux illustrent chque explication grammaticale; la langue utilisée dans les exemples et les exercices est authentique. Quand l'exemple illustrant un point grammatical exige un niveau de langage soutenue, celui-ci est signalé...

Modeling Progress in AI

OpenAIRE

Brundage, Miles

2015-01-01

Participants in recent discussions of AI-related issues ranging from intelligence explosion to technological unemployment have made diverse claims about the nature, pace, and drivers of progress in AI. However, these theories are rarely specified in enough detail to enable systematic evaluation of their assumptions or to extrapolate progress quantitatively, as is often done with some success in other technological domains. After reviewing relevant literatures and justifying the need for more ...

The implementation of AI technologies in computer wargames

Science.gov (United States)

Tiller, John A.

2004-08-01

Computer wargames involve the most in-depth analysis of general game theory. The enumerated turns of a game like chess are dwarfed by the exponentially larger possibilities of even a simple computer wargame. Implementing challenging AI is computer wargames is an important goal in both the commercial and military environments. In the commercial marketplace, customers demand a challenging AI opponent when they play a computer wargame and are frustrated by a lack of competence on the part of the AI. In the military environment, challenging AI opponents are important for several reasons. A challenging AI opponent will force the military professional to avoid routine or set-piece approaches to situations and cause them to think much deeper about military situations before taking action. A good AI opponent would also include national characteristics of the opponent being simulated, thus providing the military professional with even more of a challenge in planning and approach. Implementing current AI technologies in computer wargames is a technological challenge. The goal is to join the needs of AI in computer wargames with the solutions of current AI technologies. This talk will address several of those issues, possible solutions, and currently unsolved problems.

Tweeting AI: Perceptions of Lay vs Expert Twitterati

OpenAIRE

Manikonda, Lydia; Kambhampati, Subbarao

2017-01-01

With the recent advancements in Artificial Intelligence (AI), various organizations and individuals are debating about the progress of AI as a blessing or a curse for the future of the society. This paper conducts an investigation on how the public perceives the progress of AI by utilizing the data shared on Twitter. Specifically, this paper performs a comparative analysis on the understanding of users belonging to two categories -- general AI-Tweeters (AIT) and expert AI-Tweeters (EAIT) who ...

A single and two step isomerization process for d-tagatose and l-ribose bioproduction using l-arabinose isomerase and d-lyxose isomerase.

Science.gov (United States)

Patel, Manisha J; Akhani, Rekha C; Patel, Arti T; Dedania, Samir R; Patel, Darshan H

2017-02-01

l-ribose and d-tagatose are biochemically synthesized using sugar isomerases. The l-arabinose isomerase gene from Shigella flexneri (Sf-AI) was cloned and expressed in Escherichia coli BL-21. Sf-AI was applied for the bioproduction of d-tagatose from d-galactose. l-ribose synthesis was performed by two step isomerization using Sf-AI and d-lyxose/ribose isomerase from Cohnella laevoribosii. The overall 22.3% and 25% conversion rate were observed for d-tagatose and l-ribose production from d-galactose and l-arabinose respectively. In the present manuscript, synthesis of rare sugars from naturally available sugars is discussed along with the biochemical characterization of Sf-AI and its efficiency. Copyright © 2016 Elsevier Inc. All rights reserved.

Removal of natural organic matter and arsenic from water by electrocoagulation/flotation continuous flow reactor

Energy Technology Data Exchange (ETDEWEB)

Mohora, Emilijan, E-mail: emohora@ifc.org [University of Novi Sad Faculty of Sciences, Department of Chemistry, Biochemistry and Environmental Protection, Trg D. Obradovica 3, 21000 Novi Sad (Serbia); Roncevic, Srdjan; Dalmacija, Bozo; Agbaba, Jasmina; Watson, Malcolm; Karlovic, Elvira; Dalmacija, Milena [University of Novi Sad Faculty of Sciences, Department of Chemistry, Biochemistry and Environmental Protection, Trg D. Obradovica 3, 21000 Novi Sad (Serbia)

2012-10-15

Highlights: Black-Right-Pointing-Pointer A continuous electrocoagulation/flotation reactor was designed built and operated. Black-Right-Pointing-Pointer Highest NOM removal according to UV{sub 254} was 77% relative to raw groundwater. Black-Right-Pointing-Pointer Highest NOM removal accordance to DOC was 71%, relative to raw groundwater. Black-Right-Pointing-Pointer Highest As removal archived was 85% (6.2 {mu}g/l), relative to raw groundwater. Black-Right-Pointing-Pointer Specific reactor energy and electrode consumption was 1.7 kWh/m{sup 3} and 66 g Al/m{sup 3}. - Abstract: The performance of the laboratory scale electrocoagulation/flotation (ECF) reactor in removing high concentrations of natural organic matter (NOM) and arsenic from groundwater was analyzed in this study. An ECF reactor with bipolar plate aluminum electrodes was operated in the horizontal continuous flow mode. Electrochemical and flow variables were optimized to examine ECF reactor contaminants removal efficiency. The optimum conditions for the process were identified as groundwater initial pH 5, flow rate = 4.3 l/h, inter electrode distance = 2.8 cm, current density = 5.78 mA/cm{sup 2}, A/V ratio = 0.248 cm{sup -1}. The NOM removal according to UV{sub 254} absorbance and dissolved organic matter (DOC) reached highest values of 77% and 71% respectively, relative to the raw groundwater. Arsenic removal was 85% (6.2 {mu}g As/l) relative to raw groundwater, satisfying the drinking water standards. The specific reactor electrical energy consumption was 17.5 kWh/kg Al. The specific aluminum electrode consumption was 66 g Al/m{sup 3}. According to the obtained results, ECF in horizontal continuous flow mode is an energy efficient process to remove NOM and arsenic from groundwater.

Areal Informations Systemet - AIS

DEFF Research Database (Denmark)

Nielsen, K.; Stjernholm, M.; Olsen, B. Ø.

Forord: Denne rapport giver en kort beskrivelse af Areal Informations Systemet (AIS), som er et databasesystem med natur- og miljødata, som kan stedfæstes geografisk. Projektet er gennemført i perioden 1996-2000 som et samarbejdsprojekt mellem Danmarks Miljøundersøgelser (DMU), Danmarks og...... og enkeltpersoner med interesse for natur- og miljøforhold i Danmark. Yderligere oplysninger om Areal Informations Systemet, herunder adgangsforhold, kan fås på DMU's hjemmeside med følgende adresse: http://ais.dmu.dk/ Projektet er finansieret af Miljø- og Energiministeriet, mens en række...... (planlægning, beskyttelse), geologi (overfladegeologi og marin geologi), samt marin dybdemodel. # Etablering af dataadgang for Miljø- og Energiministeriets institutioner til AIS-data. # Afprøvning af systemet i forhold til konkrete projekter. # Formidling af produkterne til brugerkredsen....

RCC-MRx: Design and construction rules for mechanical components in high-temperature structures, experimental reactors and fusion reactors

International Nuclear Information System (INIS)

2015-01-01

The RCC-MRx code was developed for sodium-cooled fast reactors (SFR), research reactors (RR) and fusion reactors (FR-ITER). It provides the rules for designing and building mechanical components involved in areas subject to significant creep and/or significant irradiation. In particular, it incorporates an extensive range of materials (aluminum and zirconium alloys in response to the need for transparency to neutrons), sizing rules for thin shells and box structures, and new modern welding processes: electron beam, laser beam, diffusion and brazing. The RCC-MR code was used to design and build the prototype Fast Breeder Reactor (PFBR) developed by IGCAR in India and the ITER Vacuum Vessel. The RCC-Mx code is being used in the current construction of the RJH experimental reactor (Jules Horowitz reactor). The RCC-MRx code is serving as a reference for the design of the ASTRID project (Advanced Sodium Technological Reactor for Industrial Demonstration), for the design of the primary circuit in MYRRHA (Multi-purpose hybrid Research Reactor for High-tech Applications) and the design of the target station of the ESS project (European Spallation Source). Contents of the 2015 edition of the RCC-MRx code: Section I General provisions; Section II Additional requirements and special provisions; Section III Rules for nuclear installation mechanical components: Volume I: Design and construction rules: Volume A (RA): General provisions and entrance keys, Volume B (RB): Class 1 components and supports, Volume C (RC): Class 2 components and supports, Volume D (RD): Class 3 components and supports, Volume K (RK): Examination, handling or drive mechanisms, Volume L (RL): Irradiation devices, Volume Z (Ai): Technical appendices; Volume II: Materials; Volume III: Examinations methods; Volume IV: Welding; Volume V: Manufacturing operations; Volume VI: Probationary phase rules

Oral immunization with recombinant Lactobacillus casei expressing OmpAI confers protection against Aeromonas veronii challenge in common carp, Cyprinus carpio.

Science.gov (United States)

Zhang, Dong-Xing; Kang, Yuan-Huan; Chen, Long; Siddiqui, Shahrood Ahmed; Wang, Chun-Feng; Qian, Ai-Dong; Shan, Xiao-Feng

2018-01-01

Aeromonas veronii is a gram-negative pathogen capable of infecting both fish and mammals, including humans, and natural infection in fish results in irreparable damage to the aquaculture industry. Lactic acid bacteria (LAB) have a number of properties that make them attractive candidates as delivery vehicles for presentation to the mucosa sites of compounds with pharmaceutical interest, in particular vaccines. In this study, we generated two recombinant Lactobacillus casei (surface-displayed or secretory) expressing the OmpAI of A.veronii and evaluated the effect on immune responses in fish model. A 1022 bp gene fragment of the 42 kDa OmpAI antigen of A.veronii was cloned into pPG-1 (surface-displayed) and pPG-2 (secretory) and electrotransformed into Lactobacillus casei CC16. The recombinant plasmid in L.casei could be stably inherited over 50 generations, and production of OmpAI protein had slight limited effects on cells growth. Treatment of common carp with the recombinant vaccine candidate stimulated high serum or skin mucus specific antibody titers and induced a higher lysozyme, ACP, SOD activity, while fish fed with Lc-pPG or PBS had no detectable immobilizing immune responses. Expression of IL-10, IL-β, IFN-γ, TNF-α genes in the group immunized with recombinant L.casei were significantly (P casei strains were directly delivered and survive throughout the intestinal tract, the recombinant OmpAI was also detected in intestine mucosal. The results showed that common carp received Lc-pPG1-OmpAI (66.7%) and Lc-pPG2-OmpAI (50.0%) had higher survival rates compared with the controls after challenge with A.veronii, indicating that Lc-pPG1-OmpAI and Lc-pPG2-OmpAI had beneficial effects on immune response and enhanced disease resistance of common carp against A.veronii infection. Our study here demonstrates, for the first time, the ability of recombinant L.casei as oral vaccine against A.veronii infection in carps. The combination of OmpAI delivery and LAB

Adaptive Motion Gaming AI for Health Promotion

OpenAIRE

Paliyawan, Pujana; Kusano, Takahiro; Nakagawa, Yuto; Harada, Tomohiro; Thawonmas, Ruck

2017-01-01

This paper presents a design of a non-player character (AI) for promoting balancedness in use of body segments when engaging in full-body motion gaming. In our experiment, we settle a battle between the proposed AI and a player by using FightingICE, a fighting game platform for AI development. A middleware called UKI is used to allow the player to control the game by using body motion instead of the keyboard and mouse. During gameplay, the proposed AI analyze health states of the player; it d...

Why Don't Accounting Students like AIS?

Science.gov (United States)

Vatanasakdakul, Savanid; Aoun, Chadi

2011-01-01

Purpose: The demand for Accounting Information Systems (AIS) knowledge has increased exponentially over the past two decades, but studying AIS has not proved easy for many accounting students. The aim of the study is to understand the challenges accounting students face in studying AIS through investigation of the factors which may be contributing…

AI and Mathematical Education

Directory of Open Access Journals (Sweden)

Angel Garrido

2012-01-01

Full Text Available From ancient times, the history of human beings has developed by a succession of steps and sometimes jumps, until reaching the relative sophistication of the modern brain and culture. Researchers are attempting to create systems that mimic human thinking, understand speech, or beat the best human chess player. Understanding the mechanisms of intelligence, and creating intelligent artifacts are the twin goals of Artificial Intelligence (AI. Great mathematical minds have played a key role in AI in recent years; to name only a few: Janos Neumann (also known as John von Neumann, Konrad Zuse, Norbert Wiener, Claude E. Shannon, Alan M. Turing, Grigore Moisil, Lofti A. Zadeh, Ronald R. Yager, Michio Sugeno, Solomon Marcus, or Lászlo A. Barabási. Introducing the study of AI is not merely useful because of its capability for solving difficult problems, but also because of its mathematical nature. It prepares us to understand the current world, enabling us to act on the challenges of the future.

"All-In-One Test" (AI1)

DEFF Research Database (Denmark)

Giacalone, Davide; Bredie, Wender Laurentius Petrus; Frøst, Michael Bom

2013-01-01

by the Check-All-That-Apply (CATA) technique is reported. In this exploratory "All-In-One Test"(AI1), subjects (N = 160) filled out a questionnaire with demographic and psychographic variables, and appropriateness ratings for specific sensory descriptors of beer. Subsequently, subjects gave hedonic ratings...... between appropriateness and actual hedonic response. Overall, the AI1 test provided interpretable results concerning consumer perception (sensory/hedonic) of the beers, and revealed relations with consumers' background information. Initial results with AI1 test show that it is an efficient and versatile...

Ecrivains français de Page classique proposés pour l'enseignement du F.LE. en Espagne aux 18e et 19e siècles

OpenAIRE

Fischer Hubert, Denise

2015-01-01

L'étude de la littérature dans les manuels de FLE est assez tardive. L'accent est surtout mis, aux 17e et 18° siècles, sur les règles de grammaire, de prononciation et aussi sur le «français fonctionnel» (dialogues utiles aux marchands et voyageurs qui se déplacent en France et ont besoin d'une phraséologie courante). A la fin du 18e et au 19e siècle, on commence à penser que la lecture des grands classiques est un point important dans l'étude de la langue. Le grammairien se réfère sans cesse...

A fission-fusion hybrid reactor in steady-state L-mode tokamak configuration with natural uranium

International Nuclear Information System (INIS)

Reed, Mark; Parker, Ronald R.; Forget, Benoit

2012-01-01

This work develops a conceptual design for a fusion-fission hybrid reactor operating in steady-state L-mode tokamak configuration with a subcritical natural or depleted uranium pebble bed blanket. A liquid lithium-lead alloy breeds enough tritium to replenish that consumed by the D-T fusion reaction. The fission blanket augments the fusion power such that the fusion core itself need not have a high power gain, thus allowing for fully non-inductive (steady-state) low confinement mode (L-mode) operation at relatively small physical dimensions. A neutron transport Monte Carlo code models the natural uranium fission blanket. Maximizing the fission power gain while breeding sufficient tritium allows for the selection of an optimal set of blanket parameters, which yields a maximum prudent fission power gain of approximately 7. A 0-D tokamak model suffices to analyze approximate tokamak operating conditions. This fission blanket would allow the fusion component of a hybrid reactor with the same dimensions as ITER to operate in steady-state L-mode very comfortably with a fusion power gain of 6.7 and a thermal fusion power of 2.1 GW. Taking this further can determine the approximate minimum scale for a steady-state L-mode tokamak hybrid reactor, which is a major radius of 5.2 m and an aspect ratio of 2.8. This minimum scale device operates barely within the steady-state L-mode realm with a thermal fusion power of 1.7 GW. Basic thermal hydraulic analysis demonstrates that pressurized helium could cool the pebble bed fission blanket with a flow rate below 10 m/s. The Brayton cycle thermal efficiency is 41%. This reactor, dubbed the Steady-state L-mode non-Enriched Uranium Tokamak Hybrid (SLEUTH), with its very fast neutron spectrum, could be superior to pure fission reactors in terms of breeding fissile fuel and transmuting deleterious fission products. It would likely function best as a prolific plutonium breeder, and the plutonium it produces could actually be more

Applying AI techniques to improve alarm display effectiveness

International Nuclear Information System (INIS)

Gross, J.M.; Birrer, S.A.; Crosberg, D.R.

1987-01-01

The Alarm Filtering System (AFS) addresses the problem of information overload in a control room during abnormal operations. Since operators can miss vital information during these periods, systems which emphasize important messages are beneficial. AFS uses the artificial intelligence (AI) technique of object-oriented programming to filter and dynamically prioritize alarm messages. When an alarm's status changes, AFS determines the relative importance of that change according to the current process state. AFS bases that relative importance on relationships the newly changed alarm has with other activated alarms. Evaluations of a alarm importance take place without regard to the activation sequence of alarm signals. The United States Department of Energy has applied for a patent on the approach used in this software. The approach was originally developed by EG and G Idaho for a nuclear reactor control room

AI in space: Past, present, and possible futures

Science.gov (United States)

Rose, Donald D.; Post, Jonathan V.

1992-01-01

While artificial intelligence (AI) has become increasingly present in recent space applications, new missions being planned will require even more incorporation of AI techniques. In this paper, we survey some of the progress made to date in implementing such programs, some current directions and issues, and speculate about the future of AI in space scenarios. We also provide examples of how thinkers from the realm of science fiction have envisioned AI's role in various aspects of space exploration.

The Potential of AI Techniques for Remote Sensing

Science.gov (United States)

Estes, J. E.; Sailer, C. T. (Principal Investigator); Tinney, L. R.

1984-01-01

The current status of artificial intelligence AI technology is discussed along with imagery data management, database interrogation, and decision making. Techniques adapted from the field of artificial intelligence (AI) have significant, wide ranging impacts upon computer-assisted remote sensing analysis. AI based techniques offer a powerful and fundamentally different approach to many remote sensing tasks. In addition to computer assisted analysis, AI techniques can also aid onboard spacecraft data processing and analysis and database access and query.

Radioimmunoassay of apolipoprotein A-I of rat serum

International Nuclear Information System (INIS)

Fainaru, M.; Havel, R.J.; Felker, T.E.

1976-01-01

A double antibody radioimmunoassay technique was developed for quantification of apolipoprotein A-I, the major apoprotein of rat high density lipoprotein. Apo A-I was labelled with 125 I by the chloramine-T method. 125 I-labeled apo A-I had the same electrophoretic mobility as unlabeled apo A-I and more than 80% of the 125 I was precipitated by rabbit anti apo A-I antibodies. The assay is sensitive at the level of 0.5-5 ng, and has intraassay and interassay coefficients of variation of 4.5 and 6.5% respectively. The specificity of the assay was established by competitive displacement of 125 I-labeled apo A-I from its antibody by apo A-I and lipoproteins containing apo A-I, but not by rat albumin and other apoproteins. Immunoreactivity of high density lipoprotein and serum was only about 35% of that of their delipidated forms when Veronal buffer was used as a diluent. Inclusion of 5 mM sodium decyl sulfate in the incubation mixture brought out reactivity equivalent to that found after delipidation. Completeness of the reaction was verified by comparison with the amount of apo A-I in chromatographic fractions of the total apoprotein of high density lipoprotein. Content (weight %, mean values +- S.D.) of immunoassayable apo A-I was: 62.3 +- 5.9 in high density lipoprotein; 1.7 +- 0.3 in low density lipoprotein; 0.09 +- 0.03 in very low density lipoprotein and 25.0 +- 5.0 in lymph chylomicrons. Concentration in whole serum was 51.4 +- 8.9 mg/dl and 33.6 +- 4.1 mg/dl for female and male rats, respectively (p 1.21 g/ml and <1% in lipoproteins of d<1.063 g/ml

Artificial intelligence program in a computer application supporting reactor operations

International Nuclear Information System (INIS)

Stratton, R.C.; Town, G.G.

1985-01-01

Improving nuclear reactor power plant operability is an ever-present concern for the nuclear industry. The definition of plant operability involves a complex interaction of the ideas of reliability, safety, and efficiency. This paper presents observations concerning the issues involved and the benefits derived from the implementation of a computer application which combines traditional computer applications with artificial intelligence (AI) methodologies. A system, the Component Configuration Control System (CCCS), is being installed to support nuclear reactor operations at the Experimental Breeder Reactor II

Beyond AI: Interdisciplinary Aspects of Artificial Intelligence

CERN Document Server

Romportl, Jan; Zackova, Eva; Beyond Artificial Intelligence : Contemplations, Expectations, Applications

2013-01-01

Products of modern artificial intelligence (AI) have mostly been formed by the views, opinions and goals of the “insiders”, i.e. people usually with engineering background who are driven by the force that can be metaphorically described as the pursuit of the craft of Hephaestus. However, since the present-day technology allows for tighter and tighter mergence of the “natural” everyday human life with machines of immense complexity, the responsible reaction of the scientific community should be based on cautious reflection of what really lies beyond AI, i.e. on the frontiers where the tumultuous ever-growing and ever-changing cloud of AI touches the rest of the world.   The chapters of this boo are based on the selected subset of the presentations that were delivered by their respective authors at the conference “Beyond AI: Interdisciplinary Aspects of Artificial Intelligence” held in Pilsen in December 2011.   From its very definition, the reflection of the phenomena that lie beyond AI must be i...

USACE AIS Transmit Technical Support Summary Report

Science.gov (United States)

2014-09-01

the TAG block for the correct transmitters, and then send to the USACE AIS network. B. Outbound openings in the USCG firewall for the USCG Message...USACE AIS Transmit Technical Support Summary Report Distribution Statement A: Approved for public release; distribution is unlimited...September 2014 Report No. CD-D-09-15 USACE AIS Transmit Technical Support Summary Report ii UNCLAS//Public | CG-926 RDC | I. Gonin et al. Public

ALARA cost/benefit analysis at Union Electric company using the ARP/AI methodology

International Nuclear Information System (INIS)

Williams, M.C.

1987-01-01

This paper describes the development of a specific method for justification of expenditures associated with reducing occupational radiation exposure to as low as reasonably achievable (ALARA). This methodology is based on the concepts of the Apparebt Reduction Potential (ARP) and Achievability index (AI) as described in NUREG/CR-0446, Union Eletric's corporate planning model and the EPRI Model for dose rate buildup with reactor operating life. The ARP provides a screening test to determine if there is a need for ALARA expenditures based on actual or predicted exposure rates and/or dose experience. The AI is a means of assessing all costs and all benefits, even though they are expressed in different units of measurement such as person-rem and dollars, to determine if ALARA expenditures are justified and their value. This method of cost/benefit analysis can be applied by any company or organization utilizing site-specific exposure and dose rate data, and incorporating consideration of administrative exposure controls which may vary from organization to organization. Specific example cases are presented and compared to other methodologies for ALARA cost/benefit analysis

AI applications in sheet metal forming

CERN Document Server

Hussein, Hussein

2017-01-01

This book comprises chapters on research work done around the globe in the area of artificial intelligence (AI) applications in sheet metal forming. The first chapter offers an introduction to various AI techniques and sheet metal forming, while subsequent chapters describe traditional procedures/methods used in various sheet metal forming processes, and focus on the automation of those processes by means of AI techniques, such as KBS, ANN, GA, CBR, etc. Feature recognition and the manufacturability assessment of sheet metal parts, process planning, strip-layout design, selecting the type and size of die components, die modeling, and predicting die life are some of the most important aspects of sheet metal work. Traditionally, these activities are highly experience-based, tedious and time consuming. In response, researchers in several countries have applied various AI techniques to automate these activities, which are covered in this book. This book will be useful for engineers working in sheet metal industri...

Grammaire progressive du français corrigés : niveau intermédiaire

CERN Document Server

Thiévenaz, Odile

2017-01-01

Quatrième édition des corrigés de l'ouvrage de Grammaire de français langue étrangère (FLE), niveau intermédiaire, dans la collection Progressive du français destiné aux grands adolescents et adultes. Ce qui fait le succès de cet ouvrage de grammaire: Une organisation claire : la leçon de grammaire sur la page de gauche, les exercices d'entraînement sur la page de droite 52 chapitres présentant les points généralement abordés aux niveaux A2 et B1 du Cadre européen commun de référence pour les langues Un apprentissage progressif : il suit la progression naturelle des méthodes de français Un usage souple : pour la classe ou en auto-apprentissage Une préparation adaptée aux certifications : un entraînement efficace pour mieux réussir aux examens NOUVEAU!​ Appli-Web de la Grammaire progressive du français Pour s'entraîner et s'évaluer en ligne en sollicitant toutes les compétences écrites et orales: près de 300 exercices interactifs avec dialogues, instructions, exemples et corri...

The secreted L-arabinose isomerase displays anti-hyperglycemic effects in mice.

Science.gov (United States)

Rhimi, Moez; Bermudez-Humaran, Luis G; Huang, Yuan; Boudebbouze, Samira; Gaci, Nadia; Garnier, Alexandrine; Gratadoux, Jean-Jacques; Mkaouar, Héla; Langella, Philippe; Maguin, Emmanuelle

2015-12-21

The L-arabinose isomerase is an intracellular enzyme which converts L-arabinose into L-ribulose in living systems and D-galactose into D-tagatose in industrial processes and at industrial scales. D-tagatose is a natural ketohexose with potential uses in pharmaceutical and food industries. The D-galactose isomerization reaction is thermodynamically equilibrated, and leads to secondary subproducts at high pH. Therefore, an attractive L-arabinose isomerase should be thermoactive and acidotolerant with high catalytic efficiency. While many reports focused on the set out of a low cost process for the industrial production of D-tagatose, these procedures remain costly. When compared to intracellular enzymes, the production of extracellular ones constitutes an interesting strategy to increase the suitability of the biocatalysts. The L-arabinose isomerase (L-AI) from Lactobacillus sakei was expressed in Lactococcus lactis in fusion with the signal peptide of usp45 (SP(Usp45)). The L-AI protein and activity were detected only in the supernatant of the induced cultures of the recombinant L. lactis demonstrating the secretion in the medium of the intracellular L. sakei L-AI in an active form. Moreover, we showed an improvement in the enzyme secretion using either (1) L. lactis strains deficient for their two major proteases, ClpP and HtrA, or (2) an enhancer of protein secretion in L. lactis fused to the recombinant L-AI with the SP(Usp45). Th L-AI enzyme secreted by the recombinant L. lactis strains or produced intracellularly in E. coli, showed the same functional properties than the native enzyme. Furthermore, when mice are fed with the L. lactis strain secreting the L-AI and galactose, tagatose was produced in vivo and reduced the glycemia index. We report for the first time the secretion of the intracellular L-arabinose isomerase in the supernatant of food grade L. lactis cultures with hardly display other secreted proteins. The secreted L-AI originated from the food

T'ai Chi

Science.gov (United States)

... are different styles of t'ai chi, including: Chen style Hao (or Wu Shi) style Hu Lei ... medical advice, diagnoses, and treatment, consult your doctor. © 1995- The Nemours Foundation. All rights reserved. Images provided ...

Adaptive game AI with dynamic scripting

NARCIS (Netherlands)

Spronck, P.; Ponsen, M.J.V.; Sprinkhuizen-Kuyper, I.G.; Postma, E.O.

2006-01-01

Online learning in commercial computer games allows computer-controlled opponents to adapt to the way the game is being played. As such it provides a mechanism to deal with weaknesses in the game AI, and to respond to changes in human player tactics.We argue that online learning of game AI should

ILALOK. Dictionnaire vili–français/Mpisukulu bi kum' bi tshi vili ku tshi mputu.

Directory of Open Access Journals (Sweden)

P.A. Mavoungou

2011-10-01

Full Text Available On connaît le vif intérêt de l'Institut des Langues Locales au Kouilou pour la promotion des langues maternelles et des cultures dont elles sont le véhicule irremplaçable. La parution aux Éditions L'Harmattan du Dictionnaire vili–fran-çais en 2008 vient couronner des années d'efforts acharnés et de privations. Ce dictionnaire, consacré au civili, poursuit ainsi la tradition des ouvrages lexico-graphiques commencés par les missionnaires. Pour le civili notamment on peut citer les contributions des révérends pères Derouet (n.d. et Marichelle (1902 qui furent imprimés à la vieille imprimerie de Loango. Dans la préface du Dic-tionnaire vili–français (en abrégé DVF dans le reste du texte, le R.P. Marichelle précise que la parution de son dictionnaire vient compléter l'oeuvre du R.P. Derouet auteur du Dictionnaire français–vili. Hormis les travaux lexicographi-ques sur le civili, deux autres ouvrages ont également été publiés. Il s'agit de Proverbes et dictons du Loango en Afrique Centrale de René Mavoungou Pambou (1997 et de Parlons vili de Gervais Loembé (2005. La parution du Dictionnaire vili–français complète parfaitement bien cette série.

77 FR 31643 - AI-Shreveport, LLC A Subsidiary of Android Industries Including On-Site Leased Workers From...

Science.gov (United States)

2012-05-29

... Subsidiary of Android Industries Including On-Site Leased Workers From Career Adventures, Inc. Shreveport..., 2011, applicable to workers of AI-Shreveport, LLC, a subsidiary of Android Industries, Shreveport...- Shreveport, LLC, a subsidiary of Android Industries. The amended notice applicable to TA-W-80,515 is hereby...

Risk Reducing Effect of AIS Implementation on Collision Risk

DEFF Research Database (Denmark)

Lützen, Marie; Friis-Hansen, Peter

2003-01-01

AIS (Automatic Identification System) is a transponder system developed for sea traffic purposes. The system sends and receives important ship information and other safety-related information between other ships and shore-based AIS stations. The implementation of AIS has now been initiated and......, as a result, the community will undoubtedly observe an increase in navigational safety. However, to the authors? knowledge, no study has so far rigorously quantified the risk reducing effect of using AIS as an integrated part of the navigational system. The objective of this study is to fill this gap....... The risk reducing effect of AIS is quantified by building a Bayesian network facilitating an evaluation of the effect of AIS on the navigational officer?s reaction ability in a potential, critical collision situation. The time-dependent change in the risk reducing effect on ship collisions is analysed...

JGOMAS: New Approach to AI Teaching

Science.gov (United States)

Barella, A.; Valero, S.; Carrascosa, C.

2009-01-01

This paper presents a new environment for teaching practical work in AI subjects. The main purpose of this environment is to make AI techniques more appealing to students and to facilitate the use of the toolkits which are currently widely used in research and development. This new environment has a toolkit for developing and executing agents,…

Artificial Intelligence Safety and Cybersecurity: a Timeline of AI Failures

OpenAIRE

Yampolskiy, Roman V.; Spellchecker, M. S.

2016-01-01

In this work, we present and analyze reported failures of artificially intelligent systems and extrapolate our analysis to future AIs. We suggest that both the frequency and the seriousness of future AI failures will steadily increase. AI Safety can be improved based on ideas developed by cybersecurity experts. For narrow AIs safety failures are at the same, moderate, level of criticality as in cybersecurity, however for general AI, failures have a fundamentally different impact. A single fai...

Study on AI-2 signaling molecules activity and the effect of matrine on AI-2 in Staphylococcus epidermidis LuxS/AI-2 quorum sensing%产膜表皮葡萄球菌LuxS/AI-2型密度感应系统AI-2的活性及苦参碱对其的影响

Institute of Scientific and Technical Information of China (English)

李雪; 何芳; 卢金霞; 管翠萍; 周学章

2017-01-01

[Objective] This study investigated the activity of AI-2 signaling molecules in Staphylococcus epidermidis planktonic bacteria and biofilm bacteria and the effect of matrine.[Method] The growth curve of Staphylococcus epidermidis planktonic bacteria and biofilm bacteria was drawn and AI-2 concentration was measured using the V.harveyi bioluminescence assay.The transcription level of luxS gene was analyzed using real-time PCR.The AI-2 signaling molecules of Staphylococcus epidermidis ATCC35984 were treated with matrine and the changes of AI-2 signaling molecules activity were determined.[Result] In Staphylococcus epidermidis planktonic bacteria growth process,AI-2 signaling molecule activity and the relative expression quantity of luxS gene reached the maximum in the logarithmic phase before decreasing gradually.Their change curves were similar with planktonic growth curve.However,in the growth process of Staphylococcus epidermidis biofilm bacteria,the activity trend was similar with the biofilm growth.The relative expression quantity of luxS gene had an opposite trend to biofilm growth.Matrine had inhibitory effect on AI-2 signaling molecule activity in planktonic and biofilm bacteria,and the inhibitory effect was stronger to planktonic bacteria.[Conclusion] AI-2 signaling molecule activity and relative expression quantity of luxS gene highly correlated with the growth of Staphylococcus epidermidis and its biofilm formation.Matrine significantly reduced the AI-2 signaling molecule activity of Staphylococcus epidermidis.%[目的]研究产膜表皮葡萄球菌生物被膜菌和液相浮游菌LuxS/AI-2型密度感应系统中AI-2信号分子的活性及苦参碱对其的影响.[方法]绘制产膜表皮葡萄球菌ATCC35984液相浮游菌及生物被膜菌的生长曲线;利用哈维氏弧菌BB170(Vibrio harveyi BB170)作为报告菌株检测表皮葡萄球菌AI-2�

Squeeze Casting Method Of AI-Si Alloy For Piston Material

International Nuclear Information System (INIS)

Wagiyo, H.; Dani, Muhammad; Sulistioso, G.S.; Pardede, Elman; Handayani, Ari; Teguh, Yulius S.P.P.

2001-01-01

The AI-Si alloy is an alloy used as piston material. This alloys could be as AI-Si hypereutectic alloy (Si content more than 12.5 % wt.), as AI-Si eutectic alloy (Si cuntent 12.5 % wt, and as AI-Si hypoeutectic alloy (Si content less than 12.5 % wt.). The synthesize of AI-Si alloy piston generally using the technique of gravity casting in a dies. This method is causing high porousity. By using the squeeze technique, amount ofporousity in AI-Si alloy is possibly reduced and the density of this alloy should be higher. The other factors such as alloying elements of AI-Si alloy (Mg. Cu, Zn) would increase the mechanical properties especially the hardness. The focuses of this research are the microstructure and the maximum hardness during the heat treatment of AI-Si alloy which was added by alloying elments. The result of hardness at test shows the maximum hardness at 94.7 kg/mm 2 obtained at aging temperature of 210 o C for hours with homogenous dendritic microstructure

Aux membres du personnel français détachés au CERN - French version only

CERN Multimedia

2003-01-01

Affiliation au régime de retraite français Le CERN a reçu la lettre suivante de la Mission permanente de la France auprès des Organisations Internationales à Genève au sujet de la récente publication d'un décret concernant la retraite des fonctionnaires français détachés dans les organisations internationales : " .. l'article 20 de la loi 2002-73 du 17 janvier 2002 a mis fin au caractère obligatoire de l'affiliation au régime de retraite français pour les fonctionnaires détachés à l'étranger ou dans les organisations internationales. Le décret 2002-1391 du 21 novembre 2002, publié au Journal Officiel du 28 novembre 2002, a prévu que les fonctionnaires concernés disposent d'un délai de quatre mois à partir de la notification de leur arrêté de détachement pour faire part à leur administration d'origine de leur volonté de continuer à cotiser au régime national. Pour les fonctionnaires ayant déjà reçu la notification de leur arrêté de détachement à la date du 1er décembre 20...

L-Asparaginase of Leishmania donovani: Metabolic target and its role in Amphotericin B resistance

Directory of Open Access Journals (Sweden)

Jasdeep Singh

2017-12-01

Full Text Available Emergence of Amphotericin B (AmB resistant Leishmania donovani has posed major therapeutic challenge against the parasite. Consequently, combination therapy aimed at multiple molecular targets, based on proteome wise network analysis has been recommended. In this regard we had earlier identified and proposed L-asparaginase of Leishmania donovani (LdAI as a crucial metabolic target. Here we report that both LdAI overexpressing axenic amastigote and promastigote forms of L. donovani survives better when challenged with AmB as compared to wild type strain. Conversely, qRT-PCR analysis showed an upregulation of LdAI in both forms upon AmB treatment. Our data demonstrates the importance of LdAI in imparting immediate protective response to the parasite upon AmB treatment. In the absence of structural and functional information, we modeled LdAI and validated its solution structure through small angle X-ray scattering (SAXS analysis. We identified its specific inhibitors through ligand and structure-based approach and characterized their effects on enzymatic properties (Km, Vmax, Kcat of LdAI. We show that in presence of two of the inhibitors L1 and L2, the survival of L. donovani is compromised whereas overexpression of LdAI in these cells restores viability. Taken together, our results conclusively prove that LdAI is a crucial metabolic enzyme conferring early counter measure against AmB treatment by Leishmania. Keywords: Leishmania donovani, L-asparaginase, Amphotericin B resistance, Metabolic target

Towards a science of integrated AI and Robotics

OpenAIRE

Rajan, Kanna; Saffiotti, Alessandro

2017-01-01

The early promise of the impact of machine intelligence did not involve the partitioning of the nascent field of Artificial Intelligence. The founders of AI envisioned the notion of embedded intelligence as being conjoined between perception, reasoning and actuation. Yet over the years the fields of AI and Robotics drifted apart. Practitioners of AI focused on problems and algorithms abstracted from the real world. Roboticists, generally with a background in mechanical and electrical engineer...

Dictionnaire étymologique du français

CERN Document Server

Picoche, Jacqueline

1979-01-01

Cette nouvelle édition du Dictionnaire étymologique du français, largement enrichie, présente l'arbre généalogique de près de 35 000 mots. Savez-vous que concerto, décret et discernement ont la même racine que crible ?. Que chauvin, espiègle et rocambolesque viennent de noms de personnages de la littérature ?. Que le sens premier de amadouer est " frotter avec de l'amadou " pour se jaunir le teint ?. Pour chaque mot, retrouvez sa famille, son origine, son sens originel ou le sens de sa racine, les diverses formes qu'il a prises depuis sa première attestation et les règles phonétiques expliquant son évolution. Des annexes traitent plus particulièrement des mots à syllabes redoublées (coco, zigzag), de ceux formés sur des onomatopées (hennir, ouistiti) et de ceux venant de noms de personnes (dahlia, praline) ou de lieux (bougie, rugby).

LE FRANÇAIS DANS LA PRESSE ECRITE DU NORD-CAMEROUN : DIAGNOSTIC, CRITIQUES ET ORIENTATIONS

Directory of Open Access Journals (Sweden)

Moïse MBEY MAKANG

2013-11-01

Full Text Available La présente réflexion tire son origine de la crise linguistique observée au sein de la presse écrite du Nord-Cameroun. Celle-ci fait échos des irrégularités de la langue de Voltaire dans la presse écrite de cette partie du pays. De plus en plus, on y assiste à une émergence des déviances syntaxiques et une profusion des écarts langagiers à connotation dépréciative. L’indécence verbale de la société, la mauvaise prestation des élèves en classe et lors des examens officiels en sont des indicateurs pertinents. Il est important de mentionner que la cohabitation entre les langues camerounaises et le français, la sous-scolarisation et ou l’ignorance, le laxisme des rédacteurs en chef, etc. sont les mobiles profonds de cette incorrection. Pourtant, nous savons tous que les media sont une forteresse où la langue doit être préservée de toute entorse et représentent un modèle pour la société. Néanmoins, des traits caractéristiques du français de la presse écrite du Nord-Cameroun s’inscrivent en faux par rapport à cette vocation naturelle des media. Dès lors, la question que nous pouvons nous poser est celle de savoir si ces mobiles ci-dessus cités sont des éléments qui favorisent l’émergence de cette dialectalisation du français. En clair qu’est-ce qui caractérise le français des journalistes? Quelle est la structure morphosyntaxique du français des rédacteurs des journaux? S’agit-il d’un français conforme à une norme locale ou (y retrouvons-nous des énoncés exogènes ? Quel type de morphosyntaxe utilisent les rédacteurs ? Une morphosyntaxe endogène, morphosyntaxe qui leur est propre, ou plutôt une morphosyntaxe exogène, supposée unique à tous les francophones ? Peut-on parler d’alternance codique, d’argotisation, ou de créolisation ? La présente analyse a pour ambitions de s’interroger sur les mobiles profonds qui incitent des journalistes à s’écarter de la norme du français

Ada in AI or AI in Ada. On developing a rationale for integration

Science.gov (United States)

Collard, Philippe E.; Goforth, Andre

1988-01-01

The use of Ada as an Artificial Intelligence (AI) language is gaining interest in the NASA Community, i.e., by parties who have a need to deploy Knowledge Based-Systems (KBS) compatible with the use of Ada as the software standard for the Space Station. A fair number of KBS and pseudo-KBS implementations in Ada exist today. Currently, no widely used guidelines exist to compare and evaluate these with one another. The lack of guidelines illustrates a fundamental problem inherent in trying to compare and evaluate implementations of any sort in languages that are procedural or imperative in style, such as Ada, with those in languages that are functional in style, such as Lisp. Discussed are the strengths and weakness of using Ada as an AI language and a preliminary analysis provided of factors needed for the development of criteria for the integration of these two families of languages and the environments in which they are implemented. The intent for developing such criteria is to have a logical rationale that may be used to guide the development of Ada tools and methodology to support KBS requirements, and to identify those AI technology components that may most readily and effectively be deployed in Ada.

The Relevance of AI Research to CAI.

Science.gov (United States)

Kearsley, Greg P.

This article provides a tutorial introduction to Artificial Intelligence (AI) research for those involved in Computer Assisted Instruction (CAI). The general theme is that much of the current work in AI, particularly in the areas of natural language understanding systems, rule induction, programming languages, and socratic systems, has important…

Learning game AI programming with Lua

CERN Document Server

Young, David

2014-01-01

If you are a game developer or a general programmer who wishes to focus on programming systems and techniques to build your game AI without creating low-level interfaces in a game engine, then this book is for you. Knowledge of C++ will come in handy to debug the entirety of the AI sandbox and expand on the features present within the book, but it is not required.

Application of AI methods to aircraft guidance and control

Science.gov (United States)

Hueschen, Richard M.; Mcmanus, John W.

1988-01-01

A research program for integrating artificial intelligence (AI) techniques with tools and methods used for aircraft flight control system design, development, and implementation is discussed. The application of the AI methods for the development and implementation of the logic software which operates with the control mode panel (CMP) of an aircraft is presented. The CMP is the pilot control panel for the automatic flight control system of a commercial-type research aircraft of Langley Research Center's Advanced Transport Operating Systems (ATOPS) program. A mouse-driven color-display emulation of the CMP, which was developed with AI methods and used to test the AI software logic implementation, is discussed. The operation of the CMP was enhanced with the addition of a display which was quickly developed with AI methods. The display advises the pilot of conditions not satisfied when a mode does not arm or engage. The implementation of the CMP software logic has shown that the time required to develop, implement, and modify software systems can be significantly reduced with the use of the AI methods.

Reexamination of $L_{3}$ and $M_{1}$ atomic-level widths of elements 54 $\\le$ Z $\\le$ 77

CERN Document Server

Mauron, O; Baechler, S; Berset, M; Maillard, Y P; Raboud, P A; Hoszowska, J

2003-01-01

High-resolution measurements of the photoinduced L/sub 3/-M/sub 1/ and L/sub 3/-M/sub 4,5/ X-ray emission lines were performed with a reflection-type bent-crystal spectrometer for a variety of elements ranging from xenon (Z=54) to iridium (Z=77). The measurements were performed at the European Synchrotron Radiation Facility in Grenoble, France. From the observed linewidths of the L/sub 3/-M/sub 1/ x-ray transitions, the widths of the M/sub 1/ levels were determined using the L/sub 3/ level widths extracted from the measured L/sub 3/-M/sub 5/ transitions, and assuming for the M/sub 5/ levels the widths reported recently by Campbell and Papp ÝAt. Data Nucl. Data Tables 77, 1 (2001)¿. In the rare-earth region a Z-dependent broadening of the M/sub 1/ level was observed. (51 refs).

Discussion on AI Technology in Information Library Design

OpenAIRE

日比野, 省三; Shozo, HIBINO; 中京大学社会学部

1987-01-01

This paper deals with the discussion on the importance of AI (Artificial Intelligence) Technology in planning and designing a library information system in the near future. First of all, the history of Library and Information Science is reviewed and it is identified that the key technology in the future library will be AI as a mega-trend. After reviewing the concepts of AI technology, a model of a Knowledge-Base system is discussed as a case study, using micro-PROLOG.

Expanding the Possibilities of AIS Data with Heuristics

Directory of Open Access Journals (Sweden)

Bjørnar Brende Smestad

2017-06-01

Full Text Available Automatic Identification System (AIS is primarily used as a tracking system for ships, but with the launch of satellites to collect these data, new and previously untested possibilities are emerging. This paper presents the development of heuristics for establishing the specific ship type using information retrieved from AIS data alone. These heuristics expand the possibilities of AIS data, as the specific ship type is vital for several transportation research cases, such as emission analyses of ship traffic and studies on slow steaming. The presented method for developing heuristics can be used for a wider range of vessels. These heuristics may form the basis of large-scale studies on ship traffic using AIS data when it is not feasible or desirable to use commercial ship data registers.

Marqueurs cadratifs temporels et argumentatifs dans les récits d’apprenants néerlandophones de français L2

Directory of Open Access Journals (Sweden)

Aurélie Welcomme

2011-07-01

Full Text Available Cet article présente une étude quantitative sur corpus examinant la présence et la fréquence de marqueurs cadratifs temporels et de marqueurs argumentatifs dans les narrations orales (Frog Story, Mayer, 1969 d’apprenants néerlandophones de français L2. Les narrations proviennent de groupes d’apprenants néerlandophones en Flandre et à Bruxelles, de 1re et de 6e année de l’enseignement secondaire (n = 10 pour chaque groupe. La production de marqueurs cadratifs temporels et de marqueurs argumentatifs des différents groupes d’apprenants a été comparée à celle de locuteurs natifs du même âge et de même niveau scolaire. Les hypothèses de recherche formulées visent à détailler l’impact du contact curriculaire et extracurriculaire sur la production de ces marqueurs par ces apprenants. Les résultats ne vont pas de manière univoque dans le sens des hypothèses de recherche : l’impact d’un contact plus accru avec le français L2 semble influencer différemment les productions des apprenants. En outre, les résultats ne montrent pas toujours des différences statistiquement significatives entre apprenants et locuteurs natifs.This paper proposes a quantitative corpus-based study investigating the presence of temporal framing and argumentative markers in the narrative monologues of Dutch-speaking learners of French as a second language. The narrative texts were collected from Dutch-speaking monolinguals from two contexts (Flanders and Brussels and at two different stages of their learning curriculum (1st and last year of secondary education. Ten subjects from each group were asked to tell a wordless picture-book story (Frog Story, Mayer, 1969. The production of temporal framing and argumentative markers in these narratives has been compared to that of groups of native speakers of the same age and curricular level. We hypothesized that the amount of curricular and extracurricular contact would influence the production

Problems related with the power regulation of reactors by physico-chemical methods, and the behaviour of water and heavy water in nuclear reactors; Comportement de l'eau et de l'eau lourde dans les reacteurs nucleaires et problemes de la regulation de puissance par voie physico-chimique

Energy Technology Data Exchange (ETDEWEB)

Dolle, L; Conan, D; Dirian, G [Commissariat a l' Energie Atomique, Saclay (France). Centre d' Etudes Nucleaires

1964-07-01

Experience of the CEA heavy water reactors and a systematic study of the radiolytic decomposition of water in the core of swimming-pool reactors are described. Setting up of reactivity control by physico-chemical methods. Reactivity control by homogeneous poisoning of the reactor A comparison of the evolution of xenon poisoning with the residual anti reactivity of the poison in solution during its nuclear consumption establishes the programme which must govern the variation in its concentration if the exact compensation is to be produced The behaviour of the poison towards the reactor materials under the particular operational conditions must be taken into account. Radiolytic decomposition of water in the reactors in the presence of soluble poisons: A study of the effect of certain chemically inert salts, present in small concentrations in the water, on its radiolytic decomposition rate, has led to some new results which are discussed. The choice of a soluble poison is justified on the basis of the above results. Reactivity control by the use of a gaseous absorbent The use of a gas control rod circuit for compensation purposes, in place of solid control rods is described. The use of soluble poisons in the moderator to compensate the xenon effect, and of a gaseous absorbent in a circuit known as a gas control rod form original aspects of the reactivity control in the reactor EL 4. (authors) [French] L'observation du comportement de l'eau et de l'eau lourde dans les reacteurs en exploitation, contribue au fonctionnement sur de ceux-ci et oriente certaines etudes relatives aux techniques de controle de la reactivite par mise en oeuvre de poisons solubles. L'utilisation de poisons nucleaires dissous dans l'eau du reacteur entraine une pollution chimique de celle-ci. Les conditions d'emploi permettant d'eviter les effets indesirables de cette pollution sont etudiees. Les problemes analytiques - bien qu'importants - ne sont pas abordes dans le cadre de la communication

Calibrating AIS images using the surface as a reference

Science.gov (United States)

Smith, M. O.; Roberts, D. A.; Shipman, H. M.; Adams, J. B.; Willis, S. C.; Gillespie, A. R.

1987-01-01

A method of evaluating the initial assumptions and uncertainties of the physical connection between Airborne Imaging Spectrometer (AIS) image data and laboratory/field spectrometer data was tested. The Tuscon AIS-2 image connects to lab reference spectra by an alignment to the image spectral endmembers through a system gain and offset for each band. Images were calibrated to reflectance so as to transform the image into a measure that is independent of the solar radiant flux. This transformation also makes the image spectra directly comparable to data from lab and field spectrometers. A method was tested for calibrating AIS images using the surface as a reference. The surface heterogeneity is defined by lab/field spectral measurements. It was found that the Tuscon AIS-2 image is consistent with each of the initial hypotheses: (1) that the AIS-2 instrument calibration is nearly linear; (2) the spectral variance is caused by sub-pixel mixtures of spectrally distinct materials and shade, and (3) that sub-pixel mixtures can be treated as linear mixtures of pure endmembers. It was also found that the image can be characterized by relatively few endmembers using the AIS-2 spectra.

Hydrogeological and Groundwater Flow Model for C, K, L, and P Reactor Areas, Savannah River Site, Aiken, South Carolina

International Nuclear Information System (INIS)

Flach, G.P.

1999-01-01

A regional groundwater flow model encompassing approximately 100 mi 2 surrounding the C, K. L. and P reactor areas has been developed. The Reactor flow model is designed to meet the planning objectives outlined in the General Groundwater Strategy for Reactor Area Projects by providing a common framework for analyzing groundwater flow, contaminant migration and remedial alternatives within the Reactor Projects team of the Environmental Restoration Department

Adaptive game AI with dynamic scripting

OpenAIRE

Spronck, P.; Ponsen, M.J.V.; Sprinkhuizen-Kuyper, I.G.; Postma, E.O.

2006-01-01

Online learning in commercial computer games allows computer-controlled opponents to adapt to the way the game is being played. As such it provides a mechanism to deal with weaknesses in the game AI, and to respond to changes in human player tactics.We argue that online learning of game AI should meet four computational and four functional requirements. The computational requirements are speed, effectiveness, robustness and ef- ficiency. The functional requirements are clarity, variety, consi...

the Lexique kikongo–français by

African Journals Online (AJOL)

Gilles-Maurice de Schryver

français by the Jesuit missionary Charles Polis, is analysed in great detail. Section 1 expounds on the goal and ... dictionary manuscript for Kikongo: the Lexique kikongo–français by Charles Polis. s.j. (1885–†1943). .... Inkisi River, and all but one (Leverville, the present Lusanga) are close to that river, which thus strongly ...

Objectif Express 1 le monde professionnel en français A1/A2

CERN Document Server

Tauzin, Béatrice

2013-01-01

Avec un nouveau look et des contenus actualisés pour prendre en compte les évolutions du monde de l’entreprise française, la nouvelle édition d'Objectif Express 1 propose une parfaite association entre le français de tous les jours et le français de l'entreprise. 10 unités basées sur des thématiques de l'entreprise : Entrez en contact ; Organisez votre journée ; Trouvez un emploi ... Chaque unité propose : - 4 leçons d'apprentissage (1 leçon = 1 double page) basées sur des tâches concrètes et simples, ancrées dans le monde du travail francophone - 1 double page Outils linguistiques - 1 page Entrainez-vous - 1 page Testez-vous - 2 pages Repères dans chaque unité : des repères culturels et des repères professionnels Toutes les 3 unités, un scénario professionnel pour une mise en œuvre des acquis langagiers et une mobilisation des compétences professionnelles de l'apprenant. Une préparation aux diplômes DFP A2, DELF Pro A1 et A2 et au test BULATS En annexes : des tableaux d...

Fully automatic AI-based leak detection system

Energy Technology Data Exchange (ETDEWEB)

Tylman, Wojciech; Kolczynski, Jakub [Dept. of Microelectronics and Computer Science, Technical University of Lodz in Poland, ul. Wolczanska 221/223, Lodz (Poland); Anders, George J. [Kinectrics Inc., 800 Kipling Ave., Toronto, Ontario M8Z 6C4 (Canada)

2010-09-15

This paper presents a fully automatic system intended to detect leaks of dielectric fluid in underground high-pressure, fluid-filled (HPFF) cables. The system combines a number of artificial intelligence (AI) and data processing techniques to achieve high detection capabilities for various rates of leaks, including leaks as small as 15 l per hour. The system achieves this level of precision mainly thanks to a novel auto-tuning procedure, enabling learning of the Bayesian network - the decision-making component of the system - using simulated leaks of various rates. Significant new developments extending the capabilities of the original leak detection system described in and form the basis of this paper. Tests conducted on the real-life HPFF cable system in New York City are also discussed. (author)

Hydrogeological and Groundwater Flow Model for C, K, L, and P Reactor Areas, Savannah River Site, Aiken, South Carolina

Energy Technology Data Exchange (ETDEWEB)

Flach, G.P.

1999-02-24

A regional groundwater flow model encompassing approximately 100 mi{sup 2} surrounding the C, K. L. and P reactor areas has been developed. The Reactor flow model is designed to meet the planning objectives outlined in the General Groundwater Strategy for Reactor Area Projects by providing a common framework for analyzing groundwater flow, contaminant migration and remedial alternatives within the Reactor Projects team of the Environmental Restoration Department.

10 CFR 1017.28 - Processing on Automated Information Systems (AIS).

Science.gov (United States)

2010-01-01

... 10 Energy 4 2010-01-01 2010-01-01 false Processing on Automated Information Systems (AIS). 1017.28... UNCLASSIFIED CONTROLLED NUCLEAR INFORMATION Physical Protection Requirements § 1017.28 Processing on Automated Information Systems (AIS). UCNI may be processed or produced on any AIS that complies with the guidance in OMB...

Removal of natural organic matter and arsenic from water by electrocoagulation/flotation continuous flow reactor.

Science.gov (United States)

Mohora, Emilijan; Rončević, Srdjan; Dalmacija, Božo; Agbaba, Jasmina; Watson, Malcolm; Karlović, Elvira; Dalmacija, Milena

2012-10-15

The performance of the laboratory scale electrocoagulation/flotation (ECF) reactor in removing high concentrations of natural organic matter (NOM) and arsenic from groundwater was analyzed in this study. An ECF reactor with bipolar plate aluminum electrodes was operated in the horizontal continuous flow mode. Electrochemical and flow variables were optimized to examine ECF reactor contaminants removal efficiency. The optimum conditions for the process were identified as groundwater initial pH 5, flow rate=4.3 l/h, inter electrode distance=2.8 cm, current density=5.78 mA/cm(2), A/V ratio=0.248 cm(-1). The NOM removal according to UV(254) absorbance and dissolved organic matter (DOC) reached highest values of 77% and 71% respectively, relative to the raw groundwater. Arsenic removal was 85% (6.2 μg As/l) relative to raw groundwater, satisfying the drinking water standards. The specific reactor electrical energy consumption was 17.5 kWh/kg Al. The specific aluminum electrode consumption was 66 g Al/m(3). According to the obtained results, ECF in horizontal continuous flow mode is an energy efficient process to remove NOM and arsenic from groundwater. Copyright © 2012 Elsevier B.V. All rights reserved.

Data of evolutionary structure change: 1AIFB-2AI0K [Confc[Archive

Lifescience Database Archive (English)

Full Text Available ignment> 0 n> 1AIF n>B 1AI... CA 272 n> 2AI0 n>K ...n>2AI0Kn> VAHPASSTKVD EEE EEEE...1AIFB-2AI0K 1AIF 2AI0 B K EVKLQESGGGLVQPGGSMKLSCVASGFTFNNYWMSWVRQ...SCAASGFTFRNYGMSWVRQTPEKRLEWVAAIS--GNSLYTSYPDSVKGRFTISRDNAKNNLYLQMSSLRSEDTALYFCARH

Integrating the Wall Street Journal into AIS Courses

Science.gov (United States)

Kohlmeyer, James M., III

2008-01-01

While it is important for accounting information systems (AIS) students to understand computer technology, internal controls and business processes, such knowledge is of little use without reference to appropriate contexts. Integrating Wall Street Journal (WSJ) readings and discussions into AIS classes can enrich learning by stimulating…

Recent progresses on AI-2 bacterial quorum sensing inhibitors.

Science.gov (United States)

Zhu, Peng; Li, Minyong

2012-01-01

Quorum sensing (QS) is a communication procedure that predominates gene expression in response to cell density and fluctuations in the neighboring environment as a result of discerning molecules termed autoinducers (AIs). It has been embroiled that QS can govern bacterial behaviors such as the secretion of virulence factors, biofilm formation, bioluminescence production, conjugation, sporulation and swarming motility. Autoinducer 2 (AI-2), a QS signaling molecule brought up to be involved in interspecies communication, exists in both gram-negative and -positive bacteria. Therefore, novel approaches to interrupt AI-2 quorum sensing are being recognized as next generation antimicrobials. In the present review article, we summarized recent progresses on AI-2 bacterial quorum sensing inhibitors and discussed their potential as the antibacterial agents.

On the homotopy equivalence of simple AI-algebras

International Nuclear Information System (INIS)

Aristov, O Yu

1999-01-01

Let A and B be simple unital AI-algebras (an AI-algebra is an inductive limit of C*-algebras of the form BigOplus i k C([0,1],M N i ). It is proved that two arbitrary unital homomorphisms from A into B such that the corresponding maps K 0 A→K 0 B coincide are homotopic. Necessary and sufficient conditions on the Elliott invariant for A and B to be homotopy equivalent are indicated. Moreover, two algebras in the above class having the same K-theory but not homotopy equivalent are constructed. A theorem on the homotopy of approximately unitarily equivalent homomorphisms between AI-algebras is used in the proof, which is deduced in its turn from a generalization to the case of AI-algebras of a theorem of Manuilov stating that a unitary matrix almost commuting with a self-adjoint matrix h can be joined to 1 by a continuous path consisting of unitary matrices almost commuting with h

AIS reception from a CubeSat in LEO

DEFF Research Database (Denmark)

Larsen, Jesper Abildgaard; Mortensen, Hans Peter; Nielsen, Jens Frederik Dalsgaard

2013-01-01

The primary payloads on board the AAUSAT3 satellite are two different AIS receivers, one is a traditional hardware-based receiver, the other one is a software-defined radio receiver. The hardware-based receiver has been developed around an ADF-7020 transceiver, with an appropriate LNA in front...... into a low-Earth orbit with a semi-major axis of 7156 km, i.e. 800 km altitude, near circular, dusk-dawn Sun-synchronous orbit. From this orbit the AIS antenna system, which consists of a dipole antenna, has a foot print diameter of approximately 6000 km. During the first pass over the primary ground station...... at Aalborg University, basic telemetry and the first few AIS messages were downloaded. During the first 14 days of the mission, the two receivers managed to detect more than 100,000 different AIS messages from ships all around the world, and more than 35,000 of these messages have been successfully...

232 Les Défis de L'utilisation des Tic dans L'enseignement ...

African Journals Online (AJOL)

Tracie1

communication; et qu'ils n'ont pas à leur disposition l'infrastructure de base requise. ..... L'Analyse des questionnaires des professeurs de français. Tableau 3 ..... équipé et le plus fonctionnel de tous les autres établissements universitaires ...

Proceedings of conference on AI applications in physical sciences

International Nuclear Information System (INIS)

1993-01-01

A Conference cum workshop on AI applications in Physical Sciences was organised by the Indian Physics Association at Bhabha Atomic Research Centre, Bombay during January 15-17, 1992. It was held in memory of Late Shri S.N. Seshadri, who was the moving spirit behind self reliance in instrumentation development for research and industry. The two day conference which was followed by one day workshop covered the following broad spectrum of topics in Artificial Intelligence: AI Tools and Techniques, Neural Networks, Robotics and Machine Vision, Fuzzy Control and Applications, Natural Language and Speech Processing, Knowledge based Systems, and AI and Allied applications. The conference dealt with recent advances and achievements in AI. It provided a forum for the exchange of valuable information and expertise in this fast emerging field. Over 200 scientists, engineers and computer professionals from various universities, R and D institutes and industries actively participated. 45 contributed papers and 8 invited talks were presented in the symposium. The volume contains selected papers which were contributed by the participants. Some of them dealt with AI applications in nuclear science and technology. (original)

Present status of application of AI in nuclear industry

International Nuclear Information System (INIS)

Kitamura, Masaharu

1989-01-01

Artificial intelligence (AL) techniques have been introduced actively in the nuclear industry in pursuit of increased safety and efficiency. The present report outlines some AI techniques currently used in nuclear facilities. This type of techniques have increasingly been introduced to such areas as design, construction, operation, maintenance, quality control and analysis. Most of them use knowledge engineering techniques including expert systems. Positive efforts at research and application of various more advance AI techniaues have started recently. For application of AI techniques, activities in nuclear power plants can be divided into two groups. One includes 'analytical' activities such as operation, maintenance and analysis, while the other includes 'synthetic' activities such as design, construction and fuel control. The most important AI technology for the analytical activities is diagnosis. Thus the report outlines major processes to which diagnostic techniques are applicable, and knowledge description and inference methods used for diagnosis. For AI techniques for synthetic activities, some problems and possible solutions are addressed. Development efforts in and outside Japan are also outlined. (Nogami, K.)

Mapping Stress-Induced Changes in Autoinducer AI-2 Production in Chemostat-Cultivated Escherichia coli K-12

Science.gov (United States)

DeLisa, Matthew P.; Valdes, James J.; Bentley, William E.

2001-01-01

Numerous gram-negative bacteria employ a cell-to-cell signaling mechanism, termed quorum sensing, for controlling gene expression in response to population density. Recently, this phenomenon has been discovered in Escherichia coli, and while pathogenic E. coli utilize quorum sensing to regulate pathogenesis (i.e., expression of virulence genes), the role of quorum sensing in nonpathogenic E. coli is less clear, and in particular, there is no information regarding the role of quorum sensing during the overexpression of recombinant proteins. The production of autoinducer AI-2, a signaling molecule employed by E. coli for intercellular communication, was studied in E. coli W3110 chemostat cultures using a Vibrio harveyi AI-2 reporter assay (M. G. Surrette and B. L. Bassler, Proc. Natl. Acad. Sci. USA 95:7046–7050, 1998). Chemostat cultures enabled a study of AI-2 regulation through steady-state and transient responses to a variety of environmental stimuli. Results demonstrated that AI-2 levels increased with the steady-state culture growth rate. In addition, AI-2 increased following pulsed addition of glucose, Fe(III), NaCl, and dithiothreitol and decreased following aerobiosis, amino acid starvation, and isopropyl-β-d-thiogalactopyranoside-induced expression of human interleukin-2 (hIL-2). In general, the AI-2 responses to several perturbations were indicative of a shift in metabolic activity or state of the cells induced by the individual stress. Because of our interest in the expression of heterologous proteins in E. coli, the transcription of four quorum-regulated genes and 20 stress genes was mapped during the transient response to induced expression of hIL-2. Significant regulatory overlap was revealed among several stress and starvation genes and known quorum-sensing genes. PMID:11292813

Pour une introduction de la pragmatique dans l’enseignement du français en Espagne

Directory of Open Access Journals (Sweden)

Leyre Ruiz de Zarobe

2014-12-01

Full Text Available La composante pragmatique est conçue dans le Cadre européen commun de référence pour les langues (2001 comme une des composantes de la “compétence communicative” que tout étudiant de langue étrangère doit atteindre. Cette composante a été remise en valeur ces dernières années, à la suite de l´interculturalité produite par la globalisation, où le besoin de connaître les langues étrangères du point de vue social, culturel et interculturel est plus grand que jamais. Cet article prétend montrer certains domaines où la pragmatique peut être appliquée à la didactique du Français Langue Étrangère, en visant les différents types d´apprenants et de besoins d´apprentissage qui ont lieu dans nos complexes sociétés actuelles, ce qui met en valeur le besoin d´introduire la pragmatique dans l´enseignement du français.

Development of operator thinking model and its application to nuclear reactor plant operation system

International Nuclear Information System (INIS)

Miki, Tetsushi; Endou, Akira; Himeno, Yoshiaki

1992-01-01

At first, this paper presents the developing method of an operator thinking model and the outline of the developed model. In next, it describes the nuclear reactor plant operation system which has been developed based on this model. Finally, it has been confirmed that the method described in this paper is very effective in order to construct expert systems which replace the reactor operator's role with AI (artificial intelligence) systems. (author)

Creating an AI modeling application for designers and developers

Science.gov (United States)

Houlette, Ryan; Fu, Daniel; Jensen, Randy

2003-09-01

Simulation developers often realize an entity's AI by writing a program that exhibits the intended behavior. These behaviors are often the product of design documents written by designers. These individuals, while possessing a vast knowledge of the subject matter, might not have any programming knowledge whatsoever. To address this disconnect between design and subsequent development, we have created an AI application whereby a designer or developer sketches an entity's AI using a graphical "drag and drop" interface to quickly articulate behavior using a UML-like representation of state charts. Aside from the design-level benefits, the application also features a runtime engine that takes the application's data as input along with a simulation or game interface, and makes the AI operational. We discuss our experience in creating such an application for both designer and developer.

4th June: AIS and NICE/MAIL unique authentication

CERN Multimedia

AIS and NICE teams

2007-01-01

Over the past few years, the IT department has been in the process of streamlining CERN users' access to all central computing services. The long term goal is to converge on a unique computer account, which will increase computer security and simplify account maintenance. The next step of this process will occur on 4th June 2007, as of when authenticating on the AIS applications (EDH, HRT, CET, APT, ERT, CRA, Foundation, ...) and on NICE (Windows) and MAIL will be done using the same username and password. As a reminder, this account can also be used on EDMS, INDICO, CDS and SIMBA. So starting on 4th June 2007, authentication on the AIS applications must be done using your AIS username and your MAIL/NICE password. Thanks for your understanding, The AIS and NICE teams

Evaluation de l'impact des activités anthropiques sur les organismes aquatiques dulçaquicoles. Méthodes et modèles pour la mesure de l'impact des rejets chimiques

OpenAIRE

Garric, J.

2008-01-01

/ Avant toute chose, je crois nécessaire de replacer le contexte de mes activités de chercheur à la fois au sein de l'organisme où j'ai réalisé ma carrière, mais également dans le cadre du domaine où j'ai travaillé, l'écotoxicologie. Après une formation en Sciences et Techniques de l'Eau à la faculté des Science de Montpellier (USTL) dans laquelle étaient étroitement associées des formations en chimie et en biologie, j'ai obtenu en 1980 un doctorat en Ecotoxicologie et Chimie de l'Environneme...

Application of expert system to evaluating reactor water cleanup system performance

International Nuclear Information System (INIS)

Maeda, Katsuji; Nakamura, Masahiro; Nagasawa, Katsumi; Fushiki, Sumiyuki.

1991-01-01

Expert systems employing artificial intelligence (AI) have been developed for finding and elucidating causes of anomalies and malfunctions, presenting pertinent recommendation for countermeasures and for making precautionary diagnosis. On the other hand, further improvements in reliabilities for chemical control are required to promote BWR plant reliability and advancement. Especially, it is necessary to maintain the reactor water purity in high quality to minimize stress corrosion cracking (SCC) in primary cooling system, fuel performance degradation and radiation buildup. The reactor water quality is controlled by the reactor water cleanup (RWCU) system. So, it is very important to maintain the RWCU performance, in order to keep good reactor water quality. This paper describes an expert system used for evaluating RWCU system performance in BWR plants. (author)

Stress corrosion cracking of L-grade stainless steels in boiling water reactor (BWR) plants

International Nuclear Information System (INIS)

Suzuki, Shunichi; Fukuda, Toshihiko; Yamashita, Hironobu

2004-01-01

L-grade stainless steels as 316NG, SUS316L and SUS304L have been used for the BWR reactor internals and re-circulation pipes as SCC resistant materials. However, SCC of the L-grade material components were reported recently in many Japanese BWR plants. The detail investigation of the components showed the fabrication process such as welding, machining and surface finishing strongly affected SCC occurrence. In this paper, research results of SCC of L-grade stainless steels, metallurgical investigation of core shrouds and re-circulation pipings, and features of SCC morphology were introduced. Besides, the structural integrity of components with SCC, countermeasures for SCC and future R and D planning were introduced. (author)

S-aryl-L-cysteine sulphoxides and related organosulphur compounds alter oral biofilm development and AI-2-based cell-cell communication.

Science.gov (United States)

Kasper, S H; Samarian, D; Jadhav, A P; Rickard, A H; Musah, R A; Cady, N C

2014-11-01

To design and synthesize a library of structurally related, small molecules related to homologues of compounds produced by the plant Petiveria alliacea and determine their ability to interfere with AI-2 cell-cell communication and biofilm formation by oral bacteria. Many human diseases are associated with persistent bacterial biofilms. Oral biofilms (dental plaque) are problematic as they are often associated with tooth decay, periodontal disease and systemic disorders such as heart disease and diabetes. Using a microplate-based approach, a bio-inspired small molecule library was screened for anti-biofilm activity against the oral species Streptococcus mutans UA159, Streptococcus sanguis 10556 and Actinomyces oris MG1. To complement the static screen, a flow-based BioFlux microfluidic system screen was also performed under conditions representative of the human oral cavity. Several compounds were found to display biofilm inhibitory activity in all three of the oral bacteria tested. These compounds were also shown to inhibit bioluminescence by Vibrio harveyi and were thus inferred to be quorum sensing (QS) inhibitors. Due to the structural similarity of these compounds to each other, and to key molecules in AI-2 biosynthetic pathways, we propose that these molecules potentially reduce biofilm formation via antagonism of QS or QS-related pathways. This study highlights the potential for a non-antimicrobial-based strategy, focused on AI-2 cell-cell signalling, to control the development of dental plaque. Considering that many bacterial species use AI-2 cell-cell signalling, as well as the increased concern of the use of antimicrobials in healthcare products, such an anti-biofilm approach could also be used to control biofilms in environments beyond the human oral cavity. © 2014 The Society for Applied Microbiology.

Record of Decision; Continued operation of K, L, and P Reactors, Savannah River Site, Aiken, South Carolina

International Nuclear Information System (INIS)

1991-01-01

The US Department of Energy (DOE) has considered the environmental impacts, benefits and costs, and institutional and programmatic needs associated with continued operation of the Savannah River Site (SRS) reactors, and has decided that it will continue to operate K and L Reactors at SRS, and will terminate operation of P Reactor in the immediate future and maintain it in cold standby. For P Reactor, this will involve the reactor's defueling; storage of its heavy water moderator in tanks in the reactor building; shutdown of reactor equipment and systems in a protected condition to prevent deterioration; and maintenance of the reactor in a defueled, protected status by a skeleton staff, which would permit any future decision to refuel and restart. Currently committed and planned upgrade activities will be discontinued for P Reactor. DOE will proceed with the safety upgrades and management system improvements currently scheduled for K Reactor in its program to satisfy the criteria of the Safety Evaluation Report (SER), and will conduct an Operational Readiness Review (ORR). The satisfaction of the SER criteria and completion of the ORR will demonstrate that the safety and health criteria for the resumption of production have been met. Reactor restart is expected to be in the third quarter of 1991 for K Reactor

Data of evolutionary structure change: 1AIFH-2AI0K [Confc[Archive

Lifescience Database Archive (English)

Full Text Available > 0 n> 1AIF n>H ...n>1AIFHn> VAHPA-SSTKV n> 2AI0 n>K 2AI...1AIFH-2AI0K 1AIF 2AI0 H K EVKLQESGGGLVQPGGSMKLSCVASGFTFNNYWMSWVRQ...SCAASGFTFRNYGMSWVRQTPEKRLEWVAAIS--GNSLYTSYPDSVKGRFTISRDNAKNNLYLQMSSLRSEDTALYFCARH

Highlights on artificial insemination (AI technology in the pig

Directory of Open Access Journals (Sweden)

Tarek Khalifa

2014-03-01

Full Text Available Over the past decade, there has been a tremendous increase in the development of field AI services in the majority of countries concerned with pig production. The objective of this paper is to review: (a the current status of swine AI in the world, (b significance and limitation of AI with liquid and frozen semen, (c the biological traits of porcine semen in relation to in-vitro sperm storage, (d the criteria used for selection of a boar stud as a semen supplier, (e how to process boar semen for liquid and frozen storage in the commercial settings and (f how to improve fertility and prolificacy of boar semen. More than 99% of the inseminations conducted worldwide are made with liquid-stored semen. AI with frozen semen is used only for upgrading the genetic base in a particular country or herd. Determining the initial quality of semen ejaculates along with the selection of the optimum storage extender has a profound effect on the quality and fertility of AI doses. Different procedures have been used for improving the fertility of preserved spermatozoa including colloidal centrifugation of the semen, intrauterine insemination and modulation of the uterine defense mechanism after AI. Development of an efficient protocol for synchronizing the time of ovulation in sows and gilts coupled with improving uterine horn insemination technique will make a breakthrough in the commercial use of frozen boar semen.

Le détritisme carbonate profond dans le Crétacé inférieur du Sud-Est français. Ses rapports avec l'eustatisme

OpenAIRE

Ferry , Serge

1987-01-01

Mémoire HS n° 13 - Géologie Alpine : Le détritisme dans le Sud-Est de la France - Colloque Association des Géologues du Sud-est - Grenoble 11-12 décembre 1986; 10 cycles eustatiques sont définis dans le Crétacé inférieur du Sud-Est français. Sur les plates-formes carbonatées, ils correspondent aux principales séquences "klupféliennes" de comblement, pour lesquelles le moteur tectonique (à-coups de subsidence) est mis en doute. Ces cycles ne sont repérables dans les séries de bassin que si l'a...

Discovering Knowledge from AIS Database for Application in VTS

Science.gov (United States)

Tsou, Ming-Cheng

The widespread use of the Automatic Identification System (AIS) has had a significant impact on maritime technology. AIS enables the Vessel Traffic Service (VTS) not only to offer commonly known functions such as identification, tracking and monitoring of vessels, but also to provide rich real-time information that is useful for marine traffic investigation, statistical analysis and theoretical research. However, due to the rapid accumulation of AIS observation data, the VTS platform is often unable quickly and effectively to absorb and analyze it. Traditional observation and analysis methods are becoming less suitable for the modern AIS generation of VTS. In view of this, we applied the same data mining technique used for business intelligence discovery (in Customer Relation Management (CRM) business marketing) to the analysis of AIS observation data. This recasts the marine traffic problem as a business-marketing problem and integrates technologies such as Geographic Information Systems (GIS), database management systems, data warehousing and data mining to facilitate the discovery of hidden and valuable information in a huge amount of observation data. Consequently, this provides the marine traffic managers with a useful strategic planning resource.

Quality measures and assurance for AI (Artificial Intelligence) software

Science.gov (United States)

Rushby, John

1988-01-01

This report is concerned with the application of software quality and evaluation measures to AI software and, more broadly, with the question of quality assurance for AI software. Considered are not only the metrics that attempt to measure some aspect of software quality, but also the methodologies and techniques (such as systematic testing) that attempt to improve some dimension of quality, without necessarily quantifying the extent of the improvement. The report is divided into three parts Part 1 reviews existing software quality measures, i.e., those that have been developed for, and applied to, conventional software. Part 2 considers the characteristics of AI software, the applicability and potential utility of measures and techniques identified in the first part, and reviews those few methods developed specifically for AI software. Part 3 presents an assessment and recommendations for the further exploration of this important area.

4th June: AIS and NICE/MAIL unique authentication

CERN Multimedia

The AIS and NICE teams

2007-01-01

Over the past few years, the IT department has been in the process of streamlining CERN users' access to all central computing services. The long term goal is to converge on a unique computer account, which will increase computer security and simplify account maintenance. The next step of this process will occur on the 4th June 2007, as of when authenticating on the AIS applications (EDH, HRT, CET, APT, ERT, CRA, Foundation, ...) and on NICE (Windows) and MAIL will be done using the same username and password. As a reminder, this account can also be used on EDMS, INDICO, CDS and SIMBA. Thus starting on the 4th June 2007, authentication on the AIS applications must be done using your AIS username and your MAIL/NICE password. Thanks for your understanding, The AIS and NICE teams

POST-ACIDIFICATION AND EVALUATION OF ANTHOCYANINS STABILITY AND ANTIOXIDAN ACTIVITY IN AÇAI FERMENTED MILK AND YOGURTS (Euterpe oleracea Mart.

Directory of Open Access Journals (Sweden)

DANIELA CAVALCANTE DOS SANTOS CAMPOS

2017-12-01

Full Text Available ABSTRACT This study evaluated the post-acidification, stability of anthocyanins and antioxidant activity in açai yogurts and fermented milks for 28 days of cold storage. For the determination of post-acidification and stability of the functional properties of açai yogurt (IA and fermented milks (LFA, products stored at 4°C were evaluated on day 0 and every 7 days for pH, titratable acidity in lactic acid, instrumental color, anthocyanins and antioxidant activity by the DPPH free radical method. Acidification of both food matrixes was more evident between days 0 and 7 of evaluation. IA presented reduction in parameter L *, while chromaticity a * and b * of IA and LFA increased as the Açai pulp content increased; however, considering the evaluation period, it was found increase in L * and b * relating to anthocyanin degradation. Anthocyanins, as well as the antioxidant activity of IA and LFA, showed an increase in their values as the pulp content increased, but their concentrations reduced at the end of the storage period. IA and LFA can be considered excellent sources of antioxidants, being alternative to individuals not used to the consumption of fruits and vegetables.

An Immune Agent for Web-Based AI Course

Science.gov (United States)

Gong, Tao; Cai, Zixing

2006-01-01

To overcome weakness and faults of a web-based e-learning course such as Artificial Intelligence (AI), an immune agent was proposed, simulating a natural immune mechanism against a virus. The immune agent was built on the multi-dimension education agent model and immune algorithm. The web-based AI course was comprised of many files, such as HTML…

Ai Weiwei - 21. sajandi märter? / Tanel Veenre

Index Scriptorium Estoniae

Veenre, Tanel, 1977-

2011-01-01

Hiina kunstniku, inimõiguslase ja teisitimõtleja Ai Weiwei elust, õpingutest, loomingust ja tegevusest. Hiinas kunstniku tagakiusamisest, arreteerimisest, maksupettuses süüdistamisest jm. Kunstniku toetajatest. Inglise kunstileht Art Review valis Ai Weiwei 2011. a. kõige mõjuvõimsamaks kunstitegelaseks

Analyses comparatives de productions écrites d'apprenants de français et de locuteurs francophones, à l'aide d'outils d'extraction automatique du langage

Directory of Open Access Journals (Sweden)

Jean-Gabriel Ganascia

2005-11-01

Full Text Available De nouveaux logiciels d'analyse textuelle tirent parti des progrès récents effectués en apprentissage symbolique et dans le traitement automatique des langues naturelles. Conçu au LIP6 par Jean-Gabriel Ganascia, le Littératron est l'un d'entre eux ; il extrait automatiquement des motifs syntaxiques à partir de textes écrits en langage naturel. Plus exactement, le Littératron prend comme entrée un arbre d'analyse syntaxique et donne en sortie un certain nombre de motifs syntaxiques récurrents. Associé à un analyseur de textes, qui engendre l'arbre d'analyse syntaxique à partir de textes écrits en langage naturel, il révèle les singularités stylistiques de ces textes. Nous allons voir qu'utilisé en sciences du langage, dans le domaine de l'acquisition du français écrit, le Littératron effectue un diagnostic linguistique de l'apprenant, que celui-ci provienne d'une classe de langue hétérogène (différentes langues maternelles ou homogène (une seule langue maternelle, en l'occurrence ici l'arabe. L'intérêt de cette approche concerne trois domaines : d'une part la didactique des langues, à titre éducatif ; d'autre part, la linguistique computationnelle, et enfin l'enseignement assisté par ordinateur.

Nonlinear study of AI Velorum

International Nuclear Information System (INIS)

Cox, A.N.; Hodson, S.W.

1979-01-01

Using results from earlier studies of double-mode dwarf Cepheids by Cox, King, and Hodson, hydrodynamic calculations were undertaken for AI Vel. The earlier derived evolution theory mass of 1.8 M sub solar, a luminosity of of 23 L sub solar and a T/sub e/ of 7500 0 K give the observed period of 0.11 day and the observed period ratio PI 1 /PI 0 = 0.773. A cooler T/sub e/ than the observed one (7620 0 K) was used because 7620 0 K is beyond the fundamental pulsation mode blue edge. The composition used is X = 0.70 Z = 0.01. This lower than normal Z is necessary to make the period ratio as large as observed. The goal is to see if double-mode behavior, due to either mode switching or a permanent state, can be predicted for the model. Progress in converging the model to a periodic pulsation solution by the von Sengbusch--Stellingwerf relaxation method will be reported. 17 references

Research Directions for AI in Computer Games

OpenAIRE

Fairclough, Chris; Fagan, Michael; Cunningham, Padraig; Mac Namee, Brian

2001-01-01

The computer games industry is now bigger than the film industry. Until recently, technology in games was driven by a desire to achieve real-time, photo-realistic graphics. To a large extent, this has now been achieved. As game developers look for new and innovative technologies to drive games development, AI is coming to the fore. This paper will examine how sophisticated AI techniques, such as those being used in mainstream academic research, can be applied to computer games ...

Strategic Team AI Path Plans: Probabilistic Pathfinding

Directory of Open Access Journals (Sweden)

Tng C. H. John

2008-01-01

Full Text Available This paper proposes a novel method to generate strategic team AI pathfinding plans for computer games and simulations using probabilistic pathfinding. This method is inspired by genetic algorithms (Russell and Norvig, 2002, in that, a fitness function is used to test the quality of the path plans. The method generates high-quality path plans by eliminating the low-quality ones. The path plans are generated by probabilistic pathfinding, and the elimination is done by a fitness test of the path plans. This path plan generation method has the ability to generate variation or different high-quality paths, which is desired for games to increase replay values. This work is an extension of our earlier work on team AI: probabilistic pathfinding (John et al., 2006. We explore ways to combine probabilistic pathfinding and genetic algorithm to create a new method to generate strategic team AI pathfinding plans.

Towards AI-powered personalization in MOOC learning

Science.gov (United States)

Yu, Han; Miao, Chunyan; Leung, Cyril; White, Timothy John

2017-12-01

Massive Open Online Courses (MOOCs) represent a form of large-scale learning that is changing the landscape of higher education. In this paper, we offer a perspective on how advances in artificial intelligence (AI) may enhance learning and research on MOOCs. We focus on emerging AI techniques including how knowledge representation tools can enable students to adjust the sequence of learning to fit their own needs; how optimization techniques can efficiently match community teaching assistants to MOOC mediation tasks to offer personal attention to learners; and how virtual learning companions with human traits such as curiosity and emotions can enhance learning experience on a large scale. These new capabilities will also bring opportunities for educational researchers to analyse students' learning skills and uncover points along learning paths where students with different backgrounds may require different help. Ethical considerations related to the application of AI in MOOC education research are also discussed.

Tightly coupled simulation of nuclear reactor transients with artificial intelligence

International Nuclear Information System (INIS)

Makowitz, H.; Ragheb, M.; Laats, E.T.; Bray, M.A.

1985-01-01

The authors' current efforts are directed toward exploring new avenues of research in simulation of nuclear reactor kinetics transients with artificial intelligence (AI). Being examined are advanced graphics systems such as the Nuclear Plant Analyzer designed to run in parallel with the RELAP5 code, faster than real-time best-estimate simulations, the utilization of the multi-CPU super computers, and simulation as knowledge by attempting to develop new assessment methodologies for artificial intelligence systems and their associated interfaces. This new and fertile area of research should be viewed by the educational and university community as an indication of the future possibilities for AI developments in a number of academic and engineering disciplines

AI model for computer games based on case based reasoning and AI planning

NARCIS (Netherlands)

Menkovski, V.; Metafas, D.

2008-01-01

Making efficient AI models for games with imperfect information can be a particular challenge. Considering the large number of possible moves and the incorporated uncertainties building game trees for these games becomes very difficult due to the exponential growth of the number of nodes at each

Off The Beaten Lane: AI Challenges In MOBAs Beyond Player Control

OpenAIRE

Cook, Michael; Summerville, Adam; Colton, Simon

2017-01-01

MOBAs represent a huge segment of online gaming and are growing as both an eSport and a casual genre. The natural starting point for AI researchers interested in MOBAs is to develop an AI to play the game better than a human - but MOBAs have many more challenges besides adversarial AI. In this paper we introduce the reader to the wider context of MOBA culture, propose a range of challenges faced by the community today, and posit concrete AI projects that can be undertaken to begin solving them.

AI and health

OpenAIRE

Martin Anderson

2018-01-01

ntelligence refers to the ability of an individual to learn or understand something, or to deal with a new situation. When a machine or software exhibits such characteristics, it is referred to as artificial intelligence (AI). Artificial Intelligence is therefore defined as the theory and development of computer systems able to perform tasks that normally require human intelligence, such as visual perception, speech recognition, decision-making, and translation between languages.

Automatic Identification System (AIS) Transmit Testing in Louisville Phase 2

Science.gov (United States)

2014-08-01

Firewall Louisville QM 65.206.28.x NAIS Site Controller PC RS232 Serial cable TV32 Computer Cmd Center Serial splitter SAAB R40 AIS Base Station...172.17.14.6 Rack mount computer AIS Radio Interface Ethernet Switch 192.168.0.x Firewall Cable Modem 192.168.0.1 VTS Accred. Boundary serial connection...Automatic Identification System ( AIS ) Transmit Testing in Louisville Phase 2 Distribution Statement A: Approved for public release

Seed-Specific Stable Expression of the ?-AI1 Inhibitor in Coffee Grains and the In Vivo Implications for the Development of the Coffee Berry Borer

OpenAIRE

Albuquerque, ?rika V. S.; Bezerra, Caroline A.; Romero, Juan V.; Valencia, Jorge W. A.; Valencia-Jim?nez, Arnubio; Pimenta, Lucas M.; Barbosa, Aulus E. A. D.; Silva, Maria C. M.; Meneguim, Ana M.; S?, Maria Eug?nia L.; Engler, Gilbert; de Almeida-Engler, Janice; Fernandez, Diana; Grossi-de-S?, Maria F.

2015-01-01

Genetic transformation of coffee (Coffea spp.), the second most traded commodity worldwide, is an alternative approach to introducing features that cannot be introgressed by traditional crossings. The transgenic stability, heritability and quantitative and spatial expression patterns of the seed-specific promoter phytohemagglutinin (PHA-L) from Phaseolus vulgaris were characterized in genetically modified C. arabica expressing the ?-amylase inhibitor-1 (?-AI1) gene. The ?-AI1 inhibitor shows ...

Procedure for Marine Traffic Simulation with AIS Data

Directory of Open Access Journals (Sweden)

Rina Miyake

2015-03-01

Full Text Available It is essential to evaluate safety of marine traffic for the improvement of efficiency and safety of marine traffic. Spread of AIS makes observation of actual marine traffic more easily and faster than before. Besides, description of collision avoidance behaviours of ships are indispensable to simulate a realistic marine traffic. It is important to develop and implement an algorithm of collision avoidance corresponding to a target traffic or target area into the marine traffic simulation because actual actions for collision avoidance depend on circumstances where ships are sailing. The authors developed an automated marine traffic simulation system with AIS data. And in this paper, we proposed a series of systematic procedures for marine traffic simulation including analysing for collision avoidance behaviours using AIS data.

AI Based Personal Learning Environments: Directions for Long Term Research. AI Memo 384.

Science.gov (United States)

Goldstein, Ira P.; Miller, Mark L.

The application of artificial intelligence (AI) techniques to the design of personal learning environments is an enterprise of both theoretical and practical interest. In the short term, the process of developing and testing intelligent tutoring programs serves as a new experimental vehicle for exploring alternative cognitive and pedagogical…

Human-Assisted AI: an Intelligence Augmentation Approach

OpenAIRE

Alicea, Bradly

2018-01-01

As a flavor of Human-Computer Interaction (HCI), Human-Assisted AI can serve to both augment both human performance and artificial systems. This talk will feature a discussion of Human-assisted AI as an instance of Intelligence Augmentation (IA). We will discuss instances of weak and strong IA, in addition to contemporary examples of and paths forward for such systems. In the variety of models presented, data plays a critical role in the structure of interactions between human and artificial ...

La messagerie pratique de la communication commerciale en français

CERN Document Server

Descotes-Genon, Christiane; Szilagyi, Elisabeth

1990-01-01

Ce manuel s'adresse à : - des étudiants qui se destinent à des carrières commerciales ou au secrétariat, - des professionnels désirant " rafraîchir " leurs connaissances en français commercial. Il peut être utilisé dès le niveau intermédiaire. Les objectifs Son objectif est de permettre à un public non francophone d'apprendre à : - rédiger des lettres commerciales, - utiliser les nouveaux outils de la télématique (minitel, télex, téléfax...), - communiquer efficacement par téléphone. Le contenu Cet ouvrage est constitué : - de lettres commerciales authentiques à analyser, - d'exercices progressifs visant à l'acquisition du savoir-écrire commercial : les normes, le vocabulaire, les paragraphes standards, - de simulations et de jeux de rôles à partir de situations enregistrées pour donner les moyens de communiquer par le téléphone, le minitel, le télex et le télécopieur, - d'informations pratiques sur la réalité technique de ces nouveaux outils, - de répertoires alphabétiqu...

Effect of sequence of insemination after simultaneous thawing of multiple semen straws on conception rate to timed AI in suckled multiparous Nelore cows.

Science.gov (United States)

Oliveira, L Z; Arruda, R P; de Andrade, A F C; Santos, R M; Beletti, M E; Peres, R F G; Martins, J P N; de Lima, V F M Hossepian

2012-11-01

The objective was to determine the effect of sequence of insemination after simultaneous thawing of multiple 0.5 mL semen straws on conception rate in suckled multiparous Nelore cows. The effect of this thawing procedure on in vitro sperm characteristics was also evaluated. All cows (N = 944) received the same timed AI protocol. Ten straws (0.5 mL) of frozen semen from the same batch were simultaneously thawed at 36 °C, for a minimum of 30 sec. One straw per cow was used for timed AI. Frozen semen from three Angus bulls was used. Timed AI records included sequence of insemination (first to tenth) and time of semen removal from thawing bath. For laboratory analyses, the same semen batches used in the field experiment were evaluated. Ten frozen straws from the same batch were thawed simultaneously in a thawing unit identical to that used in the field experiment. The following sperm characteristics were analyzed: sperm motility parameters, sperm thermal resistance, plasma and acrosomal membrane integrity, lipid peroxidation, chromatin structure, and sperm morphometry. Based on logistic regression, there were no significant effects of breeding group, body condition score, AI technician, and sire on conception rate, but there was an interaction between sire and straw group (P = 0.002). Semen from only one bull had decreased (P conception rates at timed AI, depending on the sire used. Nevertheless, the effects of this thawing environment on in vitro sperm characteristics, remain to be further investigated. Copyright © 2012 Elsevier Inc. All rights reserved.

ASAMPSA2 best-practices guidelines for L2 PSA development and applications. Volume 3 - Extension to Gen IV reactors

International Nuclear Information System (INIS)

Bassi, C.; Bonneville, H.; Brinkman, H.; Burgazzi, L.; Polidoro, F.; Vincon, L.; Jouve, S.

2010-01-01

The main objective assigned to the Work Package 4 (WP4) of the 'ASAMPSA2' project (EC 7. FPRD) consist in the verification of the potential compliance of L2PSA guidelines based on PWR/BWR reactors (which are specific tasks of WP2 and WP3) with Generation IV representative concepts. Therefore, in order to exhibit potential discrepancies between LWRs and new reactor types, the following work was based on the up-to-date designs of: - The European Fast Reactor (EFR) which will be considered as prototypical of a pool-type Sodium-cooled Fast Reactor (SFR); - The ELSY design for the Lead-cooled Fast Reactor (LFR) technology; - The ANTARES project which could be representative of a Very-High Temperature Reactor (VHTR); - The CEA 2400 MWth Gas-cooled Fast Reactor (GFR). (authors)

A l'écoute de... l'entretien et l'interview

CERN Document Server

Lebre-Peytard, Monique

1984-01-01

Ce livre s'adresse à des étudiants en Français langue étrangère de niveau moyen ou avancé. Son objectif est de permettre un développement continu du travail de l'oral (compréhension et expression) souvent négligé dans les méthodes de niveaux 2 et 3.

Regional groundwater flow model for C, K. L. and P reactor areas, Savannah River Site, Aiken, SC

Energy Technology Data Exchange (ETDEWEB)

Flach, G.P.

2000-02-11

A regional groundwater flow model encompassing approximately 100 mi2 surrounding the C, K, L, and P reactor areas has been developed. The reactor flow model is designed to meet the planning objectives outlined in the General Groundwater Strategy for Reactor Area Projects by providing a common framework for analyzing groundwater flow, contaminant migration and remedial alternatives within the Reactor Projects team of the Environmental Restoration Department. The model provides a quantitative understanding of groundwater flow on a regional scale within the near surface aquifers and deeper semi-confined to confined aquifers. The model incorporates historical and current field characterization data up through Spring 1999. Model preprocessing is automated so that future updates and modifications can be performed quickly and efficiently. The CKLP regional reactor model can be used to guide characterization, perform scoping analyses of contaminant transport, and serve as a common base for subsequent finer-scale transport and remedial/feasibility models for each reactor area.

Regional groundwater flow model for C, K. L. and P reactor areas, Savannah River Site, Aiken, SC

International Nuclear Information System (INIS)

Flach, G.P.

2000-01-01

A regional groundwater flow model encompassing approximately 100 mi2 surrounding the C, K, L, and P reactor areas has been developed. The reactor flow model is designed to meet the planning objectives outlined in the General Groundwater Strategy for Reactor Area Projects by providing a common framework for analyzing groundwater flow, contaminant migration and remedial alternatives within the Reactor Projects team of the Environmental Restoration Department. The model provides a quantitative understanding of groundwater flow on a regional scale within the near surface aquifers and deeper semi-confined to confined aquifers. The model incorporates historical and current field characterization data up through Spring 1999. Model preprocessing is automated so that future updates and modifications can be performed quickly and efficiently. The CKLP regional reactor model can be used to guide characterization, perform scoping analyses of contaminant transport, and serve as a common base for subsequent finer-scale transport and remedial/feasibility models for each reactor area

Humans and Machines in the Evolution of AI in Korea

OpenAIRE

Zhang, Byoung-Tak

2016-01-01

Artificial intelligence in Korea is currently prospering. The media is regularly reporting AI-enabled products such as smart advisors, personal robots, autonomous cars, and human-level intelligence machines. The IT industry is investing in deep learning and AI to maintain the global competitive edge in their services and products. The Ministry of Science, ICT, and Future Planning (MSIP) has launched new funding programs in AI and cognitive science to implement the government’s newly adopted e...

harnessing_ai_20180319.pptx

OpenAIRE

Johnson, Matthew

2018-01-01

There have been great strides made in Artificial Intelligence in recent years, but it is often not clear how to apply these recent advances to new problems. In this talk I propose one method of thinking about problems in the sciences and how to find the right AI techniques to aid in research.

AI-2 of Aggregatibacter actinomycetemcomitans Inhibits Candida albicans Biofilm Formation

Directory of Open Access Journals (Sweden)

Endang W. Bachtiar

2014-07-01

Full Text Available Aggregatibacter actinomycetemcomitans, a Gram-negative bacterium, and Candida albicans, a polymorphic fungus, are both commensals of the oral cavity but both are opportunistic pathogens that can cause oral diseases. A. actinomycetemcomitans produces a quorum-sensing molecule called autoinducer-2 (AI-2, synthesized by LuxS, that plays an important role in expression of virulence factors, in intra- but also in interspecies communication. The aim of this study was to investigate the role of AI-2 based signaling in the interactions between C. albicans and A. actinomycetemcomitans. A. actinomycetemcomitans adhered to C. albicans and inhibited biofilm formation by means of a molecule that was secreted during growth. C. albicans biofilm formation increased significantly when co-cultured with A. actinomycetemcomitans luxS, lacking AI-2 production. Addition of wild-type-derived spent medium or synthetic AI-2 to spent medium of the luxS strain, restored inhibition of C. albicans biofilm formation to wild-type levels. Addition of synthetic AI-2 significantly inhibited hypha formation of C. albicans possibly explaining the inhibition of biofilm formation. AI-2 of A. actinomycetemcomitans is synthesized by LuxS, accumulates during growth and inhibits C. albicans hypha- and biofilm formation. Identifying the molecular mechanisms underlying the interaction between bacteria and fungi may provide important insight into the balance within complex oral microbial communities.

Nuclear reactor safety program in U.S. Department of Energy and future perspectives

International Nuclear Information System (INIS)

Song, Y.T.

1987-01-01

The U.S. Department of Energy (DOE) establishes policy, issues orders, and assures compliance with requirements. The contractors who design, construct, modify, operate, maintain and decommission DOE reactors, set forth the assessment of the safety of cognizant reactors and impliment DOE orders. Teams of experts in the Depatment, through scheduled and unscheduled review programs, reassess the safety of reactors in every phases of their lives. As new technology develops, the safety programs are reevaluated and policies are modified to accommodate these new technologies. The diagnostic capabilities of the computer using multiple alarms to enhance detection of defects and control of a reactor have been greatly utilized in reactor operating systems. The application of artificial intelligence (AI) technologies for diagnostic and even for the decision making process in the event of reactor accidents would be one of the future trends in reactor safety programs. (author)

Data of evolutionary structure change: 1AIFA-2AI0O [Confc[Archive

Lifescience Database Archive (English)

Full Text Available s_2> 0 n> 1AIF A...n> 1AIFAn> VSSSI----SSSNL n> 2AI0 n>O 2AI...1AIFA-2AI0O 1AIF 2AI0 A O DIQLTQSPAFMAASPGEKVTITCSVSSSI----SSSNLH...e>SER CA 251 SER CA 276 SER CA 258 ASN CA 337 LEU CA 410

AI Researchers, Video Games Are Your Friends!

OpenAIRE

Togelius, Julian

2016-01-01

If you are an artificial intelligence researcher, you should look to video games as ideal testbeds for the work you do. If you are a video game developer, you should look to AI for the technology that makes completely new types of games possible. This chapter lays out the case for both of these propositions. It asks the question "what can video games do for AI", and discusses how in particular general video game playing is the ideal testbed for artificial general intelligence research. It the...

The research reactors their contribution to the reactors physics

International Nuclear Information System (INIS)

Barral, J.C.; Zaetta, A.; Johner, J.; Mathoniere, G.

2000-01-01

The 19 october 2000, the french society of nuclear energy organized a day on the research reactors. This associated report of the technical session, reactors physics, is presented in two parts. The first part deals with the annual meeting and groups general papers on the pressurized water reactors, the fast neutrons reactors and the fusion reactors industry. The second part presents more technical papers about the research programs, critical models, irradiation reactors (OSIRIS and Jules Horowitz) and computing tools. (A.L.B.)

Brosimacutins A-I, nine new flavonoids from Brosimum acutifolium.

Science.gov (United States)

Takashima, Junko; Ohsaki, Ayumi

2002-12-01

Nine new flavonoids, brosimacutins A-I (1-9), and four known flavonoids were isolated from the bark of Brosimum acutifolium, a Brazilian folk medicine ("Mururé"). Their structures were elucidated by spectroscopic methods, including 2D NMR. Brosimacutins A-I possess differentially functionalized isoprene units at C-8.

Continuous-flow stirred-tank reactor 20-L demonstration test: Final report

International Nuclear Information System (INIS)

Lee, D.D.; Collins, J.L.

2000-01-01

One of the proposed methods of removing the cesium, strontium, and transuranics from the radioactive waste storage tanks at Savannah River is the small-tank tetraphenylborate (TPB) precipitation process. A two-reactor-in-series (15-L working volume each) continuous-flow stirred-tank reactor (CSTR) system was designed, constructed, and installed in a hot cell to test the Savannah River process. The system also includes two cross-flow filtration systems to concentrate and wash the slurry produced in the process, which contains the bulk of radioactivity from the supernatant processed through the system. Installation, operational readiness reviews, and system preparation and testing were completed. The first test using the filtration systems, two CSTRs, and the slurry concentration system was conducted over a 61-h period with design removal of Cs, Sr, and U achieved. With the successful completion of Test 1a, the following tests, 1b and 1c, were not required

Continuous-flow stirred-tank reactor 20-L demonstration test: Final report

Energy Technology Data Exchange (ETDEWEB)

Lee, D.D.; Collins, J.L.

2000-02-01

One of the proposed methods of removing the cesium, strontium, and transuranics from the radioactive waste storage tanks at Savannah River is the small-tank tetraphenylborate (TPB) precipitation process. A two-reactor-in-series (15-L working volume each) continuous-flow stirred-tank reactor (CSTR) system was designed, constructed, and installed in a hot cell to test the Savannah River process. The system also includes two cross-flow filtration systems to concentrate and wash the slurry produced in the process, which contains the bulk of radioactivity from the supernatant processed through the system. Installation, operational readiness reviews, and system preparation and testing were completed. The first test using the filtration systems, two CSTRs, and the slurry concentration system was conducted over a 61-h period with design removal of Cs, Sr, and U achieved. With the successful completion of Test 1a, the following tests, 1b and 1c, were not required.

QML-AiNet: An immune network approach to learning qualitative differential equation models.

Science.gov (United States)

Pang, Wei; Coghill, George M

2015-02-01

In this paper, we explore the application of Opt-AiNet, an immune network approach for search and optimisation problems, to learning qualitative models in the form of qualitative differential equations. The Opt-AiNet algorithm is adapted to qualitative model learning problems, resulting in the proposed system QML-AiNet. The potential of QML-AiNet to address the scalability and multimodal search space issues of qualitative model learning has been investigated. More importantly, to further improve the efficiency of QML-AiNet, we also modify the mutation operator according to the features of discrete qualitative model space. Experimental results show that the performance of QML-AiNet is comparable to QML-CLONALG, a QML system using the clonal selection algorithm (CLONALG). More importantly, QML-AiNet with the modified mutation operator can significantly improve the scalability of QML and is much more efficient than QML-CLONALG.

Tratamento de água com hidrocarbonetos aromáticos por uso de reator em bateladas sequenciais com inoculo fúngico Treatment of water with aromatic hydrocarbons by use of sequential batch reactor with fungi inoculum

Directory of Open Access Journals (Sweden)

Kelly Rodrigues

2012-06-01

Full Text Available Um reator em batelada, aerado, com biomassa imobilizada de Aspergillus niger AN400 foi operado durante 10 ciclos de 7 dias para remover benzeno (200 mg.L-1, tolueno (200 mg.L-1 e xileno (50 mg.L-1 - BTX - e de nutrientes de meio basal. O reator era alimentado semanalmente com 4 L do meio e glicose - 1 g.L-1, na Fase I, e 0,5 g.L-1, na Fase II. Os BTX foram detectados até o quarto dia de operação, em todos os ciclos. As melhores eficiências médias de remoção foram na Fase I: 75%de matéria orgânica solúvel, 80% de ortofosfato e 77% de amônia. O reator pode ser uma alternativa viável para tratamento de águas poluídas com BTX, porém há a necessidade de estudar o comportamento do reator durante período de operação mais longo e com ciclos reacionais mais curtos, bem como da identificação dos metabólitos produzidos.A batch reactor with air and immobilized biomass of Aspergillus niger AN400 was operated during 10 cycles of 7 days to remove benzene (200 mg.L-1, toluene (200 mg.L-1, and xylene (50 mg.L-1 - BTX - and nutrients from basal medium. The reactor was weekly fed with 4 L of the medium and glucose - 1 g.L-1 (Phase I and 0.5 g.L-1 (Phase II. The BTX had been detected until the fourth day of operation in all cycles. The best efficiencies of removal had been in Phase I: 75% of soluble organic matter, 80% of orthophosphate and 77% of ammonia. The reactor can be a viable alternative for the contaminated water treatment with BTX. However it has the necessity to study behavior of the reactor during longer period of operation and with shorter reaction cycles, as well as the identification of the produced metabolites.

76 FR 44045 - Establishment of the SANE/SART AI/AN Initiative Committee

Science.gov (United States)

2011-07-22

... SANE/SART AI/AN Initiative Committee AGENCY: Office for Victims of Crime, Justice. ACTION: Notice of... Nurse Examiner (SANE) Sexual Assault Response Team (SART) American Indian/Alaskan Native (AI/AN) Initiative (``SANE/SART AI/AN Initiative Committee'' or ``Committee'') is being established in accordance...

Measurement of reactor parameters of the 'Nora' reactor by noise analysis method - power spectral density

International Nuclear Information System (INIS)

Jovanovic, S.; Stormark, E.

1966-01-01

Measurements of reactor parameters the Nora reactor by Power Spectral Density (PSD) method are described. In case of critical reactor this method was applied for direct measurement of β/l ratio, β is the effective yield of delayed neutrons and l is the neutron lifetime. In case of subcritical reactor values of α+β-ρ/l were measured, ρ is the negative reactivity. Out coming PSD was measured by a filter or by ISAC. PSD was registered by ISAC as well as the auto-correlation function [sr

Validation of the Avoidance and Inflexibility Scale (AIS) among treatment-seeking smokers.

Science.gov (United States)

Farris, Samantha G; Zvolensky, Michael J; DiBello, Angelo M; Schmidt, Norman B

2015-06-01

The Avoidance and Inflexibility Scale (AIS; Gifford et al., 2004) was derived as a smoking-specific measure of experiential avoidance. However, there has been little investigation of the psychometric proprieties of the AIS and no published work on the topic. The current study aimed to test the reliability and validity of the AIS among a sample of adult treatment-seeking daily smokers (n = 465; 48.2% female, 17.8 [SD = 9.60] cigarettes per day). The AIS was administered at 3 time points (baseline, quit-day, and 1 month postquit) as part of a larger smoking cessation trial. An exploratory factor analysis indicated a 2-factor solution, described by inflexibility and avoidance because of smoking related "thoughts/feelings" (9 items) and "somatic sensations" (4 items). Results revealed that the AIS-total and factor scores demonstrated high internal consistency and test-retest reliability. The AIS total and factor scores also displayed high convergent, discriminant, and incremental predictive validity with theoretically relevant smoking and affective variables. The present data suggest that the AIS measure appears to be a valid and reliable smoking-specific index of experiential avoidance. (c) 2015 APA, all rights reserved).

Validation of the Avoidance and Inflexibility Scale (AIS) among Treatment-Seeking Smoker

Science.gov (United States)

Farris, Samantha G.; Zvolensky, Michael J.; DiBello, Angelo M.; Schmidt, Norman B.

2015-01-01

The Avoidance and Inflexibility Scale (AIS; Gifford et al., 2004) was derived as smoking-specific measure of experiential avoidance. However, there has been little investigation of the psychometric proprieties of the AIS and no published work on the topic. The current study aimed to test the reliability and validity of the AIS among a sample of adult treatment-seeking daily smokers (n = 465; 48.1% female, 17.8 [SD = 9.60] cigarettes per day). The AIS was administered at three time points (Baseline, Quit day, 1 month post-quit) as part of a larger smoking cessation trial. An exploratory factor analysis indicated a two-factor solution, described by inflexibility and avoidance due to smoking related “thoughts/feelings” (9 items) and “somatic sensations” (4 items). Results revealed that the AIS-total and factor scores demonstrated high internal consistency and test-retest reliability. The AIS total and factor scores also displayed high convergent, discriminant, and incremental predictive validity with theoretically-relevant smoking and affective variables. The present data suggest that the AIS measure appears to be a valid and reliable smoking-specific index of experiential avoidance. PMID:25642937

Validation of the Avoidance and Inflexibility Scale (AIS) among Treatment-Seeking Smoker

OpenAIRE

Farris, Samantha G.; Zvolensky, Michael J.; DiBello, Angelo M.; Schmidt, Norman B.

2015-01-01

The Avoidance and Inflexibility Scale (AIS; Gifford et al., 2004) was derived as smoking-specific measure of experiential avoidance. However, there has been little investigation of the psychometric proprieties of the AIS and no published work on the topic. The current study aimed to test the reliability and validity of the AIS among a sample of adult treatment-seeking daily smokers (n = 465; 48.1% female, 17.8 [SD = 9.60] cigarettes per day). The AIS was administered at three time points (Bas...

Code AI Personal Web Pages

Science.gov (United States)

Garcia, Joseph A.; Smith, Charles A. (Technical Monitor)

1998-01-01

The document consists of a publicly available web site (george.arc.nasa.gov) for Joseph A. Garcia's personal web pages in the AI division. Only general information will be posted and no technical material. All the information is unclassified.

Reactor. Mind picture of the future Jules-Horowitz Reactor (RHJ)

International Nuclear Information System (INIS)

Eustache, S.

1999-01-01

This paper gives information about the future research reactor, named Reactor Jules-Horowitz (RJH). This irradiation reactor will be placed at industrialists disposal, for research concerning the competitiveness and the safety french electro-nuclear park. Principles and innovations are detailed. This reactor will respect the ALARA principle (as low as reasonably achievable). (A.L.B.)

AI, automation and the Flight Telerobotic Servicer

Science.gov (United States)

Goforth, Andre; Dominy, Robert

1988-01-01

A NASA study for the preliminary definition of a teleoperated robotic device has been recently completed. The Fligt Telerobotic Servicer (FTS) will be used to assist astronauts in many of the on-board tasks of assembly, maintenance, servicing, and inspection of the Space Station. The role of artificial intelligence (AI) in furthering the FTS automation capabilities and, hence, extending its capacity for growth and evolution is discussed. Relevant system engineering issues are identified, and an approach for insertion of AI technology is presented in terms of the NASA/NBS Standard Reference Model control architecture NASREM.

Substituted Benzamides Containing Azaspiro Rings as Upregulators of Apolipoprotein A-I Transcription

Directory of Open Access Journals (Sweden)

Bin Hong

2012-06-01

Full Text Available Apolipoprotein A-I (Apo A-I is the principal protein component of high density lipoprotein (HDL, which is generally considered as a potential therapeutic target against atherosclerosis. The understanding of the Apo A-I regulation mechanism has fuelled the development of novel HDL targeted therapeutic approaches. To identify novel agents that can upregulate Apo A-I expression, we performed a cell-based reporter assay to screen 25,600 small molecules. Based on the dataset obtained from screening, a series of novel analogs of substituted benzamides containing azaspiro rings were assessed for their ability to induce the transcription of the Apo A-I gene, and the structure-activity relationship (SAR around these analogs was also proposed. The results indicated that the trifluoromethyl substituted benzamide containing an azaspiro ring is a promising backbone for designing Apo A-I transcriptional upregulator and could be viable leads for development of new drugs to prevent and treat atherosclerosis in the future.

78 FR 17232 - Meeting of the SANE/SART AI/AN Initiative Committee

Science.gov (United States)

2013-03-20

.../SART AI/AN Initiative Committee AGENCY: Office for Victims of Crime, Justice. ACTION: Notice of meeting. SUMMARY: The National Coordination Committee on the American Indian/ Alaska Native (AI/AN) Sexual Assault... violence within AI/AN communities. DATES AND LOCATIONS: The meeting will be held via webinar on Wednesday...

AI-guided parameter optimization in inverse treatment planning

International Nuclear Information System (INIS)

Yan Hui; Yin Fangfang; Guan Huaiqun; Kim, Jae Ho

2003-01-01

An artificial intelligence (AI)-guided inverse planning system was developed to optimize the combination of parameters in the objective function for intensity-modulated radiation therapy (IMRT). In this system, the empirical knowledge of inverse planning was formulated with fuzzy if-then rules, which then guide the parameter modification based on the on-line calculated dose. Three kinds of parameters (weighting factor, dose specification, and dose prescription) were automatically modified using the fuzzy inference system (FIS). The performance of the AI-guided inverse planning system (AIGIPS) was examined using the simulated and clinical examples. Preliminary results indicate that the expected dose distribution was automatically achieved using the AI-guided inverse planning system, with the complicated compromising between different parameters accomplished by the fuzzy inference technique. The AIGIPS provides a highly promising method to replace the current trial-and-error approach

Contribution to the study of the stability of water-cooled reactors; Contribution a l'etude de la stabilite des reacteurs refroidis par de l'eau

Energy Technology Data Exchange (ETDEWEB)

Coudert, C [Commissariat a l' Energie Atomique, Cadarache (France). Centre d' Etudes Nucleaires

1969-06-01

This work is devoted to the study of the stability of reactors cooled by water subjected only to natural convection. It is made up of two parts, a theoretical study and experimental work, each of these parts being devoted to a consideration of linear and non-linear conditions: - calculation of the transfer function of the reactor using neutronic and hydrodynamic linear equations with the determination of the instability threshold; - demonstration of the existence of the limiting oscillation cycle in the case of a linear feedback using MALKIN'S method; - measurement and interpretation of the reactor's transfer functions and of the hydrodynamic transfer functions; and - analysis of the noise due to boiling. (author) [French] Dans ce travail on etudie la stabilite des piles refroidies par de l'eau circulant en convection naturelle. Cette etude se divise en deux parties: un travail theorique et un travail experimental, chacune de ces parties comportant une etude lineaire et une etude non-lineaire: - calcul de la fonction de transfert du reacteur a partir des equations lineaires de la neutronique et de l'hydrodynamique avec determination du seuil d'instabilite; - demonstration de l'existence du cycle limite des oscillations dans le cas d'une retroaction lineaire en utilisant la methode de MALKIN; - mesure et interpretation de la fonction de transfert du reacteur et des fonctions de transfert hydrodynamiques; et - analyse du bruit d'ebullition. (auteur)

Méthodologie de l'extrapolation des réacteurs chimiques Methodology for Scaling Up Chemical Reactors

Directory of Open Access Journals (Sweden)

Trambouze P.

2006-11-01

Full Text Available Après un exposé général relatif à la méthodologie du développement des procédés, applicable à l'extrapolation des réacteurs, est présenté un rapide examen critique des deux principales techniques mises en oeuvre, à savoir : - la théorie de la similitude ; - l'élaboration de modèles mathématiques. Deux exemples pratiques, relatifs aux réacteurs homogènes et aux réacteurs catalytiques à lit fixe et deux phases fluides, sont ensuite examinés à la lumière des considérations générales précédentes. After giving a general description of process-development methodology applicable to scaling up reactors, this article makes a quick critical examination of the two main techniques involved, i. e. : (a the theory of similarity, and (b the compiling of mathematical models. Two practical examples relating to homogeneous reactors and trickle-bed catalytic reactors are then examined in the light of the preceding general considerations.

Description of the two-loop RELAP5 model of the L-Reactor at the Savannah River Site

International Nuclear Information System (INIS)

Cozzuol, J.M.; Davis, C.B.

1989-12-01

A two-loop RELAP5 input model of the L-Reactor at the Savannah River Site (SRS) was developed to support thermal-hydraulic analysis of SRS reactors. The model was developed to economically evaluate potential design changes. The primary simplifications in the model were in the number of loops and the detail in the moderator tank. The six loops in the reactor were modeled with two loops, one representing a single loop and the other representing five combined loops. The model has undergone a quality assurance review. This report describes the two-loop model, its limitations, and quality assurance. 29 refs., 18 figs., 10 tabs

Seed-specific stable expression of the alpha-AI1 inhibitor in coffee grains and the in vivo implications for the development of the coffee berry borer

OpenAIRE

Albuquerque, E. V. S.; Bezerra, C. A.; Romero, J. V.; Valencia, J. W. A.; Valencia-Jimenez, A.; Pimenta, L. M.; Barbosa, Aead; Silva, M. C. M.; Meneguim, A. M.; Sa, M. E. L.; Engler, G.; de Almeida-Engler, J.; Fernandez, Diana; Grossi-de-Sa, M. F.

2015-01-01

Genetic transformation of coffee (Coffea spp.), the second most traded commodity worldwide, is an alternative approach to introducing features that cannot be introgressed by traditional crossings. The transgenic stability, heritability and quantitative and spatial expression patterns of the seed-specific promoter phytohemagglutinin (PHA-L) from Phaseolus vulgaris were characterized in genetically modified C. arabica expressing the alpha-amylase inhibitor-1 (alpha-AI1) gene. The alpha-AI1 inhi...

Joint application of AI techniques, PRA and disturbance analysis methodology to problems in the maintenance and design of nuclear power plants

International Nuclear Information System (INIS)

Okrent, D.

1989-01-01

This final report summarizes the accomplishments of a two year research project entitled ''Joint Application of Artificial Intelligence Techniques, Probabilistic Risk Analysis, and Disturbance Analysis Methodology to Problems in the Maintenance and Design of Nuclear Power Plants. The objective of this project is to develop and apply appropriate combinations of techniques from artificial intelligence, (AI), reliability and risk analysis and disturbance analysis to well-defined programmatic problems of nuclear power plants. Reactor operations issues were added to those of design and maintenance as the project progressed

Joint application of AI techniques, PRA and disturbance analysis methodology to problems in the maintenance and design of nuclear power plants

Energy Technology Data Exchange (ETDEWEB)

Okrent, D.

1989-03-01

This final report summarizes the accomplishments of a two year research project entitled Joint Application of Artificial Intelligence Techniques, Probabilistic Risk Analysis, and Disturbance Analysis Methodology to Problems in the Maintenance and Design of Nuclear Power Plants. The objective of this project is to develop and apply appropriate combinations of techniques from artificial intelligence, (AI), reliability and risk analysis and disturbance analysis to well-defined programmatic problems of nuclear power plants. Reactor operations issues were added to those of design and maintenance as the project progressed.

AI technology and automobile. ; Toward vehicle autonomy. AI gijutsu to jidosha. ; Sharyo no jiritsuka ni mukatte

Energy Technology Data Exchange (ETDEWEB)

Okuno, A. (Mazda Motor Corp., Hiroshima (Japan))

1991-01-01

This report describes the vehicle autonomy by using artificial intelligence (AI) technology. Owing to a remarkable progress of AI technology, it is forecasted that driving support system will be introduced into the market till 2000, and higher autonomous navigation system will be introduced since about 2010. Autonomous vehicles have capacities of recognizing the outside world and of navigating roads by themselves, and with their enfanced environment adaptability the road transportation in the future is expected to be much more safer than in the present. The autonomous vehicle can warn its driver of potential dangers and correct operational errors of the driver. In order to realize such autonomous vehicles, extensive researches on perception systems, decision making systems and driving support systems are needed. 9 refs., 10 figs., 1 tab.

Anaerobic up flow fluidized bed reactor performance as a primary treatment unit in domestic wastewater treatment

Directory of Open Access Journals (Sweden)

M.A. Moharram

2016-04-01

The efficiencies of Total nitrogen removal ranged between 2.23 and 10.83% with an apparent decrease during the low temperature high rate stages. Nitrite removal was in the range of (23.08–77% with up to the 2 mg/L in the effluent water when obtaining high organic loading and warm temperature. These results demonstrated that the domestic wastewater could be anaerobically treated in a fluidized bed UASB reactor with very low HRT reaching 2.5 h.

Thermostable L-arabinose isomerase from Bacillus stearothermophilus IAM 11001 for D-tagatose production: gene cloning, purification and characterisation.

Science.gov (United States)

Cheng, Lifang; Mu, Wanmeng; Jiang, Bo

2010-06-01

D-Tagatose, as one of the rare sugars, has been found to be a natural and safe low-calorie sweetener in food products and is classified as a GRAS substance. L-Arabinose isomerase (L-AI, EC 5.3.1.4), catalysing the isomerisations of L-arabinose and D-galactose to L-ribulose and D-tagatose respectively, is considered to be the most promising enzyme for the production of D-tagatose. The araA gene encoding an L-AI from Bacillus stearothermophilus IAM 11001 was cloned, sequenced and overexpressed in Escherichia coli. The gene is composed of 1491 bp nucleotides and codes for a protein of 496 amino acid residues. The recombinant L-AI was purified to electrophoretical homogeneity by affinity chromatography. The purified enzyme was optimally active at 65 degrees C and pH 7.5 and had an absolute requirement for the divalent metal ion Mn(2+) for both catalytic activity and thermostability. The enzyme was relatively active and stable at acidic pH of 6. The bioconversion yield of D-galactose to D-tagatose by the purified L-AI after 12 h at 65 degrees C reached 36%. The purified L-AI from B. stearothermophilus IAM 11001 was characterised and shown to be a good candidate for potential application in D-tagatose production. Copyright (c) 2010 Society of Chemical Industry.

L'argenture de l'Anguille : métamorphose, anticipation, adaptation

Directory of Open Access Journals (Sweden)

FONTAINE Y. A.

1994-10-01

En conclusion, on s'interroge sur la définition morphologique et biochimique des étapes successives de l'argenture et sur la reconnaissance de ces étapes par des caractères, aisément détectables, plus précis et fiables que la coloration. Des progrès dans ces domaines permettraient de connaître par exemple, dès avant l'avalaison, la proportion du stock qui quittera les eaux douces dans l'année.

National AIS at 1 Minute Intervals

Data.gov (United States)

National Oceanic and Atmospheric Administration, Department of Commerce — OCM plans to contract for AIS data per the following description. The United States Automatic Identification System Database contains vessel traffic data for...

NASA space station automation: AI-based technology review

Science.gov (United States)

Firschein, O.; Georgeff, M. P.; Park, W.; Neumann, P.; Kautz, W. H.; Levitt, K. N.; Rom, R. J.; Poggio, A. A.

1985-01-01

Research and Development projects in automation for the Space Station are discussed. Artificial Intelligence (AI) based automation technologies are planned to enhance crew safety through reduced need for EVA, increase crew productivity through the reduction of routine operations, increase space station autonomy, and augment space station capability through the use of teleoperation and robotics. AI technology will also be developed for the servicing of satellites at the Space Station, system monitoring and diagnosis, space manufacturing, and the assembly of large space structures.

Enabling technologies and methods for the retro-fitting of AI software into NPPS

International Nuclear Information System (INIS)

Pymm, P.

1994-01-01

Scottish Nuclear have a number of plant monitoring and training applications at their operational nuclear power plant which could benefit from the introduction of artificial intelligence (AI) software. An outline of early work on two current AI developments in the areas of advanced operator aids and intelligent training is given. A generic workstation based engineering simulator (WES) which provides a prototyping environment for AI product application development and evaluation and development of human-computer interface (HCI) designs for plant installation is described. It is concluded that the WES architecture facilitates both migration of the prototype AI application to the plant and collaboration in the AI field between Scottish Nuclear and other organizations. (author). 1 ref., 6 figs

A Review of Future and Ethical Perspectives of Robotics and AI

OpenAIRE

Jim Torresen

2018-01-01

In recent years, there has been increased attention on the possible impact of future robotics and AI systems. Prominent thinkers have publicly warned about the risk of a dystopian future when the complexity of these systems progresses further. These warnings stand in contrast to the current state-of-the-art of the robotics and AI technology. This article reviews work considering both the future potential of robotics and AI systems, and ethical considerations that need to be taken in order to ...

Using experimental game theory to transit human values to ethical AI

OpenAIRE

Wang, Yijia; Wan, Yan; Wang, Zhijian

2017-01-01

Knowing the reflection of game theory and ethics, we develop a mathematical representation to bridge the gap between the concepts in moral philosophy (e.g., Kantian and Utilitarian) and AI ethics industry technology standard (e.g., IEEE P7000 standard series for Ethical AI). As an application, we demonstrate how human value can be obtained from the experimental game theory (e.g., trust game experiment) so as to build an ethical AI. Moreover, an approach to test the ethics (rightness or wrongn...

Compatibility of 316L stainless steel with tritium breeders for fusion reactors

International Nuclear Information System (INIS)

Broc, M.; Fauvet, P.; Flament, T.; Sannier, J.

1986-06-01

Compatibility problems with structural materials are a concern for the choice of the tritium breeder for fusion reactors. In the frame of the European Programme on Fusion Technology, two types of blankets are considered: liquid (eutectic lithium-lead alloy at 0.68 wt % Li: 17Li83Pb) and solid (lithium aluminate or silicate) breeders. This paper is devoted to compatibility studies of 316L stainless steel with 17Li83Pb alloy and γ-LiA10 2 ceramic

Accretion in Radiative Equipartition (AiRE) Disks

Energy Technology Data Exchange (ETDEWEB)

Yazdi, Yasaman K.; Afshordi, Niayesh, E-mail: yyazdi@pitp.ca, E-mail: nafshordi@pitp.ca [Perimeter Institute for Theoretical Physics, 31 Caroline Street N, Waterloo, ON N2L 2Y5 (Canada)

2017-07-01

Standard accretion disk theory predicts that the total pressure in disks at typical (sub-)Eddington accretion rates becomes radiation pressure dominated. However, radiation pressure dominated disks are thermally unstable. Since these disks are observed in approximate steady state over the instability timescale, our accretion models in the radiation-pressure-dominated regime (i.e., inner disk) need to be modified. Here, we present a modification to the Shakura and Sunyaev model, where the radiation pressure is in equipartition with the gas pressure in the inner region. We call these flows accretion in radiative equipartition (AiRE) disks. We introduce the basic features of AiRE disks and show how they modify disk properties such as the Toomre parameter and the central temperature. We then show that the accretion rate of AiRE disks is limited from above and below, by Toomre and nodal sonic point instabilities, respectively. The former leads to a strict upper limit on the mass of supermassive black holes as a function of cosmic time (and spin), while the latter could explain the transition between hard and soft states of X-ray binaries.

Development and Validation of the Alcohol Identity Implicit Associations Test (AI-IAT)

Science.gov (United States)

Gray, Heather M.; LaPlante, Debi A.; Bannon, Brittany L.; Ambady, Nalini; Shaffer, Howard J.

2011-01-01

Alcohol identity is the extent to which an individual perceives drinking alcohol to be a defining characteristic of his or her self-identity. Although alcohol identity might play an important role in risky college drinking practices, there is currently no easily administered, implicit measure of this concept. Therefore we developed a computerized implicit measure of alcohol identity (the Alcohol Identity Implicit Associations Test; AI-IAT) and assessed its reliability and predictive validity in relation to risky college drinking practices. One hundred forty-one college students completed the AI-IAT. Again 3- and 6-months later, we administered the AI-IAT and indices of engagement in risky college drinking practices. A subset of participants also completed the previously-validated implicit measure of alcohol identity. Scores on the AI-IAT were stable over time, internally consistent, and positively correlated with the previously-validated measure of alcohol identity. Baseline AI-IAT scores predicted future engagement in risky college drinking practices, even after controlling for standard alcohol consumption measures. We conclude that the AI-IAT reliably measures alcohol identity, a concept that appears to play an important role in risky college drinking practices. PMID:21621924

Combining AI Methods for Learning Bots in a Real-Time Strategy Game

Directory of Open Access Journals (Sweden)

Robin Baumgarten

2009-01-01

Full Text Available We describe an approach for simulating human game-play in strategy games using a variety of AI techniques, including simulated annealing, decision tree learning, and case-based reasoning. We have implemented an AI-bot that uses these techniques to form a novel approach for planning fleet movements and attacks in DEFCON, a nuclear war simulation strategy game released in 2006 by Introversion Software Ltd. The AI-bot retrieves plans from a case-base of recorded games, then uses these to generate a new plan using a method based on decision tree learning. In addition, we have implemented more sophisticated control over low-level actions that enable the AI-bot to synchronize bombing runs, and used a simulated annealing approach for assigning bombing targets to planes and opponent cities to missiles. We describe how our AI-bot operates, and the experimentation we have performed in order to determine an optimal configuration for it. With this configuration, our AI-bot beats Introversion's finite state machine automated player in 76.7% of 150 matches played. We briefly introduce the notion of ability versus enjoyability and discuss initial results of a survey we conducted with human players.

Tout va bien ! méthode de français : cahier d'exercices 2

CERN Document Server

Augé, H; Marlhens, C; Martin, L

2005-01-01

Tout va bien ! est une méthode de français destinée aux grands adolescents et adultes débutants ou faux-débutants. Ses objectifs respectent scrupuleusement les recommandations du Cadre européen commun de référence pour les langues, comme en témoigne le portfolio qui accompagne le livre de l'élève. Tout va bien ! propose : Des supports et des situations de communication authentiques ou proches de l'authentique, permettant à l'élève de se sensibiliser aux différents registres et de découvrir certains aspects de la culture francophone tout autant que la langue. De très nombreuses activités visant l'acquisition des quatre compétences de communication et l'utilisation de stratégies spécifiques. Un travail sur la grammaire et le vocabulaire associés aux situations et au service de la communication faisant une large place à l'observation et à la réflexion. Une invitation régulière à l'évaluation, au travail an autonomie et à l'auto-évaluation.

Tout va bien ! méthode de français : cahier d'exercices 1

CERN Document Server

Augé, H; Marlhens, C; Martin, L

2005-01-01

Tout va bien ! est une méthode de français destinée aux grands adolescents et adultes débutants ou faux-débutants. Ses objectifs respectent scrupuleusement les recommandations du Cadre européen commun de référence pour les langues, comme en témoigne le portfolio qui accompagne le livre de l'élève. Tout va bien ! propose : Des supports et des situations de communication authentiques ou proches de l'authentique, permettant à l'élève de se sensibiliser aux différents registres et de découvrir certains aspects de la culture francophone tout autant que la langue. De très nombreuses activités visant l'acquisition des quatre compétences de communication et l'utilisation de stratégies spécifiques. Un travail sur la grammaire et le vocabulaire associés aux situations et au service de la communication faisant une large place à l'observation et à la réflexion. Une invitation régulière à l'évaluation, au travail an autonomie et à l'auto-évaluation.

The dangers of irradiate uranium in nuclear reactors; Les dangers de l'uranium irradie dans les reacteurs nucleaires

Energy Technology Data Exchange (ETDEWEB)

Jammet, H; Joffre, H [Commissariat a l' Energie Atomique, Saclay (France). Centre d' Etudes Nucleaires

1955-07-01

The danger of the uranium cans sur-activated by the use in the nuclear reactors is triple: - Irradiation from afar, during manipulations of the cans. - Contamination of air when decladding. - Contamination of air by fire of uranium in a reactor in function The first two dangers are usual and can be treated thanks to the rules of security in use in the atomic industry. The third has an accidental character and claimed for the use of special and exceptional rules, overflowing the industrial setting, to reach the surrounding populations. (authors) [French] Le danger des cartouches d'uranium suractive par utilisation dans les reacteurs nucleaires est triple: - Irradiation a distance, lors des manipulations des cartouches. - Contamination de l'air au moment de leur degainage. - Contamination de l'air par incendie d'uranium dans un reacteur en fonctionnement. Les deux premiers dangers sont habituels et peuvent etre traites grace aux regles de securite en usage dans l'industrie atomique. Le troisieme revet un caractere accidentel et reclame l'emploi de regles speciales et exceptionnelles, debordant le cadre industriel, pour atteindre celui des populations environnantes. (auteurs)

AIS Ship Traffic: Hawaii: 2011-2012

Data.gov (United States)

National Oceanic and Atmospheric Administration, Department of Commerce — Ship position data from a satellite-based Automatic Identification System (AIS) were obtained jointly by PacIOOS (J. Potemra), SOEST/ORE of the University of Hawaii...

Artemisiae Argyi Folium and its geo-authentic crude drug qi ai

Directory of Open Access Journals (Sweden)

Diangang Liu

2017-01-01

Conclusion: The superior quality of qi ai compared with general AAF may be due to relatively higher contents of bioactive components. This study provides basic information for further study and utilization of AAF and qi ai.

Apolipoprotein A-I metabolism in cynomolgus monkey. Identification and characterization of beta-migrating pools

International Nuclear Information System (INIS)

Melchior, G.W.; Castle, C.K.

1989-01-01

Fresh plasma from control (C) and hypercholesterolemic (HC) cynomolgus monkeys was analyzed by agarose electrophoresis-immunoblotting with antibody to cynomolgus monkey apolipoprotein (apo) A-I. Two bands were evident on the autoradiogram: an alpha-migrating band (high density lipoprotein) and a beta-migrating band that comigrated exactly with cynomolgus monkey low density lipoprotein (LDL). The presence of beta-migrating apo A-I in the plasma of these monkeys was confirmed by Geon-Pevikon preparative electrophoresis, crossed immunoelectrophoresis, and isotope dilution studies in which radiolabeled apo A-I was found to equilibrate also with alpha- and beta-migrating pools of apo A-I in the plasma. Subfractionation of C and HC plasma by agarose column chromatography (Bio-Gel A-0.5M and A-15M) followed by agarose electrophoresis-immunoblotting indicated that the beta-migrating apo A-I in C was relatively homogeneous and eluted with proteins of Mr approximately 50 kD [apo A-I(50 kD)], whereas two beta-migrating fractions were identified in HC, one that eluted with the 50-kD proteins, and the other that eluted in the LDL Mr range [apo A-I(LDL)]. The apo A-I(LDL) was precipitated by antibody to cynomolgus monkey apo B. The apo A-I(50 kD) accounted for 5 +/- 1% (mean +/- SD) of the plasma apo A-I in C plasma, and 15 +/- 7% in HC plasma. No apo A-I(LDL) was detected in C plasma, but that fraction accounted for 9 +/- 7% of the apo A-I in HC plasma. These data establish the presence of multiple pools of apo A-I in the cynomolgus monkey, which must be taken into consideration in any comprehensive model of apo A-I metabolism in this species

Ethanol production from wet-exploded wheat straw hydrolysate by thermophilic anaerobic bacterium Thermoanaerobacter BG1L1 in a continuous immobilized reactor

DEFF Research Database (Denmark)

Georgieva, Tania I.; Mikkelsen, Marie Just; Ahring, Birgitte Kiær

2008-01-01

was not detoxified, ethanol yield in a range of 0.39-0.42 g/g was obtained. Overall, sugar efficiency to ethanol was 68-76%. The reactor was operated continuously for approximately 143 days, and no contamination was seen without the use of any agent for preventing bacterial infections. The tested microorganism has......Thermophilic ethanol fermentation of wet-exploded wheat straw hydrolysate was investigated in a continuous immobilized reactor system. The experiments were carried out in a lab-scale fluidized bed reactor (FBR) at 70C. Undetoxified wheat straw hydrolysate was used (3-12% dry matter), corresponding...... to sugar mixtures of glucose and xylose ranging from 12 to 41 g/l. The organism, thermophilic anaerobic bacterium Thermoanaerobacter BG1L1, exhibited significant resistance to high levels of acetic acid (up to 10 g/l) and other metabolic inhibitors present in the hydrolysate. Although the hydrolysate...

General general game AI

OpenAIRE

Togelius, Julian; Yannakakis, Georgios N.; 2016 IEEE Conference on Computational Intelligence and Games (CIG)

2016-01-01

Arguably the grand goal of artificial intelligence research is to produce machines with general intelligence: the capacity to solve multiple problems, not just one. Artificial intelligence (AI) has investigated the general intelligence capacity of machines within the domain of games more than any other domain given the ideal properties of games for that purpose: controlled yet interesting and computationally hard problems. This line of research, however, has so far focuse...

Serum concentrations of cholesterol, apolipoprotein A-I and apolipoprotein B in a total of 1694 meat-eaters, fish-eaters, vegetarians and vegans.

Science.gov (United States)

Bradbury, K E; Crowe, F L; Appleby, P N; Schmidt, J A; Travis, R C; Key, T J

2014-02-01

The objective of this study was to describe serum lipid concentrations, including apolipoproteins A-I and B, in different diet groups. A cross-sectional analysis of a sample of 424 meat-eaters, 425 fish-eaters, 423 vegetarians and 422 vegans, matched on sex and age, from the European Prospective Investigation into Cancer and Nutrition-Oxford cohort. Serum concentrations of total, and high-density lipoprotein (HDL) cholesterol, as well as apolipoproteins A-I and B were measured, and serum non-HDL cholesterol was calculated. Vegans had the lowest body mass index (BMI) and the highest and lowest intakes of polyunsaturated and saturated fat, respectively. After adjustment for age, alcohol and physical activity, compared with meat-eaters, fish-eaters and vegetarians, serum concentrations of total and non-HDL cholesterol and apolipoprotein B were significantly lower in vegans. Serum apolipoprotein A-I concentrations did not differ between the diet groups. In males, the mean serum total cholesterol concentration was 0.87 mmol/l lower in vegans than in meat-eaters; after further adjustment for BMI this difference was 0.76 mmol/l. In females, the difference in total cholesterol between these two groups was 0.6 mmol/l, and after further adjustment for BMI was 0.55 mmol/l. [corrected]. In this study, which included a large number of vegans, serum total cholesterol and apolipoprotein B concentrations were lower in vegans compared with meat-eaters, fish-eaters and vegetarians. A small proportion of the observed differences in serum lipid concentrations was explained by differences in BMI, but a large proportion is most likely due to diet.

Purification and characterization of an L-arabinose isomerase from an isolated strain of Geobacillus thermodenitrificans producing D-tagatose.

Science.gov (United States)

Kim, Hye-Jung; Oh, Deok-Kun

2005-11-04

The araA gene, encoding l-arabinose isomerase (AI), from the thermophilic bacterium Geobacillus thermodenitrificans was cloned and expressed in Escherichia coli. Recombinant AI was isolated with a final purity of about 97% and a final specific activity of 2.10 U/mg. The molecular mass of the purified AI was estimated to be about 230 kDa to be a tetramer composed of identical subunits. The AI exhibited maximum activity at 70 degrees C and pH 8.5 in the presence of Mn2+. The enzyme was stable at temperatures below 60 degrees C and within the pH range 7.5-8.0. d-Galactose and l-arabinose as substrate were isomerized with high activities. Ribitol was the strongest competitive inhibitor of AI with a Ki of 5.5mM. The apparent Km and Vmax for L-arabinose were 142 mM and 86 U/mg, respectively, whereas those for d-galactose were 408 mM and 6.9 U/mg, respectively. The catalytic efficiency (kcat/Km) was 48 mM(-1)min(-1) for L-arabinose and 0.5mM(-1)min(-1) for D-galactose. Mn2+ was a competitive activator and increased the thermal stability of the AI. The D-tagatose yield produced by AI from d-galactose was 46% without the addition of Mn2+ and 48% with Mn2+ after 300 min at 65 degrees C.

Emotion Oriented Programming: Computational Abstractions for AI Problem Solving

OpenAIRE

Darty , Kevin; Sabouret , Nicolas

2012-01-01

International audience; In this paper, we present a programming paradigm for AI problem solving based on computational concepts drawn from Affective Computing. It is believed that emotions participate in human adaptability and reactivity, in behaviour selection and in complex and dynamic environments. We propose to define a mechanism inspired from this observation for general AI problem solving. To this purpose, we synthesize emotions as programming abstractions that represent the perception ...

Heterologous expression and characterization of Bacillus coagulans L-arabinose isomerase.

Science.gov (United States)

Zhou, Xingding; Wu, Jin Chuan

2012-05-01

Bacillus coagulans has been of great commercial interest over the past decade owing to its strong ability of producing optical pure L: -lactic acid from both hexose and pentose sugars including L: -arabinose with high yield, titer and productivity under thermophilic conditions. The L: -arabinose isomerase (L-AI) from Bacillus coagulans was heterologously over-expressed in Escherichia coli. The open reading frame of the L-AI has 1,422 nucleotides encoding a protein with 474 amino acid residues. The recombinant L-AI was purified to homogeneity by one-step His-tag affinity chromatography. The molecular mass of the enzyme was estimated to be 56 kDa by SDS-PAGE. The enzyme was most active at 70°C and pH 7.0. The metal ion Mn(2+) was shown to be the best activator for enzymatic activity and thermostability. The enzyme showed higher activity at acidic pH than at alkaline pH. The kinetic studies showed that the K (m), V (max) and k (cat)/K (m) for the conversion of L: -arabinose were 106 mM, 84 U/mg and 34.5 mM(-1)min(-1), respectively. The equilibrium ratio of L: -arabinose to L: -ribulose was 78:22 under optimal conditions. L: -ribulose (97 g/L) was obtained from 500 g/l of L: -arabinose catalyzed by the enzyme (8.3 U/mL) under the optimal conditions within 1.5 h, giving at a substrate conversion of 19.4% and a production rate of 65 g L(-1) h(-1).

Do older t'ai chi practitioners have better attention and memory function?

Science.gov (United States)

Man, David W K; Tsang, William W N; Hui-Chan, Christina W Y

2010-12-01

Cognitive declines are common in older people and can be a major health issue in an aging world. One type of body-mind exercises, t'ai chi, can be a possible means to help maintaining older adults' cognitive abilities, in addition to beneficial effects of physical exercises. The purpose of this study was to investigate whether t'ai chi practitioners had better attention and memory functions than older people with or without regular exercises. A cross-sectional study examining the relationship between t'ai chi practice and age-, gender- and education-similar older peoples' attention and memory functions. Forty-two (42) community-dwelling elderly subjects, aged 60 or older, recruited from t'ai chi clubs in Hong Kong formed the t'ai chi group. Another 49 elderly having regular exercise habits were recruited from community centers for inclusion in the exercise group. A nonexercise group (normal healthy control) consisting of 44 subjects were also recruited by random selection and through contacting local elderly centers. They were also screened by the Modified Barthel Index, Chinese Mini-mental Status Examination, Geriatric Depression Scale, and evaluated by attention tests (Color Trail Form A-1 and 2) and memory tests (including Rivermead Behavioral Memory Test and The Hong Kong List Learning Test). The main finding was that the three groups differed in attention and memory functions, and the t'ai chi group had demonstrated better performance than the other two groups in most subtests. As a causal relationship cannot be assumed in the present cross-sectional study, future research is required to examine how t'ai chi can improve cognitive function using a randomized control trial as well as determining whether t'ai chi practice can lead to better health status among elderly people.

Application of AI technology to nuclear plant operations

International Nuclear Information System (INIS)

Sackett, J.I.

1988-01-01

In this paper, applications of Artificial Intelligence (AI) Technology to nuclear-power plant operation are reviewed. AI Technology is advancing rapidly and in the next five years is expected to enjoy widespread application to operation, maintenance, management and safety. Near term emphasis on a sensor validation, scheduling, alarm handling, and expert systems for procedural assistance. Ultimate applications are envisioned to culminate in autonomous control such as would be necessary for a power system in space, where automatic control actions are taken based upon reasoned conclusions regarding plant conditions, capability and control objectives

Teaching AI Search Algorithms in a Web-Based Educational System

Science.gov (United States)

Grivokostopoulou, Foteini; Hatzilygeroudis, Ioannis

2013-01-01

In this paper, we present a way of teaching AI search algorithms in a web-based adaptive educational system. Teaching is based on interactive examples and exercises. Interactive examples, which use visualized animations to present AI search algorithms in a step-by-step way with explanations, are used to make learning more attractive. Practice…

Managing bioengineering complexity with AI techniques.

Science.gov (United States)

Beal, Jacob; Adler, Aaron; Yaman, Fusun

2016-10-01

Our capabilities for systematic design and engineering of biological systems are rapidly increasing. Effectively engineering such systems, however, requires the synthesis of a rapidly expanding and changing complex body of knowledge, protocols, and methodologies. Many of the problems in managing this complexity, however, appear susceptible to being addressed by artificial intelligence (AI) techniques, i.e., methods enabling computers to represent, acquire, and employ knowledge. Such methods can be employed to automate physical and informational "routine" work and thus better allow humans to focus their attention on the deeper scientific and engineering issues. This paper examines the potential impact of AI on the engineering of biological organisms through the lens of a typical organism engineering workflow. We identify a number of key opportunities for significant impact, as well as challenges that must be overcome. Copyright © 2015 Elsevier Ireland Ltd. All rights reserved.

Joint application of AI techniques, PRA and disturbance analysis methodology to problems in the maintenance and design of nuclear power plants. Final report

Energy Technology Data Exchange (ETDEWEB)

Okrent, D.

1989-03-01

This final report summarizes the accomplishments of a two year research project entitled ``Joint Application of Artificial Intelligence Techniques, Probabilistic Risk Analysis, and Disturbance Analysis Methodology to Problems in the Maintenance and Design of Nuclear Power Plants. The objective of this project is to develop and apply appropriate combinations of techniques from artificial intelligence, (AI), reliability and risk analysis and disturbance analysis to well-defined programmatic problems of nuclear power plants. Reactor operations issues were added to those of design and maintenance as the project progressed.

Simultaneous biological removal of sulfur, nitrogen and carbon using EGSB reactor

Energy Technology Data Exchange (ETDEWEB)

Chen Chuan; Ren Nanqi; Wang Aijie; Yu Zhenguo [School of Municipal and Environmental Engineering, Harbin Inst. of Tech. (China); Lee Duu-Jong [School of Municipal and Environmental Engineering, Harbin Inst. of Tech. (China); Dept. of Chemical Engineering, National Taiwan Univ., Taipei (China)

2008-04-15

High-rate biological conversion of sulfide and nitrate in synthetic wastewater to, respectively, elemental sulfur (S{sup 0}) and nitrogen-containing gas (such as N{sub 2}) was achieved in an expanded granular sludge bed (EGSB) reactor. A novel strategy was adopted to first cultivate mature granules using anaerobic sludge as seed sludge in sulfate-laden medium. The cultivated granules were then incubated in sulfide-laden medium to acclimate autotrophic denitrifiers. The incubated granules converted sulfide, nitrate, and acetate simultaneously in the same EGSB reactor to S{sup 0}, N-containing gases and CO{sub 2} at loading rates of 3,0 kg S m{sup -3} d{sup -1}, 1.45 kg N m{sup -3} d{sup -1}, and 2.77 kg Ac m{sup -1} d{sup -1}, respectively, and was not inhibited by sulfide concentrations up to 800 mg l{sup -1}. Effects of the C/N ratio on granule performance were identified. The granules cultivated in the sulfide-laden medium have Pseudomonas spp. and Azoarcus sp. presenting the heterotrophs and autotrophs that co-work in the high-rate EGSB-SDD (simultaneous desulfurization and denitrification) reactor. (orig.)

SDI satellite autonomy using AI and Ada

Science.gov (United States)

Fiala, Harvey E.

1990-01-01

The use of Artificial Intelligence (AI) and the programming language Ada to help a satellite recover from selected failures that could lead to mission failure are described. An unmanned satellite will have a separate AI subsystem running in parallel with the normal satellite subsystems. A satellite monitoring subsystem (SMS), under the control of a blackboard system, will continuously monitor selected satellite subsystems to become alert to any actual or potential problems. In the case of loss of communications with the earth or the home base, the satellite will go into a survival mode to reestablish communications with the earth. The use of an AI subsystem in this manner would have avoided the tragic loss of the two recent Soviet probes that were sent to investigate the planet Mars and its moons. The blackboard system works in conjunction with an SMS and a reconfiguration control subsystem (RCS). It can be shown to be an effective way for one central control subsystem to monitor and coordinate the activities and loads of many interacting subsystems that may or may not contain redundant and/or fault-tolerant elements. The blackboard system will be coded in Ada using tools such as the ABLE development system and the Ada Production system.

Annealing Induced Softening in Deformed AI-4043 Alloy

International Nuclear Information System (INIS)

Saad, G.; Fawzy, A.; Soliman, H.N.; Mohammed, Gh.; Fayek, S.A.

2011-01-01

The present paper is devoted to study the effect of annealing temperature for different annealing periods of time on the structure and consequently on the tensile properties of Al-4043 alloy. The obtained results showed that the microstructure of AI-4043 alloy is characterized by the presence of spherically shaped Si-particles, which were found to be uniformly distributed within the AI-matrix. Stress-strain characterizations of AI-4043 samples annealed at different temperatures (T a = 573, 673 and 773 K) for different periods of time (t a = 0.5, 1,2.5,5 and 10 h), showed that the tensile parameters; yield stress ε y 0.2 and fracture stress ε f were decreased with increasing Ta and/or ta while the total strain ε T was increased. This was interpreted in terms of growth of Si-particles with increasing T a and/or t a . Attention has been also paid to the role of the minor elements Fe, Cu and Ti on the structure and tensile response behavior of the alloy under investigation

Evaluation of the Steel Creek ecosystem in relation to the proposed restart of L reactor

International Nuclear Information System (INIS)

Smith, M.H.; Sharitz, R.R.; Gladden, J.B.

1981-10-01

Information is presented on the following subjects: habitat and vegetation, the avifauna, semi-aquatic and terrestrial vertebrates, and aquatic communities of Steel Creek, species of special concern, and radiocesium in Steel Creek. Two main goals of the study were the compilation of a current inventory of the flora and fauna of the Steel Creek ecosystem and an assessment of the probable impacts of radionuclides, primarily 137 Cs, that were released into Steel Creek during earlier reactor operations. Although a thorough evaluation of the impacts of the L reactor restart is impossible at this time, it is concluded that the effects on the Steel Creek ecosystem will be substantial if no mitigative measures are taken

Beyond AI: Multi-Intelligence (MI Combining Natural and Artificial Intelligences in Hybrid Beings and Systems

Directory of Open Access Journals (Sweden)

Stephen Fox

2017-06-01

Full Text Available Framing strongly influences actions among technology proponents and end-users. Underlying much debate about artificial intelligence (AI are several fundamental shortcomings in its framing. First, discussion of AI is atheoretical, and therefore has limited potential for addressing the complexity of causation. Second, intelligence is considered from an anthropocentric perspective that sees human intelligence, and intelligence developed by humans, as superior to all other intelligences. Thus, the extensive post-anthropocentric research into intelligence is not given sufficient consideration. Third, AI is discussed often in reductionist mechanistic terms. Rather than in organicist emergentist terms as a contributor to multi-intelligence (MI hybrid beings and/or systems. Thus, current framing of AI can be a self-validating reduction within which AI development is focused upon AI becoming the single-variable mechanism causing future effects. In this paper, AI is reframed as a contributor to MI.

Les diatomées et les indices diatomiques dans les réseaux de mesure de la qualité des cours d'eau français : historique et avenir

Directory of Open Access Journals (Sweden)

PRYGIEL J.

1996-04-01

Full Text Available L'utilisation des diatomées et des indices diatomiques dans les réseaux français de mesure de la qualité des eaux a débuté en 1970, sur la Seine. Un regain d'intérêt s'est manifesté à partir des années 1990, avec des applications sur les bassins Rhône-Méditerranée-Corse, Artois- Picardie, Rhin-Meuse et Adour-Garonne. En 1994, les Agences se sont associées avec le CEMAGREF pour mettre au point un indice diatomique applicable en routine sur l'ensemble du territoire français, et pour promouvoir et faciliter son utilisation en réseau de surveillance. Cet indice diatomique doit rejoindre l'Indice Biologique Global Normalisé au sein du volet biologique du futur système d'évaluation de la qualité des cours d'eau, actuellement en cours de réalisation. Les développements doivent désormais porter sur la consolidation de cet indice au niveau français, ainsi que sur des tests dans plusieurs pays européens.

Balzac peint les français: social satire and construction of ideal types in Les français peints par eux-mêmes.

Directory of Open Access Journals (Sweden)

Marilisa Moccia

2017-02-01

Full Text Available Tra il 1840 e il 1842, negli stessi anni in cui prendeva forma quella che sarà di lì a poco la Comédie Humaine, furono dati alle stampe nove volumi dell’opera Les Français peints par eux-mêmes, pubblicata da Léon Curmer. L’opera vide la collaborazione di disegnatori e scrittori fra i quali Honoré de Balzac che contribuì al progetto scrivendo due voci l’épicier e la femme comme il faut. Les Français peints par eux-mêmes, definito nel sottotitolo Encyclopédie morale du XIXe siècle, è uno dei maggiori esempi di «letteratura panoramica», come ebbe a definirla Walter Benjamin (Benjamin 1979, e vi si mescolano caricatura e determinismo fisiologico impiegati per ritrarre, e non semplicemente descrivere, i tipi umani e sociali che popolano Parigi e la Provincia. L’introduzione di Léon Curmer e Jules Janin colloca il progetto globale dell’opera sotto l’etichetta di «tableau», già utilizzata da Louis-Sébastien Mercier (Mercier 1782, della società contemporanea messa al servizio della storia dei costumi. Da un lato, il dispositivo umoristico dell’opera scatena dall’idea di classificare gli uomini, svuotati della loro soggettività e degradati a tipi sociali, al pari delle specie animali e vegetali, ricalcando e “scoronando”, dunque, l’intento normalizzante dell’Enciclopedia dei lumi. Per questo motivo, la mise en page (ogni voce dell’opera è strutturata in type, tête de page, cul de lampe, contribuisce a creare un transtesto (Genette 1997, che stringe l’occhio al lettore del tempo, nutrito dalle opere di Buffon e Cuvier.  Dall’altro, però, l’intento dichiaratamente “serio” dell’opera che deve occuparsi di spiegare, con intento pedagogico e attraverso l’escamotage dell’autoritratto, i francesi ai Francesi, suggerisce una seconda ipotesi: la società tutta è risibile perché ridicola è la borghesia del regno di Luigi Filippo. Il contributo si propone di indagare il tipo di satira che

Novel cross-linked alcohol-insoluble solid (CL-AIS) affinity gel from pea pod for pectinesterase purification.

Science.gov (United States)

Wu, Ming-Chang; Lin, Guan-Hui; Wang, Yuh-Tai; Jiang, Chii-Ming; Chang, Hung-Min

2005-10-05

Alcohol-insoluble solids (AIS) from pea pod were cross-linked (CL-AIS) and used as an affinity gel matrix to isolate pectin esterases (PEs) from tendril shoots of chayote (TSC) and jelly fig achenes (JFA), and the results were compared with those isolated by ion-exchange chromatography with a commercial resin. CL-AIS gel matrix in a column displayed poor absorption and purification fold of PE; however, highly methoxylated CL-AIS (HM-CL-AIS), by exposing CL-AIS to methanolic sulfuric acid to increase the degree of esterification (DE) to 92%, facilitated the enzyme purification. The purified TSC PE and JFA PE by the HM-CL-AIS column were proofed as a single band on an SDS-PAGE gel, showing that the HM-CL-AIS column was a good matrix for purification of PE, either with alkaline isoelectric point (pI) (TSC PE) or with acidic pI (JFA PE).

État d'avancement du projet de rédaction de l'histoire de l'apport ...

International Development Research Centre (IDRC) Digital Library (Canada)

, avait pour but principal de terminer le tournage de la minisérie, qui sera diffusée sur les ondes de TFO, la télévision éducative et culturelle de l'Ontario français. Avant la date butoir de février 2009, les historiens et leurs ...

Enzymatic conversion of D-galactose to D-tagatose: cloning, overexpression and characterization of L-arabinose isomerase from Pediococcus pentosaceus PC-5.

Science.gov (United States)

Men, Yan; Zhu, Yueming; Zhang, Lili; Kang, Zhenkui; Izumori, Ken; Sun, Yuanxia; Ma, Yanhe

2014-01-01

The gene encoding L-arabinose isomerase from food-grade strain Pediococcus pentosaceus PC-5 was cloned and overexpressed in Escherichia coli. The recombinant protein was purified and characterized. It was optimally active at 50 °C and pH 6.0. Furthermore, this enzyme exhibited a weak requirement for metallic ions for its maximal activity evaluated at 0.6 mM Mn(2+) or 0.8 mM Co(2+). Interestingly, this enzyme was distinguished from other L-AIs, it could not use L-arabinose as its substrate. In addition, a three-dimensional structure of L-AI was built by homology modeling and L-arabinose and D-galactose were docked into the active site pocket of PPAI model to explain the interaction between L-AI and its substrate. The purified P. pentosaceus PC-5 L-AI converted D-galactose into D-tagatose with a high conversion rate of 52% after 24 h at 50 °C, suggesting its excellent potential in D-tagatose production. Crown Copyright © 2013. Published by Elsevier GmbH. All rights reserved.

Caractérisation de l'état chimique d'un élément par fluorescence X : l'aluminium dans les zéolithes Characterizing the Chemical State of an Element by X-Ray Fluorescence: Aluminium in Zeolites

Directory of Open Access Journals (Sweden)

Freund E.

2006-11-01

Full Text Available La fluorescence X est essentiellement connue dans le domaine de l'analyse quantitative, mais c'est aussi une méthode qui permet d'obtenir des informations détaillées sur la structure électronique des éléments. Dans cet article, nous montrons qu'il est possible de mettre au point une technique simple de caractérisation de l'état chimique d'un élément en utilisant de façon conjointe un spectromètre commercial et un programme adapté de traitement des données. Nous avons appliqué cette technique au cas de l'aluminium dans une zéolithe particulière : la mordénite dite à petits pores modifiée par différents traitements. Nous avons ainsi pu classer les solides suivant leur rapport (AI hexa-coordinné/AI tétracoordinné et montrer que le débouchage de la mordénite dite à petits pores est lié à l'extraction d'atomes d'aluminium de la charpente cristalline. X-ray fluorescence is mainly known in the field of qua-titative analysis, but it is also a useful method for obtaining detailed informations about the electronic structure of elements. This article shows that it is possible to develop a simple technique for characterizing the chemical state of an element by combining a commercial spectrometer with a program suited for data processing. This technique has been applied to the case of aluminum in a specific zeolite, ( small portmodernite, modified by various treatments. We were thus able to classify the solids according to the ratio of hexacoordinated AI/tetracoordinated AI and to show that the deblocking of the small portmordenite is linked to the extraction of aluminum atomrs from the crystalline structure.

Launching AI in NASA ground systems

Science.gov (United States)

Perkins, Dorothy C.; Truszkowski, Walter F.

1990-01-01

This paper will discuss recent operational successes in implementing expert systems to support the complex functions of NASA mission control systems at the Goddard Space Flight Center, including fault detection and diagnosis for real time and engineering analysis functions in the Cosmic Background Explorer and Gamma Ray Observatory missions and automation of resource planning and scheduling functions for various missions. It will also discuss ongoing developments and prototypes that will lead to increasingly sophisticated applications of artificial intelligence. These include the use of neural networks to perform telemetry monitoring functions, the implementation of generic expert system shells that can be customized to telemetry handling functions specific to NASA control centers, the applications of AI in training and user support, the long-term potential of implementing systems based around distributed, cooperative problem solving, and the use of AI to control and assist system development activities.

Deploying Embodied AI into Virtual Worlds

Science.gov (United States)

Burden, David J. H.

The last two years have seen the start of commercial activity within virtual worlds. Unlike computer games where Non-Player-Character avatars are common, in most virtual worlds they are the exception — and until recently in Second Life they were non-existent. However there is real commercial scope for Als in these worlds — in roles from virtual sales staff and tutors to personal assistants. Deploying an embodied AI into a virtual world offers a unique opportunity to evaluate embodied Als, and to develop them within an environment where human and computer are on almost equal terms. This paper presents an architecture being used for the deployment of chatbot driven avatars within the Second Life virtual world, looks at the challenges of deploying an AI within such a virtual world, the possible implications for the Turing Test, and identifies research directions for the future.

AI systems approach in particle accelerators

International Nuclear Information System (INIS)

Kataria, S.K.; Bhagwat, P.V.; Kori, S.A.

1992-01-01

The large particle accelerators machines like pelletron accelerator at Tata Institute of Fundamental Research (T.I.F.R) have several levels of controls with operators responsible for overall global control decisions and closed loop feedback controllers for relatively small subsystems of the machines. As the accelerator machines are becoming more complicated and the requirements more stringent, there is a need to provide the operators with an artificial intelligence (AI) system to aid in the tuning the machine and in failure diagnosis. There are few major areas in the pelletron operation, which can be done more efficiently using AI systems approach so that useful beam is available for much more time: 1) Accelerator Conditioning, 2) Accelerator Tuning, and 3) Maintaining the Tune beams. The feasibility study for using expert system for above areas and also for safety evaluation of the various subsystems is carried out. (author). 10 refs., 4 figs

Effects of an Ai Chi fall prevention programme for patients with Parkinson's disease.

Science.gov (United States)

Pérez-de la Cruz, S; García Luengo, A V; Lambeck, J

2016-04-01

One of the main symptoms of Parkinson's disease is the high incidence of falls occurring due to the decline of both static and dynamic balance. The aim of this study is to determine the effect of an Ai Chi programme designed to prevent falls in patients with Parkinson's disease by improving both functional independence and perception of physical pain. Fifteen patients diagnosed with Parkinson's disease (Hoehn and Yahr stages 1-3) participated in a 10-week Ai Chi programme consisting of 30 to 45-minute aquatic exercise sessions twice a week. The assessment measures used in this study were the pain visual analogue scale (VAS), the Tinetti gait and balance assessment tool, and the Timed Get up and Go test. The results were calculated by applying the Friedman test to 3 related measurements: patients at baseline, at post-treatment (at the end of the 10 week programme) and after one month of follow-up. The data obtained showed a significant improvement (p Parkinson's disease. Copyright © 2015 Sociedad Española de Neurología. Published by Elsevier España, S.L.U. All rights reserved.

Computing Facilities for AI: A Survey of Present and Near-Future Options

OpenAIRE

Fahlman, Scott

1981-01-01

At the recent AAAI conference at Stanford, it became apparent that many new AI research centers are being established around the country in industrial and governmental settings and in universities that have not paid much attention to AI in the past. At the same time, many of the established AI centers are in the process of converting from older facilities, primarily based on Decsystem-10 and Decsystem-20 machines, to a variety of newer options. At present, unfortunately, there is no simple an...

Combining AI Methods for Learning Bots in a Real-Time Strategy Game

OpenAIRE

Robin Baumgarten; Simon Colton; Mark Morris

2009-01-01

We describe an approach for simulating human game-play in strategy games using a variety of AI techniques, including simulated annealing, decision tree learning, and case-based reasoning. We have implemented an AI-bot that uses these techniques to form a novel approach for planning fleet movements and attacks in DEFCON, a nuclear war simulation strategy game released in 2006 by Introversion Software Ltd. The AI-bot retrieves plans from a case-base of recorded games, then uses these to generat...

Production of D-tagatose, a low caloric sweetener during milk fermentation using L-arabinose isomerase.

Science.gov (United States)

Rhimi, Moez; Chouayekh, Hichem; Gouillouard, Isabelle; Maguin, Emmanuelle; Bejar, Samir

2011-02-01

Lactobacillusdelbrueckii subsp. bulgaricus and Streptococcus thermophilus are used for the biotransformation of milk in yoghurt. During milk fermentation, these lactic acid bacteria (LAB) hydrolyze lactose producing a glucose moiety that is further metabolized and a galactose moiety that they are enable to metabolize. We investigated the ability of L. bulgaricus and S. thermophilus strains expressing a heterologous L-arabinose isomerase to convert residual D-galactose to D-tagatose. The Bacillus stearothermophilus US100l-arabinose isomerase (US100l-AI) was expressed in both LAB, using a new shuttle vector where the araA US100 gene is under the control of the strong and constitutive promoter of the L. bulgaricus ATCC 11842 hlbA gene. The production of L-AI by these LAB allowed the bioconversion of D-galactose to D-tagatose during fermentation in laboratory media and milk. We also established that the addition of L-AI to milk also allowed the conversion of D-galactose into D-tagatose during the fermentation process. Copyright © 2010 Elsevier Ltd. All rights reserved.

77 FR 5281 - State-of-the-Art Reactor Consequence Analyses Reports

Science.gov (United States)

2012-02-02

... NUCLEAR REGULATORY COMMISSION [Docket ID: NRC-2012-0022] State-of-the-Art Reactor Consequence... release of Draft NUREG-1935, ``State-of-the-Art Reactor Consequence Analyses (SOARCA) Report,'' for public... offsite radiological health consequences for potential severe reactor accidents for the Peach Bottom...

In Orbit Validation of the AAUSAT3 SDR based AIS receiver

DEFF Research Database (Denmark)

Larsen, Jesper Abildgaard; Mortensen, Hans Peter

2013-01-01

During the past years, there has been a high interest in monitoring the global ship traffic from space. The recently launched AAUSAT3 satellite carries an SDR based AIS receiver, which during the past months have been transmitting space based AIS data down to the Aalborg University Ground Station...

Restart of R reactor at SRP

International Nuclear Information System (INIS)

McDonell, W.R.

1983-01-01

Restart of the Savannah River R-Reactor is an alternative to L-Reactor operation for increased production of defense nuclear material. R-Reactor was shut down in 1964 after 11-years operation and has been on standby for 19 years. This report presents a description of R-Reactor operation to serve as a basis for analysis of environmental impacts after restoration to meet current SRP performance standards. R-Reactor operation would differ from L-Reactor operation principally in discharge and recycle of effluent cooling water to Par Pond, rather than direct discharge to the Savannah River by way of Steel Creek. Significant differences in environmental effects could result. A costly renovation program would be required to restore R-Reactor to operability, and the reactor could not contribute to material production before about 1989

AI, Native Supercomputing and The Revival of Moore's Law

OpenAIRE

Lu, Chien-Ping

2017-01-01

Based on Alan Turing's proposition on AI and computing machinery, which shaped Computing as we know it today, the new AI computing machinery should comprise a universal computer and a universal learning machine. The later should understand linear algebra natively to overcome the slowdown of Moore's law. In such a universal learnig machine, a computing unit does not need to keep the legacy of a universal computing core. The data can be distributed to the computing units, and the results can be...

AiGERM: A logic programming front end for GERM

Science.gov (United States)

Hashim, Safaa H.

1990-01-01

AiGerm (Artificially Intelligent Graphical Entity Relation Modeler) is a relational data base query and programming language front end for MCC (Mission Control Center)/STP's (Space Test Program) Germ (Graphical Entity Relational Modeling) system. It is intended as an add-on component of the Germ system to be used for navigating very large networks of information. It can also function as an expert system shell for prototyping knowledge-based systems. AiGerm provides an interface between the programming language and Germ.

Reactor operation environmental information document

Energy Technology Data Exchange (ETDEWEB)

Haselow, J.S.; Price, V.; Stephenson, D.E.; Bledsoe, H.W.; Looney, B.B.

1989-12-01

The Savannah River Site (SRS) produces nuclear materials, primarily plutonium and tritium, to meet the requirements of the Department of Defense. These products have been formed in nuclear reactors that were built during 1950--1955 at the SRS. K, L, and P reactors are three of five reactors that have been used in the past to produce the nuclear materials. All three of these reactors discontinued operation in 1988. Currently, intense efforts are being extended to prepare these three reactors for restart in a manner that protects human health and the environment. To document that restarting the reactors will have minimal impacts to human health and the environment, a three-volume Reactor Operations Environmental Impact Document has been prepared. The document focuses on the impacts of restarting the K, L, and P reactors on both the SRS and surrounding areas. This volume discusses the geology, seismology, and subsurface hydrology. 195 refs., 101 figs., 16 tabs.

A Review of Future and Ethical Perspectives of Robotics and AI

Directory of Open Access Journals (Sweden)

Jim Torresen

2018-01-01

Full Text Available In recent years, there has been increased attention on the possible impact of future robotics and AI systems. Prominent thinkers have publicly warned about the risk of a dystopian future when the complexity of these systems progresses further. These warnings stand in contrast to the current state-of-the-art of the robotics and AI technology. This article reviews work considering both the future potential of robotics and AI systems, and ethical considerations that need to be taken in order to avoid a dystopian future. References to recent initiatives to outline ethical guidelines for both the design of systems and how they should operate are included.

Functional subdivisions in low-frequency primary auditory cortex (AI).

Science.gov (United States)

Wallace, M N; Palmer, A R

2009-04-01

We wished to test the hypothesis that there are modules in low-frequency AI that can be identified by their responsiveness to communication calls or particular regions of space. Units were recorded in anaesthetised guinea pig AI and stimulated with conspecific vocalizations and a virtual motion stimulus (binaural beats) presented via a closed sound system. Recording tracks were mainly oriented orthogonally to the cortical surface. Some of these contained units that were all time-locked to the structure of the chutter call (14/22 tracks) and/or the purr call (12/22 tracks) and/or that had a preference for stimuli from a particular region of space (8/20 tracks with four contralateral, two ipsilateral and two midline), or where there was a strong asymmetry in the response to beats of different direction (two tracks). We conclude that about half of low-frequency AI is organized into modules that are consistent with separate "what" and "where" pathways.

Effect of increasing nitrobenzene loading rates on the performance of anaerobic migrating blanket reactor and sequential anaerobic migrating blanket reactor/completely stirred tank reactor system

International Nuclear Information System (INIS)

Kuscu, Ozlem Selcuk; Sponza, Delia Teresa

2009-01-01

A laboratory scale anaerobic migrating blanket reactor (AMBR) reactor was operated at nitrobenzene (NB) loading rates increasing from 3.33 to 66.67 g NB/m 3 day and at a constant hydraulic retention time (HRT) of 6 days to observe the effects of increasing NB concentrations on chemical oxygen demand (COD), NB removal efficiencies, bicarbonate alkalinity, volatile fatty acid (VFA) accumulation and methane gas percentage. Moreover, the effect of an aerobic completely stirred tank reactor (CSTR) reactor, following the anaerobic reactor, on treatment efficiencies was also investigated. Approximately 91-94% COD removal efficiencies were observed up to a NB loading rate of 30.00 g/m 3 day in the AMBR reactor. The COD removal efficiencies decreased from 91% to 85% at a NB loading rate of 66.67 g/m 3 day. NB removal efficiencies were approximately 100% at all NB loading rates. The maximum total gas, methane gas productions and methane percentage were found to be 4.1, 2.6 l/day and 59%, respectively, at a NB loading rate of 30.00 g/m 3 day. The optimum pH values were found to be between 7.2 and 8.4 for maximum methanogenesis. The total volatile fatty acid (TVFA) concentrations in the effluent were 110 and 70 mg/l in the first and second compartments at NB loading rates as high as 66.67 and 6.67 g/m 3 day, respectively, while they were measured as zero in the effluent of the AMBR reactor. In this study, from 180 mg/l NB 66 mg/l aniline was produced in the anaerobic reactor while aniline was completely removed and transformed to 2 mg/l of cathechol in the aerobic CSTR reactor. Overall COD removal efficiencies were found to be 95% and 99% for NB loading rates of 3.33 and 66.67 g/m 3 day in the sequential anaerobic AMBR/aerobic CSTR reactor system, respectively. The toxicity tests performed with Photobacterium phosphoreum (LCK 480, LUMIStox) and Daphnia magna showed that the toxicity decreased with anaerobic/aerobic sequential reactor system from the influent, anaerobic and to

An AI-based layout design system for nuclear power plants

International Nuclear Information System (INIS)

Fujita, Kikuo; Akagi, Shinsuke; Nakatogawa, Tetsundo; Tanaka, Kazuo; Takeuchi, Makoto.

1991-01-01

An AI-based layout design system for nuclear power plants has been developed. The design of the layout of nuclear power plants is a time-consuming task requiring expertise, in which a lot of machinery and equipment must be arranged in a plant building considering various kinds of design constraints, i.e. spatial, functional, economical etc. Computer aided layout design systems have been widely expected and the application of AI technology is expected as a promising approach for the synthesis phase of this task. In this paper, we present an approach to the layout design of nuclear power plants based on a constraint-directed search; one of the AI techniques. In addition, we show how it was implemented with an object-oriented programming technique and give an example of its application. (author)

Dissecting phenotypic variation among AIS patients

International Nuclear Information System (INIS)

Wang Minghua; Wang Jiucun; Zhang Zhen; Zhao Zhimin; Zhang Rongmei; Hu Xiaohua; Tan Tao; Luo Shijing; Luo Zewei

2005-01-01

We have created genital skin fibroblast cell lines directly from three patients in a Chinese family affected by androgen insensitivity syndrome (AIS). All patients in the family share an identical AR Arg 840 Cys mutant but show different disease phenotypes. By using the cell lines, we find that the mutation has not influenced a normal androgen-binding capacity at 37 deg C but has reduced the affinity for androgens and may cause thermolability of the androgen-receptor complex. The impaired nuclear trafficking of the androgen receptor in the cell lines is highly correlated with the severity of donors' disease phenotype. The transactivity of the mutant is substantially weakened and the extent of the reduced transactivity reflects severity of the donors' disease symptom. Our data reveal that although etiology of AIS is monogenic and the mutant may alter the major biological functions of its wild allele, the function of the mutant AR can also be influenced by the different genetic backgrounds and thus explains the divergent disease phenotypes

Seed-Specific Stable Expression of the α-AI1 Inhibitor in Coffee Grains and the In Vivo Implications for the Development of the Coffee Berry Borer.

Science.gov (United States)

Albuquerque, Érika V S; Bezerra, Caroline A; Romero, Juan V; Valencia, Jorge W A; Valencia-Jiménez, Arnubio; Pimenta, Lucas M; Barbosa, Aulus E A D; Silva, Maria C M; Meneguim, Ana M; Sá, Maria Eugênia L; Engler, Gilbert; de Almeida-Engler, Janice; Fernandez, Diana; Grossi-de-Sá, Maria F

Genetic transformation of coffee ( Coffea spp.), the second most traded commodity worldwide, is an alternative approach to introducing features that cannot be introgressed by traditional crossings. The transgenic stability, heritability and quantitative and spatial expression patterns of the seed-specific promoter phytohemagglutinin (PHA-L) from Phaseolus vulgaris were characterized in genetically modified C. arabica expressing the α-amylase inhibitor-1 ( α-AI1 ) gene. The α-AI1 inhibitor shows considerable activity toward digestive enzymes of the coffee berry borer (CBB) Hypothenemus hampei . This insect pest expends its life cycle almost entirely in coffee berries. Transgene containment in the fruit is important to meeting food and environmental safety requirements for releasing genetically modified (GM) crops. PCR analysis of T2 coffee plants showed a Mendelian single-copy segregation pattern. Ectopic transgene expression was only detected in coffee grains, as demonstrated by reverse transcription-PCR analysis of different plant tissues. An intense immunocytochemical signal associated with α-AI1 protein expression was localized to endospermic cells. In addition, a delay in the larval development of CBB was observed after challenging transgenic coffee seeds with the insect. These results indicate that the PHA-L promoter might be a useful tool in coffee for the seed-specific expression of genes related to coffee bean productivity, quality and pest protection. The biotechnological applicability of the α-AI1 gene for controlling CBB is also discussed. This work is the first report showing a seed-specific transgene expression in coffee plants.

Augmentation index (AI) in a dose–response relationship with smoking habits in males

Science.gov (United States)

Tsuru, Tomoko; Adachi, Hisashi; Enomoto, Mika; Fukami, Ako; Kumagai, Eita; Nakamura, Sachiko; Nohara, Yume; Kono, Shoko; Nakao, Erika; Sakaue, Akiko; Morikawa, Nagisa; Fukumoto, Yoshihiro

2016-01-01

Abstract We investigated the relationship between augmentation index (AI) and smoking habits in community-dwelling Japanese. This cross-sectional study enrolled 1926 subjects (769 males and 1157 females) aged 40 to 95 years who underwent a health check-up in a Japanese cohort of the Seven Countries Study, in Tanushimaru, a typical farming town in Kyushu Island in 2009. The subjects’ medical history, alcohol intake, smoking habit, and current medications for hypertension, dyslipidemia, and diabetes were ascertained by questionnaire. Radial arterial pressure wave analysis was used to obtain AI. We analyzed the data stratified by gender. Age-adjusted means of AI in males showed a clear dose–response relationship in 4 categories of smoking habits (P = 0.010). There was no significant relationship between AI and smoking habits in females (P = 0.127). The significant dose–response relationship (P = 0.036) in males between AI and 4 categories of smoking habits still remained even after adjustment for age, body mass index, systolic blood pressure, estimated glomerular filtration rate, glucose, hypertensive medication, and alcohol intake. The present study demonstrated that AI values were significantly associated with smoking habits in a dose-dependent manner in Japanese males. PMID:28002323

Correlation of the L-Arginine Pathway with Thrombo-Inflammation May Contribute to the Outcome of Acute Ischemic Stroke

DEFF Research Database (Denmark)

Molnar, Tihamer; Pusch, Gabriella; Nagy, Lajos

2016-01-01

BACKGROUND: Immune responses contribute to secondary injury after acute ischemic stroke (AIS), and metabolites of the L-arginine pathway are associated with stroke outcome. Here, we analyzed the relationship of the L-arginine pathway with thrombo-inflammatory biomarkers in AIS and their additive...... and independent associations to outcome. METHODS: Serial changes in P-selectin, tPA, MCP-1, sCD40L, IL-6, IL-8, L-arginine, and asymmetric and symmetric dimethylarginine (ADMA, SDMA) were investigated in 55 patients with AIS and without infection within 6 and 72 hours after stroke onset. Outcomes were assessed...... as National Institutes of Health Stroke Scale (NIHSS) worsening by 24 hours, poststroke infection, and death by 1 month. RESULTS: Serum levels of L-arginine showed negative correlation, whereas ADMA and SDMA showed positive correlation with thrombo-inflammatory biomarkers in the hyperacute phase. Most...

Development of core thermal-hydraulics module for intelligent reactor design system (IRDS)

International Nuclear Information System (INIS)

Kugo, Teruhiko; Nakagawa, Masayuki; Fujii, Sadao.

1994-08-01

We have developed an innovative reactor core thermal-hydraulics module where a designer can easily and efficiently evaluate his design concept of a new type reactor in the thermal-hydraulics field. The main purpose of this module is to decide a feasible range of basic design parameters of a reactor core in a conceptual design stage of a new type reactor. The module is to be implemented in Intelligent Reactor Design System (IRDS). The module has the following characteristics; 1) to deal with several reactor types, 2) four thermal hydraulics and fuel behavior analysis codes are installed to treat different type of reactors and design detail, 3) to follow flexibly modification of a reactor concept, 4) to provide analysis results in an understandable way so that a designer can easily evaluate feasibility of his concept, and so on. The module runs on an engineering workstation (EWS) and has a user-friendly man-machine interface on a pre- and post-processing. And it is equipped with a function to search a feasible range called as Design Window, for two design parameters by artificial intelligence (AI) technique and knowledge engineering. In this report, structure, guidance for users of an usage of the module and instruction of input data for analysis modules are presented. (author)

Cracks appear in the AI gravy train

Energy Technology Data Exchange (ETDEWEB)

Mill, J.

1983-10-01

This article highlights some of the problems facing the Alvey committee and outlines some reasons for believing that the optimistically founded Alvey and Esprit funding programmes are no guarantee Britain will win the AI race.

Lack of genomic evidence of AI-2 receptors suggests a non-quorum sensing role for luxS in most bacteria.

Science.gov (United States)

Rezzonico, Fabio; Duffy, Brion

2008-09-20

Great excitement accompanied discoveries over the last decade in several Gram-negative and Gram-positive bacteria of the LuxS protein, which catalyzes production of the AI-2 autoinducer molecule for a second quorum sensing system (QS-2). Since the luxS gene was found to be widespread among the most diverse bacterial taxa, it was hypothesized that AI-2 may constitute the basis of a universal microbial language, a kind of bacterial Esperanto. Many of the studies published in this field have drawn a direct correlation between the occurrence of the luxS gene in a given organism and the presence and functionality of a QS-2 therein. However, rarely hathe existence of potential AI-2 receptors been examined. This is important, since it is now well recognized that LuxS also holds a central role as a metabolic enzyme in the activated methyl cycle which is responsible for the generation of S-adenosyl-L-methionine, the major methyl donor in the cell. In order to assess whether the role of LuxS in these bacteria is indeed related to AI-2 mediated quorum sensing we analyzed genomic databases searching for established AI-2 receptors (i.e., LuxPQ-receptor of Vibrio harveyi and Lsr ABC-transporter of Salmonella typhimurium) and other presumed QS-related proteins and compared the outcome with published results about the role of QS-2 in these organisms. An unequivocal AI-2 related behavior was restricted primarily to organisms bearing known AI-2 receptor genes, while phenotypes of luxS mutant bacteria lacking these genes could often be explained simply by assuming deficiencies in sulfur metabolism. Genomic analysis shows that while LuxPQ is restricted to Vibrionales, the Lsr-receptor complex is mainly present in pathogenic bacteria associated with endotherms. This suggests that QS-2 may play an important role in interactions with animal hosts. In most other species, however, the role of LuxS appears to be limited to metabolism, although in a few cases the presence of yet unknown

Lack of genomic evidence of AI-2 receptors suggests a non-quorum sensing role for luxS in most bacteria

Directory of Open Access Journals (Sweden)

Duffy Brion

2008-09-01

Full Text Available Abstract Background Great excitement accompanied discoveries over the last decade in several Gram-negative and Gram-positive bacteria of the LuxS protein, which catalyzes production of the AI-2 autoinducer molecule for a second quorum sensing system (QS-2. Since the luxS gene was found to be widespread among the most diverse bacterial taxa, it was hypothesized that AI-2 may constitute the basis of a universal microbial language, a kind of bacterial Esperanto. Many of the studies published in this field have drawn a direct correlation between the occurrence of the luxS gene in a given organism and the presence and functionality of a QS-2 therein. However, rarely hathe existence of potential AI-2 receptors been examined. This is important, since it is now well recognized that LuxS also holds a central role as a metabolic enzyme in the activated methyl cycle which is responsible for the generation of S-adenosyl-L-methionine, the major methyl donor in the cell. Results In order to assess whether the role of LuxS in these bacteria is indeed related to AI-2 mediated quorum sensing we analyzed genomic databases searching for established AI-2 receptors (i.e., LuxPQ-receptor of Vibrio harveyi and Lsr ABC-transporter of Salmonella typhimurium and other presumed QS-related proteins and compared the outcome with published results about the role of QS-2 in these organisms. An unequivocal AI-2 related behavior was restricted primarily to organisms bearing known AI-2 receptor genes, while phenotypes of luxS mutant bacteria lacking these genes could often be explained simply by assuming deficiencies in sulfur metabolism. Conclusion Genomic analysis shows that while LuxPQ is restricted to Vibrionales, the Lsr-receptor complex is mainly present in pathogenic bacteria associated with endotherms. This suggests that QS-2 may play an important role in interactions with animal hosts. In most other species, however, the role of LuxS appears to be limited to metabolism

L'état de l'environnement industriel français est-il objectivement mesurable ?

OpenAIRE

Gotteland, David; Boulé, Jean-Marie

2004-01-01

Working paper serie RMT (WPS 04-07); the environmental state is a frequently modelized variable in marketing research. This paper proposes updated scales and panorama of the objective state of 58 industrial branches defined by INSEE based on three characteristic dimensions: dynamism, complexity and capacity.; l'état de l'environnement est une variable fréquemment modélisée dans la recherche en marketing. A partir de ce constat, cet article propose une échelle de mesure et un panorama actualis...

CATALisp - an expert system for real-time diagnosis of multiple-failure transients in pressurized water reactors

International Nuclear Information System (INIS)

Martin, R.P.; Nassersharif, B.

1988-01-01

The state of the art in artificial intelligence (AI) and expert system (ES) technology has matured to a degree that the potential development of a computer-aided/automated diagnostic and transient mitigation system in the area of nuclear reactor operation can be considered. Since traditional methods cannot handle complex systems efficiently, AI techniques provide a means to emulate an expert reactor operator rather than follow mechanistic methods. Computer-aided transient analysis coded in LISP (CATA-Lisp) is a confidence level based expert system written in Common LISP on the SYMBOLICS 3640 computer system. New versions are being developed in Common LISP for the Texas Instruments (TI) Explorer and the Sun microsystems machines, CATALisp manipulates both a knowledge base of transient identifier patterns (tree structured to allow for zooming in diagnostics) and a knowledge base containing a qualitative model of a nuclear power plant. The interference engine used by CATALisp uses the information stored in both knowledge bases to arrive at confidence level values that are used to infer particular plant states

À propos du lexique juridique en ancien français avant le 13e siècle : la Règle de saint Benoît et le Perceval de Chrétien de Troyes

Directory of Open Access Journals (Sweden)

Schauwecker Yela

2012-07-01

Full Text Available La plus ancienne traduction de la {em Règle} de saint Benoît en franc{c}ais, rédigée en dialecte picard-wallon, date de la première moitié ou du milieu du {sc xii}$^{m e}$~siècle. On veut montrer que son auteur, pour qui le changement de langue, n'est pas le premier objectif s'efforce de transférer le texte de son milieu originel de l'Antiquité tardive dans le monde chevaleresque-féodal du {sc xii}$^{m e}$~siècle. Même sans nécessité apparente, quand il a eu à sa disposition l'équivalent du mot employé dans la {em Regula}, il substitue aux mots latins des termes juridiques et féodaux franc{c}ais. par Son texte, en tant que document de droit pour les moines, devient ainsi une source de vocabulaire juridique franc{c}ais avant le {sc xiii}$^{m e}$~siècle, c'est-à-dire dans un temps où les documents juridiques en langue vulgaire sont extrêmement rares. Cela est dû au fait que la justice, dans le Nord, fondée sur des coutumes, utilisait la langue vernaculaire à l'oral. La terminologie juridique franc{c}aise est bien enracinée dans la langue courante de l'époque~: leur insertion dans les Lais et les Chansons de geste en fait preuve. Mais cette terminologie est souvent méconnue par la lexicographie traditionnelle de l'ancien franc{c}ais, en raison des contextes littéraires et figurés. par

A model of lipid-free apolipoprotein A-I revealed by iterative molecular dynamics simulation.

Directory of Open Access Journals (Sweden)

Xing Zhang

Full Text Available Apolipoprotein A-I (apo A-I, the major protein component of high-density lipoprotein, has been proven inversely correlated to cardiovascular risk in past decades. The lipid-free state of apo A-I is the initial stage which binds to lipids forming high-density lipoprotein. Molecular models of lipid-free apo A-I have been reported by methods like X-ray crystallography and chemical cross-linking/mass spectrometry (CCL/MS. Through structural analysis we found that those current models had limited consistency with other experimental results, such as those from hydrogen exchange with mass spectrometry. Through molecular dynamics simulations, we also found those models could not reach a stable equilibrium state. Therefore, by integrating various experimental results, we proposed a new structural model for lipid-free apo A-I, which contains a bundled four-helix N-terminal domain (1-192 that forms a variable hydrophobic groove and a mobile short hairpin C-terminal domain (193-243. This model exhibits an equilibrium state through molecular dynamics simulation and is consistent with most of the experimental results known from CCL/MS on lysine pairs, fluorescence resonance energy transfer and hydrogen exchange. This solution-state lipid-free apo A-I model may elucidate the possible conformational transitions of apo A-I binding with lipids in high-density lipoprotein formation.

Ship propulsion reactors technology

International Nuclear Information System (INIS)

Fribourg, Ch.

2002-01-01

This paper takes the state of the art on ship propulsion reactors technology. The french research programs with the corresponding technological stakes, the reactors specifications and advantages are detailed. (A.L.B.)

So Sorry––Never Sorry. Ai Weiwei’s Art between Tradition and Modernity

Directory of Open Access Journals (Sweden)

Tania Becker

2011-12-01

Full Text Available Ai Weiwei’s 艾未未 (b. 1957 artistic expression revolves around his use of traditional Chinese techniques to create new designs and forms, shaping traditional materials into contemporary configurations. In the face of obstruction from state officials and local politicians, Ai Weiwei exposes himself to considerable personal risk in order to continue his activities as an artist and stay loyal to his convictions. This paper examines the roots of Ai Weiwei’s work in Chinese art history and looks at how the artist has deliberately adapted traditional motifs to bring about a sense of alienation. Ai Weiwei’s unique stance between current trends in western art and the Chinese feeling for handicrafts is also explored.

Emerging trends in geospatial artificial intelligence (geoAI): potential applications for environmental epidemiology.

Science.gov (United States)

VoPham, Trang; Hart, Jaime E; Laden, Francine; Chiang, Yao-Yi

2018-04-17

Geospatial artificial intelligence (geoAI) is an emerging scientific discipline that combines innovations in spatial science, artificial intelligence methods in machine learning (e.g., deep learning), data mining, and high-performance computing to extract knowledge from spatial big data. In environmental epidemiology, exposure modeling is a commonly used approach to conduct exposure assessment to determine the distribution of exposures in study populations. geoAI technologies provide important advantages for exposure modeling in environmental epidemiology, including the ability to incorporate large amounts of big spatial and temporal data in a variety of formats; computational efficiency; flexibility in algorithms and workflows to accommodate relevant characteristics of spatial (environmental) processes including spatial nonstationarity; and scalability to model other environmental exposures across different geographic areas. The objectives of this commentary are to provide an overview of key concepts surrounding the evolving and interdisciplinary field of geoAI including spatial data science, machine learning, deep learning, and data mining; recent geoAI applications in research; and potential future directions for geoAI in environmental epidemiology.

A regulator's viewpoint on the use of AI in the nuclear industry

International Nuclear Information System (INIS)

Wainwright, N.

1995-01-01

The regulatory position within the UK places the responsibility for safety on a nuclear site with the licensee. The licensee must produce a safety case that demonstrates that the plant is safe. Assessment of this safety case is performed by the regulator in the Health and Safety Executive (HSE) using HSE's published Safety Assessment Principles. This paper presents the personal views of a regulator on the use of artificial intelligence (AI) in the nuclear industry. The AI-based system considered are restricted to expert systems, neural networks and fuzzy logic. Some of the safety issues are discussed. The particular concerns associated with software-based systems are compounded by some of the inherent problems of AI-based systems. Such is the nature of these concerns that an acceptable safety case will be difficult to mount for safety systems and post-accident monitoring systems. However, given the present maturity of the technology, acceptable safety cases might be formulated in the areas of operator advisory systems designed to reduce accident frequencies, and robotics where dose reduction is important. There are also arguments that suggests that suitable safety cases could be formulated for AI-based plant control systems. Nevertheless, AI-based systems should be treated with caution - further research is required into suitable designs and safety demonstration techniques. (author)

Characterization of an L-arabinose isomerase from Bacillus coagulans NL01 and its application for D-tagatose production.

Science.gov (United States)

Mei, Wending; Wang, Lu; Zang, Ying; Zheng, Zhaojuan; Ouyang, Jia

2016-06-30

L-arabinose isomerase (AI) is a crucial catalyst for the biotransformation of D-galactose to D-tagatose. In previous reports, AIs from thermophilic bacterial strains had been wildly researched, but the browning reaction and by-products formed at high temperatures restricted their applications. By contrast, AIs from mesophilic Bacillus strains have some different features including lower optimal temperatures and lower requirements of metallic cofactors. These characters will be beneficial to the development of a more energy-efficient and safer production process. However, the relevant data about the kinetics and reaction properties of Bacillus AIs in D-tagatose production are still insufficient. Thus, in order to support further applications of these AIs, a comprehensive characterization of a Bacillus AI is needed. The coding gene (1422 bp) of Bacillus coagulans NL01 AI (BCAI) was cloned and overexpressed in the Escherichia coli BL21 (DE3) strain. The enzymatic property test showed that the optimal temperature and pH of BCAI were 60 °C and 7.5 respectively. The raw purified BCAI originally showed high activity in absence of outsourcing metallic ions and its thermostability did not change in a low concentration (0.5 mM) of Mn(2+) at temperatures from 70 °C to 90 °C. Besides these, the catalytic efficiencies (k cat/K m) for L-arabinose and D-galactose were 8.7 mM(-1) min(-1) and 1.0 mM(-1) min(-1) respectively. Under optimal conditions, the recombinant E. coli cell containing BCAI could convert 150 g L(-1) and 250 g L(-1) D-galactose to D-tagatose with attractive conversion rates of 32 % (32 h) and 27 % (48 h). In this study, a novel AI from B. coagulans NL01was cloned, purified and characterized. Compared with other reported AIs, this AI could retain high proportions of activity at a broader range of temperatures and was less dependent on metallic cofactors such as Mn(2+). Its substrate specificity was understood deeply by carrying out molecular

Organisational intelligence and distributed AI

OpenAIRE

Kirn, Stefan

1995-01-01

The analysis of this chapter starts from organisational theory, and from this it draws conclusions for the design, and possible organisational applications, of Distributed AI systems. We first review how the concept of organisations has emerged from non-organised black-box entities to so-called computerised organisations. Within this context, organisational researchers have started to redesign their models of intelligent organisations with respect to the availability of advanced computing tec...

Development and application of AI technology to plant operation and support

International Nuclear Information System (INIS)

Sackett, J.I.; Mott, J.E.

1989-01-01

This paper discusses a framework for the development and application of artificial intelligence (AI) technology in existing nuclear facilities and reviews the status of development. We consider those areas best addressed by AI technology, e.g., equipment diagnostics, sensor validation, and expert systems for procedural response or planning. A brief discussion of work in computer displays is also given. (orig./GL)

Identification and characterization of a novel L-arabinose isomerase from Anoxybacillus flavithermus useful in D-tagatose production.

Science.gov (United States)

Li, Yanjun; Zhu, Yueming; Liu, Anjun; Sun, Yuanxia

2011-05-01

D-Tagatose is a highly functional rare ketohexose and many attempts have been made to convert D-galactose into the valuable D-tagatose using L-arabinose isomerase (L-AI). In this study, a thermophilic strain possessing L-AI gene was isolated from hot spring sludge and identified as Anoxybacillus flavithermus based on its physio-biochemical characterization and phylogenetic analysis of its 16s rRNA gene. Furthermore, the gene encoding L-AI from A. flavithermus (AFAI) was cloned and expressed at a high level in E. coli BL21(DE3). L-AI had a molecular weight of 55,876 Da, an optimum pH of 10.5 and temperature of 95°C. The results showed that the conversion equilibrium shifted to more D-tagatose from D-galactose by raising the reaction temperatures and adding borate. A 60% conversion of D-galactose to D-tagatose was observed at an isomerization temperature of 95°C with borate. The catalytic efficiency (k (cat) /K (m)) for D-galactose with borate was 9.47 mM(-1) min(-1), twice as much as that without borate. Our results indicate that AFAI is a novel hyperthermophilic and alkaliphilic isomerase with a higher catalytic efficiency for D-galactose, suggesting its great potential for producing D-tagatose.

AIS Algorithm for Smart Antenna Application in WLAN

Directory of Open Access Journals (Sweden)

Evizal Abdul Kadir

2015-07-01

Full Text Available Increasing numbers of wireless local area networks (WLAN replacing wired networks have an impact on wireless network systems, causing issues such as interference. The smart antenna system is a method to overcome interference issues in WLANs. This paper proposes an artificial immune system (AIS for a switch beam smart antenna system. A directional antenna is introduced to aim the beam at the desired user. The antenna consists of 8 directional antennas, each of which covers 45 degrees, thus creating an omnidirectional configuration of which the beams cover 360 degrees. To control the beam switching, an inexpensive PIC 16F877 microchip was used. An AIS algorithm was implemented in the microcontroller, which uses the received radio signal strength of the mobile device as reference. This is compared for each of the eight beams, after which the AIS algorithm selects the strongest signal received by the system and the microcontroller will then lock to the desired beam. In the experiment a frequency of 2.4 GHz (ISM band was used for transmitting and receiving. A test of the system was conducted in an outdoor environment. The results show that the switch beam smart antenna worked fine based on locating the mobile device.

The fusion reactor

International Nuclear Information System (INIS)

Brennan, M.H.

1974-01-01

Basic principles of the fusion reactor are outlined. Plasma heating and confinement schemes are described. These confinement systems include the linear Z pinch, magnetic mirrors and Tokamaks. A fusion reactor is described and a discussion is given of its environmental impact and its fuel situation. (R.L.)

It Takes Two to Tango: Towards Theory of AI's Mind

OpenAIRE

Chandrasekaran, Arjun; Yadav, Deshraj; Chattopadhyay, Prithvijit; Prabhu, Viraj; Parikh, Devi

2017-01-01

Theory of Mind is the ability to attribute mental states (beliefs, intents, knowledge, perspectives, etc.) to others and recognize that these mental states may differ from one's own. Theory of Mind is critical to effective communication and to teams demonstrating higher collective performance. To effectively leverage the progress in Artificial Intelligence (AI) to make our lives more productive, it is important for humans and AI to work well together in a team. Traditionally, there has been m...

Rapid and simple colorimetric method for the quantification of AI-2 produced from Salmonella Typhimurium.

Science.gov (United States)

Wattanavanitchakorn, Siriluck; Prakitchaiwattana, Cheunjit; Thamyongkit, Patchanita

2014-04-01

The aim of this study was to evaluate the feasibility of Fe(III) ion reduction for the simple and rapid quantification of autoinducer-2 (AI-2) produced from bacteria using Salmonella Typhimurium as a model. Since the molecular structure of AI-2 is somewhat similar to ascorbic acid it was expected that AI-2 would also act as a reducing agent and reduce Fe(III) ions in the presence of 1,10-phenanthroline to form the colored [(o-phen)3 Fe(II)]SO4 ferroin complex that could be quantified colorimetrically. In support of this, colony rinses and cell free supernatants from cultures of all tested AI-2 producing strains, but not the AI-2 negative Sinorhizobium meliloti, formed a colored complex with a λmax of 510nm. The OD510 values of these culture supernatants or colony rinses were in broad agreement with the % activity observed in the same samples using the standard Vibrio harveyi bioluminescence assay for AI-2 detection, and with previously reported results. This methodology could potentially be developed as an alternative method for the simple and rapid quantification of AI-2 levels produced in bacterial cultures. Copyright © 2014 Elsevier B.V. All rights reserved.

Increased SRP reactor power

International Nuclear Information System (INIS)

MacAfee, I.M.

1983-01-01

Major changes in the current reactor hydraulic systems could be made to achieve a total of about 1500 MW increase of reactor power for P, K, and C reactors. The changes would be to install new, larger heat exchangers in the reactor buildings to increase heat transfer area about 24%, to increase H 2 O flow about 30% per reactor, to increase D 2 O flow 15 to 18% per reactor, and increase reactor blanket gas pressure from 5 psig to 10 psig. The increased reactor power is possible because of reduced inlet temperature of reactor coolant, increased heat removal capacity, and increased operating pressure (larger margin from boiling). The 23% reactor power increase, after adjustment for increased off-line time for reactor reloading, will provide a 15% increase of production from P, K, and C reactors. Restart of L Reactor would increase SRP production 33%

Artificial Intelligence (AI), Operations Research (OR), and Decision Support Systems (DSS): A conceptual framework

Science.gov (United States)

Parnell, Gregory S.; Rowell, William F.; Valusek, John R.

1987-01-01

In recent years there has been increasing interest in applying the computer based problem solving techniques of Artificial Intelligence (AI), Operations Research (OR), and Decision Support Systems (DSS) to analyze extremely complex problems. A conceptual framework is developed for successfully integrating these three techniques. First, the fields of AI, OR, and DSS are defined and the relationships among the three fields are explored. Next, a comprehensive adaptive design methodology for AI and OR modeling within the context of a DSS is described. These observations are made: (1) the solution of extremely complex knowledge problems with ill-defined, changing requirements can benefit greatly from the use of the adaptive design process, (2) the field of DSS provides the focus on the decision making process essential for tailoring solutions to these complex problems, (3) the characteristics of AI, OR, and DSS tools appears to be converging rapidly, and (4) there is a growing need for an interdisciplinary AI/OR/DSS education.

Chemical elimination of alumina in suspension in nuclear reactors heavy water; Elimination de l'alumine en suspension dans l'eau lourde des reacteurs nucleaires par voie chimique

Energy Technology Data Exchange (ETDEWEB)

Ledoux, A [Commissariat a l' Energie Atomique, Saclay (France). Centre d' Etudes Nucleaires

1967-02-01

Corrosion of aluminium in contact with moderating water in nuclear reactor leads to the formation of an alumina hydrosol which can have an adverse effect on the operation of the reactor. Several physical methods have been used in an attempt to counteract this effect. The method proposed here consists in the elimination of the aluminium by dissolution and subsequent fixation in the ionic form on mixed-bed ion-exchange resin. In order to do this, the parameters and the values of these parameters most favorable to the dissolution process have been determined. If the moderator is heavy water, the deuterated acid can be prepared by converting a solution in heavy water to a salt of the acid using a deuterated cationic resin. (author) [French] La corrosion de l'aluminium au contact de l'eau moderatrice des reacteurs nucleaires, donne lieu a la formation d'un hydrosol d'alumine nuisible au bon fonctionnement des reacteurs. Plusieurs methodes physiques ont ete mises en oeuvre pour pallier ces inconvenients. On propose ici d'eliminer l'alumine par solubilisation pour la fixer ensuite sous forme ionique par des resines echangeuses d'ions, en lit melange. A cette fin on determine les parametres et leurs grandeurs favorables a cette solubilisation. Si le moderateur est de l'eau lourde la preparation d'acide deutere peut etre effectuee par passage d'une solution en eau lourde a un sel de l'acide sur resine cationique deuteree.

Louis Massignon l'amour mystique ou l'extase dans l'abandon

OpenAIRE

Jacques Keryell

2008-01-01

Parler de Massignon et de son Amour de Dieu n'est pas chose aisée. En effet, si les mystiques musulmans des premiers siècles de l'hégire ont été les hérauts de cet Amour : Al-Hallâj, Râbia al-Adawiyya, Al-Niffâri, Ibn Arabi, Ansâri, Al-Ghazâli, l'Amour de Dieu comme tel, n'est pas au cœur du "ilm al kalâm", de la théologie musulmane traditionnelle. Pour Massignon, langue et spiritualité étaient intimement liées. Si je devais me placer dans une perspective musulmane, je dirais que Louis Massig...

Damage analysis of TRIGA MARK II Bandung reactor tank material structure

International Nuclear Information System (INIS)

Soedardjo; Sumijanto

2000-01-01

Damage of Triga Mark II Bandung reactor tank material structure has been analyzed. The analysis carried out was based on ultrasonic inspection result in 1996 and the monthly reports of reactor operation by random data during 1988 up to 1995. Ultrasonic test data had shown that thinning processes on south and west region of reactor out side wall at upper part of water level had happened. Reactor operation data had shown the demineralized water should be added monthly to the reactor and bulk shielding water tank. Both reactor and bulk shielding tank are shielded by concrete of Portland type I cement consisting of CaO content about 58-68 %. The analysis result shows that the reaction between CaO and seepage water from bulk shielding wall had taken place and consequently the reactor out sidewall surroundings became alkaline. Based on Pourbaix diagram, the aluminum reactor tank made of aluminum alloy 6061 T6 would be corroded easily at pH equal an greater than 8.6. The passive layer AI 2 O 3 aluminum metal surface would be broken due to water reaction taken place continuously at high pH and produces hydrogen gas. The light hydrogen gas would expand the concrete cement and its expanding power would open the passive layer of aluminum metal upper tank. The water sea pages from adding water into reactor tank could indicate the upper water level tank corrosion is worse than the lower water level tank. (author)

Rétrospective de la diffusion du français en Espagne

Directory of Open Access Journals (Sweden)

Isabelle Cros

2014-12-01

Full Text Available Le français bénéficia longtemps en Espagne d’une vieille tradition francophile et de la forte implantation de l’Alliance française. Ainsi, il prédomina dans le système éducatif espagnol jusqu’au milieu du 20ème siècle sans intervention de l’État français pour en assurer la diffusion. Son déclin, amorcé sous Franco, nécessita toutefois la mise en place d’une politique linguistique et éducative compensatoire qui aboutit à un premier accord bilatéral favorisant surtout le développement de l’enseignement en français au sein du réseau de la Mission laïque mais qui eut peu d’effets à l’école espagnole où le français fut relégué au rang de deuxième langue étrangère. Cependant, suite à son adhésion à l’Europe, l’Espagne a recréé, en partenariat avec la France, une dynamique pour le français, notamment grâce aux sections bilingues qui connaissent un succès croissant. La langue française, considérée à présent davantage comme une langue utile, de communication et de travail, est enseignée suivant une méthodologie communicative plus adaptée aux réalités socio-économiques.

The L-arginine Pathway in Acute Ischemic Stroke and Severe Carotid Stenosis

DEFF Research Database (Denmark)

Molnar, Tihamer; Pusch, Gabriella; Papp, Viktoria

2014-01-01

BACKGROUND: Endothelial dysfunction is associated with increased levels of asymmetric dimethylarginine (ADMA) and symmetric dimethylarginine (SDMA) resulting in a decreased production of nitric oxide, which regulates the vascular tone. METHODS: Patients with acute ischemic stroke (AIS, n = 55......) and asymptomatic significant carotid stenosis (AsCS, n = 44) were prospectively investigated. L-arginine, ADMA, SDMA, S100 B, and high-sensitivity C-reactive protein (hsCRP) were serially measured within 6 hours after the onset of stroke, at 24 and 72 poststroke hours. All markers were compared with healthy...... subjects (n = 45). The severity of AIS was daily assessed by National Institute of Health Stroke Scale scoring. RESULTS: Even within 6 hours after the onset of stroke, L-arginine, ADMA, and SDMA were significantly higher in patients with AIS compared with both AsCS and healthy subjects. S100 B reflecting...

The deep learning AI playbook strategy for disruptive artificial intelligence

CERN Document Server

Perez, Carlos E

2017-01-01

Deep Learning Artificial Intelligence involves the interplay of Computer Science, Physics, Biology, Linguistics and Psychology. In addition to that, it is technology that can be extremely disruptive. The ramifications to society and even our own humanity will be profound. There are few subjects that are as captivating and as consequential as this. Surprisingly, there is very little that is written about this new technology in a more comprehensive and cohesive way. This book is an opinionated take on the developments of Deep Learning AI. One question many have will be "how to apply Deep Learning AI in a business context?" Technology that is disruptive does not automatically imply that its application to valuable use cases will be apparent. For years, many people could not figure out how to monetize the World Wide Web. We are in a similar situation with Deep Learning AI. The developments may be mind-boggling but its monetization is far from being obvious. This book presents a framework to address this shortcomi...

Analysis of raw AIS spectrum recordings from a LEO satellite

DEFF Research Database (Denmark)

Larsen, Jesper Abildgaard; Mortensen, Hans Peter

2014-01-01

The AAUSAT3 satellite is a 1U cubesat, which has been developed by students at Aalborg University, Denmark in collaboration with the Danish Maritime Authority. The satellite was launched in February 2013 on a mission to monitor ships from space using their AIS broadcast signals as an indication...... of position. The SDR receiver developed to listen for these AIS signals also allows for sampling and storing of the raw intermediate frequency spectrum, which has been used in order to map channel utilization over the areas of interest for the mission, which is mainly the arctic regions. The SDR based...... receiver used onboard the satellite is using a single chip front-end solution, which down converts the AIS signal located around 162 MHz into an intermediate frequency, with a up to 200 kHz bandwidth. This I/F signal is sampled with a 750 kSPS A/D converter and further processed by an Analog Devices DSP...

Explanation and trust: what to tell the user in security and AI?

NARCIS (Netherlands)

Pieters, Wolter

There is a common problem in artificial intelligence (AI) and information security. In AI, an expert system needs to be able to justify and explain a decision to the user. In information security, experts need to be able to explain to the public why a system is secure. In both cases, an important

9-cis-retinoic acid increases apolipoprotein AI secretion and mRNA expression in HepG2 cells.

Science.gov (United States)

Haghpassand, M; Moberly, J B

1995-10-01

HepG2 cells were studied as a model for regulation of hepatic apolipoprotein AI (apo AI) secretion and gene expression by 9-cis-retinoic acid. HepG2 cells cultured on plastic dishes were exposed to 9-cis-retinoic acid (9-cis-RA) for 48 h with a complete media change at 24 h. Apo AI mass in cultured media was determined by ELISA, by quantitative immunoblotting and by steady-state 35S-methionine labeling. Messenger RNA levels were determined by RNase protection using probes for apo AI and the housekeeping gene, glyceraldehyde 3-phosphate dehydrogenase (G3PDH). 9-cis-RA increased secretion of apo AI by 52% at doses of 10 and 1 microM (6.3 +/- 0.6 vs. 4.2 +/- 0.3; P G3PDH mRNA was slightly decreased (14%, P < 0.05). Thus, 9-cis-RA stimulates apo AI expression in HepG2 cells, suggesting a role for retinoids in activating endogenous apo AI gene expression.

Osiris reactor descriptive report

International Nuclear Information System (INIS)

1976-03-01

OSIRIS is a swimming pool reactor of 70 MW thermal power. Its main purpose is the irradiation of reactor materials in high neutron flux. A description is given of the air conditioning, ventilation, and radioactive gas removal system. (R.L.)

Explanation and trust: what to tell the user in security and AI?

NARCIS (Netherlands)

Pieters, Wolter

2010-01-01

There is a common problem in artificial intelligence (AI) and information security. In AI, an expert system needs to be able to justify and explain a decision to the user. In information security, experts need to be able to explain to the public why a system is secure. In both cases, the goal of

Artificial Intelligence (AI) Based Tactical Guidance for Fighter Aircraft

Science.gov (United States)

McManus, John W.; Goodrich, Kenneth H.

1990-01-01

A research program investigating the use of Artificial Intelligence (AI) techniques to aid in the development of a Tactical Decision Generator (TDG) for Within Visual Range (WVR) air combat engagements is discussed. The application of AI programming and problem solving methods in the development and implementation of the Computerized Logic For Air-to-Air Warfare Simulations (CLAWS), a second generation TDG, is presented. The Knowledge-Based Systems used by CLAWS to aid in the tactical decision-making process are outlined in detail, and the results of tests to evaluate the performance of CLAWS versus a baseline TDG developed in FORTRAN to run in real-time in the Langley Differential Maneuvering Simulator (DMS), are presented. To date, these test results have shown significant performance gains with respect to the TDG baseline in one-versus-one air combat engagements, and the AI-based TDG software has proven to be much easier to modify and maintain than the baseline FORTRAN TDG programs. Alternate computing environments and programming approaches, including the use of parallel algorithms and heterogeneous computer networks are discussed, and the design and performance of a prototype concurrent TDG system are presented.

78 FR 63494 - Meeting of the National Coordination Committee on the AI/AN SANE-SART Initiative

Science.gov (United States)

2013-10-24

... National Coordination Committee on the AI/AN SANE--SART Initiative AGENCY: Office for Victims of Crime.../ Alaska Native (AI/AN) Sexual Assault Nurse Examiner (SANE)--Sexual Assault Response Team (SART..., victim-centered responses to sexual violence within AI/AN communities. DATES: The meeting will be held...

Effects of red grape juice consumption on high density lipoprotein-cholesterol, apolipoprotein AI, apolipoprotein B and homocysteine in healthy human volunteers.

Science.gov (United States)

Khadem-Ansari, Mohammad H; Rasmi, Yousef; Ramezani, Fatemeh

2010-01-01

It has suggested that grape juice consumption has lipid- lowering effect and it is associated with a decreased risk of heart disease. We aimed to evaluate the effects of red grape juice (RGj) consumption on high density lipoprotein-cholesterol (HDL-C), apolipoprotein AI (apoAI), apolipoprotein B (apoB) and homocysteine (Hcy) levels in healthy human volunteers. Twenty six healthy and nonsmoking males, aged between 25-60 years, who were under no medication asked to consume 150 ml of RGj twice per day for one month. Serum HDL-C, apoAI, apoB and plasma Hcy levels were measured before and after one month RGj consumption. HDL-C levels after RGj consumption were significantly higher than the corresponding levels before the RGj consumption (41.44 ± 4.50 and 44.37 ± 4.30 mg/dl; P0.05). Hcy levels were decreased after RGj consumption (7.70 ± 2.80 and 6.20 ± 2.30 µmol/l; P<0.001). The present study demonstrates that RGj consumption can significantly increase serum HDL-C levels and decrease Hcy levels. These findings may have important implications for the prevention of atherosclerosis in healthy individuals.

The limnology of L Lake: Results of the L-Lake monitoring program, 1986--1989

Energy Technology Data Exchange (ETDEWEB)

Bowers, J.A.

1991-12-15

L Lake was constructed in 1985 on the upper regions of Steel Creek, SRS to mitigate the heated effluents from L Reactor. In addition to the NPDES permit specifications (Outfall L-007) for the L-Reactor outfall, DOE-SR executed an agreement with the South Carolina Department of Health and Environmental Control (SCDHEC), that thermal effluents from L-Reactor will not substantially alter ecosystem components in the approximate lower half of L Lake. This region should be inhabited by Balanced (Indigenous) Biological Communities (BBCs) in accordance with Section 316(a) of the Pollution Control (Clean Water) Act (Public Law 92-500). In response to this requirement the Environmental Sciences Section/Ecology Group initiated a comprehensive biomonitoring program which documented the development of BBCs in L Lake from January 1986 through December 1989. This report summarizes the principal results of the program with regards to BBC compliance issues and community succession in L Lake. The results are divided into six sections: water quality, macronutrients, and phytoplankton, aquatic macrophytes, zooplankton, benthic macroinvertebrates, fish, and community succession. One of the prime goals of the program was to detect potential reactor impacts on L Lake.

Structure et fonctionnement des écosystèmes du Haut-Rhône français.

Directory of Open Access Journals (Sweden)

KRAIEM M. M.

1980-07-01

Full Text Available L'examen qualitatif de contenus stomacaux de Barbeaux du Haut-Rhône français met en évidence un régime alimentaire assez varié, essentiellement zoophage, avec une composante permanente constituée, par ordre de dominance décroissante, de larves de Diptères, d'Ephéméroptères, de Trichoptères et de Nématodes. Ce régime parait, d'autre part, davantage lié à la taille, à l'âge du poisson et au faciès du cours d'eau, qu'à la composition de la faune benthique. Le Barbeau est planctonophage et microbenthophage pendant son jeune âge ; il devient essentiellement benthophage en vieillissant.

Research and materials irradiation reactors

International Nuclear Information System (INIS)

Ballagny, A.; Guigon, B.

2004-01-01

Devoted to the fundamental and applied research on materials irradiation, research reactors are nuclear installations where high neutrons flux are maintained. After a general presentation of the research reactors in the world and more specifically in France, this document presents the heavy water cooled reactors and the water cooled reactors. The third part explains the technical characteristics, thermal power, neutron flux, operating and details the Osiris, the RHF (high flux reactor), the Orphee and the Jules Horowitz reactors. The last part deals with the possible utilizations. (A.L.B.)

Adolescent idiopathic scoliosis (AIS, environment, exposome and epigenetics: a molecular perspective of postnatal normal spinal growth and the etiopathogenesis of AIS with consideration of a network approach and possible implications for medical therapy

Directory of Open Access Journals (Sweden)

Burwell R Geoffrey

2011-12-01

Full Text Available Abstract Genetic factors are believed to play an important role in the etiology of adolescent idiopathic scoliosis (AIS. Discordant findings for monozygotic (MZ twins with AIS show that environmental factors including different intrauterine environments are important in etiology, but what these environmental factors may be is unknown. Recent evidence for common chronic non-communicable diseases suggests epigenetic differences may underlie MZ twin discordance, and be the link between environmental factors and phenotypic differences. DNA methylation is one important epigenetic mechanism operating at the interface between genome and environment to regulate phenotypic plasticity with a complex regulation across the genome during the first decade of life. The word exposome refers to the totality of environmental exposures from conception onwards, comprising factors in external and internal environments. The word exposome is used here also in relation to physiologic and etiopathogenetic factors that affect normal spinal growth and may induce the deformity of AIS. In normal postnatal spinal growth we propose a new term and concept, physiologic growth-plate exposome for the normal processes particularly of the internal environments that may have epigenetic effects on growth plates of vertebrae. In AIS, we propose a new term and concept pathophysiologic scoliogenic exposome for the abnormal processes in molecular pathways particularly of the internal environment currently expressed as etiopathogenetic hypotheses; these are suggested to have deforming effects on the growth plates of vertebrae at cell, tissue, structure and/or organ levels that are considered to be epigenetic. New research is required for chromatin modifications including DNA methylation in AIS subjects and vertebral growth plates excised at surgery. In addition, consideration is needed for a possible network approach to etiopathogenesis by constructing AIS diseasomes. These approaches may

Methods in nuclear reactors calculations; Metodos de calculo en reactores nucleares

Energy Technology Data Exchange (ETDEWEB)

Velarde, G

1966-07-01

Studies are made of the neutron transport equation corresponding to the the real and virtual reactors, as well as the starting hypotheses. Methods are developed to solve the transport equation in slab geometry, and P{sub l}; B{sub l}; M{sub l}; S{sub n} and discrete ordinates approximations. (Author)

Activity of autoinducer two (AI-2) in bacteria isolated from surface ripened cheeses

DEFF Research Database (Denmark)

Gori, Klaus; Jespersen, Lene

2007-01-01

). Corynebacterium casei, Microbacterium barkeri, Microbacterium gubbeenense and S. equorum subsp. linens (all isolated from the smear of surface ripened cheeses) using the AI-2 bioluminescence assay. This indicates that AI-2 signaling could take place between bacteria found in the smear of surface ripened cheeses....

Dry eyes and AIs: If you don't ask you won't find out.

Science.gov (United States)

Inglis, Holly; Boyle, Frances M; Friedlander, Michael L; Watson, Stephanie L

2015-12-01

Our objective was to investigate the hypothesis that women on adjuvant aromatase inhibitors (AIs) for treatment of breast cancer have a higher prevalence of dry eye syndrome (DES) compared with controls. Exposure and control groups were recruited. A cross sectional questionnaire-based study was performed. Demographic data and medical histories were collected. The presence of dry eye syndrome was determined by the ocular surface disease index (OSDI). The Functional Assessment of Cancer Treatment - Endocrine Subscale (FACT-ES) was performed to investigate correlations with other side effects of AIs. 93 exposure group and 100 control group questionnaires were included. The groups were similar in all demographic variables. The prevalence of dry eye syndrome was 35% (exposure) and 18% (control) (p dry eyes. The OSDI score was negatively correlated with the total FACT-ES score and positively correlated with duration of treatment. Our study is the first to use a validated questionnaire to assess for DES in this population. DES is significantly more prevalent in women on AIs compared with controls. This is a newly emerging, and easily treated side effect of AIs. Self-reporting of dry eye symptoms underestimates the prevalence of DES with AIs. We recommend routine screening of patients on AIs with the OSDI with the aim of improving patient quality of life and possibly adherence. Copyright © 2015 Elsevier Ltd. All rights reserved.

A study on the applications of AI in finishing of additive manufacturing parts

Science.gov (United States)

Fathima Patham, K.

2017-06-01

Artificial intelligent and computer simulation are the technological powerful tools for solving complex problems in the manufacturing industries. Additive Manufacturing is one of the powerful manufacturing techniques that provide design flexibilities to the products. The products with complex shapes are directly manufactured without the need of any machining and tooling using Additive Manufacturing. However, the main drawback of the components produced using the Additive Manufacturing processes is the quality of the surfaces. This study aims to minimize the defects caused during Additive Manufacturing with the aid of Artificial Intelligence. The developed AI system has three layers, each layer is trying to eliminate or minimize the production errors. The first layer of the AI system optimizes the digitization of the 3D CAD model of the product and hence reduces the stair case errors. The second layer of the AI system optimizes the 3D printing machine parameters in order to eliminate the warping effect. The third layer of AI system helps to choose the surface finishing technique suitable for the printed component based on the Degree of Complexity of the product and the material. The efficiency of the developed AI system was examined on the functional parts such as gears.

Do adolescent idiopathic scoliosis (AIS neglect proprioceptive information in sensory integration of postural control?

Directory of Open Access Journals (Sweden)

Christine Assaiante

Full Text Available INTRODUCTION: It has been reported that AIS rely much more on ankle proprioception to control the amplitude of the balance control commands as compared to age-matched healthy adolescents. Our hypothesis was that AIS do not neglect proprioceptive information to control posture probably because of their vestibular deficits. We investigated the proprioceptive contribution to postural control in AIS which expresses spinal deformity during a crucial transitional period of ontogenesis. METHODS: 10 adolescents with idiopathic scoliosis (AIS with moderate spinal deformity (10° 35° and 10 control adolescents (CA had to maintain vertical stance while very slow oscillations in the frontal plane (below the detection threshold of the semicircular canal system were applied to the support with the eyes open and closed. Postural orientation and segmental stabilisation were analysed at head, shoulder, trunk and pelvis levels. RESULTS: Scoliosis did not affect vertical orientation control and segmental stabilization strategies. Vision improves postural control in both CA and AIS, which seem more dependent on visual cues than adults. CONCLUSIONS: AIS as CA were unable to control efficiently their postural orientation on the basis of the proprioceptive cues, the only sensory information available in the EC situation, whereas in the same condition healthy young adults present no difficulty to achieve the postural control. This suggests that AIS as CA transitory neglect proprioceptive information to control their posture. These results and previous studies suggest the existence of different afferent pathways for proprioceptive information subserving different parts in sensory integration of postural control. We conclude that the static proprioceptive system is not affected by the idiopathic scoliosis, while the dynamic proprioceptive system would be mainly affected.

The experimental and technological developments reactor

International Nuclear Information System (INIS)

Carbonnier, J.L.

2003-01-01

THis presentation concerns the REDT, gas coolant reactor for experimental and technological developments. The specifications and the research programs concerning this reactor are detailed;: materials, safety aspects, core physic, the corresponding fuel cycle, the reactor cycle and the program management. (A.L.B.)

Café crème méthode de français : niveau 1

CERN Document Server

Kaneman-Pougatch, Massia; Beacco di Giura, Marcella; Jennepin, Dominique

1997-01-01

Une méthode de français pour grands adolescents et adultes pour assurer un apprentissage complet, pratique, dynamique et efficace. 80 ? 100 heures de cours. 16 unité de 8 pages organisées en quatre parties, qui reprennent les quatre types de discours : 1 - Bonjour ! (l'informatif) 2 - A mon avis... (l'argumentatif) 3 - Dis pourquoi... (l'explicatif) 4 - Alors raconte... ( le narratif) Chaque unité comprend : - 3 pages "" Découvertes "" Activités de compréhension, exploitation et réemploi : la découverte de la langue par les activités. - 3 pages "" Boîte ? outils "" 1 page Vocabulaire et Phonétique et 2 pages Grammaire (tableaux, exercices systématiques d'acquisition et animation grammaticale) : la systématisation formelle. - 2 pages "" Paroles en liberté "" Dialogues avec une exploitation orale et écrite : l'élargissement et le réemploi. Toutes les 4 unités : un bilan-test de 2 pages et un supplément de civilisation (3 pages). En annexe : un précis grammatical et un lexique multilingue.

Optimizing Limousine Service with AI

OpenAIRE

Chun, Andy Hon Wai

2011-01-01

A common problem for companies with strong business growth is that it is hard to find enough experienced staff to support expansion needs. This problem is particular pronounced for operations planners and controllers who must be very highly knowledgeable and experienced with the business domain. This article is a case study of how one of the largest travel agencies in Hong Kong alleviated this problem by using AI to support decision-making and problem-solving so that their planners and contro...

En effeuillant la marguerite... exercices d'entraînement à la compréhension et à l'expression orales : cahier de l'élève

CERN Document Server

Fiusa, Dolores; Weiss, François

1978-01-01

Pour les adolescents ou adultes ayant fait plus d'un an de français. Des exercices d'un type nouveau destinés à améliorer la compréhension et l'expression orales et à développer la compétence de communication.

AI Reloaded: Objectives, Potentials, and Challenges of the Novel Field of Brain-Like Artificial Intelligence

Directory of Open Access Journals (Sweden)

Rosemarie Velik

2012-11-01

Full Text Available The general objective of Artificial Intelligence (AI is to make machines – particularly computers – do things that require intelligence when done by humans. In the last 60 years, AI has significantly progressed and today forms an important part of industry and technology. However, despite the many successes, fundamental questions concerning the creation of human-level intelligence in machines still remain open and will probably not be answerable when continuing on the current, mainly mathematic-algorithmically-guided path of AI. With the novel discipline of
Brain-Like Artificial Intelligence, one potential way out of this dilemma has been suggested. Brain-Like AI aims at analyzing and deciphering the working mechanisms of the brain and translating this knowledge into implementable AI architectures with the objective to develop in this way more efficient, flexible, and capable technical systems This article aims at giving a review about this young and still heterogeneous and dynamic research field.

Control of ZrH reactor reactivity perturbations during orbital maneuvers

International Nuclear Information System (INIS)

Audette, R.F.

1970-01-01

Scheduled and inadvertent vehicle maneuvers in manned and unmanned space missions may result in reactivity perturbations to the ZrH reactor due to fuel and control drum motion from acceleration forces. Potential power and outlet coolant temperature excursions could result in interruptions of PCS power generation, or excessive coolant temperatures if uncontrolled. This analysis compares potential uncontrolled reactor transients with allowable transients for uninterrupted electrical power generation from a Brayton system, and presents a control scheme to limit transient reactor outlet temperatures to 1250 0 F for a system designed to operate at a nominal 1200 0 F reactor outlet. Potential uncontrolled transients could result in a reactor outlet temperature swing of +-77 0 F about a nominal 1200 0 F and a reactor power swing of +92 Kwt and -67 Kwt about a nominal 130 Kwt for the Brayton System. (U.S.)

Constitution d’un Corpus de Français Langue Etrangère destiné aux Apprenants Allemands

Directory of Open Access Journals (Sweden)

Fauth Camille

2014-07-01

Nationale de la Recherche et Deutsche Forschungsgemeinschaft attribué à l’équipe Parole du LORIA UMR 7503, Nancy – France et à l’Equipe de Linguistique Computationnelle et de Phonétique FR 4.7 de l’Université de la Sarre Sarrebruck – Allemagne dans lequel le français et l’allemand sont des langues cibles. Pour la paire allemand-français, peu de corpus parallèles sont disponibles. Nous présentons ici l’élaboration d’un corpus de productions orales de locuteurs natifs et non natifs pour la paire allemand-français. Notre corpus entend mettre au jour les déviations phonétiques et phonologiques que les locuteurs allemands produisent lorsqu’ils apprennent le français. Ce travail s’insère dans un projet plus global, Ce projet entend étudier les difficultés que les locuteurs français rencontrent lorsqu’ils apprennent l’allemand, et réciproquement. Aussi, cinquante locuteurs allemands seront recrutés dans des milieux universitaires et scolaires (niveau lycée en Allemagne et cinquante locuteurs français dans les mêmes milieux en France. Il s’agit pour les deux populations de produire d’une part le corpus en langue étrangère (en langue française pour les locuteurs allemands et en langue allemande pour les locuteurs français mais également le corpus en langue maternelle (en allemand pour les allemands et en français pour les français. Les corpus ainsi obtenus devraient nous permettre d’identifier les difficultés que les locuteurs allemands ou français rencontrent lorsqu’ils apprennent le français ou l’allemand. Les données de contrôle sont doubles puisque l’on pourra à la fois se référer aux productions des apprenants dans leur langue maternelle (ici l’allemand, mais également à celles de locuteurs natifs (ici germanophones. Nous ne présenterons ici que la constitution du corpus en français.

The potential for expert system support in solving the pressurized water reactor fuel shuffling problem

International Nuclear Information System (INIS)

Rothleder, B.M.; Poetschat, G.R.; Faught, W.S.; Eich, V.J.

1988-01-01

The fuel shuffling problem is posed by the need to reposition partially burned assemblies to achieve minimum X-Y pin power peaks reload cycles of pressurized water reactors. This problem is a classic artificial intelligence (AI) problem and is highly suitable for AI expert system solution assistance, in contrast to the conventional solution, which ultimately depends solely on trial and error. Such a fuel shuffling assistant would significantly reduce engineering and computer execution time for conventional loading patterns and, much more importantly, even more significantly for low-leakage loading patterns. A successful hardware/software demonstrator has been introduced, paving the way for development of a broadly expert system program. Such a program, upon incorporating the recently developed technique perverse depletion, would provide a directed path for solving the low-leakage problem

Archiving AIS messages in a Geo-DBMS

NARCIS (Netherlands)

Meijers, B.M.; Quak, C.W.; van Oosterom, P.J.M.; Bregt, Arnold; Sarjakoski, Tapani; Lammeren, Ron van; Rip, Frans

2017-01-01

This paper reports on the result of two studies for using a geographical database management system for archiving Automated Identification System (AIS) message data. In this paper, we analyse the storage (using MongoDB and PostgreSQL) and we give a more in-depth description of a possible data model

Effect of increase in salinity on ANAMMOX-UASB reactor stability.

Science.gov (United States)

Xing, Hui; Wang, Han; Fang, Fang; Li, Kai; Liu, Lianwei; Chen, Youpeng; Guo, Jinsong

2017-05-01

The effect of salinity on the anaerobic ammonium oxidation (ANAMMOX) process in a UASB reactor was investigated by analysing ammonium, nitrite, nitrate and TN concentrations, and TN removal efficiency. Extracellular polymeric substances (EPSs) and specific ANAMMOX activity (SAA) were evaluated. Results showed the effluent deteriorated after salinity was increased from 8 to 13 g/L and from 13 to 18 g/L, and TN removal efficiency decreased from 80% to 30% and 80% to 50%, respectively. However, ANAMMOX performance recovered and TN removal efficiency increased to 80% after 40 days when the influent concentrations of [Formula: see text] and [Formula: see text] were 200 mg/L and salinity levels were at 13 and 18 g/L, respectively. The amount of EPSs decreased from 58.9 to 37.1 mg/g volatile suspended solids (VSS) when the reactor was shocked by salinity of 13 g/L, and then increased to 57.2 mg/g VSS when the reactor recovered and ran stably at 13 g/L. The amount of EPSs decreased from 57.2 to 49.1 mg/g VSS when the reactor was shocked by salinity of 18 g/L, and then increased to 60.7 mg/g VSS when the reactor recovered and ran stably at 18 g/L. The amount of EPS and the amounts of polysaccharide, protein and humus showed no evident difference when the reactor recovered from different levels of salinity shocks. Batch tests showed salinity shock load from 8 to 38 g/L inhibited the SAA. However, when the reactor recovered from salinity shocks, SAA was higher compared to that when the reactor was subjected to the same level of salinity shock.

Tensile and shear fracture behavior of fiber reinforced plastics at 77K irradiated by various radiation sources

International Nuclear Information System (INIS)

Humer, K.; Weber, H.W.; Tschegg, E.K.; Gerstenberg, H.

1993-08-01

Influence of radiation damage (gamma, electron, neutron) on mechanical properties of fiber reinforced plastics (FRPs) has been investigated. Different types of FRPs (two or three dimensional E-, S- or T-glass fiber reinforcement, epoxy or bismaleimide resin) have been irradiated at room temperature with 2 MeV electrons and 6O Co γ-rays up to 1.8 x 1 0 8 Gy as well as with different reactor spectra up to a fast neutron fluence of 5 x lO 22 m -2 (E > 0.1 MeV). Tensile and intralaminar shear tests were carried out on the irradiated samples at 77 K. Some samples were irradiated at 5 K and tested at 77 K with and without an annealing cycle to room temperature. Results on the influence of these radiation conditions and of warm-up cycles on the mechanical properties of FRPs are compared and discussed

Detection of possible AI-2-mediated quorum sensing system in commensal intestinal bacteria.

Science.gov (United States)

Lukás, F; Gorenc, G; Kopecný, J

2008-01-01

The Vibrio harveyi strain BB170-autoinducer bioassay was used to detect possible quorum sensing autoinducer-2 molecule (AI-2) in culture fluids of commensal intestinal bacteria. Culture fluids of Bacteroides vulgatus, Clostridium proteoclasticum, Escherichia coli, Eubacterium rectale, Lachnospira multipara, Pseudobutyrivibrio ruminis, Roseburia intestinalis, Ruminococcus albus and Ruminococcus flavefaciens contained AI-2-like molecules. The PCR bands from some of the tested strains could be also amplified using primers designed for the luxS gene. These findings suggest that AI-2 is present in the gastrointestinal tract; however, it has not yet been proved whether it is used for bacterial cell-to-cell communication.

[Screening of food-grade microorganisms for biotransformation of D-tagatose and cloning and expression of L-arabinose isomerase].

Science.gov (United States)

Men, Yan; Zhu, Yueming; Guan, Yuping; Zhang, Tongcun; Izumori, Ken; Sun, Yuanxia

2012-05-01

L-Arabinose isomerase (L-AI) is an intracellular enzyme that catalyzes the reversible isomerization of D-galactose and D-tagatose. Given the widespread use of D-tagatose in the food industry, food-grade microorganisms and the derivation of L-AI for the production of D-tagatose is gaining increased attention. In the current study, food-grade strains from different foods that can convert D-galactose to D-tagatose were screened. According to physiological, biochemical, and 16S rDNA gene analyses, the selected strain was found to share 99% identity with Pediococcus pentosaceus, and was named as Pediococcus pentosaceus PC-5. The araA gene encoding L-AI from Pediococcus pentosaceus PC-5 was cloned and overexpressed in E. coli BL21. The yield of D-tagatose using D-galactose as the substrate catalyzed by the crude enzyme in the presence of Mn2+ was found to be 33% at 40 degrees C.

Liste de vérification – L'arbre et l'humanité : la résilience face aux ...

International Development Research Centre (IDRC) Digital Library (Canada)

remplir le questionnaire sur l'admissibilité à la bourse et le formulaire de demande en ligne; téléverser les versions numérisées de tous les documents requis qui sont indiqués ci-dessous; tous les documents doivent être soumis en anglais ou an français, les deux langues officielles du Canada; soumettre au plus tard à la ...

No suspension of erection for the Grohnde reactor

International Nuclear Information System (INIS)

Anon.

1981-01-01

Two decisions of the Higher Administrative Court of Lueneburg are reported in the following. 1. In its decision of February 5, 1981 - VII OVG B 87/77 - the Higher Administrative Court of Hanover, handed down on June 2, 1977 dismissing the petition to restitute the suspensive effect of the action taken against the first partial building permit for the Grohnde reactor, to the effect that the suspensive effect is restituted 'as far as the permit covers the concept of the Grohnde reactor'. The decision was handed down to avoid providently that the permit appealed from has a binding effect before a judgement on the merits is given. 2. In its decision of February 5, 1981 - VII OVG B 88/77 - the Higher Administrative Court of Lueneburg dismissed an analogous appeal filed by the town of Hameln against a dismissal by the Administrative Court of Hanover of June 2, 1977 without limitations. (orig./HSCH) [de

Development of thermohydraulic software for PWR reactors with natural circulation

International Nuclear Information System (INIS)

Chasseur, Alfredo F.; Rauschert, A.; Delmastro, Dario F.

2009-01-01

The basics concepts about the development of software for steady state analysis of a reactor with natural circulations, in the primary circuit, are exposed. The reactor type is pressurized light water. The equations, correlations and flux diagrams of the source code of the software developed are shown. The source code of the software was written in FORTRAN 77 making use of modular technique, this save development effort and release of news versions is simplified. (author)

How AI localisation in plant tissues determines the targeted pest spectrum of different chemistries

DEFF Research Database (Denmark)

Buchholz, Anke; Trapp, Stefan

penetration as first crucial step can be modified by formulation whereas the active ingredient (AI) distribution within cells is usually solely determined by physicochemical properties. This passive AI distribution was calculated with the Fick-Nernst-Planck equation implemented in a cell model....... The predictions were compared to the measured biological effects against three different arthropods. Test compounds differed in log P (-0.1 to 4.3) and pKa (4.1 to 10.7). Efficacies in different bioassays are discussed with the postulated cellular AI localisation and the individual feeding behaviour...

AI mass spectrometers for space shuttle health monitoring

Science.gov (United States)

Adams, F. W.

1991-01-01

The facility Hazardous Gas Detection System (HGDS) at Kennedy Space Center (KSC) is a mass spectrometer based gas analyzer. Two instruments make up the HGDS, which is installed in a prime/backup arrangement, with the option of using both analyzers on the same sample line, or on two different lines simultaneously. It is used for monitoring the Shuttle during fuel loading, countdown, and drainback, if necessary. The use of complex instruments, operated over many shifts, has caused problems in tracking the status of the ground support equipment (GSE) and the vehicle. A requirement for overall system reliability has been a major force in the development of Shuttle GSE, and is the ultimate driver in the choice to pursue artificial intelligence (AI) techniques for Shuttle and Advanced Launch System (ALS) mass spectrometer systems. Shuttle applications of AI are detailed.

Anaerobic biogranulation in a hybrid reactor treating phenolic waste

International Nuclear Information System (INIS)

Ramakrishnan, Anushyaa; Gupta, S.K.

2006-01-01

Granulation was examined in four similar anaerobic hybrid reactors 15.5 L volume (with an effective volume of 13.5 L) during the treatment of synthetic coal wastewater at the mesophilic temperature of 27 ± 5 deg. C. The hybrid reactors are a combination of UASB unit at the lower part and an anaerobic filter at the upper end. Synthetic wastewater with an average chemical oxygen demand (COD) of 2240 mg/L, phenolics concentration of 752 mg/L and a mixture of volatile fatty acids was fed to three hybrid reactors. The fourth reactor, control system, was fed with a wastewater containing sodium acetate and mineral nutrients. Coal waste water contained phenol (490 mg/L); m-, o-, p-cresols (123.0, 58.6, 42 mg/L); 2,4-, 2,5-, 3,4- and 3,5-dimethyl phenols (6.3, 6.3, 4.4 and 21.3 mg/L) as major phenolic compounds. A mixture of anaerobic digester sludge and partially granulated sludge (3:1) were used as seed materials for the start up of the reactors. Granules were observed after 45 days of operation of the systems. The granules ranged from 0.4 to 1.2 mm in diameter with good settling characteristics with an SVI of 12 mL/g SS. After granulation, the hybrid reactor performed steadily with phenolics and COD removal efficiencies of 93% and 88%, respectively at volumetric loading rate of 2.24 g COD/L d and hydraulic retention time of 24 h. The removal efficiencies for phenol and m/p-cresols reached 92% and 93% (corresponding to 450.8 and 153 mg/L), while o-cresol was degraded to 88% (corresponding to 51.04 mg/L). Dimethyl phenols could be removed completely at all the organic loadings and did not contribute much to the residual organics. Biodegradation of o-cresol was obtained in the hybrid-UASB reactors

AIS as key component in modern vessel traffic management and information systems

Energy Technology Data Exchange (ETDEWEB)

Lamers, W. [DaimlerChrysler Aerospace AG (DASA), Ulm (Germany)

1999-07-01

The objective of this paper is to provide information in respect to universal shipborne identification system (UAIS) as main sensor in various vessel traffic applications. The presented paper will give general information concerning AIS functionality and the standardisation process. Based on experience from recent projects and various IALA working group activities, a typical future VTMIS architectures is also presented being based on AIS as key sensor. The required key performance of AIS associated with the HW components will be described. The results from European technology study Indris are presented and discussed. Finally, a summary and conclusion from the presented material will complete the technical paper. The elaboration of this presentation has been carried out as a joint task between Mr. Andre van Berg, MDS Suedafrika und Mr. Walter Lamers, DASA Ulm. (orig.)

Reactor operation safety information document

Energy Technology Data Exchange (ETDEWEB)

1990-01-01

The report contains a reactor facility description which includes K, P, and L reactor sites, structures, operating systems, engineered safety systems, support systems, and process and effluent monitoring systems; an accident analysis section which includes cooling system anomalies, radioactive materials releases, and anticipated transients without scram; a summary of onsite doses from design basis accidents; severe accident analysis (reactor core disruption); a description of operating contractor organization and emergency planning; and a summary of reactor safety evolution. (MB)

Treating domestic sewage by Integrated Inclined-Plate-Membrane bio-reactor

Science.gov (United States)

Song, Li Ming; Wang, Zi; Chen, Lei; Zhong, Min; Dong, Zhan Feng

2017-12-01

Membrane fouling shorten the service life of the membrane and increases aeration rate for membrane surface cleaning. Two membrane bio-reactors, one for working and another for comparing, were set up to evaluate the feasibility of alleviating membrane fouling and improving wastewater treatment efficiency by integrating inclined-plate precipitation and membrane separation. The result show that: (1) Inclined-plate in reactor had a good effect on pollutant removal of membrane bioreactor. The main role of inclined-plate is dividing reactor space and accelerating precipitation. (2) Working reactor have better performance in COD, TN and TP removal, which can attribute to that working reactor (integrated inclined-plate-Membrane bioreactor) takes both advantages of membrane separation and biological treatment. When influent COD, TP and TN concentration is 163-248 mg/L, 2.08-2.81 mg/L and 24.38-30.49 mg/L in working reactor, effluent concentration is 27-35 mg/L, 0.53-0.59 mg/L and 11.28-11.56 mg/L, respectively. (3) Membrane fouling was well alleviated in integrated inclined-plate-Membrane bioreactor, and membrane normal service time is significantly longer than that in comparing reactor, which can attribute to accelerating precipitation of inclined-plate. In summary, integrated inclined-plate-Membrane bioreactor is a promising technology to alleviating membrane fouling and improving wastewater treatment efficiency, having good performance and bright future in application.

Sewage treatment in integrated system of UASB reactor and duckweed pond and reuse for aquaculture.

Science.gov (United States)

Mohapatra, D P; Ghangrekar, M M; Mitra, A; Brar, S K

2012-06-01

The performance of a laboratory-scale upflow anaerobic sludge blanket (UASB) reactor and a duckweed pond containing Lemna gibba was investigated for suitability for treating effluent for use in aquaculture. While treating low-strength sewage having a chemical oxygen demand (COD) of typically less than 200 mg/L, with an increase in hydraulic retention time (HRT) from 10.04 to 33.49 h, COD removal efficiency of the UASB reactor decreased owing to a decrease in organic loading rate (OLR) causing poor mixing in the reactor. However, even at the lower OLR (0.475 kg COD/(m3 x d)), the UASB reactor gave a removal efficiency of 68% for COD and 74% for biochemical oxygen demand (BOD). The maximum COD, BOD, ammonia-nitrogen and phosphate removal efficiencies of the duckweed pond were 40.77%, 38.01%, 61.87% and 88.57%, respectively. Decreasing the OLR by increasing the HRT resulted in an increase in efficiency of the duckweed pond for removal of ammonia-nitrogen and phosphate. The OLR of 0.005 kg COD/(m2 x d) and HRT of 108 h in the duckweed pond satisfied aquaculture quality requirements. A specific growth rate of 0.23% was observed for tilapia fish fed with duckweed harvested from the duckweed pond. The economic analysis proved that it was beneficial to use the integrated system of a UASB reactor and a duckweed pond for treatment of sewage.

77 FR 8902 - Draft Regulatory Guide: Issuance, Availability Decommissioning of Nuclear Power Reactors

Science.gov (United States)

2012-02-15

... Decommissioning of Nuclear Power Reactors AGENCY: Nuclear Regulatory Commission. ACTION: Draft regulatory guide... draft regulatory guide (DG) DG-1271 ``Decommissioning of Nuclear Power Reactors.'' This guide describes... Regulatory Guide 1.184, ``Decommissioning of Nuclear Power Reactors,'' dated July 2000. This proposed...

Biological hydrogen production by Clostridium acetobutylicum in an unsaturated flow reactor.

Science.gov (United States)

Zhang, Husen; Bruns, Mary Ann; Logan, Bruce E

2006-02-01

A mesophilic unsaturated flow (trickle bed) reactor was designed and tested for H2 production via fermentation of glucose. The reactor consisted of a column packed with glass beads and inoculated with a pure culture (Clostridium acetobutylicum ATCC 824). A defined medium containing glucose was fed at a flow rate of 1.6 mL/min (0.096 L/h) into the capped reactor, producing a hydraulic retention time of 2.1 min. Gas-phase H2 concentrations were constant, averaging 74 +/- 3% for all conditions tested. H2 production rates increased from 89 to 220 mL/hL of reactor when influent glucose concentrations were varied from 1.0 to 10.5 g/L. Specific H2 production rate ranged from 680 to 1270 mL/g glucose per liter of reactor (total volume). The H2 yield was 15-27%, based on a theoretical limit by fermentation of 4 moles of H2 from 1 mole of glucose. The major fermentation by-products in the liquid effluent were acetate and butyrate. The reactor rapidly (within 60-72 h) became clogged with biomass, requiring manual cleaning of the system. In order to make long-term operation of the reactor feasible, biofilm accumulation in the reactor will need to be controlled through some process such as backwashing. These tests using an unsaturated flow reactor demonstrate the feasibility of the process to produce high H2 gas concentrations in a trickle-bed type of reactor. A likely application of this reactor technology could be H2 gas recovery from pre-treatment of high carbohydrate-containing wastewaters.

Test reactors in the world

International Nuclear Information System (INIS)

Corella, M.R.; Gomez Alonso, M.

1983-01-01

INFCE work on research reactor core conversion from HEU to LEU, attracted a raising interest on this type of nuclear reactors. In this context, the present work shows a compilation of worldwide research and test nuclear reactors, now in operation, under construction, or planned, as well as decommissioned reactors (tables A to F). Brief descriptions of these reactors are included in tables G to L. In table M a summary view of reactors with power level between 10 and 30 MWt is shown. Attention is focused on that power range, as it has been considered in very preliminar studies for a new research reactor. Almost all data have been obtained from current available bibliography. (author)

Augmentation index (AI) in a dose-response relationship with smoking habits in males: The Tanushimaru study.

Science.gov (United States)

Tsuru, Tomoko; Adachi, Hisashi; Enomoto, Mika; Fukami, Ako; Kumagai, Eita; Nakamura, Sachiko; Nohara, Yume; Kono, Shoko; Nakao, Erika; Sakaue, Akiko; Morikawa, Nagisa; Fukumoto, Yoshihiro

2016-12-01

We investigated the relationship between augmentation index (AI) and smoking habits in community-dwelling Japanese.This cross-sectional study enrolled 1926 subjects (769 males and 1157 females) aged 40 to 95 years who underwent a health check-up in a Japanese cohort of the Seven Countries Study, in Tanushimaru, a typical farming town in Kyushu Island in 2009. The subjects' medical history, alcohol intake, smoking habit, and current medications for hypertension, dyslipidemia, and diabetes were ascertained by questionnaire. Radial arterial pressure wave analysis was used to obtain AI. We analyzed the data stratified by gender.Age-adjusted means of AI in males showed a clear dose-response relationship in 4 categories of smoking habits (P = 0.010). There was no significant relationship between AI and smoking habits in females (P = 0.127). The significant dose-response relationship (P = 0.036) in males between AI and 4 categories of smoking habits still remained even after adjustment for age, body mass index, systolic blood pressure, estimated glomerular filtration rate, glucose, hypertensive medication, and alcohol intake.The present study demonstrated that AI values were significantly associated with smoking habits in a dose-dependent manner in Japanese males.

An artificial intelligence (AI) NOx/heat rate optimization system for Ontario Hydro`s fossil generating stations

Energy Technology Data Exchange (ETDEWEB)

Luk, J.; Frank, A.; Bodach, P. [Ontario Hydro, Toronto, ON (Canada); Warriner, G. [Radian International, Tucker, GA (United States); Noblett, J. [Radian International, Austin, TX (United States); Slatsky, M. [Southern Company, Birmingham, AL (United States)

1999-08-01

Artificial intelligence (AI)-based software packages which can optimize power plant operations that improves heat rate and also reduces nitrogen oxide emissions are now commonly available for commercial use. This paper discusses the implementation of the AI-based NOx and Heat Rate Optimization System at Ontario Hydro`s generation stations, emphasizing the current AI Optimization Project at Units 5 and 6 of the Lakeview Generating Station. These demonstration programs are showing promising results in NOx reduction and plant performance improvement. The availability of the plant Digital Control System (DCS) in implementing AI optimization in a closed-loop system was shown to be an important criterion for success. Implementation of AI technology at other Ontario Hydro fossil generating units as part of the overall NOx emission reduction system is envisaged to coincide with the retrofit of the original plant control system with the latest DCS systems. 14 refs., 3 figs.

Protection level of AI H5N1 vaccine clade 2.1.3 commercial against AI H5N1 clade 2.3.2 virus from Ducks to SPF chicken in laboratory conditions

Directory of Open Access Journals (Sweden)

Indriani R

2015-03-01

Full Text Available Highly Pathogenic Avian Influenza (HPAI subtype H5N1 clade 2.3.2 has infected chickens in farms, causing mortality and a decrease in egg production. Vaccination is one of the strategies to control disease of AI subtype H5N1. AI H5N1 clade 2.1.3 vaccine is available commercially. The effectiveness of two vaccines of AI H5N1 clade 2.1.3 (product A and B, and AI H5N1 clade 2.3.2 (Sukoharjo against AI H5N1 clade 2.3.2 (Sukoharjo virus SPF chickens was tested in laboratory. Four groups of SPF chickens were used in this study, there were (1 vaccinated with H5N1 clade 2.1.3 (product A, (2 vaccinated with H5N1 clade 2.1.3 (product B, (3 vaccinated with AI H5N1 clade 2.3.2 and (4 unvaccinated (as a control. Each vaccinated group consisted of 10 chicken except 8 chicken for control group. SPF chicken were vaccinated with 1 dose of vaccine at 3 weeks olds, and then after 3 weeks post vaccination (at 6 weeks olds. All group of chicken were challenged with 106 EID50 per 0.1 ml via intranasal. The results showed, chicken vaccinated with H5N1 clade 2.1.3 product A and B gave 100 and 80% protection respectively, but showed challenged virus shedding, whereas vaccine of H5N1 clade 2.3.2 gave 100% protection from mortality and without virus shedding. Vaccines of AI H5N1 clade 2.1.3 product A was better than vaccine product B, and when chicken vaccinated against H5N1 clade 2.3.2, H5N1 clade 2.3.2 vaccine was the best to be used. In order to protect chicken from AI subtype H5N1 clade 2.1.3 and 2.3.2 in the field, a bivalent vaccine of H5N1 clade 2.1.3 and 2.3.2 subtypes should be developed.

Os efeitos do método Ai Chi em pacientes portadoras da síndrome fibromiálgica The effect of Ai Chi method in fybromialgic patients

Directory of Open Access Journals (Sweden)

Jacqueline Soares de Santana

2010-06-01

Full Text Available O objetivo do estudo é demonstrar os efeitos do método Ai Chi como forma alternativa de abordagem hidroterapêutica em pacientes portadoras da síndrome fibromiálgica. Foram estudados dez pacientes; quatro fizeram parte do grupo experimento e cinco, do grupo controle, com uma desistência. As pacientes foram avaliadas através do Questionário de Impacto da Fibromialgia (QIF e da Escala de Intensidade e Índice de dor nos Pontos Sensíveis. Foram realizadas duas avaliações, uma antes e outra após o tratamento. As pacientes foram submetidas a dez sessões do método Ai Chi, com duração de quarenta minutos. Houve melhora na intensidade da dor, de acordo com a escala da intensidade de dor nos pontos sensíveis, após a intervenção; já a qualidade de vida manteve-se sem alteração. Na qualidade de vida, observou-se que os grupos obtiveram resultados semelhantes; isso se deve ao fato que as pacientes não apresentaram melhora no seu estado depressivo. No índice dos pontos sensíveis, verificou-se diferença entre os grupos. A explicação para essa diferença deve-se possivelmente aos benefícios da imersão em água aquecida e aos efeitos do método Ai Chi. Não houve diferença significativa entre os grupos, o que pode ser atribuído às limitações do estudo. Desta forma, torna-se relevante a realização de novos estudos referentes à aplicação do método Ai Chi em pacientes portadoras da síndrome fibromiálgica.The objective of this article is to show the effect of the Ai Chi method, as an alternative form of hydrotherapeutic approach in fibromyalgia syndrome patients. Ten patients were studied, four were part of the experiment group and five of the control group, with one desistance. The patients were evaluated through the Fibromyalgia Impact Questionnaire (QIF and Scale of Intensity and Index of pain in Sensible Points. Two evaluations were performed, before and after the treatment. The patients were submitted to ten sessions

Performance Study of Chromium (VI) Removal in Presence of Phenol in a Continuous Packed Bed Reactor by Escherichia coli Isolated from East Calcutta Wetlands

Science.gov (United States)

Chakraborty, Bhaswati; Indra, Suvendu; Hazra, Ditipriya; Betai, Rupal; Ray, Lalitagauri; Basu, Srabanti

2013-01-01

Organic pollutants, like phenol, along with heavy metals, like chromium, are present in various industrial effluents that pose serious health hazard to humans. The present study looked at removal of chromium (VI) in presence of phenol in a counter-current continuous packed bed reactor packed with E. coli cells immobilized on clay chips. The cells removed 85% of 500 mg/L of chromium (VI) from MS media containing glucose. Glucose was then replaced by 500 mg/L phenol. Temperature and pH of the MS media prior to addition of phenol were 30°C and 7, respectively. Hydraulic retention times of phenol- and chromium (VI)-containing synthetic media and air flow rates were varied to study the removal efficiency of the reactor system. Then temperature conditions of the reactor system were varied from 10°C to 50°C, the optimum being 30°C. The pH of the media was varied from pH 1 to pH 12, and the optimum pH was found to be 7. The maximum removal efficiency of 77.7% was achieved for synthetic media containing phenol and chromium (VI) in the continuous reactor system at optimized conditions, namely, hydraulic retention time at 4.44 hr, air flow rate at 2.5 lpm, temperature at 30°C, and pH at 7. PMID:24073400

Performance Study of Chromium (VI Removal in Presence of Phenol in a Continuous Packed Bed Reactor by Escherichia coli Isolated from East Calcutta Wetlands

Directory of Open Access Journals (Sweden)

Bhaswati Chakraborty

2013-01-01

Full Text Available Organic pollutants, like phenol, along with heavy metals, like chromium, are present in various industrial effluents that pose serious health hazard to humans. The present study looked at removal of chromium (VI in presence of phenol in a counter-current continuous packed bed reactor packed with E. coli cells immobilized on clay chips. The cells removed 85% of 500 mg/L of chromium (VI from MS media containing glucose. Glucose was then replaced by 500 mg/L phenol. Temperature and pH of the MS media prior to addition of phenol were 30°C and 7, respectively. Hydraulic retention times of phenol- and chromium (VI-containing synthetic media and air flow rates were varied to study the removal efficiency of the reactor system. Then temperature conditions of the reactor system were varied from 10°C to 50°C, the optimum being 30°C. The pH of the media was varied from pH 1 to pH 12, and the optimum pH was found to be 7. The maximum removal efficiency of 77.7% was achieved for synthetic media containing phenol and chromium (VI in the continuous reactor system at optimized conditions, namely, hydraulic retention time at 4.44 hr, air flow rate at 2.5 lpm, temperature at 30°C, and pH at 7.

A l'écoute des professionnels

CERN Document Server

Lebre-Peytard, Monique

1994-01-01

Cet ouvrage s'adresse aux étudiants de niveau moyen ou avancé en français. Il propose un travail d'écoute, de réflexion et d'expression autour d'interview authentiques. Des professionnels parlent de leur métier, des entreprises où ils travaillent, des fonctions qu'ils occupent... Ils appartiennent à divers secteurs de l'économie : banque, mode, tourisme, agriculture, télécommunications, etc.

Simulation of LOFT anticipated-transient experiments L6-1, L6-2, and L6-3 using TRAC-PF1/MOD1

International Nuclear Information System (INIS)

Sahota, M.S.

1984-01-01

Anticipated-transient experiments L6-1, L6-2, and L6-3, performed at the Loss-of-fluid Test (LOFT) facility, are analyzed using the latest released version of the Transient Reactor Analysis Code (TRAC-PF1/MOD1). The results are used to assess TRAC-PF1/MOD1 trip and control capabilities, and predictions of thermal-hydraulic phenomena during slow transients. Test L6-1 simulated a loss-of-stream load in a large pressurized-water reactor (PWR), and was initiated by closing the main steam-flow control valve (MSFCV) at its maximum rate, which reduced the heat removal from the secondary-coolant system and increased the primary-coolant system pressure that initiated a reactor scram. Test L6-2 simulated a loss-of-primary coolant flow in a large PWR, and was initiated by tripping the power to the primary-coolant pumps (PCPs) allowing the pumps to coast down. The reduced primary-coolant flow caused a reactor scram. Test L6-3 simulated an excessive-load increase incident in a large PWR, and was initiated by opening the MSFCV at its maximum rate, which increased the heat removal from the secondary-coolant system and decreased the primary-coolant system pressure that initiated a reactor scram. The TRAC calculations accurately predict most test events. The test data and the calculated results for most parameters of interest also agree well

Press kit. EPR (European pressurized water reactor). The advanced nuclear reactor

International Nuclear Information System (INIS)

2004-10-01

Nuclear energy, which provides a steady supply of electricity at low cost, has its rightful place in the energy mix of the 21 century, which puts the emphasis on sustainable development. In this framework, this document presents the advantages of the EPR (European Pressurized water Reactor). The EPR is the only third generation reactor under construction today. It is an evolutionary reactor that represents a new generation of pressurized water reactors with no break in the technology used for the most recent models. The EPR can guarantee a safe, inexpensive electricity supply, without adding to the greenhouse effect. It meets the requirements of the safety authorities and lives up to the expectations of electricity utilities. (A.L.B.)

Traditional Chinese Medicine Bionic Tiger Bone Powder for the Treatment of AI-Associated Musculoskeletal Symptoms

Directory of Open Access Journals (Sweden)

Yifan Li

2017-01-01

Full Text Available Background. Aromatase inhibitors (AIs are used for adjuvant therapy of breast cancer; however AIMSS (AI-Associated Musculoskeletal Symptoms can negatively affect quality of life and compliance. Most patients in China moved to TCM (traditional Chinese medicine for help. TB (tiger bone is used to treat bone disease, whose main ingredients are calcium and collagen. The objective of this study was to evaluate whether the TB prevented AIMSS in postmenopausal women with ER/PR+ breast cancer. Methods. We conducted a randomized, blind, controlled study of comparing TB versus placebo for 12 weeks in postmenopausal women with breast cancer who have taken AI for less than a month. Patients completed the M-BPI, VAS, and FACT-B at baseline, 6 weeks, and 12 weeks. M-BPI and VAS were used as the primary outcomes. FACT-B was used as the secondary outcome. Serum E2 and FSH were tested every 6 weeks. Results. Of 70 evaluable cases, 8 of 35 patients (22.9% developed new or worsening point symptoms in TB group, compared to 21 of 35 (60% in placebo group (P<0.001. We also found differences between 2 groups in average pain (2 to 5.6, worst pain (3.9 to 8, pain interference severity (1.9 to 5.3, stiffness (2.4 to 6.9, and joint symptom interference (1.8 to 5.7, all P<0.001; similar findings were seen in VAS value (3 to 6.6 at the end of intervention. HRQoL measured by FACT-B (P<0.05 was improved. No change of serum estradiol and FSH between two groups. Conclusions. TB appeared to be effective and safe in the prevention of AIMSS. This trial is registered with ChiCTR-IPR-15007081.

Operator Support System for Pressurized Water Reactor

International Nuclear Information System (INIS)

Wei Renjie; Shen Shifei

1996-01-01

Operator Support System for Pressurized Water Reactor (OSSPWR) has been developed under the sponsorship of IAEA from August 1994. The project is being carried out by the Department of Engineering Physics, Tsinghua University, Beijing, China. The Design concepts of the operator support functions have been established. The prototype systems of OSSPWR has been developed as well. The primary goal of the project is to create an advanced operator support system by applying new technologies such as artificial intelligence (AI) techniques, advanced communication technologies, etc. Recently, the advanced man-machine interface for nuclear power plant operators has been developed. It is connected to the modern computer systems and utilizes new high performance graphic displays. (author). 6 refs, 4 figs

Érasme, l'Europe et moi.

Directory of Open Access Journals (Sweden)

Jacques Lévy

2003-03-01

Full Text Available Ce film est fondé sur une double métaphore, poussée jusqu'à l'allégorie : la diversité de l'Europe comme expression de celle de l'individu, la construction européenne comme image de la construction de la personnalité. Passant un an à Barcelone dans le cadre d'échanges « Erasmus », un étudiant français découvre, en partageant un appartement avec des étudiants venus de plusieurs pays européens, l'importance de l'altérité dans la création ...

Louis Massignon l'amour mystique ou l'extase dans l'abandon

Directory of Open Access Journals (Sweden)

Jacques Keryell

2008-09-01

Full Text Available Parler de Massignon et de son Amour de Dieu n'est pas chose aisée. En effet, si les mystiques musulmans des premiers siècles de l'hégire ont été les hérauts de cet Amour : Al-Hallâj, Râbia al-Adawiyya, Al-Niffâri, Ibn Arabi, Ansâri, Al-Ghazâli, l'Amour de Dieu comme tel, n'est pas au cœur du "ilm al kalâm", de la théologie musulmane traditionnelle. Pour Massignon, langue et spiritualité étaient intimement liées. Si je devais me placer dans une perspective musulmane, je dirais que Louis Massignon se situe dans la ligne de la "wahdat al shuhûd", celle de "l'unicité du témoignage" ou Dieu se témoigne Lui-même en son mystère dans le cœur du soufi.

BanII dimorphic site located in the third intron of the human apolipoprotein AI (APOA1) gene

Energy Technology Data Exchange (ETDEWEB)

Coleman, R T; Kresnak, M T; Frossard, P M

1988-02-11

A 0.7kb fragment generated by AvaII digestion of pBL13AI, a 0.965kb full-length human apolipoprotein AI cDNA was cloned into the EcoRI site of pBR322. The apoAI cDNA was isolated from a lambdagt10 human fetal liver cDNA library. BanII (GPuGCPyC) (International Biotechnologies, Inc.) identifies two invariant bands at 1122bp and 417bp, and a single two-allele polymorphism with bands at either 274bp or 452bp. The human apolipoprotein AI-CIII-AIV gene complex has been localized on the long arm of chromosome 11 by Southern blot analysis of human-chinese hamster cell hybrids. Co-dominant segregation has been observed in two families (13 individuals). The BanII restriction map was constructed from DNA sequence data of the human apoAI gene. The 452bp fragment is generated by the loss of a BanII dimorphic site in the third intron of the apoAI gene, between the 178bp and the 274bp fragments.

PASTURE ffPROVEMENT POSSIBILTTIES IN EFFECTIVE AI{IMAL ...

African Journals Online (AJOL)

PASTURE ffPROVEMENT POSSIBILTTIES IN EFFECTIVE AI{IMAL PRODUCTION SYSTEMS. P. de V. Booysen. University of Natal, King George V Avenue, Durban. (Key words: .... inherent in biotic simplification is the danger of increased susceptibility of the abiotic component to degradation. So as the agriculturalist ...

The hidden dangers of experimenting in distributed AI

NARCIS (Netherlands)

Meyer, A.P.; Smit, A.; Kempen, M.; Wijngaards, N.

2006-01-01

Research on multi-agent systems often involves experiments, also in situations where humans interact with agents. Consequently, the field of experimental (human) sciences becomes more and more relevant. This paper clarifies how things can and often do go wrong in distributed AI experiments. We show

The 2010 Mario AI Championship: Level Generation Track

DEFF Research Database (Denmark)

Shaker, Noor; Togelius, Julian; Yannakakis, Georgios N.

2011-01-01

The Level Generation Competition, part of the IEEE CIS-sponsored 2010 Mario AI Championship, was to our knowledge the world’s first procedural content generation competition. Competitors participated by submitting level generators — software that generates new levels for a version of Super Mario...

Synthesized and characterization of AI and Gd substitute ferrite for microwave

International Nuclear Information System (INIS)

Sudjono, Hans K.; Muljadi; Soepriyanto, Syony

2000-01-01

Ferrite for microwave components has been synthesized from garnet ceramics (YIG)substituted by AI and Gd. Magnetic permeability and magnetic polarization changes according to the AI 3+ ion addition. XRD is performed to determined the sintering products at various temperatures. For some samples the magnetic property and performance in microwave region was tested. The testing is conducted in the form of completely assembled circulator which gives data on isolation, insertion loss when microwave circuit analyzer was employed. Due to high level of porosity insertion lost is still to large, improved process is necessary

AIS radiometry and the problem of contamination from mixed spectral orders

Science.gov (United States)

Conel, J. E.; Adams, S.; Alley, R. E.; Hoover, G.; Schultz, S.

1988-01-01

The spectral radiance of test areas under solar illumination is ascertained in view of Airborne Imaging Spectrometer (AIS) data from Mono Lake, CA, establishing an atmospheric correction method for major absorbers on the basis of the spectrometric data themselves. The apparent low contrast of all atmospheric absorption bands leads to a study of contamination from overlapping spectral orders in the AIS data; this contamination is found unambiguously above 1500 nm with a magnitude that is a factor of 1.5-2.0 greater than the expected uncontaminated signal alone.

Evaluation of the Steel Creek ecosystem in relation to the proposed restart of the L-reactor

International Nuclear Information System (INIS)

Smith, M.H.; Sharitz, R.R.; Gladden, J.B.

1982-10-01

This report summarizes the findings of slightly more than one year's study of the Steel Creek ecosystem. Generally, the findings have allowed us to refine our understanding of the structural and functional organization of the Steel Creek ecosystem which is an essential prerequisite for predicting the impacts associated with L-reactor restart. Reanalysis of the Steel Creek plant community relationships using 1981 aerial photography revealed that this component of the delta ecosystem continues to change as a result of natural successional processes. The major detectable changes have occurred on the more elevated portions of Steel Creek delta where coverage by woody species (especially willow) is continuing to increase. This successional woody community is invading areas previously dominated by persistent herbaceous species such as cut grass. Eleven vegetation associations were identified in the Steel Creek delta area, including two associations that were not apparently affected by the earlier reactor operations

Study on usage of low enriched uranium Russian type fuel elements for design of an experimental ADS research reactor

International Nuclear Information System (INIS)

Pesic, M.P.

2005-01-01

Conceptual design of an accelerator driven sub-critical experimental research reactor (ADSRR) was initiated in 1999 at the Vinca Institute of Nuclear Sciences, Serbia and Montenegro. Initial results of neutronic analyses of the proposed ADSRR-H were carried out by Monte Carlo based codes and available high-enriched uranium dioxide (HEU) dispersed Russian type TVR-S fuel elements (FE) placed in a lead matrix. Beam of charged particles (proton or deuteron) would be extracted from the high-energy channel H5B of the VINCY cyclotron of the TESLA Accelerator Installation. In 2002, the Vinca Institute has, in compliance with the Reduced Enrichment for Research and Test Reactors (RERTR) Program, returned fresh HEU TVR-S type FEs back to the Russian Federation. Since usage of HEU FEs in research reactors is not further recommended, a new study of an ADSRR-L conceptual design has initiated in Vinca Institute in last two years, based on assumed availability of low-enriched uranium (LEU) dispersed type TVR-S FEs. Initial results of numerical simulations of this new ADSRR-L, published for the first time in this paper, shows that such a small low neutron flux system can be used as an experimental - 'demonstration' - ADS with neutron characteristics similar to proposed well-known lead moderated and cooled power sub-critical ADS with intermediate neutron spectrum. Neutron spectrum characteristics of the ADSRR-L are compared to ones of the ADSRR-H with the same mass (7.7 g) of 235 U nuclide per TVR-S FE. (author)

Noise analysis role in reactor safety, Spectral analysis (PSD)

International Nuclear Information System (INIS)

Jovanovic, S.; Velickovic, Lj.

1967-11-01

Spectral power density of a zero power reactor is frequency dependent and related to transfer function of the reactor and to spectral density of the input disturbance. Measurement of spectral power density of a critical system is used to obtain the ratio (β/l), β is the effective yield of delayed neutrons, and l is the effective mean neutron lifetime. When reactor is subcritical, if the effective yie ald of delayed neutrons, the effective mean neutron lifetime are known, the shutdown margin can be determined by relation α = (1 - k (1- β0)/l, k is the effective multiplication factor. Output neutron spectrum at the RB reactor in Vinca was measured for a few reactor core configurations and for a few levels of heavy water at subcritical state. Measured values were satisfactory when the reactor was critical, but the reactor noise of subcritical system was covered by the white noise of the detector and electronic equipment. The Ra-Be source was under the reactor vessel when measurements of subcritical system were done. More efficient detector or external random stimulus for increasing the intensity of neutron fluctuations would be needed to obtain results for subcritical system

Application de principes cognitivistes et constructivistes à l'enseignement de l'écrit assisté par ordinateur : perceptions des étudiants

Directory of Open Access Journals (Sweden)

Catherine Caws

2005-09-01

Full Text Available Cet article traite des apports des théories cognitives et constructivistes à l'enseignement de l'écrit assisté par ordinateur, en milieu universitaire, chez des apprenants de français langue seconde. À partir des premiers résultats d'un projet pilote mené à l'université de Victoria, au Canada, l'auteure cherche à montrer comment, par le biais d'exercices collaboratifs en réseau Internet, l'application de certains principes-clés des recherches récentes en didactique du français langue seconde peuvent contribuer à un renouveau de l'engagement des étudiants, à une hausse notable de leur motivation et à une prise de conscience de leurs stratégies d'apprentissage. Une analyse des réactions des étudiants face à ce nouveau type d'apprentissage nous permet d'analyser, d'une part, les aspects de l'outil que les étudiants perçoivent comme étant utiles pour leur apprentissage et, d'autre part, les éléments qu'ils voudraient voir améliorer dans l'avenir. La prise de conscience même de ces stratégies nous montre à quel point l'apprenant s'engage activement dans la découverte de la L2, répondant ainsi inconsciemment à un des principes-clés de la psychologie cognitive.

Purification and Characterization of BmooAi: A New Toxin from Bothrops moojeni Snake Venom That Inhibits Platelet Aggregation

Directory of Open Access Journals (Sweden)

Mayara Ribeiro de Queiroz

2014-01-01

Full Text Available In this paper, we describe the purification/characterization of BmooAi, a new toxin from Bothrops moojeni that inhibits platelet aggregation. The purification of BmooAi was carried out through three chromatographic steps (ion-exchange on a DEAE-Sephacel column, molecular exclusion on a Sephadex G-75 column, and reverse-phase HPLC chromatography on a C2/C18 column. BmooAi was homogeneous by SDS-PAGE and shown to be a single-chain protein of 15,000 Da. BmooAi was analysed by MALDI-TOF Spectrometry and revealed two major components with molecular masses 7824.4 and 7409.2 as well as a trace of protein with a molecular mass of 15,237.4 Da. Sequencing of BmooAi by Edman degradation showed two amino acid sequences: IRDFDPLTNAPENTA and ETEEGAEEGTQ, which revealed no homology to any known toxin from snake venom. BmooAi showed a rather specific inhibitory effect on platelet aggregation induced by collagen, adenosine diphosphate, or epinephrine in human platelet-rich plasma in a dose-dependent manner, whereas it had little or no effect on platelet aggregation induced by ristocetin. The effect on platelet aggregation induced by BmooAi remained active even when heated to 100°C. BmooAi could be of medical interest as a new tool for the development of novel therapeutic agents for the prevention and treatment of thrombotic disorders.

On how AI & Law can help autonomous systems obey the law: a position paper

NARCIS (Netherlands)

Prakken, Hendrik

2016-01-01

In this position paper I discuss to what extent current and past AI & law research is relevant for research on autonomous intelligent systems that exhibit legally relevant behaviour. After a brief review of the history of AI & law, I will compare the problems faced by autonomous intelligent systems

Tensile and shear fracture behavior of fiber reinforced plastics at 77K irradiated by various radiation sources

Energy Technology Data Exchange (ETDEWEB)

Humer, K.; Weber, H.W. [Atominstitut der Oesterreichischen Hochschulen, Vienna (Austria); Tschegg, E.K. [Technische Univ., Vienna (Austria). Inst. fuer Angewandte und Technische Physik; Egusa, Shigenori [Japan Atomic Energy Research Inst., Takasaki, Gunma (Japan). Takasaki Radiation Chemistry Research Establishment; Birtcher, R.C. [Argonne National Lab., IL (United States); Gerstenberg, H. [Technische Univ. Muenchen, Garching (Germany). Fakultaet fuer Physik

1993-08-01

Influence of radiation damage (gamma, electron, neutron) on mechanical properties of fiber reinforced plastics (FRPs) has been investigated. Different types of FRPs (two or three dimensional E-, S- or T-glass fiber reinforcement, epoxy or bismaleimide resin) have been irradiated at room temperature with 2 MeV electrons and {sup 6O}Co {gamma}-rays up to 1.8 {times} 1 0{sup 8} Gy as well as with different reactor spectra up to a fast neutron fluence of 5 {times} lO{sup 22} m{sup {minus}2} (E > 0.1 MeV). Tensile and intralaminar shear tests were carried out on the irradiated samples at 77 K. Some samples were irradiated at 5 K and tested at 77 K with and without an annealing cycle to room temperature. Results on the influence of these radiation conditions and of warm-up cycles on the mechanical properties of FRPs are compared and discussed.

Degradation of Acid Orange 7 Dye in Two Hybrid Plasma Discharge Reactors

Science.gov (United States)

Shen, Yongjun; Lei, Lecheng; Zhang, Xingwang; Ding, Jiandong

2014-11-01

To get an optimized pulsed electrical plasma discharge reactor and to increase the energy utilization efficiency in the removal of pollutants, two hybrid plasma discharge reactors were designed and optimized. The reactors were compared via the discharge characteristics, energy transfer efficiency, the yields of the active species and the energy utilization in dye wastewater degradation. The results showed that under the same AC input power, the characteristics of the discharge waveform of the point-to-plate reactor were better. Under the same AC input power, the two reactors both had almost the same peak voltage of 22 kV. The peak current of the point-to-plate reactor was 146 A, while that of the wire-to-cylinder reactor was only 48.8 A. The peak powers of the point-to-plate reactor and the wire-to-cylinder reactor were 1.38 MW and 1.01 MW, respectively. The energy per pulse of the point-to-plate reactor was 0.2221 J, which was about 29.4% higher than that of the wire-to-cylinder reactor (0.1716 J). To remove 50% Acid Orange 7 (AO7), the energy utilizations of the point-to-plate reactor and the wire-to-cylinder reactor were 1.02 × 10-9 mol/L and 0.61 × 10-9 mol/L, respectively. In the point-to-plate reactor, the concentration of hydrogen peroxide in pure water was 3.6 mmol/L after 40 min of discharge, which was higher than that of the wire-to-cylinder reactor (2.5 mmol/L). The concentration of liquid phase ozone in the point-to-plate reactor (5.7 × 10-2 mmol/L) was about 26.7% higher than that in the wire-to-cylinder reactor (4.5 × 10-2 mmol/L). The analysis results of the variance showed that the type of reactor and reaction time had significant impacts on the yields of the hydrogen peroxide and ozone. The main degradation intermediates of AO7 identified by gas chromatography and mass spectrometry (GCMS) were acetic acid, maleic anhydride, p-benzoquinone, phenol, benzoic acid, phthalic anhydride, coumarin and 2-naphthol. Proposed degradation pathways were

Degradation of Acid Orange 7 Dye in Two Hybrid Plasma Discharge Reactors

International Nuclear Information System (INIS)

Shen Yongjun; Ding Jiandong; Lei Lecheng; Zhang Xingwang

2014-01-01

To get an optimized pulsed electrical plasma discharge reactor and to increase the energy utilization efficiency in the removal of pollutants, two hybrid plasma discharge reactors were designed and optimized. The reactors were compared via the discharge characteristics, energy transfer efficiency, the yields of the active species and the energy utilization in dye wastewater degradation. The results showed that under the same AC input power, the characteristics of the discharge waveform of the point-to-plate reactor were better. Under the same AC input power, the two reactors both had almost the same peak voltage of 22 kV. The peak current of the point-to-plate reactor was 146 A, while that of the wire-to-cylinder reactor was only 48.8 A. The peak powers of the point-to-plate reactor and the wire-to-cylinder reactor were 1.38 MW and 1.01 MW, respectively. The energy per pulse of the point-to-plate reactor was 0.2221 J, which was about 29.4% higher than that of the wire-to-cylinder reactor (0.1716 J). To remove 50% Acid Orange 7 (AO7), the energy utilizations of the point-to-plate reactor and the wire-to-cylinder reactor were 1.02 × 10 −9 mol/L and 0.61 × 10 −9 mol/L, respectively. In the point-to-plate reactor, the concentration of hydrogen peroxide in pure water was 3.6 mmol/L after 40 min of discharge, which was higher than that of the wire-to-cylinder reactor (2.5 mmol/L). The concentration of liquid phase ozone in the point-to-plate reactor (5.7 × 10 −2 mmol/L) was about 26.7% higher than that in the wire-to-cylinder reactor (4.5 × 10 −2 mmol/L). The analysis results of the variance showed that the type of reactor and reaction time had significant impacts on the yields of the hydrogen peroxide and ozone. The main degradation intermediates of AO7 identified by gas chromatography and mass spectrometry (GCMS) were acetic acid, maleic anhydride, p-benzoquinone, phenol, benzoic acid, phthalic anhydride, coumarin and 2-naphthol. Proposed degradation

An Empirical Study of AI Population Dynamics with Million-agent Reinforcement Learning

OpenAIRE

Yang, Yaodong; Yu, Lantao; Bai, Yiwei; Wang, Jun; Zhang, Weinan; Wen, Ying; Yu, Yong

2017-01-01

In this paper, we conduct an empirical study on discovering the ordered collective dynamics obtained by a population of artificial intelligence (AI) agents. Our intention is to put AI agents into a simulated natural context, and then to understand their induced dynamics at the population level. In particular, we aim to verify if the principles developed in the real world could also be used in understanding an artificially-created intelligent population. To achieve this, we simulate a large-sc...

The Core Conversion of the TRIGA Reactor Vienna

International Nuclear Information System (INIS)

Villa, M.; Bergmann, R.; Musilek, A.; Sterba, J.H.; Böck, H.; Messick, C.

2016-01-01

The TRIGA Reactor Vienna has operated for many years with a mixed core using Al-clad and stainless-steel (SST) clad low enriched uranium (LEU) fuel and a few SST high enriched uranium (HEU) fuel elements. In view of the US spent fuel return program, the average age of these fuel elements and the Austrian position not to store any spent nuclear fuel on its territory, negotiation started in April 2011 with the US Department of Energy (DOE) and the International Atomic Energy Agency (IAEA). The sensitive subject was to return the old TRIGA fuel and to find a solution for a possible continuation of reactor operation for the next decades. As the TRIGA Vienna is the closest nuclear facility to the IAEA headquarters, high interest existed at the IAEA to have an operating research reactor nearby, as historically close cooperation exists between the IAEA and the Atominstitut. Negotiation started before summer 2011 between the involved Austrian ministries, the IAEA and the US DOE leading to the following solution: Austria will return 91 spent fuel elements to the Idaho National Laboratory (INL) while INL offers 77 very low burnt SST clad LEU elements for further reactor operation of the TRIGA reactor Vienna. The titles of these 77 new fuel elements will be transferred to Euratom in accordance with Article 86 of the Euratom-US Treaty. The fuel exchange with the old core returned to the INL, and the new core transferred to Vienna was carried out in one shipment in late 2012 through the ports of Koper/Slovenia and Trieste/Italy. This paper describes the administrative, logistic and technical preparations of the fuel exchange being unique world-wide and first of its kind between Austria and the USA performed successfully in early November 2012. (author)

Sulfide toxicity kinetics of a uasb reactor

Directory of Open Access Journals (Sweden)

D. R. Paula Jr.

2009-12-01

Full Text Available The effect of sulfide toxicity on kinetic parameters of anaerobic organic matter removal in a UASB (up-flow anaerobic sludge blanket reactor is presented. Two lab-scale UASB reactors (10.5 L were operated continuously during 12 months. The reactors were fed with synthetic wastes prepared daily using glucose, ammonium acetate, methanol and nutrient solution. One of the reactors also received increasing concentrations of sodium sulfide. For both reactors, the flow rate of 16 L.d-1 was held constant throughout the experiment, corresponding to a hydraulic retention time of 15.6 hours. The classic model for non-competitive sulfide inhibition was applied to the experimental data for determining the overall kinetic parameter of specific substrate utilization (q and the sulfide inhibition coefficient (Ki. The application of the kinetic parameters determined allows prediction of methanogenesis inhibition and thus the adoption of operating parameters to minimize sulfide toxicity in UASB reactors.

Side Effects of Fungicides Used in Cucurbitaceous Crop on Trichogrammaatopovirilia Oatman & Platner (Hymenoptera: Trichogramatidae Efectos Secundarios sobre Trichogramma atopovirilia Oatman & Platner (Hymenoptera: Trichogramatidae de Fungicidas usados en Cucurbitáceas

Directory of Open Access Journals (Sweden)

Dirceu Pratissoli

2010-06-01

Full Text Available Trichogramma spp. (Hymenoptera: Trichogrammatidae can control Diaphania hyalinata Linnaeus (Lepidoptera: Pyralidae. On the other hand, pesticides may reduce the efficiency of natural enemies. The objective was to evaluate the side-effects of fungicides used in the production of cucurbitaceous crops on Trichogramma atopovirilia Oatman & Platner parasitizing D. hyalinata eggs. The fungicides used in bioassays were: azoxystrobin (0.08 g active ingredient [ai] L-1, chlorothalonil (2.00 g ai L-1, mancozeb (1.60 g ai L-1, tebuconazole (0.25 g ai L-1 and thiophanate-methyl (0.49 g ai L-1. Cardboards with 30 D. hyalinata eggs previously immersedin fungicide solutions and distilled water (control were offered separately to 20 newly emerged T. atopovirilia females in glass tubes. Parasitism, parasitism reduction, emergence, sex ratio, and number of individuals per egg were evaluated. The fungicides chlorothalonil, thiophanate-methyl and tebuconazole reduced parasitism of T. atopovirilia by 43.37, 27.64 and 18.51%, respectively. However, parasitism with azoxystrobin (79.21% was higher than the control (67.37% (P ≤ 0.05. Chlorothalonil, thiophanate-methyl and tebuconazole reduced emergence by 73.77, 75.62 and 79.35% (P ≤ 0.05, respectively. Azoxystrobin and thiophanate-methyl reduced the sex ratio by 0.77 and 0.76 (P ≤ 0.05, respectively. Fungicides did not reduce the number of individuals per egg. The fungicides azoxystrobin and mancozeb were selective for T. atopovirilia for most studied parameters suggesting that these products must have the priority in crop disease management to allow efficient biological control of T. atopovirilia against D. hyalinata.Trichogramma spp. (Hymenoptera: Trichogrammatidae pueden controlar Diaphania hyalinata Linnaeus (Lepidoptera: Pyralidae. Sin embargo, los plaguicidas pueden reducir la eficiencia de los enemigos naturales. El objetivo de este trabajo fue evaluar la influencia de los fungicidas utilizados en la

Evaluation of Packed-Bed Reactor and Continuous Stirred Tank Reactor for the Production of Colchicine Derivatives

OpenAIRE

Dubey, Kashyap Kumar; Kumar, Dhirendra; Kumar, Punit; Haque, Shafiul; Jawed, Arshad

2013-01-01

Bioconversion of colchicine into its pharmacologically active derivative 3-demethylated colchicine (3-DMC) mediated by P450BM3 enzyme is an economic and promising strategy for the production of this inexpensive and potent anticancer drug. Continuous stirred tank reactor (CSTR) and packed-bed reactor (PBR) of 3 L and 2 L total volumes were compared for the production of 3-demethylated colchicine (3-DMC) a colchicine derivative using Bacillus megaterium MTCC*420 under aerobic conditions. Statis...

Neutronics conceptual design of the innovative research reactor core using uranium molybdenum fuel

International Nuclear Information System (INIS)

Tukiran S; Surian Pinem; Tagor MS; Lily S; Jati Susilo

2012-01-01

The multipurpose of research reactor utilization make many countries build the new research reactor. Trend of this reactor for this moment is multipurpose reactor type with a compact core to get high neutron flux at the low or medium level of power. The research newest. Reactor in Indonesia right now is already 25 year old. Therefore, it is needed to design a new research reactor, called innovative research reactor (IRR) and then as an alternative to replace the old research reactor. The aim of this research is to get the optimal configuration of equilibrium core with the acceptance criteria are minimum thermal neutron flux is 2.5E14 n/cm 2 s at the power level of 20 MW (minimum), length of cycle of more than 40 days, and the most efficient of using fuel in the core. Neutronics design has been performed for new fuel of U-9Mo-AI with various fuel density and reflector. Design calculation has been performed using WIMSD-5B and BATAN-FUEL computer codes. The calculation result of the conceptual design shows four core configurations namely 5x5, 5x7, 6x5 and 6x6. The optimalization result for equilibrium core of innovative research reactor is the 5x5 configuration with 450 gU fuel loading, berilium reflector, maximum thermal neutron flux at reflector is 3.33E14 n/cm 2 sand length of cycle is 57 days is the most optimal of IRR. (author)

AI techniques in geomagnetic storm forecasting

Science.gov (United States)

Lundstedt, Henrik

This review deals with how geomagnetic storms can be predicted with the use of Artificial Intelligence (AI) techniques. Today many different Al techniques have been developed, such as symbolic systems (expert and fuzzy systems) and connectionism systems (neural networks). Even integrations of AI techniques exist, so called Intelligent Hybrid Systems (IHS). These systems are capable of learning the mathematical functions underlying the operation of non-linear dynamic systems and also to explain the knowledge they have learned. Very few such powerful systems exist at present. Two such examples are the Magnetospheric Specification Forecast Model of Rice University and the Lund Space Weather Model of Lund University. Various attempts to predict geomagnetic storms on long to short-term are reviewed in this article. Predictions of a month to days ahead most often use solar data as input. The first SOHO data are now available. Due to the high temporal and spatial resolution new solar physics have been revealed. These SOHO data might lead to a breakthrough in these predictions. Predictions hours ahead and shorter rely on real-time solar wind data. WIND gives us real-time data for only part of the day. However, with the launch of the ACE spacecraft in 1997, real-time data during 24 hours will be available. That might lead to the second breakthrough for predictions of geomagnetic storms.

Integration of AI-2 Based Cell-Cell Signaling with Metabolic Cues in Escherichia coli.

Directory of Open Access Journals (Sweden)

Arindam Mitra

Full Text Available The quorum sensing molecule Autoinducer-2 (AI-2 is generated as a byproduct of activated methyl cycle by the action of LuxS in Escherichia coli. AI-2 is synthesized, released and later internalized in a cell-density dependent manner. Here, by mutational analysis of the genes, uvrY and csrA, we describe a regulatory circuit of accumulation and uptake of AI-2. We constructed a single-copy chromosomal luxS-lacZ fusion in a luxS + merodiploid strain and evaluated its relative expression in uvrY and csrA mutants. At the entry of stationary phase, the expression of the fusion and AI-2 accumulation was positively regulated by uvrY and negatively regulated by csrA respectively. A deletion of csrA altered message stability of the luxS transcript and CsrA protein exhibited weak binding to 5' luxS regulatory region. DNA protein interaction and chromatin immunoprecipitation analysis confirmed direct interaction of UvrY with the luxS promoter. Additionally, reduced expression of the fusion in hfq deletion mutant suggested involvement of small RNA interactions in luxS regulation. In contrast, the expression of lsrA operon involved in AI-2 uptake, is negatively regulated by uvrY and positively by csrA in a cell-density dependent manner. The dual role of csrA in AI-2 synthesis and uptake suggested a regulatory crosstalk of cell signaling with carbon regulation in Escherichia coli. We found that the cAMP-CRP mediated catabolite repression of luxS expression was uvrY dependent. This study suggests that luxS expression is complex and regulated at the level of transcription and translation. The multifactorial regulation supports the notion that cell-cell communication requires interaction and integration of multiple metabolic signals.

Methods in nuclear reactors calculations

International Nuclear Information System (INIS)

Velarde, G.

1966-01-01

Studies are made of the neutron transport equation corresponding to the the real and virtual reactors, as well as the starting hypotheses. Methods are developed to solve the transport equation in slab geometry, and P l ; B l ; M l ; S n and discrete ordinates approximations. (Author)

Termitarium-inhabiting Bacillus endophyticus TSH42 and Bacillus cereus TSH77 colonizing Curcuma longa L.: isolation, characterization, and evaluation of their biocontrol and plant-growth-promoting activities.

Science.gov (United States)

Chauhan, Ankit Kumar; Maheshwari, Dinesh Kumar; Kim, Kangmin; Bajpai, Vivek K

2016-10-01

Bacillus strains were isolated from termitarium soil and screened for their antifungal activity through the production of diffusible and volatile metabolites. Further, the bacterial strains that showed antifungal activity were evaluated for their biocontrol potential on the basis of their plant-growth-promoting attributes. Termitarium-inhabiting Bacillus strains TSH42 and TSH77 significantly reduced the growth of pathogenic fungus Fusarium solani, controlled the symptoms of rhizome rot in turmeric (Curcuma longa L.), and demonstrated various plant-growth-promoting traits in different in vitro assays. On the basis of morphological, physiological, biochemical, and 16S rDNA characteristics, isolates TSH42 and TSH77 were identified as Bacillus endophyticus (KT379993) and Bacillus cereus (KT379994), respectively. Through liquid chromatography - mass spectrometry analysis, acidified cell-free culture filtrate (CFCF) of B. cereus TSH77 was shown to contain surfactin and fengycin, while CFCF of B. endophyticus TSH42 contained iturin in addition to surfactin and fengycin. Treatment of the turmeric (C. longa L.) plants with TSH42 and TSH77 significantly reduced the percentage incidence of rhizome rot disease caused by F. solani. The same treatment also increased the fresh rhizome biomass and plant growth in greenhouse conditions.

L’italiano L2 : auto-apprendimento e narratività. Materiali multimediali di italiano L2 per bambini e ragazzi.

Directory of Open Access Journals (Sweden)

Graziella Favaro

2009-12-01

Full Text Available Normal 0 14 /* Style Definitions */ table.MsoNormalTable {mso-style-name:"Tabella normale"; mso-tstyle-rowband-size:0; mso-tstyle-colband-size:0; mso-style-noshow:yes; mso-style-parent:""; mso-padding-alt:0cm 5.4pt 0cm 5.4pt; mso-para-margin:0cm; mso-para-margin-bottom:.0001pt; mso-pagination:widow-orphan; font-size:10.0pt; font-family:"Times New Roman";} Normal 0 14 /* Style Definitions */ table.MsoNormalTable {mso-style-name:"Tabella normale"; mso-tstyle-rowband-size:0; mso-tstyle-colband-size:0; mso-style-noshow:yes; mso-style-parent:""; mso-padding-alt:0cm 5.4pt 0cm 5.4pt; mso-para-margin:0cm; mso-para-margin-bottom:.0001pt; mso-pagination:widow-orphan; font-size:10.0pt; font-family:"Times New Roman";} Insegnare l'italiano come seconda lingua ai bambini e ragazzi di recente immigrazione è un percorso  delicato e complesso che  fa ormai parte  dei compiti professionali ";ordinari"; dei docenti che operano nelle classi sempre più multiculturali e plurilingui. La modalità di insegnamento/apprendimento della L2 più diffusa ed efficace è quella integrata: l'alunno non italofono è inserito nella classe comune e, parallelamente, in determinati momenti, frequenta il laboratorio  di italiano L2. Per  sostenere  questo modello integrato e accompagnare il  viaggio dentro l'italiano dei bambini e dei ragazzi neoarrivati, servono materiali didattici flessibili e ricchi di proposte, utilizzabili in maniera autonoma e in piccolo gruppo; proponibili in maniera tradizionale o anche attraverso la LIM; adatti a sviluppare competenze diverse, proprie della lingua per comunicare, dell'italiano scritto e propedeutiche all'apprendimento del curricolo comune. I due corsi di italiano L2  che vengono presentati nell'ultima parte dell'articolo rispondono a queste esigenze, in quanto a sono rivolti l'uno ai bambini e l'altro ai ragazzi stranieri neo arrivati; b si propongono  il passaggio dal livello prebasico ai livelli A1, A2 e B1 del QCERL; c si

Swapping the N- and C-terminal domains of human apolipoprotein E3 and AI reveals insights into their structure/activity relationship.

Directory of Open Access Journals (Sweden)

Mark T Lek

Full Text Available Apolipoprotein (apo E3 and apoAI are exchangeable apolipoproteins that play a dominant role in regulating plasma lipoprotein metabolism. ApoE3 (299 residues is composed of an N-terminal (NT domain bearing a 4-helix bundle and a C-terminal (CT domain bearing a series of amphipathic α-helices. ApoAI (243 residues also comprises a highly helical NT domain and a less structured CT tail. The objective of this study was to understand their structural and functional role by generating domain swapped chimeras: apoE3-NT/apoAI-CT and apoAI-NT/apoE-CT. The bacterially overexpressed chimeras were purified by affinity chromatography and their identity confirmed by immunoblotting and mass spectrometry. Their α-helical content was comparable to that of the parent proteins. ApoE3-NT/apoAI-CT retained the denaturation profile of apoE3 NT domain, with apoAI CT tail eliciting a relatively unstructured state; its lipid binding ability improved dramatically compared to apoE3 indicative of a significant role of apoAI CT tail in lipid binding interaction. The LDL receptor interaction and ability to promote ABCA1-mediated cholesterol efflux of apoE3-NT/apoAI-CT was comparable to that of apoE3. In contrast, apoAI-NT/apoE-CT elicited an unfolding pattern and lipid binding ability that were similar to that of apoAI. As expected, DMPC/apoAI-NT/apoE-CT discoidal particles did not elicit LDLr binding ability, and promoted SR-B1 mediated cellular uptake of lipids to a limited extent. However, apoAI-NT/apoE-CT displayed an enhanced ability to promote cholesterol efflux compared to apoAI, indicative of a significant role for apoE CT domain in mediating this function. Together, these results indicate that the functional attributes of apoAI and apoE3 can be conferred on each other and that NT-CT domain interactions significantly modulate their structure and function.

Cathepsin L in human meningiomas

International Nuclear Information System (INIS)

Trinkaus, M.; Lah, T.T.; Vranic, A.; Dolenc, V.V.

2003-01-01

Background. Although meningiomas are considered as benign tumours, about 10% comprise a subgroup of a typical meningiomas, classified as WHO grade II, with greater likelihood of recurrences and/or aggressive behaviour, including the possibility of brain tissue invasion. The lysosomal cysteine endopeptidase cathepsin L plays a role in tumour cell invasion and malignant progression of cancer, and has been suggested as a prognostic marker for certain types of tumours. Results. In our study, we compared the expression of cathepsin L in 30 meningiomas with their clinical invasiveness. Cathepsin L was determined by immunohistochemical analysis, quantitative real-time RT-PCR and Northern blot. We showed that expression of cathepsin L protein was significantly higher (p=0.019) in 9 atypical than in 21 benign meningiomas. Within the group of benign meningiomas, expression of cathepsin L was significantly lower in the transitional histological subtype. We measured the levels of cathepsin LA type of RNA splicing variants: LA, LAI and LAII, but not LAIII and not the LB variant, the latter being several times lower than the LA type. In contrast to protein levels, the levels of cathepsin LA, AI, AII RNA variants did not differ between histological subtypes or between benign and a typical meningiomas. The expression of total measured cathepsin LA, AI, AII RNA variants in the samples, taken from the centre and the periphery of the tumours, also showed no statistically significant differences. Conclusions. These results indicate that cathepsin L protein over-expression may contribute to the development of the aggressive and possibly invasive character of a typical meningiomas and that it may be up regulated at the translational level. (author)

Microstructural studies of suck cast (Zr-SS)-3 and 5 AI alloys for nuclear metallic waste form

International Nuclear Information System (INIS)

Kumar, P.; Das, N.; Sengupta, P.; Arya, A.; Dey, G.K.

2015-01-01

Management of radioactive metallic waste using 'alloy melting route' is currently being investigated. For disposal of Zr and SS base nuclear metallic wastes, Zr-stainless steel (SS) hybrid alloys are being considered as baseline alloys for developing metallic-waste-form (MWF) alloys. In this context Zr-16 wt. %55 has been selected for MWF alloy in our previous study. In present study, to include amorphous phase in this alloy, 3 and 5 wt. % Al has been added in order to improve desirable properties and useful features of MWF and the two alloys have been prepared by suck casting techniques. Microstructure of these alloys have been investigated by optical and electron microscopy which shows occurrence of two different phases, e.g. dark grey and white phases, in (Zr-16 SS)-3 Al and three different phases, e.g. grey, dark grey and white phases in (Zr-16 SS)-5 AI. Electron diffraction and X-ray diffraction (XRD) analyses of these two alloy specimens revealed the occurrence of Zr (Fe, Cr, AI) (dark grey) and Zr 2 (Fe, Cr, AI) (white) phases in (Zr-16 SS)-3 Al whereas, Zr (Fe, Cr, AI) (dark grey), Zr 2 (Fe, Cr, AI) (grey) and Zr 3 (Fe, Cr, AI) (white) phases were found in (Zr-16 SS)-5 AI. In addition, presence of amorphous phase was indicated by XRD analysis that could be confirmed by transmission electron microscopy of these two alloys. (author)

LE CINÉMA FRANÇAIS EN ROUMANIE DANS L’ENTRE-DEUX-GUERRES

Directory of Open Access Journals (Sweden)

Georgiana MEDREA

2013-05-01

Full Text Available Avant même d’aborder la nature des films français importés en Roumanie dans l’entre-deux-guerres, il convient de situer cette production cinématographique dans l’ensemble de celles présentes sur le marché roumain, ce que permettent documents et articles critiques contemporains. La diversité des mises en scène et des acteurs, la variété des sujets traités plaisent à un large public. La plus grande place que connaît le cinéma français en Roumanie dans les années trente est sans doute due,également, à la présence, dans le monde cinématographique français, d’artistes roumains qui manifestent un souci d’intégration dans une culture d’accueil qu’ils admirent. Les exemplesde coopérations franco-roumaines sont nombreuses, jusqu’à se manifester parfois sous la forme de coproductions

Decommissioning of Salaspils Research Reactor

International Nuclear Information System (INIS)

Abramenkovs, A.; Popelis, A.; Abramenkova, G

2008-01-01

The Salaspils Research Reactor (SRR) is out of operation since July 1998 and the decommissioning of SRR was started in 1999 according to the decision of the Government of Latvia. The main decommissioning activities up to 2006 were connected with collecting and conditioning of historical radioactive wastes from different storages outside and inside of reactor hall. The total amount of dismantled materials was about 700 tons, more than 77 tons were conditioned in concrete containers for disposal in repository. The radioactive wastes management technology is discussed in the paper. It was found, that additional efforts must be spent for immobilization of radionuclides in cemented matrix to be comply with the wastes acceptance criteria. The investigations of mechanical stability of water-cement matrix are described and discussed in the paper

L-Lake zooplankton: L-Lake/Steel Creek Biological Monitoring Program, November 1985--December 1991

Energy Technology Data Exchange (ETDEWEB)

Bowers, J.A. [Westinghouse Savannah River Co., Aiken, SC (United States); Bowen, M. [Normandeau Associates, Inc., New Ellenton, SC (United States)

1992-03-01

The L- Lake Biological Monitoring Program was designed to meet environmental regulatory requirements associated with the restart of L-Reactor and address portions of Section 316(a) of the Clean Water Act, which requires an applicant for a discharge permit to provide scientific evidence that the discharge causes no significant impact on the indigenous ecosystem. The Department of Energy (DOE) must demonstrate that the discharge of L-Reactor affluent into L Lake will not inhibit the eventual establishment of a ``Balanced Biological Community`` (BBC) in at least 50% of the lake. This report details results of monitoring zooplankton populations in L-Lake.

L-Lake zooplankton: L-Lake/Steel Creek Biological Monitoring Program, November 1985--December 1991

International Nuclear Information System (INIS)

Bowers, J.A.; Bowen, M.

1992-03-01

The L- Lake Biological Monitoring Program was designed to meet environmental regulatory requirements associated with the restart of L-Reactor and address portions of Section 316(a) of the Clean Water Act, which requires an applicant for a discharge permit to provide scientific evidence that the discharge causes no significant impact on the indigenous ecosystem. The Department of Energy (DOE) must demonstrate that the discharge of L-Reactor affluent into L Lake will not inhibit the eventual establishment of a ''Balanced Biological Community'' (BBC) in at least 50% of the lake. This report details results of monitoring zooplankton populations in L-Lake

Calculational prediction of fuel burn-up for the Dalat Nuclear Research Reactor

International Nuclear Information System (INIS)

Nguyen Phuoc Lan; Do Quang Binh

2016-01-01

In this paper, the method of expanding operators and functions in the neutron diffusion equations as chains of time variable is used for calculation of fuel burn-up of the Dalat nuclear reactors. A computer code, named BURREF, programmed in language Fortran-77 running on IBM PC-AT, has been developed based on this method to predict the fuel burn-up of the Dalat reactor. Some results will be presented here. (author)

Atom-type-based AI topological descriptors: application in structure-boiling point correlations of oxo organic compounds.

Science.gov (United States)

Ren, Biye

2003-01-01

Structure-boiling point relationships are studied for a series of oxo organic compounds by means of multiple linear regression (MLR) analysis. Excellent MLR models based on the recently introduced Xu index and the atom-type-based AI indices are obtained for the two subsets containing respectively 77 ethers and 107 carbonyl compounds and a combined set of 184 oxo compounds. The best models are tested using the leave-one-out cross-validation and an external test set, respectively. The MLR model produces a correlation coefficient of r = 0.9977 and a standard error of s = 3.99 degrees C for the training set of 184 compounds, and r(cv) = 0.9974 and s(cv) = 4.16 degrees C for the cross-validation set, and r(pred) = 0.9949 and s(pred) = 4.38 degrees C for the prediction set of 21 compounds. For the two subsets containing respectively 77 ethers and 107 carbonyl compounds, the quality of the models is further improved. The standard errors are reduced to 3.30 and 3.02 degrees C, respectively. Furthermore, the results obtained from this study indicate that the boiling points of the studied oxo compound dominantly depend on molecular size and also depend on individual atom types, especially oxygen heteroatoms in molecules due to strong polar interactions between molecules. These excellent structure-boiling point models not only provide profound insights into the role of structural features in a molecule but also illustrate the usefulness of these indices in QSPR/QSAR modeling of complex compounds.

Grammaire progressive du français corrigés : niveau intermédiaire : avec 680 exercices

CERN Document Server

Thiévenaz, Odile

2013-01-01

Les corrigés de la 3e édition de la Grammaire progressive du français - niveau intermédiaire Ce qui fait le succès de cette grammaire : Une organisation claire : la leçon de grammaire sur la page de gauche ; les exercices d'entraînement sur la page de droite ; 52 chapitres présentant les points généralement abordés aux niveaux A2 et B1 du Cadre européen commun de référence pour les langues ; Un apprentissage progressif : il suit la progression naturelle des méthodes de français ; Un usage souple : pour la classe ou en auto-apprentissage ; Une préparation adaptée aux certifications : un entraînement efficace pour mieux réussir aux examens ; Une large place faite à l'évaluation : de nombreux exercices de révision et des bilans réguliers. À découvrir dans cette troisième édition tout en couleurs (ISBN 978 209 038 124 5) : Un CD audio avec 14 documents sonores ; 80 nouveaux exercices et activités communicatives ; Des chapitres révisés et des exercices plus variés ; Un test d'�...

Best-practices guidelines for L2PSA development and applications. Volume 2 - Best practices for the Gen II PWR, Gen II BWR L2PSAs. Extension to Gen III reactors

International Nuclear Information System (INIS)

Raimond, E.; Durin, T.; Rahni, N.; Meignen, R.; Cranga, M.; Pichereau, F.; Bentaib, A.; Guigueno, Y.; Loeffler, H.; Mildenberger, O.; Lajtha, G.; Santamaria, C.S.; Dienstbier, J.; Rydl, A.; Holmberg, J.E.; Lindholm, I.; Maennistoe, I.; Pauli, E.M.; Dirksen, G.; Grindon, L.; Peers, K.; Hulqvist, G.; Parozzi, F.; Polidoro, F.; Cazzoli, E.; Vitazkova, J.; Burgazzi, L.; Oury, L.; Ngatchou, C.; Siltanen, S.; Niemela, I.; Routamo, T.; Helstroem, P.; Bassi, C.; Brinkman, H.; Seidel, A.; Schubert, B.; Wohlstein, R.; Guentay, S.; Vincon, L.

2010-01-01

The objective of this coordinated action was to develop best practice guidelines for the performance of Level 2 PSA methodologies with a view of harmonisation at EU level and to allow meaningful and practical uncertainty evaluations in a Level 2 PSA. Specific relationships with community in charge of nuclear reactor safety (utilities, safety authorities, vendors, and research or services companies) have been established in order to define the current needs in terms of guidelines for level 2 PSA development and applications. An international workshop was organised in Hamburg, with the support of VATTENFALL, in November 2008. The level 2 PSA experts from the ASAMPSA2 project partners have proposed some guidelines for the development and application of L2PSA based on their experience and on information available from international cooperation (EC Severe Accident network of Excellence - SARNET, IAEA standards, OECD-NEA publications and workshop) or open literature. The number of technical issues addressed in the guideline is very large and all are not covered with the same relevancy in the first version of the guideline. This version is submitted for external review in November 2010 by severe accident experts and PSA, especially, from SARNET and OECD-NEA members. The feedback of the external review will be dis cussed during an international open works hop planned in March 2011 and all outcomes will be taken into consideration in the final version of this guideline (June 2011). The guideline includes 3 volumes: - Volume 1 - General considerations on L2PSA. - Volume 2 - Technical recommendations for Gen II and III reactors. - Volume 3 - Specific considerations for future reactor (Gen IV). The recommendations formulated in the guideline should not be considered as 'mandatory' but should help the L2PSA developers to achieve high quality studies with limited time and resources. It may also help the L2PSA reviewers by positioning one specific study in comparison with some

The research reactors their contribution to the reactors physics; Les reacteurs de recherche leur apport sur la physique des reacteurs

Energy Technology Data Exchange (ETDEWEB)

Barral, J C [Electricite de France (EDF), 75 - Paris (France); Zaetta, A [CEA/Cadarache, Direction des Reacteurs Nucleaires, DRN, 13 - Saint-Paul-lez-Durance (France); Johner, J [CEA/Cadarache, Dept. de Recherches sur la Fusion Controlee (DRFC), 13 - Saint Paul lez Durance (France); Mathoniere, G [CEA/Saclay, DEN, 91 - Gif sur Yvette (France); and others

2000-07-01

The 19 october 2000, the french society of nuclear energy organized a day on the research reactors. This associated report of the technical session, reactors physics, is presented in two parts. The first part deals with the annual meeting and groups general papers on the pressurized water reactors, the fast neutrons reactors and the fusion reactors industry. The second part presents more technical papers about the research programs, critical models, irradiation reactors (OSIRIS and Jules Horowitz) and computing tools. (A.L.B.)

The experience of the fuel waste management of AM and BR-10 reactor facilities at SSC RF IPPE named after A.I. Leipunsky

International Nuclear Information System (INIS)

Kochetkov, L.A.; Mamaev, L.I.; Stuzhnev, Yu.A.

1999-01-01

8 research and experimental reactors have been created at the Institute industrial site. The majority of them have been or are being decommissioned now. During many decades the reactor of the first-in-the-world NPP -AM and the fast neutron reactor BR-5 (BR-10) are the main research reactor bases of the Institute. They have been in operation for 45 and 40 years respectively. At present the preparation work for their decommissioning is being carried out. One of the problems of that process is the fuel waste management which amount is about 13 tons. The possibility of its reprocessing is under consideration. (author)

Ship Emission Inventories in Estuary of the Yangtze River Using Terrestrial AIS Data

Directory of Open Access Journals (Sweden)

Xin Yao

2016-12-01

Full Text Available Estuary forms a transition zone between inland river and open sea. In China, the estuary of the Yangtze River plays a vital role in connecting the inland and oversea shipping, and witnesses heavy vessel traffic in the recent decades. Nowadays, more attentions have been directed to the issue of ship pollution in busy waterways. In order to investigate the ship emission inventory, this paper presents an Automatic Identification System(AIS based method. AIS data is the realistic data of vessel traffic including dynamic information (position, speed, course, etc. and static information (ship type, dimensions, name, etc.. According to ship dimensions, the power of engines is estimated for different ship types. By using AIS based bottom-up approach, ship emission inventories and shares of air pollutants and GHGs (Greenhouse gases are developed. Spatial distribution of ship emissions is illustrated in the form of heat map. As a case study, the emission inventories are analyzed using AIS data of 2010 in the estuary, and following results are made:(1 shares of the emission are cruise ships 6.59%, bulk carriers 5.16%, container ships 52.96%, tankers 15.16%, fishing ships 9.16%, other ships 10.97%; (2 CO2 is the dominant part of the emission. (3 Areas of highest emission intensity are generally clustered around the South Channel, the North Channel and ports in the vicinity. The proposed method is promising because it is derived from the AIS data which contains not only real data of individual ship but also vessel traffic situation in the study area. It can server as a reference for other researchers and policy makers working in this field.

Fragments of a Forgotten Aiōn. An Outline of a Gnostic Myth

Directory of Open Access Journals (Sweden)

Ezio Albrile

2005-07-01

Full Text Available Gnostics regard the cosmos as the result of an «error» or of a hybris begotten in the transcendent world. Reality is perceived as a great dream intentionally moulded by the Demiurge in order to forget the Light concealed in the creations. By consequence, the power of the Demiurge consists precisely in being the creator and keeper of a level of existence limited in space and time. Gnostic imagination plastically depicts the homicide and ignorant Demiurge with the features of an abnormous creature with the head of a lion and wings, enveloped in the coils of a snake. Thus, Gnostics reinterpreted a key figure in the syncretic pantheon of late Hellenism, i. e. Aiōn, the god of endless eternity, the Saeculum, the Iranic  Zurwān, the Jewish ‘Olām. This means that Aiōn involved contacts with two different visions: the Aiōnes are the creations that populate the gnostic plērōma, immortal and eternal entities, and outside the plērōma the demiurgic Aiōn arises as the result of a divine «fault», a monstrous being whose somatic features can be found in the Orphic and Mithriac iconography.

Exploring AI Language Assistants with Primary EFL Students

Science.gov (United States)

Underwood, Joshua

2017-01-01

The main objective of this study was to identify ways to incorporate voice-driven Artificial Intelligence (AI) effectively in classroom language learning. This nine month teacher-led design research study employed technology probes (Amazon's Alexa, Apple's Siri, Google voice search) and co-design methods with a class of primary age English as a…

Space reactor fuel element testing in upgraded TREAT

International Nuclear Information System (INIS)

Todosow, M.; Bezler, P.; Ludewig, H.; Kato, W.Y.

1993-01-01

The testing of candidate fuel elements at prototypic operating conditions with respect to temperature, power density, hydrogen coolant flow rate, etc., is a crucial component in the development and qualification of nuclear rocket engines based on the Particle Bed Reactor (PBR), NERVA-derivative, and other concepts. Such testing may be performed at existing reactors, or at new facilities. A scoping study has been performed to assess the feasibility of testing PBR based fuel elements at the TREAT reactor. Initial results suggests that full-scale PBR elements could be tested at an average energy deposition of ∼60--80 MW-s/L in the current TREAT reactor. If the TREAT reactor was upgraded to include fuel elements with a higher temperture limit, average energy deposition of ∼100 MW/L may be achievable

Space reactor fuel element testing in upgraded TREAT

Science.gov (United States)

Todosow, Michael; Bezler, Paul; Ludewig, Hans; Kato, Walter Y.

1993-01-01

The testing of candidate fuel elements at prototypic operating conditions with respect to temperature, power density, hydrogen coolant flow rate, etc., is a crucial component in the development and qualification of nuclear rocket engines based on the Particle Bed Reactor (PBR), NERVA-derivative, and other concepts. Such testing may be performed at existing reactors, or at new facilities. A scoping study has been performed to assess the feasibility of testing PBR based fuel elements at the TREAT reactor. Initial results suggests that full-scale PBR elements could be tested at an average energy deposition of ˜60-80 MW-s/L in the current TREAT reactor. If the TREAT reactor was upgraded to include fuel elements with a higher temperture limit, average energy deposition of ˜100 MW/L may be achievable.

L-Lake fish: L-Lake/Steel Creek Biological Monitoring Program, January 1986--December 1991

International Nuclear Information System (INIS)

Sayers, R.E. Jr.; Mealing, H.G. III

1992-04-01

The L Lake Biological Monitoring Program was designed to meet environmental regulatory requirements associated with the re-start of L-Reactor and address portions of Section 316(a) of the Clean Water Act, which requires an applicant for a discharge permit to provide scientific evidence that the discharge causes no significant impact on the indigenous ecosystem. The Department of Energy (DOE) must demonstrate that the discharge of L-Reactor effluent into L Lake will not inhibit the eventual establishment of a ''Balanced Biological Community'' (BBC) in at least 50% of the lake

L-Lake fish: L-Lake/Steel Creek Biological Monitoring Program, January 1986--December 1991

Energy Technology Data Exchange (ETDEWEB)

Sayers, R.E. Jr.; Mealing, H.G. III [Normandeau Associates, Inc., New Ellenton, SC (United States)

1992-04-01

The L Lake Biological Monitoring Program was designed to meet environmental regulatory requirements associated with the re-start of L-Reactor and address portions of Section 316(a) of the Clean Water Act, which requires an applicant for a discharge permit to provide scientific evidence that the discharge causes no significant impact on the indigenous ecosystem. The Department of Energy (DOE) must demonstrate that the discharge of L-Reactor effluent into L Lake will not inhibit the eventual establishment of a ``Balanced Biological Community`` (BBC) in at least 50% of the lake.

Sulfidogenic biotreatment of synthetic acid mine drainage and sulfide oxidation in anaerobic baffled reactor

Energy Technology Data Exchange (ETDEWEB)

Bekmezci, Ozan K.; Ucar, Deniz [Harran University, Environmental Engineering Department, Osmanbey Campus, 63000 Sanliurfa (Turkey); Kaksonen, Anna H. [CSIRO Land and Water, Underwood Avenue, Floreat, WA 6014 (Australia); Sahinkaya, Erkan, E-mail: erkansahinkaya@yahoo.com [Harran University, Environmental Engineering Department, Osmanbey Campus, 63000 Sanliurfa (Turkey)

2011-05-30

The treatment of synthetic acid mine drainage (AMD) water (pH 3.0-6.5) containing sulfate (3.0-3.5 g L{sup -1}) and various metals (Co, Cu, Fe, Mn, Ni, and Zn) was studied in an ethanol-fed sulfate-reducing 4-compartment anaerobic baffled reactor (ABR) at 32 {sup o}C. The reactor was operated for 160 days at different chemical oxygen demand (COD)/sulfate ratios, hydraulic retention times (HRT), pH, and metal concentrations to study the robustness of the process. The last compartment of the reactor was aerated at different rates to study the bio-oxidation of sulfide to elemental sulfur. The highest sulfate reduction efficiency (88%) was obtained with a feed sulfate concentration of 3.5 g L{sup -1}, COD/sulfate mass ratio of 0.737, feed pH of 3.0 and HRT of 2 days without aeration in the 4th compartment. The corresponding COD removal efficiency was about 92%. The alkalinity produced in the sulfidogenic ethanol oxidation neutralized the acidic mine water from pH 3.0-4.5 to pH 7.0-8.0. Effluent soluble and total heavy metal concentrations were substantially reduced with removal efficiencies generally higher than 99%, except for Mn (25-77%). Limited aeration in the 4th compartment of ABR promoted incomplete oxidation of sulfide to elemental sulfur rather than complete oxidation to sulfate. Depending on the aeration rate and HRT, 32-74% of produced sulfide was oxidized to elemental sulfur. This study demonstrates that by optimizing operating conditions, sulfate reduction, metal removal, alkalinity generation, and excess sulfide oxidation can be achieved in a single ABR treating AMD.

The new fluorescence enhancement system Eu3+-ARADE-HMTM-AI3+ and its analytical application

International Nuclear Information System (INIS)

Wenwu Quin; Weisheng Liu; Tianlin Yang

2004-01-01

A new bis-Schiff base ligand, N,N -bis-(4-N-aminothiourea-2-amylidene)-4,4 -diaminodiphenyl ether (ARADE), was synthesized. Its complex with Eu 3+ in DMF emits the intrinsic fluorescence of Eu 3+ . The fluorescence intensity of the Eu 3+ -ARADE system was enhanced about 60-fold by the addition of hexamethylene tetramine (NMTM) and potash alum. This is a new fluorescence enhancement phenomenon. The excitation and emission wavelengths are 375 nm and 615 nm, respectively. Under optimal conditions, the fluorescence intensities vary linearly with the concentration of Eu 3+ in the range of 7.8x10 -9 -1.75x10 -5 mol L -1 with a detection limit of 5.2x10 -9 mol L -1 , or with the concentration of Al 3+ in the range of 3.1x10 -7 -9.7x10 -5 mol-L -1 with a detection limit of 2.7x10 -7 mol L -1 . The interferences of some rare earth metals and other inorganic ions were described. This method was applied to the determination of Eu 3+ in high purity yttrium oxide and the analysis of AI 3+ in alloy steel standard samples. The mechanism of fluorescence enhancement was also studied. (author)

PERFORMATIVITAS DALAM MANGA SHONEN-AI: SEKAIICHI HATSUKOI, HENSHIN DEKINAI DAN HIMANANODE HAJIMETE MIMASHITA

OpenAIRE

Savitri Paramita, Ni Made

2014-01-01

This research underlies the analysis on the performance and performativity of characters in shonen-ai: Sekaiichi Hatsukoi, Henshin Dekinai, and Himananode Hajimete Mimashita manga. Characterization in shonen-ai manga is based on the characters’ role within the same-sex relationship, which are the male role (seme) and the female role (uke). The character of Seme tends to be aggressive, protective, smart, good looking, and unemotional. On the other hand, Uke is feminine, smaller, physically wea...

Risk Management for Sodium Fast Reactors.

Energy Technology Data Exchange (ETDEWEB)

Denman, Matthew R. [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States); Groth, Katrina [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States); Cardoni, Jeffrey N. [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States); Wheeler, Timothy A. [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States)

2015-01-01

Accident management is an important component to maintaining risk at acceptable levels for all complex systems, such as nuclear power plants. With the introduction of self - correcting, or inherently safe, reactor designs the focus has shifted from management by operators to allowing the syste m's design to manage the accident. While inherently and passively safe designs are laudable, extreme boundary conditions can interfere with the design attributes which facilitate inherent safety , thus resulting in unanticipated and undesirable end states. This report examines an inherently safe and small sodium fast reactor experiencing a beyond design basis seismic event with the intend of exploring two issues : (1) can human intervention either improve or worsen the potential end states and (2) can a Bayes ian Network be constructed to infer the state of the reactor to inform (1). ACKNOWLEDGEMENTS The author s would like to acknowledge the U.S. Department of E nergy's Office of Nuclear Energy for funding this research through Work Package SR - 14SN100303 under the Advanced Reactor Concepts program. The authors also acknowledge the PRA teams at A rgonne N ational L aborator y , O ak R idge N ational L aborator y , and I daho N ational L aborator y for their continue d contributions to the advanced reactor PRA mission area.

Apollo-L2, an advanced fuel tokamak reactor utilizing direct conversion

International Nuclear Information System (INIS)

Emmert, G.A.; Kulcinski, G.L.; Blanchard, J.P.; El-Guebaly, L.A.; Khater, H.Y.; Santarius, J.F.; Sawan, M.E.; Sviatoslavsky, I.N.; Wittenberg, L.J.; Witt, R.J.

1989-01-01

A scoping study of a tokamak reactor fueled by a D- 3 He plasma is presented. The Apollo D- 3 He tokamak capitalizes on recent advances in high field magnets (20 T) and utilizes rectennas to convert the synchrotron radiation directly to electricity. The low neutron wall loading (0.1 MW/m 2 ) permits a first wall lasting the life of the plant and enables the reactor to be classified as inherently safe. The cost of electricity is less than that from a similar power level DT reactor. 10 refs., 1 fig., 4 tabs

Thiophenone Attenuates Enteropathogenic Escherichia coli O103:H2 Virulence by Interfering with AI-2 Signaling.

Science.gov (United States)

Witsø, Ingun Lund; Valen Rukke, Håkon; Benneche, Tore; Aamdal Scheie, Anne

2016-01-01

Interference with bacterial quorum sensing communication provides an anti-virulence strategy to control pathogenic bacteria. Here, using the Enteropathogenic E. coli (EPEC) O103:H2, we showed for the first time that thiophenone TF101 reduced expression of lsrB; the gene encoding the AI-2 receptor. Combined results of transcriptional and phenotypic analyses suggested that TF101 interfere with AI-2 signalling, possibly by competing with AI-2 for binding to LsrB. This is supported by in silico docking prediction of thiophenone TF101 in the LsrB pocket. Transcriptional analyses furthermore showed that thiophenone TF101 interfered with expression of the virulence genes eae and fimH. In addition, TF101 reduced AI-2 induced E. coli adhesion to colorectal adenocarcinoma cells. TF101, on the other hand, did not affect epinephrine or norepinephrine enhanced E. coli adhesion. Overall, our results showed that thiophenone TF101 interfered with virulence expression in E. coli O103:H2, suggestedly by interfering with AI-2 mediated quorum sensing. We thus conclude that thiophenone TF101 might represent a promising future anti-virulence agent in the fight against pathogenic E. coli.

Study on Turn-to-turn Short Circuit On一line Monitoring System for Dry一type Ai r一core Reactor

Directory of Open Access Journals (Sweden)

GAO Zi-wei

2017-04-01

Full Text Available The change of current value caused by turn-to-turn short circuit of dry-type air-core reactor is so little that failure detection is difficult to be carried out. In order to solve this problem，a new on-line monitoring system based on impedance variation of turn-to-turn short circuit is proposed. The numerical method is applied to analyze the variation of equivalent resistance and equivalent reactance when dry-type air-core reactor winding short circuit happens in different places，and the monitoring method based on harmonic analysis method and quasi- synchronization sampling method is analyzed by theory. The hardware system，which takes single-chip microcomputer as the core of data processing and logic control，completes data acquisition of voltage signal and current signal of the reactor. In the respect of software design，the impedance variation will be uploaded to the PC after it has been calculated by using the above monitoring method，and then monitoring of turn-to-turn short circuit fault will be realized. Finally，the design of on-line monitoring system is studied by testing. The research result shows that，the equivalent resistance increases and the equivalent reactance decreases when turn-to-turn short circuit occurs，and the variation of equivalent resistance is more obvious than equivalent reactance. The experiment results prove that this monitoring method is true and the on-line monitoring system is feasible.

Contribution to the study and use of ionisation chambers for nuclear reactor control (1965); Contribution a l'etude et a l'utilisation des chambres d'ionisation pour le controle des reacteurs nucleaires (1965)

Energy Technology Data Exchange (ETDEWEB)

Duchene, J [Commissariat a l' Energie Atomique, Saclay (France). Centre d' Etudes Nucleaires

1961-02-15

high-power reactors. (author) [French] Les chambres d'ionisation sont actuellement les detecteurs les mieux adaptes au controle des reacteurs nucleaires par des mesures neutroniques. Nous avons cru bon de rappeler quelques generalites concernant la dynamique des reacteurs, les differents procedes de detection des neutrons, le fonctionnement des chambres d'ionisation et les methodes de mesure utilisees. Notre contribution aux techniques de controle des reacteurs consiste d'une part en une tentative de synthese des facteurs intervenant dans le fonctionnement des chambres d'ionisation, l'etude de ces facteurs, et d'autre part l'elaboration de chambres d'ionisation a fission et a bore permettant de suivre la marche d'un reacteur du demarrage jusqu'a la puissance maximale. Dans le domaine des chambres a fission, nous avons en particulier ameliore les techniques de depot d'oxyde d'uranium sur l'aluminium et realise la mise au point de depots par electrolyse sur d'autres metaux: acier inoxydable, cuivre, molybdene, nickel, tantale, titane, kovar, tungstene et beryllium. Nous avons elabore plusieurs types de chambres a fission servant au demarrage des reacteurs: un type de performances moyennes actuellement utilise dans les piles francaises un type a haute sensibilite un type a haute temperature qui a fonctionne jusqu'a 600 deg. C. En ce qui concerne les chambres a bore, nous avons etudie les perturbations apportees dans les mesures par l'exposition des chambres a d'importants flux de neutrons et a un rayonnement {gamma} intense. Cette exposition produit une modification des proprietes des materiaux constitutifs et la production dans les chambres d'un bruit de fond qui peut gener considerablement les mesures neutroniques. Nous avons montre que la technique de compensation permettait de limiter l'importance de ce bruit de fond et d'augmenter ainsi la plage de fonctionnement des chambres d'ionisation classiques destinees aux mesures de puissance. Enfin, nous avons realise deux

Biogas production from UASB and polyurethane carrier reactors treating sisal processing wastewater

Energy Technology Data Exchange (ETDEWEB)

Rubindamayugi, M S.T.; Salakana, L K.P. [Univ. of Dar es Salaam, Faculty of Science, Applied Microbiology Unit (Tanzania, United Republic of)

1998-12-31

The fundamental benefits which makes anaerobic digestion technology (ADT) attractive to the poor developing include the low cost and energy production potential of the technology. In this study the potential of using UASB reactor and Polyurethane Carrier Reactor (PCR) as pollution control and energy recovery systems from sisal wastewater were investigated in lab-scale reactors. The PCR demonstrated the shortest startup period, whereas the UASB reactor showed the highest COD removal efficiency 79%, biogas production rate (4.5 l biogas/l/day) and process stability than the PCR under similar HRT of 15 hours and OLR of 8.2 g COD/l/day. Both reactor systems became overloaded at HRT of 6 hours and OLR of 15.7 g COD/l/day, biogas production ceased and reactors acidified to pH levels which are inhibiting to methanogenesis. Based on the combined results on reactor performances, the UASB reactor is recommended as the best reactor for high biogas production and treatment efficiency. It was estimated that a large-scale UASB reactor can be designed under the same loading conditions to produce 2.8 m{sup 3} biogas form 1 m{sup 3} of wastewater of 5.16 kg COD/m{sup 3}. Wastewater from one decortication shift can produce 9,446 m{sup 3} og biogas. The energy equivalent of such fuel energy is indicated. (au)

Biogas production from UASB and polyurethane carrier reactors treating sisal processing wastewater

Energy Technology Data Exchange (ETDEWEB)

Rubindamayugi, M.S.T.; Salakana, L.K.P. [Univ. of Dar es Salaam, Faculty of Science, Applied Microbiology Unit (Tanzania, United Republic of)

1997-12-31

The fundamental benefits which makes anaerobic digestion technology (ADT) attractive to the poor developing include the low cost and energy production potential of the technology. In this study the potential of using UASB reactor and Polyurethane Carrier Reactor (PCR) as pollution control and energy recovery systems from sisal wastewater were investigated in lab-scale reactors. The PCR demonstrated the shortest startup period, whereas the UASB reactor showed the highest COD removal efficiency 79%, biogas production rate (4.5 l biogas/l/day) and process stability than the PCR under similar HRT of 15 hours and OLR of 8.2 g COD/l/day. Both reactor systems became overloaded at HRT of 6 hours and OLR of 15.7 g COD/l/day, biogas production ceased and reactors acidified to pH levels which are inhibiting to methanogenesis. Based on the combined results on reactor performances, the UASB reactor is recommended as the best reactor for high biogas production and treatment efficiency. It was estimated that a large-scale UASB reactor can be designed under the same loading conditions to produce 2.8 m{sup 3} biogas form 1 m{sup 3} of wastewater of 5.16 kg COD/m{sup 3}. Wastewater from one decortication shift can produce 9,446 m{sup 3} og biogas. The energy equivalent of such fuel energy is indicated. (au)

Biochemical properties of L-arabinose isomerase from Clostridium hylemonae to produce D-tagatose as a functional sweetener.

Science.gov (United States)

Nguyen, Tien-Kieu; Hong, Moon-Gi; Chang, Pahn-Shick; Lee, Byung-Hoo; Yoo, Sang-Ho

2018-01-01

d-Tagatose has gained substantial interest due to its potential functionalities as a sucrose substitute. In this study, the gene araA, encoding l-arabinose isomerase (l-AI) from Clostridium hylemonae (DSM 15053), was cloned and expressed in Escherichia coli BL21 (DE3). This gene consists of 1,506 nucleotides and encodes a protein of 501 amino acid residues with a calculated molecular mass of 56,554 Da. Since l-AI was expressed as an intracellular inclusion body, this enzyme was solubilized with guanidine hydrochloride, refolded, and activated with a descending concentration gradient of urea. The purified enzyme exhibited the greatest activity at 50°C, pH 7-7.5, and required 1 mM of Mg2+ as a cofactor. Notably, the catalytic efficiency (3.69 mM-1sec-1) of l-AI from C. hylemonae on galactose was significantly greater than that of other previously reported enzymes. The bioconversion yield of d-tagatose using the C. hylemonae l-arabinose isomerase at 60°C reached approximately 46% from 10 mM of d-galactose after 2 h. From these results, it is suggested that the l-arabinose isomerase from C. hylemonae could be utilized as a potential enzyme for d-tagatose production due to its high conversion yield at an industrially competitive temperature.

Açai Palm Fruit (Euterpe oleracea Mart.) Pulp Improves Survival of Flies on a High Fat Diet

OpenAIRE

Sun, Xiaoping; Seeberger, Jeanne; Alberico, Thomas; Wang, Chunxu; Wheeler, Charles T.; Schauss, Alexander G.; Zou, Sige

2010-01-01

Reducing oxidative damage is thought to be an effective aging intervention. Açai, a fruit indigenous to the Amazon, is rich in phytochemicals that possesses high anti-oxidant activities, and has anti-inflammatory, anti-cancer and anti-cardiovascular disease properties. However, little is known about its potential anti-aging properties especially at the organismal level. Here we evaluated the effect of açai pulp on modulating lifespan in Drosophila melanogaster. We found that açai supplementat...

The 'SURA' fast reactor program

International Nuclear Information System (INIS)

Anon.

1979-01-01

The Commissariat a l'Energie Atomique's SURA program on fast reactor safety consists of two specific testing programs on fastbreeder reactor safety: the Cabri and Scarabee programs. Both Cabri and Scarabee are examples of multinational research collaboration. The CEA and the Karlsruhe Nuclear Research Center are each covering half of the construction costs. Britain, the US and Japan are also due to participate in these experiments. The aim of the programs is to examine the behaviour of fuel in sodium cooled fast reactors. The Cabri program consists of setting off a reactivity accident in a power reactor core which is cooled with liquid sodium, such an accident occurring after a sharp increase in reactivity or as a result of the pump suddenly breaking down without there at the same time being any fall in the control rods. In 1967 the Commissariat a l'Energie Atomique started its Scarabee research program which is trying to analyse the sort of things that can go wrong with fuel cooling systems and what the consequences can be [fr

Molecular characterization of AI viruses from poultry and wild bird surveillance in Denmark

DEFF Research Database (Denmark)

Larsen, Lars Erik; Krog, Jesper Schak; Madsen, Jesper J.

Infection with avian influenza virus (AIV) in poultry may cause devastating disease although the same virus may not cause disease in wild birds. Since AI viruses can be exchanged between poultry and wild birds, surveillance in wild birds provides important knowledge for control of disease...... in poultry. AIV’s from the Danish wild bird active surveillance were characterized, focusing on viruses from 2012, and from outbreaks of AI in poultry in Denmark. The matrix (M) gene from more than 50 viruses of different subtypes and the hemagglutinin (HA) gene from more than 30 subtype H5 low pathogenic...... viruses were sequenced and compared by alignment and phylogenetic analyses. The aim was to evaluate: the origin of viruses from outbreaks of AI in Danish poultry, the design of active surveillance in Denmark, and the suitability of the molecular diagnostic RT-PCR tests employed. All M-genes from Danish...

De l’harmonie dans la construction des mots français

Directory of Open Access Journals (Sweden)

Roché Michel

2016-01-01

Full Text Available La formation des gentilés, particulièrement sensible aux contraintes d’euphonie, permet de mettre en évidence, pour le français, deux manifestations complémentaires de la contrainte dissimilative. L’une, négative, tend à éviter la consécution à faible distance du même phonème ou de deux phonèmes proches. Elle explique la sous-représentation des deux principaux suffixes, -ais et -ois, après une accroche en sifflante, à cause de la sifflante conte-nue par le suffixe au féminin, ainsi que la sous-représentation de -ais après /E/ et de -ois après /A/. L’autre, positive, favorise entre les voyelles une harmonie fondée sur les contrastes. De-vant les suffixes dont la voyelle est une voyelle d’avant moyenne ou haute (-ais, -ain, -in, -ier…, sont privilégiés les radicaux dont la dernière voyelle est une voyelle d’arrière moyenne ou basse, et de préférence un /O/ plutôt qu’un /A/. Devant les suffixes dont la voyelle est une voyelles d’arrière moyenne ou basse (-ois, -ot, -on, -and, -at, -ard…, sont privilégiés les radi-caux dont la dernière voyelle est une voyelle d’avant moyenne ou haute, et de préférence un /i/ plutôt qu’un /E/. Pour cela, un yod au contact du suffixe joue le même rôle qu’un /i/ dans la syllabe précédente. Cette harmonie est obtenue soit par la sélection du suffixe, soit par un aménagement – substitution, épenthèse, troncation, insertion d’un interfixe, etc. – du radical fourni par la base. On observe d’autre part une harmonisation de l’accroche consonantique du radical avec la voyelle du suffixe. Devant -ois, sont privilégiées les attaques en labiale ou en vélaire, en accord avec le double caractère du /w/ propre à ce suffixe. Devant -ais et -ain, ce sont les attaques en dentale. Devant -ot, -on, -and, -at, -ard, la tendance à rapprocher l’articu-lation de la consonne de celle de la voyelle peut aller jusqu’aux vélaires mais elle s’arrête sou

Sensor assignment to mission in AI-TECD

Science.gov (United States)

Ganger, Robert; de Mel, Geeth; Pham, Tien; Rudnicki, Ronald; Schreiber, Yonatan

2016-05-01

Sensor-mission assignment involves the allocation of sensors and other information-providing resources to missions in order to cover the information needs of the individual tasks within each mission. The importance of efficient and effective means to find appropriate resources for tasks is exacerbated in the coalition context where the operational environment is dynamic and a multitude of critically important tasks need to achieve their collective goals to meet the objectives of the coalition. The Sensor Assignment to Mission (SAM) framework—a research product of the International Technology Alliance in Network and Information Sciences (NIS-ITA) program—provided the first knowledge intensive resource selection approach for the sensor network domain so that contextual information could be used to effectively select resources for tasks in coalition environments. Recently, CUBRC, Inc. was tasked with operationalizing the SAM framework through the use of the I2WD Common Core Ontologies for the Communications-Electronics Research, Development and Engineering Center (CERDEC) sponsored Actionable Intelligence Technology Enabled Capabilities Demonstration (AI-TECD). The demonstration event took place at Fort Dix, New Jersey during July 2015, and this paper discusses the integration and the successful demonstration of the SAM framework within the AI-TECD, lessons learned, and its potential impact in future operations.

Technology programs in support of advanced light water reactor plants: Construction

International Nuclear Information System (INIS)

Eichen, E.P.

1989-10-01

Stone ampersand Webster Engineering Corporation (SWEC) is conducting several independent, yet interrelated, studies of light water reactor plants to improve constructibility and quality, to reduce costs and schedule duration, and to simplify design. This document discusses construction approaches. 77 refs., 5 figs., 6 tabs

Irradiation effects on reactor structural materials. Semiannual progress report, March 1975--July 1975

International Nuclear Information System (INIS)

Claudson, T.T.

1975-12-01

Mechanical properties and irradiation effects are reported by Aerojet, ANL, AI, GE, HEDL, NRL, ORNL, PNL, and Univ. of Cincinnati for: Type 304, 304L, and 316 stainless steels; Inconel 718; nickel; Ni alloys; V alloys; Mo; Nb; and Nb--1 Zr

l-Arabinose Isomerase and d-Xylose Isomerase from Lactobacillus reuteri: Characterization, Coexpression in the Food Grade Host Lactobacillus plantarum, and Application in the Conversion of d-Galactose and d-Glucose

Science.gov (United States)

2014-01-01

The l-arabinose isomerase (l-AI) and the d-xylose isomerase (d-XI) encoding genes from Lactobacillus reuteri (DSMZ 17509) were cloned and overexpressed in Escherichia coli BL21 (DE3). The proteins were purified to homogeneity by one-step affinity chromatography and characterized biochemically. l-AI displayed maximum activity at 65 °C and pH 6.0, whereas d-XI showed maximum activity at 65 °C and pH 5.0. Both enzymes require divalent metal ions. The genes were also ligated into the inducible lactobacillal expression vectors pSIP409 and pSIP609, the latter containing a food grade auxotrophy marker instead of an antibiotic resistance marker, and the l-AI- and d-XI-encoding sequences/genes were coexpressed in the food grade host Lactobacillus plantarum. The recombinant enzymes were tested for applications in carbohydrate conversion reactions of industrial relevance. The purified l-AI converted d-galactose to d-tagatose with a maximum conversion rate of 35%, and the d-XI isomerized d-glucose to d-fructose with a maximum conversion rate of 48% at 60 °C. PMID:24443973

The control equipment of the Melusine II reactor; L'equipement de controle du reacteur Melusine II

Energy Technology Data Exchange (ETDEWEB)

Cordelle, M; Delcroix, V; Denis, P; Gariod, R

1963-07-01

Melusine II, low-power reactor, used for the study of Siloe core has diverged at the CEA Grenoble, the 23. May 1962; its monitoring board studied and carried out in this center is the first in France to be entirely transistorized. The first months of running have justified the hope put in the new electronics to improve the stability and the safety of running. The article describes the design of the control and gives the main characteristics of the measurement chains and of the actions on reactivity. (O.M.) [French] Melusine II, reacteur de faible puissance destine a l'etude du coeur de Siloe a diverge au Centre d'Etudes Nucleaires de Grenoble, le 23 mai 1962, son tableau de controle etudie et realise dans ce Centre est le premier en France a etre entierement transistorise. Les premiers mois de fonctionnement ont justifie l'espoir mis dans la nouvelle electronique pour ameliorer la stabilite et la surete de fonctionnement. L'article decrit la conception du controle et donne les principales caracteristiques des chaines de mesure et des actions sur la reactivite. (auteurs)

Oklo natural reactor

International Nuclear Information System (INIS)

Fujii, Isao

1985-01-01

In 1954, Professor Kazuo, Kuroda of Arkansas University in USA published the possibility that spontaneously generated natural nuclear reactors existed in prehistoric age. In 1972, 18 years after that, Commissariat a l'Energie Atomique published that in the Oklo uranium deposit in Gabon, Africa, a natural nuclear reactor was found. This fact was immediately informed to the whole world, but in Japan, its details have not necessarily been well known. The chance of investigating into this fact and visiting the Oklo deposit by the favor of COMUF, the owner of the Oklo deposit, was given, therefore, the state of the natural reactors, which has been known so far, is reported. At present, 12 natural reactors have been found in the vicinity of the Oklo deposit. The natural reactors were generated spontaneously in uranium deposits about 1.7 billion years ago when the isotopic abundance of U-235 was 3 %, and the chain reaction started naturally. When the concentration of U-235 lowered, the reaction stopped naturally. The abnormality in the U-235 abundance in natural uranium was found, and the cause was pursued. The evidence of the existence of natural reactors was shown. (Kako, I.)

KS-150 reactor control

International Nuclear Information System (INIS)

Wagner, K.

1974-01-01

A thorough description is presented of the control and protection system of the Bohunice A-1 reactor. The system including auxiliary facilities was developed, manufactured and installed at the reactor by the SKODA Works, Plzen. The system parameters are listed and a brief account is also given of the development efforts and of the physical and power start-up of the A-1 nuclear power plant. (L.O.)

ANAEROBIC DIGESTION AND THE DENITRIFICATION IN UASB REACTOR

Directory of Open Access Journals (Sweden)

José Tavares de Sousa

2008-01-01

Full Text Available The environmental conditions in Brazil have been contributing to the development of anaerobic systems in the treatment of wastewaters, especially UASB - Upflow Anaerobic Sludge Blanket reactors. The classic biological process for removal of nutrients uses three reactors - Bardenpho System, therefore, this work intends an alternative system, where the anaerobic digestion and the denitrification happen in the same reactor reducing the number of reactors for two. The experimental system was constituted by two units: first one was a nitrification reactor with 35 L volume and 15 d of sludge age. This system was fed with raw sanitary waste. Second unit was an UASB, with 7.8 L and 6 h of hydraulic detention time, fed with ¾ of effluent nitrification reactor and ¼ of raw sanitary waste. This work had as objective to evaluate the performance of the UASB reactor. In terms of removal efficiency, of bath COD and nitrogen, it was verified that the anaerobic digestion process was not affected. The removal efficiency of organic material expressed in COD was 71%, performance already expected for a reactor of this type. It was also observed that the denitrification process happened; the removal nitrate efficiency was 90%. Therefore, the denitrification process in reactor UASB is viable.

Polychronous Zirconology of Navysh Volcanics of the Ai Formation (Southern Urals)

Science.gov (United States)

Krasnobaev, A. A.; Puchkov, V. N.; Sergeeva, N. D.

2018-01-01

In order to resolve the age of Navysh volcanics (NV), which is usually attributed to the Lower Riphean of the Ai Formation, we have used geochronological, petrologic, and mineralogical methods of zirconology, apart from the SHRIMP isotopic data of single zircon grains. Moreover, TIMS isotope age analyses have been conducted, the results of which can be regarded as both controlling and providing the most correct information. The TIMS and SHRIMP data make it possible to suggest a polychronous character of the NV, which include not only Riphean, but also Paleozoic groups of volcanics. In this situation, an assessment of the scales of such polychroneity of NV and, correspondingly, of the Ai Formation as a whole becomes urgent.

Creation of metal-independent hyperthermophilic L-arabinose isomerase by homologous recombination.

Science.gov (United States)

Hong, Young-Ho; Lee, Dong-Woo; Pyun, Yu-Ryang; Lee, Sung Haeng

2011-12-28

Hyperthermophilic L-arabinose isomerases (AIs) are useful in the commercial production of D-tagatose as a low-calorie bulk sweetener. Their catalysis and thermostability are highly dependent on metals, which is a major drawback in food applications. To study the role of metal ions in the thermostability and catalysis of hyperthermophilic AI, four enzyme chimeras were generated by PCR-based hybridization to replace the variable N- and C-terminal regions of hyperthermophilic Thermotoga maritima AI (TMAI) and thermophilic Geobacillus stearothermophilus AI (GSAI) with those of the homologous mesophilic Bacillus halodurans AI (BHAI). Unlike Mn(2+)-dependent TMAI, the GSAI- and TMAI-based hybrids with the 72 C-terminal residues of BHAI were not metal-dependent for catalytic activity. By contrast, the catalytic activities of the TMAI- and GSAI-based hybrids containing the N-terminus (residues 1-89) of BHAI were significantly enhanced by metals, but their thermostabilities were poor even in the presence of Mn(2+), indicating that the effects of metals on catalysis and thermostability involve different structural regions. Moreover, in contrast to the C-terminal truncate (Δ20 residues) of GSAI, the N-terminal truncate (Δ7 residues) exhibited no activity due to loss of its native structure. The data thus strongly suggest that the metal dependence of the catalysis and thermostability of hyperthermophilic AIs evolved separately to optimize their activity and thermostability at elevated temperatures. This may provide effective target regions for engineering, thereby meeting industrial demands for the production of d-tagatose.

Evaluación del comportamiento hidráulico en un reactor anaerobio de doble cámara (RADCA

Directory of Open Access Journals (Sweden)

Nancy Rincón

2011-01-01

tales como cortos circuitos, zonas muertas y recirculación interna afectan su desempeño. En esta investigación se evaluó el comportamiento hidráulico de un reactor anaerobio de doble cámara (RADCA de 534,5 L (cámara 1=305 L y cámara 2= 229,5 L como innovación tecnológica de los reactores UASB. El RADCA fue alimentado con agua residual municipal (ARM de la ciudad de Maracaibo, Venezuela; cada una de las cámaras fueron inoculadas con lodo granular (20% v/v proveniente de una cervecería local. La evaluación hidráulica se realizó en la fase líquida y en operación utilizando Li+ (LiCl como trazador aplicado de forma instantánea en el afluente a tiempo de retención hidráulico teórico (TRHt de 6 horas; 3,4 h en la cámara 1 y 2,6 para la cámara 2. El RADCA describió un flujo pistón en ambas cámaras y una eficiencia hidráulica cercana a la unidad (1 indicando una presencia casi nula de zonas muertas. La eficiencia de remoción de la DQO total (DQOT del RADCA se mantuvo en el rango de 59,77% a 74,64% con un promedio de 68,26%. Para las cámaras 1 y 2 la eficiencia promedio fue 60,4 y 20,94% con una producción de biogás (L/h de 2,768 y 0,541 respectivamente.

77 FR 34378 - PJM Interconnection, L.L.C.; Notice of Complaint

Science.gov (United States)

2012-06-11

... Interconnection, L.L.C.; Notice of Complaint Take notice that on June 1, 2012, pursuant to section 206 of the Federal Power Act (FPA), 16 U.S.C. 824(e), PJM Interconnection, L.L.C. (PJM) filed proposed revisions to the Amended and Restated Operating Agreement of PJM Interconnection L.L.C. (Operating Agreement) to...