The Securing of a Precarious Commerce: Exchanges between Seville and Yucatan (1590- 1600

Directory of Open Access Journals (Sweden)

Manuela Cristina García Bernal

2000-10-01

Full Text Available This work underlines the importance of Yucatan's commercial relations across the Atlantic Ocean, as opposed to the traditional belief  that  these exchanges were small and  infrequent. Due to the margination and poverty of the province, in 1590 the Span­ish Crown granted Yucatan a license  to send two small  ships each year, with the necessary products. This license  allowed the securing of a trade that until  then had  been quite  precarious. This is why the quantitative and qualitative analyses of the move­ments of ships and merchandise between 1590 and 1600 lets us understand why, despite being considered secondary, this re­gion's commerce occupied, as seen from Seville, a considerable position among the  great amount of Atlantic trade. These analy­ses also reveal  why  during the  seventeenth  century Yucatan would come  to be  the  most  favored of the smaller posts along the Spain-Indies trading route.

Isidore of Seville – Reader of Solinus

Directory of Open Access Journals (Sweden)

Anca Crivăţ

2013-05-01

Full Text Available This paper focuses on examining how in his Etymologiae sive Origines Isidore of Seville makes use of the lexis that describes marvellous phenomena. This lexis was borrowed to some extent from Solinus’ Collectanea rerum memorabilium. This research therefore aims at checking the results of some previous studies which demonstrate the rationality of Isidore’s approach by investigating the lexis in his work.

[Influence of postcode on paediatric admissions in Seville].

Science.gov (United States)

Tornero Patricio, Sebastián; Charris-Castro, Liliana; Granero Asencio, Mercedes; Daponte Codina, Antonio

2017-12-01

The postcode (where the home is situated) is an indicator of socioeconomic status and is associated with morbidity, mortality, and the use of health services. The aim of this study was to analyse its effects on paediatric admissions and to determine the rates of the most common causes of paediatric admissions in Seville. An observational cross-sectional study with two analysis units: under 15 year-old "admissions" in public hospitals in Seville (n=2,660) and "city districts" of Seville (n=11). The independent variable analysed was whether the postcode of the admitted patients was within a Regional Government designated "area with social transformation needs". The analysis of the admissions was performed using X 2 -test, Fisher test and Student-t test, with the description of rates using the calculation of crude and specific rates, and by rate ratio. Children living in districts with a lower socioeconomic status were on average 7 months younger (P<.001), and they were significantly more likely to be admitted via the emergency department (P<.001). There was no statistical difference detected in either the length of hospital stay or mortality. The crude admission rate ratio was higher in districts with a lower socioeconomic status (1.8), with a higher specific rate ratio detected in admissions due to asthma, respiratory infections, inguinal hernia, and epilepsy/convulsions. Paediatric hospital admission rates of the main diagnoses were higher in districts with a lower socioeconomic status. Children living in these districts were more likely to be admitted younger and via the emergency department. Copyright © 2016 Asociación Española de Pediatría. Publicado por Elsevier España, S.L.U. All rights reserved.

Experiences to substitute polyacrylamide in Carambolo DWTP (Seville, Spain); Experiencias para la sustitucion de las pliacrilamidas en la ETAP Carambolo de Sevilla

Energy Technology Data Exchange (ETDEWEB)

Diaz Garcia, J. M.; Gonzalez Quesada, R.

2010-07-01

The legal limitation of Spanish normative OM SCO/3719/2005 about polyacrylamide flocculants dosification produced the need to reduce this dosing or the substitution of flocculants by other alternative products. this work, realized in laboratory and in a decanter too, determines the performance obtained for final turbidity, wash and frequency of filters, economic costs and application technical problems. the study of these alternatives has been realized to apply in carambolo DWTP. This plant supplies drinking water to Seville city and great part of its metropolitan area. (Author) 10 refs.

A forensic pathology approach to sudden death in children and young adults in Biscay and Seville (Spain

Directory of Open Access Journals (Sweden)

Benito Morentin

2012-10-01

Full Text Available Sudden death (SD in children and young adults is a complex multifactorial problem that entails medical forensic and socio-familial implications. Forensic pathology plays an important role in these cases due to the fact that they tend to occur unexpectedly, and therefore a postmortem examination is needed to determine cause and mechanism of death. Most of these deaths are of cardiovascular origin and many of them have a hereditary component. The autopsy may be the only way to establish the correct diagnosis of the underlying condition enabling the family to receive proper medical counseling, to identify asymptomatic relatives at risk, and to prevent subsequent deaths. A proper approach requires the collaboration of various medical specialties (coroners, pathologists, pediatricians, cardiologists, microbiologists, geneticians, who must work in coordination in accordance to international protocols. In this article, the epidemiologic and clinical-pathological features of the main conditions that may lead to SD in children and young adults are reviewed and a case series from Seville and Biscay provinces is presented. Finally, the importance of forensic pathology in the management and prevention of these cases is underlined.

Macroscopical morphology of deterioration of the stone in the Cathedral of Seville, Spain

Directory of Open Access Journals (Sweden)

Alcalde, M.

1990-09-01

Full Text Available The lithotype mainly used in the construction of the Cathedral of Seville is the calcarenite from Puerto de Santa f/laria followed by the limestone from Espera. The primordial extrinsecal factor of deterioration is the atmospherical contamination, mainly sulphur oxides and smoke, within a humid environment. From both factors, the porose stone of a carbonated nature and the acid environment, we can deduce that the principal mechanism of deterioration is the chemical attack; the most important indicators of deterioration that have been found are the deposits and arenizations. In a "grosso modo" valoration we can say that the stone of structural employment is well conserved in its majority while the ornamental stone is degraded at 80%. Half the cresting is in a state of ruin and 20% of the tips have been removed or will have to be in the near future.

El litotipo mayoritariamente empleado en la construcción de la Catedral de Sevilla es la calcarenita del Puerto de Santa María seguida de la caliza de Espera. El factor extrínseco de alteración primordial es la contaminación atmosférica, principalmente óxidos de azufre y humos, en ambiente húmedo. De ambos factores, piedra porosa de naturaleza carbonatada y medio ambiente ácido, puede deducirse que el principal mecanismo de alteración es el ataque químico y se ha encontrado que los indicadores de alteración más importantes son los depósitos y las arenizaciones. En una valoración a grosso modo puede decirse que la piedra de uso estructural se encuentra bien conservada en su mayor parte, y la ornamental degradada en un 80%. La mitad de las cresterías se encuentran en estado de ruina y un 20% de los remates han sido retirados o habrán de serlo próximamente.

Spanish version of the Thought-Action Fusion Questionnaire and its application in eating disorders

OpenAIRE

Jáuregui-Lobera, Ignacio; Bolaños-Ríos,Patricia; Santed-Germán,Miguel Angel; Garrido-Casals,Olivia

2013-01-01

I Jáuregui-Lobera,1,3 MA Santed-Germán,2 P Bolaños-Ríos,3 O Garrido-Casals3 1Molecular Biology and Biochemistry Engineering Department, Pablo de Olavide University, Seville, Spain; 2Personality, Evaluation and Psychological Treatments Department, UNED, Madrid, Spain; 3Behavioral Sciences Institute, Seville, Spain Purpose: The aims of the study were to analyze the psychometric properties of the Spanish version of the Thought-Action Fusion Questionna...

Impact on the psychotic vulnerability of the therapeutic approachin the Prison Psychiatric Hospital in Seville (Spain).

Science.gov (United States)

Massé-García, P; Lamas-Bosque, F J; Massé-Palomo, A

2017-06-01

to analyze changes in psychotic vulnerability following the implementation of a program of prison psychiatric treatment, recidivism after the release and various descriptive variables of criminological interest. review of a sample consisting of 50 patients diagnosed with schizophrenia admitted to the Prison Psychiatric Hospital of Seville. there was a statistically significant reduction of psychotic vulnerability according to an assessment using the Frankfurt psychopathological inventory (FBF-3), after conducting a complete psychiatric, psychological, social and rehabilitation approach in the prison environment. The core symptoms relating to complex perception and language also decreased significantly. The reduction is particularly noticeable in the number of patients categorized as medium-high and high severity. Recidivism in the follow-up of release of patients in the study sample is low (6%) and there were no cases of serious felony or grievous bodily harm. Recidivism, when it occurs, is not immediate. Although there is some criminal versatility, it is limited. The most frequent victims are parents with a previous relationship with the patient. Most of the patients in the sample, and all recidivists, have comorbid substance abuse (dual diagnosis). we need more comprehensive studies to establish causal relationships between the decrease in psychotic vulnerability and an integrated psychiatric, psychological, social and rehabilitation approach in prisons; or to attribute the low rate of recidivism to the decline of psychotic vulnerability.

Impact on the psychotic vulnerability of the therapeutic approachin the Prison Psychiatric Hospital in Seville (Spain

Directory of Open Access Journals (Sweden)

P. Massé-García

Full Text Available Objectives: to analyze changes in psychotic vulnerability following the implementation of a program of prison psychiatric treatment, recidivism after the release and various descriptive variables of criminological interest. Materials and methods: review of a sample consisting of 50 patients diagnosed with schizophrenia admitted to the Prison Psychiatric Hospital of Seville. Results: there was a statistically significant reduction of psychotic vulnerability according to an assessment using the Frankfurt psychopathological inventory (FBF-3, after conducting a complete psychiatric, psychological, social and rehabilitation approach in the prison environment. The core symptoms relating to complex perception and language also decreased significantly. The reduction is particularly noticeable in the number of patients categorized as medium-high and high severity. Recidivism in the follow-up of release of patients in the study sample is low (6% and there were no cases of serious felony or grievous bodily harm. Recidivism, when it occurs, is not immediate. Although there is some criminal versatility, it is limited. The most frequent victims are parents with a previous relationship with the patient. Most of the patients in the sample, and all recidivists, have comorbid substance abuse (dual diagnosis. Discussion: we need more comprehensive studies to establish causal relationships between the decrease in psychotic vulnerability and an integrated psychiatric, psychological, social and rehabilitation approach in prisons; or to attribute the low rate of recidivism to the decline of psychotic vulnerability.

Tweeting AI: Perceptions of AI-Tweeters (AIT) vs Expert AI-Tweeters (EAIT)

OpenAIRE

Manikonda, Lydia; Dudley, Cameron; Kambhampati, Subbarao

2017-01-01

With the recent advancements in Artificial Intelligence (AI), various organizations and individuals started debating about the progress of AI as a blessing or a curse for the future of the society. This paper conducts an investigation on how the public perceives the progress of AI by utilizing the data shared on Twitter. Specifically, this paper performs a comparative analysis on the understanding of users from two categories -- general AI-Tweeters (AIT) and the expert AI-Tweeters (EAIT) who ...

Spain's greatest and most recent mine disaster.

Science.gov (United States)

Guerrero, Flor Ma; Lozano, Macarena; Rueda-Cantuche, José M

2008-03-01

On 25 April 1998, the mineral waste retaining wall at the Swedish-owned pyrite mine at Aznalcóllar (Seville, Spain) burst, causing the most harmful environmental and socio-economic disaster in the history of the River Guadiamar basin. The damage was so great that the regional government decided in May 1998 to finance a comprehensive, multidisciplinary research initiative with the objective of eradicating or at least minimising all of the negative social, economic and environmental impacts. This paper utilises a Strengths, Weaknesses, Opportunities and Threats (SWOT) analysis to identify eight strategic measures aimed at providing policymakers with key guidelines on implementing a sustainable development model, in a broad sense. Empirical evidence, though, reveals that, to date, major efforts to tackle the negative impacts have centred on environmental concerns and that the socio-economic consequences have not been completely mitigated.

Valorization of agroforest crops for biomass utilization. Editorial Note

OpenAIRE

Río Andrade, José Carlos del

2010-01-01

Editorial Note. Special issue on "Valorization of Agroforest Crops for Biomass Utilization", The Open Agriculture Journal. José C. del Río (Guest Editor) Department of Plant Biotechnology Institute of Natural Resources and Agrobiology of Seville (IRNAS-CSIC) Seville, Spain E-mail:

AIS authentication

CERN Multimedia

2006-01-01

Users are invited to use the NICE password for AIS authentication. As announced in CNL June-August 2006 (see http://www.cerncourier.com/articles/cnl/3/6/14/1) it is possible to use the NICE username and password to log on to AIS. The procedure is now fully operational and users can themselves reset the AIS password such that the NICE password will be used for authentication required by AIS applications. We strongly recommend CERN users who have a NICE account (this is the case of most users) to do this, with the objective to reduce the number of passwords they need to remember. This can be achieved very easily, directly from the Change Password option on the AIS login (https://aislogin.cern.ch/). Users should just select the '[Change Password]' option displayed at the bottom of the page, provide the 'Old Password' and then click on the button 'Use Nice password' followed by 'Submit'. Change Password option on the AIS login windowSetting the AIS password - Use Nice Password It should be noted that the proce...

International Conference on Low Temperature Chemistry (6th) Held in Chernogolovka, Russia on 27 August - 1 September 2006

Science.gov (United States)

2006-09-20

University of California, Davis, CA 95616, USA 3Instituto de Bioquimica Vegetal y Fotosintesis, Universidad de Seville-CSIC E-41092 Seville, Spain The...with the aim of improvement of their pharmaceutical and therapeutical characteristics, is a very actual task at the present time. Dispersity of

Spain. Women in the world.

Science.gov (United States)

Galindo, E; Serrano, N

1994-08-01

Spanish women live almost 2 times longer today than did their great grandmothers (60-65 years vs. 35). Contraception is more accessible, resulting in fewer pregnancies and their complications. The National Health Service of Spain provides women and their families medical care. Yet, women's health risks continue. Class, race, and geography result in women having uneven access to medical care. Primary health care services are not a priority as are high- technology hospitals. Women, who already lead a busy life, still care for older people or people with disabilities. Many households have a very limited or no income and depend on welfare benefits or family. There are more women than men who are poor because women, many of whom are single, are raising large families and many live alone. Women are often the victims of violence and of domestic abuse (1993, 86 violent deaths and 200,000 cases of abuse by a partner). Spain has laws that protect women facing divorce and that allow abortion, but men have created the world order. Women suffer daily in a world which does not recognize rape and sexual harassment as war crimes (e.g., former Yugoslavia). In Seville, the Solidarity Network of Women in Black is a pacifist group working to stop violence. They plan on setting up links to publicly denounce and act against all aggression and to institutionalize women's right to full freedom. War is destroying women's lives.

Radionuclides in the environment in the south of Spain, anthropogenic enhancements due to industry

Energy Technology Data Exchange (ETDEWEB)

Manjon, G. [Depto. de Fisica Aplicada 2, E.T.S. Arquitectura, Universidad de Sevilla, Av. Reina Mercedes 2, 41012 - Sevilla (Spain)

2007-07-01

Levels of natural radionuclides in the environment are affected by human activities in the South of Spain. Industry wastes, such as phospho-gypsum, have been released to an estuary since sixties until 1997. Nowadays the wastes management is careful with environment protection, which can be clearly observed today in the radionuclides pattern. Different sources of radionuclides (industry wastes, tidal action and mining) can be distinguished in the estuary. Uranium isotopes, {sup 226}Ra, {sup 210}Pb and {sup 210}Po were determined in water and sediment samples for this study. An iron recycling factory is working close to Seville (South of Spain). A {sup 137}Cs source was accidentally burnt in a furnace of this factory in 2001. The environmental impact of this accident was immediately denatured. Monitoring procedure and results are sho vn in this contribution. Radionuclides measurement involves difficult techniques. In this communication a procedure to determine the activity concentration of {sup 210}Pb by liquid scintillation counting is presented. Two quality tests, using gamma- and alpha-spectrometry were applied to the {sup 210} Pb results. (Author)

Radionuclides in the environment in the south of Spain, anthropogenic enhancements due to industry

International Nuclear Information System (INIS)

Manjon, G.

2007-01-01

Levels of natural radionuclides in the environment are affected by human activities in the South of Spain. Industry wastes, such as phospho-gypsum, have been released to an estuary since sixties until 1997. Nowadays the wastes management is careful with environment protection, which can be clearly observed today in the radionuclides pattern. Different sources of radionuclides (industry wastes, tidal action and mining) can be distinguished in the estuary. Uranium isotopes, 226 Ra, 210 Pb and 210 Po were determined in water and sediment samples for this study. An iron recycling factory is working close to Seville (South of Spain). A 137 Cs source was accidentally burnt in a furnace of this factory in 2001. The environmental impact of this accident was immediately denatured. Monitoring procedure and results are sho vn in this contribution. Radionuclides measurement involves difficult techniques. In this communication a procedure to determine the activity concentration of 210 Pb by liquid scintillation counting is presented. Two quality tests, using gamma- and alpha-spectrometry were applied to the 210 Pb results. (Author)

Long-term fiscal implications of funding assisted reproduction: a generational accounting model for Spain

Directory of Open Access Journals (Sweden)

R. Matorras

2015-12-01

Full Text Available The aim of this study was to assess the lifetime economic benefits of assisted reproduction in Spain by calculating the return on this investment. We developed a generational accounting model that simulates the flow of taxes paid by the individual, minus direct government transfers received over the individual’s lifetime. The difference between discounted transfers and taxes minus the cost of either IVF or artificial insemination (AI equals the net fiscal contribution (NFC of a child conceived through assisted reproduction. We conducted sensitivity analysis to test the robustness of our results under various macroeconomic scenarios. A child conceived through assisted reproduction would contribute €370,482 in net taxes to the Spanish Treasury and would receive €275,972 in transfers over their lifetime. Taking into account that only 75% of assisted reproduction pregnancies are successful, the NFC was estimated at €66,709 for IVF-conceived children and €67,253 for AI-conceived children. The return on investment for each euro invested was €15.98 for IVF and €18.53 for AI. The long-term NFC of a child conceived through assisted reproduction could range from €466,379 to €-9,529 (IVF and from €466,923 to €-8,985 (AI. The return on investment would vary between €-2.28 and €111.75 (IVF, and €-2.48 and €128.66 (AI for each euro invested. The break-even point at which the financial position would begin to favour the Spanish Treasury ranges between 29 and 41 years of age. Investment in assisted reproductive techniques may lead to positive discounted future fiscal revenue, notwithstanding its beneficial psychological effect for infertile couples in Spain.

The former school of San Buenaventura in Seville: new graphic documents

Directory of Open Access Journals (Sweden)

Alberto Fernández González

2018-05-01

Full Text Available Built in the first decades of the 17th century, the San Buenaventura Convent-School was an important architectural ensemble in the historic centre of Seville, which was demolished, almost entirely, in the mid-19th century due to roadwork carried out in the area around the present Plaza Nueva. In this article, the result of research carried out in the General Military Archive of Madrid, the author analyses and divulges the floor plan and section of the building. These graphic documents, drawn by the academic architect Juan Manuel Caballero in 1847, are extremely interesting because they reproduce the exact organization of the architecture of this Franciscan school. To complete this study, an anonymous 1687 description of the building has been recovered.

Analytical investigation of Mudéjar polychrome on the carpentry in the Casa de Pilatos palace in Seville using non-destructive XRF and complementary techniques

Science.gov (United States)

Garrote, M. A.; Robador, M. D.; Perez-Rodriguez, J. L.

2017-02-01

The pigments, execution technique and repainting used on the polychrome wood ceilings and doors in the Casa de Pilatos (Seville, Spain) were studied using portable X-ray fluorescence equipment. Cross-sections of small samples were also analysed by optical microscopy, SEM with EDX analysis, micro-Raman and micro-infrared spectroscopy and X-ray diffraction. These carpentry works are magnificent examples of the Mudéjar art made in Spain in the early 16th century. Portable X-ray fluorescence gave good information on the different components of the polychrome. The SEM-EDX study of the surfaces of small samples gave information on their components and also characterized the compounds that had been deposited or formed by environmental contamination or by the alteration of some pigments. The SEM-EDX study of cross-sections facilitated the characterization of all layers and pigments from the support to the most external layer. The following pigments were characterized: red (cinnabar/vermillion, lead oxide, iron oxides and orpiment/realgar), black (carbon black), white (white lead and titanium barium white), yellow-orange-red-brown (orpiment/realgar and iron oxides), green (chromium oxide), blue (indigo blue and ultramarine blue), and gilding (gold leaf on bole). False gold, bronze and brass were also found. The pigments were applied with the oil painting technique over a support layer that had been primed with animal glue. This support layer was gypsum in some cases and white lead in others. This study is essential to the polychrome conservation of the studied artwork, and it will help clarify uncertainties in the history and painting of Mudéjar art.

Analytical investigation of Mudéjar polychrome on the carpentry in the Casa de Pilatos palace in Seville using non-destructive XRF and complementary techniques.

Science.gov (United States)

Garrote, M A; Robador, M D; Perez-Rodriguez, J L

2017-02-15

The pigments, execution technique and repainting used on the polychrome wood ceilings and doors in the Casa de Pilatos (Seville, Spain) were studied using portable X-ray fluorescence equipment. Cross-sections of small samples were also analysed by optical microscopy, SEM with EDX analysis, micro-Raman and micro-infrared spectroscopy and X-ray diffraction. These carpentry works are magnificent examples of the Mudéjar art made in Spain in the early 16th century. Portable X-ray fluorescence gave good information on the different components of the polychrome. The SEM-EDX study of the surfaces of small samples gave information on their components and also characterized the compounds that had been deposited or formed by environmental contamination or by the alteration of some pigments. The SEM-EDX study of cross-sections facilitated the characterization of all layers and pigments from the support to the most external layer. The following pigments were characterized: red (cinnabar/vermillion, lead oxide, iron oxides and orpiment/realgar), black (carbon black), white (white lead and titanium barium white), yellow-orange-red-brown (orpiment/realgar and iron oxides), green (chromium oxide), blue (indigo blue and ultramarine blue), and gilding (gold leaf on bole). False gold, bronze and brass were also found. The pigments were applied with the oil painting technique over a support layer that had been primed with animal glue. This support layer was gypsum in some cases and white lead in others. This study is essential to the polychrome conservation of the studied artwork, and it will help clarify uncertainties in the history and painting of Mudéjar art. Copyright © 2016 Elsevier B.V. All rights reserved.

Artificial Intelligence Study (AIS).

Science.gov (United States)

1987-02-01

ARTIFICIAL INTELLIGNECE HARDWARE ....... 2-50 AI Architecture ................................... 2-49 AI Hardware ....................................... 2...ftf1 829 ARTIFICIAL INTELLIGENCE STUDY (RIS)(U) MAY CONCEPTS 1/3 A~NLYSIS AGENCY BETHESA RD R B NOJESKI FED 6? CM-RP-97-1 NCASIFIED /01/6 M |K 1.0...p/ - - ., e -- CAA- RP- 87-1 SAOFŔ)11 I ARTIFICIAL INTELLIGENCE STUDY (AIS) tNo DTICFEBRUARY 1987 LECT 00 I PREPARED BY RESEARCH AND ANALYSIS

AIS ASM Operational Integration Plan

Science.gov (United States)

2013-08-01

Rack mount computer AIS Radio Interface Ethernet Switch 192.168.0.x Firewall Cable Modem 192.168.0.1 VTS Accred. Boundary AIS ASM Operational... AIS ASM Operational Integration Plan Distribution Statement A: Approved for public release; distribution is unlimited. August 2013 Report No...CD-D-07-15 AIS ASM Operational Integration Plan ii UNCLAS//Public | CG-926 R&DC | I. Gonin, et al. | Public August 2013 N O T I C

Use of AI-1024 and AI-4096 analyzers in multiple regimes

International Nuclear Information System (INIS)

Zaika, N.D.; Kovtunenko, I.S.; Savchuk, O.G.

1975-01-01

The operation of pulse multichannel analyzers in the following multidimensional modes: AI-1024-4 - amplitude mode from several transducers; amplitude mode from several transducers at different time intervals; AI-4096-3M - amplitude mode at different time intervals in each of four groups with unit BVI-1

MassAI

DEFF Research Database (Denmark)

2011-01-01

A software tool for general analysis and data-mining of mass-spectrometric datasets. The program features a strong emphasis on scan-by-scan identification and results-transparency. MassAI also accommodates residue level analysis of labelled runs, e.g. HDX.......A software tool for general analysis and data-mining of mass-spectrometric datasets. The program features a strong emphasis on scan-by-scan identification and results-transparency. MassAI also accommodates residue level analysis of labelled runs, e.g. HDX....

Municipal distribution of bladder cancer mortality in Spain: Possible role of mining and industry

Directory of Open Access Journals (Sweden)

Escolar-Pujolar Antonio

2006-01-01

Full Text Available Abstract Background Spain shows the highest bladder cancer incidence rates in men among European countries. The most important risk factors are tobacco smoking and occupational exposure to a range of different chemical substances, such as aromatic amines. Methods This paper describes the municipal distribution of bladder cancer mortality and attempts to "adjust" this spatial pattern for the prevalence of smokers, using the autoregressive spatial model proposed by Besag, York and Molliè, with relative risk of lung cancer mortality as a surrogate. Results It has been possible to compile and ascertain the posterior distribution of relative risk for bladder cancer adjusted for lung cancer mortality, on the basis of a single Bayesian spatial model covering all of Spain's 8077 towns. Maps were plotted depicting smoothed relative risk (RR estimates, and the distribution of the posterior probability of RR>1 by sex. Towns that registered the highest relative risks for both sexes were mostly located in the Provinces of Cadiz, Seville, Huelva, Barcelona and Almería. The highest-risk area in Barcelona Province corresponded to very specific municipal areas in the Bages district, e.g., Suría, Sallent, Balsareny, Manresa and Cardona. Conclusion Mining/industrial pollution and the risk entailed in certain occupational exposures could in part be dictating the pattern of municipal bladder cancer mortality in Spain. Population exposure to arsenic is a matter that calls for attention. It would be of great interest if the relationship between the chemical quality of drinking water and the frequency of bladder cancer could be studied.

Social movements and access to assets and services. Proposal of an analytical framework based on a comparative analysis of cases: political confrontation of unemployed persons (Argentina and occupancy of housing (Spain

Directory of Open Access Journals (Sweden)

Maria-Rosa Herrera-Gutierrez

2017-06-01

Full Text Available This work is the result of collaboration between researchers from two Academic Units of Social Work located in Spain and Argentina. The overall objective is to explore the analytical frameworks and empirical objects of research projects linked to social movements developed in both countries. Specifically, two phenomena that lead to social mobilization, unemployment through the territorial expressions of the unemployed (Córdoba, Argentina and housing through the occupation of buildings by people who are evicted (Seville, Spain are compared. The work includes the description of the cases in each country, and the nuclear concepts of analysis, community social innovation in the Spanish case of occupation of housing and political confrontation in the case of Argentina. Finally, we discuss some conclusions that present the proposed dimensions for an analytical framework that responds to the relationship between social movements and access to assets and services.

Ai

African Journals Online (AJOL)

:=g=~!Ai~~~~~g~~ ~~~~~~. Jim Taylor, Rob O'Donoghue and Alistair Clacherty. INTRODUCTION. The Department of Environment Affairs, in cooperation with ...

The environmental research programme of the Centro Nacional de Aceleradores, Sevilla (Spain)

International Nuclear Information System (INIS)

Ager, F.J.; Martin, J.E.; Ynsa, M.D.; Ontalba, M.A.; Ruiz-Lara, J.R.; Respaldiza, M.A.

2001-01-01

Full text: The Centro Nacional de Aceleradores (National Accelerator Center, CNA), the first and for the moment the only Spanish ion beam analysis (IBA) laboratory, was set up in 1998 in the University of Seville (Spain). This laboratory was created with the aim to fulfill the increasing demand for IBA techniques existing in Spain. This facility is based on a 3 MB pelletron tandem accelerator, which is being used for interdisciplinary studies concerning Material Science, Art, Archaeology, Biology, Medicine, Environmental Science, etc. In addition, the works for a cyclotron laboratory are commencing now. This paper reports on the most recent applications in the field of Environmental Science carried out in our laboratory. Remediation of metal-contaminated soils and waters poses a challenging problem due to its implications in the environment and the human health. A possible solution to this problem is the phytoremediation, i.e. the process of using plants for environmental restoration taking advantage of the ability of certain terrestrial plants to absorb and accumulate metals, removing them from soils and aqueous streams. These plants are called metal hyper accumulators if they accumulate for instance more than 0.01% of Cd, 0.1% of Ni or 1% of Zn per dry weight in their shoots. For example, Cd is readily transported and accumulated in the shoots of several plant species, being a favourable target metal for this technology. In recent works making use of nuclear microscopy techniques, we investigated the sites of metal localization within the leaves of metal hyper accumulator Arabidopsis thaliana, when plants are grown in a cadmium-rich environment, and we proved that cadmium is sequestered within the trichomes on the leaf surface. The Donana Natural Park is an internationally important wetland area of 280,000 ha in the Huelva-Seville-Cadiz triangle in Southern Spain, which includes natural beaches, dunes, pine forests and marshlands as the most relevant habitats. On

Dicty_cDB: FC-AI01 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available FC (Link to library) FC-AI01 (Link to dictyBase) - - - Contig-U15592-1 FC-AI01E (Li...nk to Original site) - - - - - - FC-AI01E 307 Show FC-AI01 Library FC (Link to library) Clone ID FC-AI01 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AI/FC-AI01Q.Seq.d/ Representative seq. ID FC-AI...01E (Link to Original site) Representative DNA sequence >FC-AI01 (FC-AI01Q) /CSM/FC/FC-AI/FC-AI01Q.Seq....uences producing significant alignments: (bits) Value FC-AI01 (FC-AI01Q) /CSM/FC/FC-AI/FC-AI01Q.Seq.d/ 68 8e

Dicty_cDB: FC-AI13 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available FC (Link to library) FC-AI13 (Link to dictyBase) - - - Contig-U16263-1 FC-AI13F (Li...nk to Original site) FC-AI13F 507 - - - - - - Show FC-AI13 Library FC (Link to library) Clone ID FC-AI13 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AI/FC-AI13Q.Seq.d/ Representative seq. ID FC-AI...13F (Link to Original site) Representative DNA sequence >FC-AI13 (FC-AI13Q) /CSM/FC/FC-AI/FC-AI13Q.Seq....nificant alignments: (bits) Value FC-AI13 (FC-AI13Q) /CSM/FC/FC-AI/FC-AI13Q.Seq.d/ 963 0.0 VSA730 (VSA730Q)

Dicty_cDB: FC-AI17 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available FC (Link to library) FC-AI17 (Link to dictyBase) - - - Contig-U15690-1 FC-AI17P (Li...nk to Original site) FC-AI17F 587 FC-AI17Z 626 FC-AI17P 1212 - - Show FC-AI17 Library FC (Link to library) Clone ID FC-AI...nal site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AI/FC-AI17Q.Seq.d/ Representative seq. ID FC-AI...17P (Link to Original site) Representative DNA sequence >FC-AI17 (FC-AI17Q) /CSM/FC/FC-AI/FC-AI...slated Amino Acid sequence ANIATVGDFLKADTVVPKMIITYNKRKQGTDYLKAVIGPILSNVIKQELNLELKPNLVYA AIISEQEIRTGEKSTLDRNV

Dicty_cDB: FC-AI18 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available FC (Link to library) FC-AI18 (Link to dictyBase) - - - Contig-U15590-1 FC-AI18P (Li...nk to Original site) FC-AI18F 621 FC-AI18Z 703 FC-AI18P 1324 - - Show FC-AI18 Library FC (Link to library) Clone ID FC-AI...nal site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AI/FC-AI18Q.Seq.d/ Representative seq. ID FC-AI...18P (Link to Original site) Representative DNA sequence >FC-AI18 (FC-AI18Q) /CSM/FC/FC-AI/FC-AI...AVWPLIPGYERA DGEKQYPVAAMLCNFTKPTPTTPSLLTHDEVVTFFHEFGHVMHNMSTKVHYSMFSGTSVE RDFVECPSQLFEFWCWNKDVLVNKLSGHXKDHSKKLPTDLVERMIAAKNLNVAI

Dicty_cDB: FC-AI03 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available FC (Link to library) FC-AI03 (Link to dictyBase) - - - Contig-U15833-1 FC-AI03P (Li...nk to Original site) FC-AI03F 690 FC-AI03Z 651 FC-AI03P 1341 - - Show FC-AI03 Library FC (Link to library) Clone ID FC-AI...nal site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AI/FC-AI03Q.Seq.d/ Representative seq. ID FC-AI...03P (Link to Original site) Representative DNA sequence >FC-AI03 (FC-AI03Q) /CSM/FC/FC-AI/FC-AI...li*l*ivtlskv*qswyqvfcslmrftcwi*nv fht*ivhwsqhwhql*flqpivaiv*skapitifnlhmaslwif*ivl*sfvpfhiitmk sfkfspfvpqlki

Dicty_cDB: FC-AI04 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available FC (Link to library) FC-AI04 (Link to dictyBase) - - - Contig-U15121-1 FC-AI04E (Li...nk to Original site) - - - - - - FC-AI04E 772 Show FC-AI04 Library FC (Link to library) Clone ID FC-AI04 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AI/FC-AI04Q.Seq.d/ Representative seq. ID FC-AI...04E (Link to Original site) Representative DNA sequence >FC-AI04 (FC-AI04Q) /CSM/FC/FC-AI/FC-AI04Q.Seq....qvnkhqqvvtktvsd vlvphqvhnqvfphipqqmtlvnkhqpvvtktvsdvlvphqvhnqvfphtpqlkiqvylq vfqvvvvtiisai

Dicty_cDB: FC-AI10 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available FC (Link to library) FC-AI10 (Link to dictyBase) - - - Contig-U16270-1 FC-AI10F (Li...nk to Original site) FC-AI10F 405 - - - - - - Show FC-AI10 Library FC (Link to library) Clone ID FC-AI10 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AI/FC-AI10Q.Seq.d/ Representative seq. ID FC-AI...10F (Link to Original site) Representative DNA sequence >FC-AI10 (FC-AI10Q) /CSM/FC/FC-AI/FC-AI10Q.Seq.... sequence RKKRKSDYTSFSTYIHKLLKQITPPTNAKSNEKGDRKFTISSKAMSVMNSFVHDIFDRIA TEASGLAKKKKRQTLHSRDIQVAVRIILTGELAXHAI

Dicty_cDB: FC-AI23 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available FC (Link to library) FC-AI23 (Link to dictyBase) - - - Contig-U15308-1 FC-AI23Z (Li...nk to Original site) - - FC-AI23Z 603 - - - - Show FC-AI23 Library FC (Link to library) Clone ID FC-AI23 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AI/FC-AI23Q.Seq.d/ Representative seq. ID FC-AI...23Z (Link to Original site) Representative DNA sequence >FC-AI23 (FC-AI23Q) /CSM/FC/FC-AI/FC-AI23Q.Seq....LNTLAKKNEQVVEGEILAKQLTGVTAEELSEFKACFSHFDKDN DNKLNRLEFSSCLKSIGDELTEEQLNQVISKIDTDGNGTISFEEFIDYMVSSRKGTDSVE STKAAFKVMAEDKDFITEAQIRAAI

Dicty_cDB: FC-AI05 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available FC (Link to library) FC-AI05 (Link to dictyBase) - - - Contig-U15516-1 FC-AI05E (Li...nk to Original site) - - - - - - FC-AI05E 1189 Show FC-AI05 Library FC (Link to library) Clone ID FC-AI05 (L...//dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AI/FC-AI05Q.Seq.d/ Representative seq. ID FC-AI...05E (Link to Original site) Representative DNA sequence >FC-AI05 (FC-AI05Q) /CSM/FC/FC-AI/FC-AI05Q.Seq...KIVGEASLKNKGKMSRVLAAKAALSARFD ALCEVSDTSYGIAYKGAVDRRAAAIEGREVRKSLNAVKPEKSGNVAKYDHTKSATTNTTR DVATKSSKESSIKQEKQ

Dicty_cDB: FC-AI21 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available FC (Link to library) FC-AI21 (Link to dictyBase) - - - Contig-U16254-1 FC-AI21Z (Li...nk to Original site) - - FC-AI21Z 696 - - - - Show FC-AI21 Library FC (Link to library) Clone ID FC-AI21 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AI/FC-AI21Q.Seq.d/ Representative seq. ID FC-AI...21Z (Link to Original site) Representative DNA sequence >FC-AI21 (FC-AI21Q) /CSM/FC/FC-AI/FC-AI21Q.Seq....YPGYMYTDLSTIYERAGRIQGRNGSITQI PILTMPNDDITHPIPDLTGYITEGQIFIDRQINNRQIYPPINVLPSLSRLMKSAI

Introduction to a special section: Impacts and implications of future-oriented technology analysis for policy and decision-making

OpenAIRE

Karel Haegeman; Jennifer C Harper; Ron Johnston

2010-01-01

Experiences of recent years place a premium, for governments and individuals, on being able to discern the possible shape of the future: what is likely to influence it, and what can be done to prepare for it. This special section is based on selected papers from the Third International Seville Seminar on Future-Oriented Technology Analysis, held 16–17 October 2008 at Seville, Spain, which addressed the challenge of increasing the impact of future-oriented technology analysis on policy and dec...

Dicty_cDB: FC-AI12 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available FC (Link to library) FC-AI12 (Link to dictyBase) - - - Contig-U15484-1 FC-AI12Z (Li...nk to Original site) - - FC-AI12Z 614 - - - - Show FC-AI12 Library FC (Link to library) Clone ID FC-AI12 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AI/FC-AI12Q.Seq.d/ Representative seq. ID FC-AI...12Z (Link to Original site) Representative DNA sequence >FC-AI12 (FC-AI12Q) /CSM/FC/FC-AI/FC-AI12Q.Seq....EKIVRRI ELLDGITCYRNEKAKDEIVLTGNSLELLSQSCATIQLRSAIKYKDVRKFLDGIYVSERNV LESN*in*riys

Dicty_cDB: FC-AI19 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available FC (Link to library) FC-AI19 (Link to dictyBase) - - - Contig-U15115-1 FC-AI19Z (Li...nk to Original site) - - FC-AI19Z 661 - - - - Show FC-AI19 Library FC (Link to library) Clone ID FC-AI19 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AI/FC-AI19Q.Seq.d/ Representative seq. ID FC-AI...19Z (Link to Original site) Representative DNA sequence >FC-AI19 (FC-AI19Q) /CSM/FC/FC-AI/FC-AI19Q.Seq....lmrqswvkkiesi*lvl krrkkkknnkkkkkkkkkkklfn*lvnkkn*ik*kkllcnqkk Frame B: ---*ekaieilsklfsin*kfn**ysiiigkkstkyq

Dicty_cDB: FC-AI14 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available FC (Link to library) FC-AI14 (Link to dictyBase) - - - Contig-U16280-1 FC-AI14Z (Li...nk to Original site) - - FC-AI14Z 671 - - - - Show FC-AI14 Library FC (Link to library) Clone ID FC-AI14 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AI/FC-AI14Q.Seq.d/ Representative seq. ID FC-AI...14Z (Link to Original site) Representative DNA sequence >FC-AI14 (FC-AI14Q) /CSM/FC/FC-AI/FC-AI14Q.Seq....nqrllv*lvvlskklqllnsnqsfkfkkvq rmkknsvkntkn*rfvllt*nlkslkrmpksknsptkliifilkly Frame B: ---lkdl*krtphl*stcfhhptlcssrrfclwslnai

Dicty_cDB: FC-AI06 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available FC (Link to library) FC-AI06 (Link to dictyBase) - - - Contig-U16465-1 FC-AI06E (Li...nk to Original site) - - - - - - FC-AI06E 1138 Show FC-AI06 Library FC (Link to library) Clone ID FC-AI06 (L...//dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AI/FC-AI06Q.Seq.d/ Representative seq. ID FC-AI...06E (Link to Original site) Representative DNA sequence >FC-AI06 (FC-AI06Q) /CSM/FC/FC-AI/FC-AI06Q.Seq...FGRGIDIERVNVVINYDMAESADTYLHRVGRAGRFGTK GLAISFVPSKEDPVLEQVQSKFVVSIKELVATPDPSTYMSG*kkkkkkkknlfvlksikk k*kkk*in

Dicty_cDB: FC-AI09 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available FC (Link to library) FC-AI09 (Link to dictyBase) - - - Contig-U16149-1 FC-AI09Z (Li...nk to Original site) - - FC-AI09Z 591 - - - - Show FC-AI09 Library FC (Link to library) Clone ID FC-AI09 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AI/FC-AI09Q.Seq.d/ Representative seq. ID FC-AI...09Z (Link to Original site) Representative DNA sequence >FC-AI09 (FC-AI09Q) /CSM/FC/FC-AI/FC-AI09Q.Seq....*tkl ik*ilifykiknnkkkkkk Frame B: ---gt*kvpeflailfkrmasrsvlwy*rcltkakkglkapqtltik

AI 3D Cybug Gaming

OpenAIRE

Ahmed, Zeeshan

2010-01-01

In this short paper I briefly discuss 3D war Game based on artificial intelligence concepts called AI WAR. Going in to the details, I present the importance of CAICL language and how this language is used in AI WAR. Moreover I also present a designed and implemented 3D War Cybug for AI WAR using CAICL and discus the implemented strategy to defeat its enemies during the game life.

The "El Alamo" project (1990-1997): two consecutive hospital-based studies of breast cancer outcomes in Spain.

Science.gov (United States)

Martín, M; Mahillo, E; Llombart-Cussac, A; Lluch, A; Munarriz, B; Pastor, M; Alba, E; Ruiz, A; Antón, A; Bermejo, B

2006-07-01

The "Alamo" project is a retrospective analysis of 14,854 patients diagnosed of breast cancer between 1990 and 1997 in 50 Spanish hospitals. Alamo I (AI) consisted of 4,532 patients diagnosed with breast cancer between 1990 and 1993. Data were collected in 2000. Alamo II (AII) consisted of 10,322 patients diagnosed between 1994 and 1997. Data were collected in 2003. At presentation, there were (AI vs. AII) 17.6% vs. 24.3% at stage I; 55.5% vs. 53.1% at stage II; 18.7% vs. 15% at stage III; 7.2% vs. 5.9 at stage IV. Median age was 57 (AI) vs. 58 years (AII) and 65.9% vs. 67.2% (AI vs. AII) were post-menopausal. Firstline treatment for disease stages I, II and III was surgery in 91% of patients in both studies. Breast conserving surgery rate increased from 20.2% (AI) to 32.7% (AII). Adjuvant systemic treatments were administered to 87.6% (AI) and 92.8% (AII) of patients. Recurrence rate diminished from 36.6% (AI) to 22.5% (AII) and the 9-year survival rate increased from 63.2% (95% CI: 61.5-64.9) to 70.1% (95% CI: 68.5-71.8). Breast cancer outcomes in Spain have improved from 1990-1993 to 1994-1997, likely because of breast cancer screening program implementation and new therapies.

Dicty_cDB: FC-AI15 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available FC (Link to library) FC-AI15 (Link to dictyBase) - G01730 DDB0214993 Contig-U15123-1 FC-AI...15E (Link to Original site) - - - - - - FC-AI15E 856 Show FC-AI15 Library FC (Link to library) Clone ID FC-AI...3-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AI/FC-AI15Q.Se...q.d/ Representative seq. ID FC-AI15E (Link to Original site) Representative DNA sequence >FC-AI15 (FC-AI15Q) /CSM/FC/FC-AI/FC-AI...AAAAAAAATA sequence update 1996.12.24 Translated Amino Acid sequence kt*riyi*KMMIKYITIAILFIASLVKADLQFSLCPTCV

Dicty_cDB: FC-AI24 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available FC (Link to library) FC-AI24 (Link to dictyBase) - - - - FC-AI24Z (Link to Original site) - - FC-AI...24Z 693 - - - - Show FC-AI24 Library FC (Link to library) Clone ID FC-AI24 (Link to dictyBas...e) Atlas ID - NBRP ID - dictyBase ID - Link to Contig - Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AI/FC-AI...24Q.Seq.d/ Representative seq. ID FC-AI24Z (Link to Original s...ite) Representative DNA sequence >FC-AI24 (FC-AI24Q) /CSM/FC/FC-AI/FC-AI24Q.Seq.d/ XXXXXXXXXXAAATTAGAAAACAAA

Dicty_cDB: FC-AI08 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available FC (Link to library) FC-AI08 (Link to dictyBase) - G01729 DDB0233148 Contig-U14939-1 FC-AI...08P (Link to Original site) FC-AI08F 654 FC-AI08Z 563 FC-AI08P 1217 - - Show FC-AI08 Library FC (Link... to library) Clone ID FC-AI08 (Link to dictyBase) Atlas ID - NBRP ID G01729 dictyBase ID DDB0233148 Link to ...Contig Contig-U14939-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AI/FC-AI...08Q.Seq.d/ Representative seq. ID FC-AI08P (Link to Original site) Representative DNA sequence >FC-AI08 (FC-AI

The BSM-AI project: SUSY-AI-generalizing LHC limits on supersymmetry with machine learning

Energy Technology Data Exchange (ETDEWEB)

Caron, Sascha [Radboud Universiteit, Institute for Mathematics, Astro- and Particle Physics IMAPP, Nijmegen (Netherlands); Nikhef, Amsterdam (Netherlands); Kim, Jong Soo [UAM/CSIC, Instituto de Fisica Teorica, Madrid (Spain); Rolbiecki, Krzysztof [UAM/CSIC, Instituto de Fisica Teorica, Madrid (Spain); University of Warsaw, Faculty of Physics, Warsaw (Poland); Ruiz de Austri, Roberto [IFIC-UV/CSIC, Instituto de Fisica Corpuscular, Valencia (Spain); Stienen, Bob [Radboud Universiteit, Institute for Mathematics, Astro- and Particle Physics IMAPP, Nijmegen (Netherlands)

2017-04-15

A key research question at the Large Hadron Collider is the test of models of new physics. Testing if a particular parameter set of such a model is excluded by LHC data is a challenge: it requires time consuming generation of scattering events, simulation of the detector response, event reconstruction, cross section calculations and analysis code to test against several hundred signal regions defined by the ATLAS and CMS experiments. In the BSM-AI project we approach this challenge with a new idea. A machine learning tool is devised to predict within a fraction of a millisecond if a model is excluded or not directly from the model parameters. A first example is SUSY-AI, trained on the phenomenological supersymmetric standard model (pMSSM). About 300, 000 pMSSM model sets - each tested against 200 signal regions by ATLAS - have been used to train and validate SUSY-AI. The code is currently able to reproduce the ATLAS exclusion regions in 19 dimensions with an accuracy of at least 93%. It has been validated further within the constrained MSSM and the minimal natural supersymmetric model, again showing high accuracy. SUSY-AI and its future BSM derivatives will help to solve the problem of recasting LHC results for any model of new physics. SUSY-AI can be downloaded from http://susyai.hepforge.org/. An on-line interface to the program for quick testing purposes can be found at http://www.susy-ai.org/. (orig.)

The BSM-AI project: SUSY-AI-generalizing LHC limits on supersymmetry with machine learning

International Nuclear Information System (INIS)

Caron, Sascha; Kim, Jong Soo; Rolbiecki, Krzysztof; Ruiz de Austri, Roberto; Stienen, Bob

2017-01-01

A key research question at the Large Hadron Collider is the test of models of new physics. Testing if a particular parameter set of such a model is excluded by LHC data is a challenge: it requires time consuming generation of scattering events, simulation of the detector response, event reconstruction, cross section calculations and analysis code to test against several hundred signal regions defined by the ATLAS and CMS experiments. In the BSM-AI project we approach this challenge with a new idea. A machine learning tool is devised to predict within a fraction of a millisecond if a model is excluded or not directly from the model parameters. A first example is SUSY-AI, trained on the phenomenological supersymmetric standard model (pMSSM). About 300, 000 pMSSM model sets - each tested against 200 signal regions by ATLAS - have been used to train and validate SUSY-AI. The code is currently able to reproduce the ATLAS exclusion regions in 19 dimensions with an accuracy of at least 93%. It has been validated further within the constrained MSSM and the minimal natural supersymmetric model, again showing high accuracy. SUSY-AI and its future BSM derivatives will help to solve the problem of recasting LHC results for any model of new physics. SUSY-AI can be downloaded from http://susyai.hepforge.org/. An on-line interface to the program for quick testing purposes can be found at http://www.susy-ai.org/. (orig.)

Dicty_cDB: FC-AI07 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available FC (Link to library) FC-AI07 (Link to dictyBase) - - - Contig-U15296-1 | Contig-U15756-1 FC-AI...07P (Link to Original site) FC-AI07F 580 FC-AI07Z 723 FC-AI07P 1303 - - Show FC-AI07 Library FC (...Link to library) Clone ID FC-AI07 (Link to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Con...tig-U15296-1 | Contig-U15756-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AI/FC-AI...07Q.Seq.d/ Representative seq. ID FC-AI07P (Link to Original site) Representative DNA sequence >FC-AI07 (FC-AI

Dicty_cDB: FC-AI22 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available FC (Link to library) FC-AI22 (Link to dictyBase) - - - Contig-U15369-1 | Contig-U15732-1 FC-AI...22P (Link to Original site) FC-AI22F 583 FC-AI22Z 683 FC-AI22P 1266 - - Show FC-AI22 Library FC (...Link to library) Clone ID FC-AI22 (Link to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Con...tig-U15369-1 | Contig-U15732-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AI/FC-AI...22Q.Seq.d/ Representative seq. ID FC-AI22P (Link to Original site) Representative DNA sequence >FC-AI22 (FC-AI

The London Charter and the Seville Principles as sources of requirements for e-archaeology systems development purposes

Directory of Open Access Journals (Sweden)

Juan M. Carrillo Gea

2013-11-01

Full Text Available Requirements engineering (RE is a discipline of critical importance in software development. This paper provides a process and a set of software artefacts to help in the production of e-archaeology systems with emphasis on requirements reuse and standards. In particular, two important guidelines in the field of earchaeology, the London Charter and the Principles of Seville, have been shown as two sources of requirements to be considered as a starting point for developing this type of systems.

Health Information in French (français)

Science.gov (United States)

... Biopsy - français (French) Bilingual PDF Health Information Translations Breast Biopsy - français (French) Bilingual PDF Health Information Translations Colposcopy - français (French) Bilingual PDF ...

Two new Oxalis species (Oxalidaceae) from the Ai-Ais / Richtersveld Transfrontier Park, South Africa

NARCIS (Netherlands)

Roets, F.; Oberlander, K.C.; Dreyer, L.L.

2012-01-01

South Africa has a rich, but scantily surveyed, desert flora. Documenting annual and geophytic species in this biome is challenging, as they usually only flower after adequate precipitation, which is characteristically erratic and infrequent. Recent floristic surveys in the Ai-Ais / Richtersveld

An SDR based AIS receiver for satellites

DEFF Research Database (Denmark)

Larsen, Jesper Abildgaard; Mortensen, Hans Peter; Nielsen, Jens Frederik Dalsgaard

2011-01-01

For a few years now, there has been a high interest in monitoring the global ship traffic from space. A few satellite, capable of listening for ship borne AIS transponders have already been launched, and soon the AAUSAT3, carrying two different types of AIS receivers will also be launched. One...... of the AIS receivers onboard AAUSAT3 is an SDR based AIS receiver. This paper serves to describe the background of the AIS system, and how the SDR based receiver has been integrated into the AAUSAT3 satellite. Amongst some of the benefits of using an SDR based receiver is, that due to its versatility, new...... detection algorithms are easily deployed, and it is easily adapted the new proposed AIS transmission channels....

PARTICLE FACTORIES: Tau-charm in the spotlight

International Nuclear Information System (INIS)

Anon.

1991-01-01

Following earlier workshops in Stanford (1989) and in Orsay (1990), some hundred physicists from Europe and the United States met from 29 April to 2 May in Seville, Spain, to consolidate plans for a Tau-Charm Factory

PARTICLE FACTORIES: Tau-charm in the spotlight

Energy Technology Data Exchange (ETDEWEB)

Anon.

1991-07-15

Following earlier workshops in Stanford (1989) and in Orsay (1990), some hundred physicists from Europe and the United States met from 29 April to 2 May in Seville, Spain, to consolidate plans for a Tau-Charm Factory.

Airborne grass (Poaceae) pollen in southern Spain. Results of a 10-year study (1987-96).

Science.gov (United States)

González Minero, F J; Candau, P; Tomás, C; Morales, J

1998-03-01

This work reports an exhaustive study of the aerobiology of the Gramineae in Seville, Spain, which is typical of coastal Mediterranean areas. Sampling was done with a Cour trap installed on the roof terrace of the School of Pharmacy, Seville, from 1987 to 1996, both inclusive. The climatic pattern of that period was characterized by two exceptionally wet years (1989 and 1996), between which were 5 consecutive years of drought (1990-5). This typically Mediterranean climate affects grass aerobiology. The annual amounts of total grass pollen are low, never exceeding 2500 grains/m3. The start, length, and intensity of the pollen season are significantly correlated with preseasonal meteorologic factors (precipitation and temperature), but intraseasonal meteorologic conditions have no effect on the three variables. The relationships are stated by three equations that, while further years of observations are anticipated, can be considered models to forecast the characteristics of the pollen season: the starting date depends on the mean temperatures of January and February, and the length and intensity of the season depend on the rainfall between the beginning of January and the starting date of the season. For the study period, the weekly concentrations (pollen curves) throughout the year showed no typical pattern of variation over the years, so that it was impossible to make mid- and long-term forecasts of the variation in weekly concentration. The most noteworthy aspects of grass pollen curves are a long pollen season, which starts in February or March and lasts until September or October; peaks of higher concentration (> 100 grains/m3) in May and June, associated with increases in temperature and absence of precipitation; and other peaks in the summer months that may be as high as the spring peaks.

AI its nature and future

CERN Document Server

Boden, Margaret A

2016-01-01

least - on the Internet. Margaret Boden considers the realistic and unrealistic expectations we have placed on AI, analyses its progress, and considers the value of its byproducts. ations we have placed on AI, analyses its progress, and considers the value of its byproducts.

Transverse Magnetic Waves in Myelinated Nerves

Science.gov (United States)

2001-10-25

IN MYELINATED NERVES M. Mª Villapecellín-Cid1, L. Mª Roa2, and J. Reina-Tosina1 1Área de Teoría de la Señal y Comunicaciones , E.S. de Ingeniería...Element Number Author(s) Project Number Task Number Work Unit Number Performing Organization Name(s) and Address(es) Área de Teoría de la Señal...y Comunicaciones , E.S. de Ingeniería, University of Seville, Seville, Spain Performing Organization Report Number Sponsoring/Monitoring Agency Name(s

Modeling Progress in AI

OpenAIRE

Brundage, Miles

2015-01-01

Participants in recent discussions of AI-related issues ranging from intelligence explosion to technological unemployment have made diverse claims about the nature, pace, and drivers of progress in AI. However, these theories are rarely specified in enough detail to enable systematic evaluation of their assumptions or to extrapolate progress quantitatively, as is often done with some success in other technological domains. After reviewing relevant literatures and justifying the need for more ...

The implementation of AI technologies in computer wargames

Science.gov (United States)

Tiller, John A.

2004-08-01

Computer wargames involve the most in-depth analysis of general game theory. The enumerated turns of a game like chess are dwarfed by the exponentially larger possibilities of even a simple computer wargame. Implementing challenging AI is computer wargames is an important goal in both the commercial and military environments. In the commercial marketplace, customers demand a challenging AI opponent when they play a computer wargame and are frustrated by a lack of competence on the part of the AI. In the military environment, challenging AI opponents are important for several reasons. A challenging AI opponent will force the military professional to avoid routine or set-piece approaches to situations and cause them to think much deeper about military situations before taking action. A good AI opponent would also include national characteristics of the opponent being simulated, thus providing the military professional with even more of a challenge in planning and approach. Implementing current AI technologies in computer wargames is a technological challenge. The goal is to join the needs of AI in computer wargames with the solutions of current AI technologies. This talk will address several of those issues, possible solutions, and currently unsolved problems.

Tweeting AI: Perceptions of Lay vs Expert Twitterati

OpenAIRE

Manikonda, Lydia; Kambhampati, Subbarao

2017-01-01

With the recent advancements in Artificial Intelligence (AI), various organizations and individuals are debating about the progress of AI as a blessing or a curse for the future of the society. This paper conducts an investigation on how the public perceives the progress of AI by utilizing the data shared on Twitter. Specifically, this paper performs a comparative analysis on the understanding of users belonging to two categories -- general AI-Tweeters (AIT) and expert AI-Tweeters (EAIT) who ...

Uptake of heavy metals and As by Brassica juncea grown in a contaminated soil in Aznalcollar (Spain): The effect of soil amendments

International Nuclear Information System (INIS)

Clemente, Rafael; Walker, David J.; Bernal, M. Pilar

2005-01-01

Two crops of Brassica juncea (L.) Czern. were grown in a field experiment, at the site affected by the toxic spillage of acidic, metal-rich waste in Aznalcollar (Seville, Spain), to study its metal accumulation and the feasibility of its use for metal phytoextraction. The effects of organic soil amendments (cow manure and mature compost) and lime on biomass production and plant survival were also assessed; plots without organic amendment and without lime were used as controls. Plots, with or without organic amendment, having pH -1 , respectively). The total uptake of heavy metals in the plants was relatively low, emphasising the problems faced when attempting to employ phytoextraction for clean-up of pluri-contaminated sites. - Although organic amendments improved soil conditions and plant growth, the phytoextraction capacity of Brassica juncea (cv. Z1) is too low for efficient soil remediation

Areal Informations Systemet - AIS

DEFF Research Database (Denmark)

Nielsen, K.; Stjernholm, M.; Olsen, B. Ø.

Forord: Denne rapport giver en kort beskrivelse af Areal Informations Systemet (AIS), som er et databasesystem med natur- og miljødata, som kan stedfæstes geografisk. Projektet er gennemført i perioden 1996-2000 som et samarbejdsprojekt mellem Danmarks Miljøundersøgelser (DMU), Danmarks og...... og enkeltpersoner med interesse for natur- og miljøforhold i Danmark. Yderligere oplysninger om Areal Informations Systemet, herunder adgangsforhold, kan fås på DMU's hjemmeside med følgende adresse: http://ais.dmu.dk/ Projektet er finansieret af Miljø- og Energiministeriet, mens en række...... (planlægning, beskyttelse), geologi (overfladegeologi og marin geologi), samt marin dybdemodel. # Etablering af dataadgang for Miljø- og Energiministeriets institutioner til AIS-data. # Afprøvning af systemet i forhold til konkrete projekter. # Formidling af produkterne til brugerkredsen....

Adaptive Motion Gaming AI for Health Promotion

OpenAIRE

Paliyawan, Pujana; Kusano, Takahiro; Nakagawa, Yuto; Harada, Tomohiro; Thawonmas, Ruck

2017-01-01

This paper presents a design of a non-player character (AI) for promoting balancedness in use of body segments when engaging in full-body motion gaming. In our experiment, we settle a battle between the proposed AI and a player by using FightingICE, a fighting game platform for AI development. A middleware called UKI is used to allow the player to control the game by using body motion instead of the keyboard and mouse. During gameplay, the proposed AI analyze health states of the player; it d...

GC/MS in the study of deterioration process of historical monuments: characterization of the black crust formed in the Cathedral of Seville

International Nuclear Information System (INIS)

Reyes, J.; Hermosin, B.; Saiz J, C.

2006-01-01

Here, we present an interesting application of Gas Chromatography/Mass Spectrometry (GC/MS) technique which permitted to differentiate successfully between natural and anthropogenic compounds present in the black crust formed in the Cathedral of Seville. This building, considered as one of the most important historic and cultural European monuments suffers from intense blackening of its outside walls and sculptures due to the interaction with the urban environment. Fragment of black crusts were removed from the Cathedral walls and extraction process with organic solvents was carried out. The aliphatic, aromatic and polar fractions were separated and analyzed using GC/MS. A complex organic composition of the black crusts indicated the accumulative character of the deposition process of atmospheric particles as a function of the time. The presence of high molecular weight n-alkanes, n-fatty acids and natural molecular markers identified during the study were indicative of current biogenic contributions. It was also found an important group of petrogenic molecular markers related with diesel soot emissions from motor engines. The diesel soot and molecular markers were entrapped within the black crust mineral matrix and contribute to the observed blackening of the Seville Cathedral. (Author)

Artificial intelligence. Fears of an AI pioneer.

Science.gov (United States)

Russell, Stuart; Bohannon, John

2015-07-17

From the enraged robots in the 1920 play R.U.R. to the homicidal computer H.A.L. in 2001: A Space Odyssey, science fiction writers have embraced the dark side of artificial intelligence (AI) ever since the concept entered our collective imagination. Sluggish progress in AI research, especially during the “AI winter” of the 1970s and 1980s, made such worries seem far-fetched. But recent breakthroughs in machine learning and vast improvements in computational power have brought a flood of research funding— and fresh concerns about where AI may lead us. One researcher now speaking up is Stuart Russell, a computer scientist at the University of California, Berkeley, who with Peter Norvig, director of research at Google, wrote the premier AI textbook, Artificial Intelligence: A Modern Approach, now in its third edition. Last year, Russell joined the Centre for the Study of Existential Risk at Cambridge University in the United Kingdom as an AI expert focusing on “risks that could lead to human extinction.” Among his chief concerns, which he aired at an April meeting in Geneva, Switzerland, run by the United Nations, is the danger of putting military drones and weaponry under the full control of AI systems. This interview has been edited for clarity and brevity.

Why Don't Accounting Students like AIS?

Science.gov (United States)

Vatanasakdakul, Savanid; Aoun, Chadi

2011-01-01

Purpose: The demand for Accounting Information Systems (AIS) knowledge has increased exponentially over the past two decades, but studying AIS has not proved easy for many accounting students. The aim of the study is to understand the challenges accounting students face in studying AIS through investigation of the factors which may be contributing…

Newspapers as early meteorological data sources in Andalusia (southern Spain), 1796-1830.

Science.gov (United States)

Fernández-Montes, S.; Rodrigo, F. S.

2010-09-01

The growing evidence of an anthropogenically induced climatic change and the need to compare present-day climate with that of the past centuries, has boosted the search of early meteorological data from all kind of historical archives. Among the documentary data sources, early newspapers deserve special attention. Anonymous observers began to send their data to local newspapers to ensure that people were informed of them. Hardly anything is known of the conditions in which these recording were made, and press collections conserved from late 18th century to mid-19th century are fragmentary. However, it is interesting to analyze the potential of these newspapers as climatic data sources in a period prior to the existence of an official meteorological service. In this work, some examples of Andalusian cities (southern Spain) are analyzed and their utility as data sources is studied: El Mensagero (1796-1797), El Publicista (1812-1813), Diario Constitucional (1820) of Granada, Diario del Gobierno de Sevilla (1812-1813), Diario de Sevilla (1826-1831), Diario de Sevilla de Comercio, Artes y Literatura (1829-1830) of Seville, and Diario Mercantil de Cádiz (1802-1803, 1816-1830) of Cádiz. Future research is outlined.

Perception of weight and psychological variables in a sample of Spanish adolescents

Directory of Open Access Journals (Sweden)

Jáuregui-Lobera I

2011-06-01

Full Text Available Ignacio Jáuregui-Lobera1,2, Patricia Bolaños-Ríos2, María José Santiago-Fernández2, Olivia Garrido-Casals2, Elsa Sánchez31Department of Nutrition and Bromatology, Pablo de Olavide University, Seville, Spain; 2Behavioral Sciences Institute, Seville, Spain; 3Professional Schools Sagrada Familia, Écija, Seville, SpainBackground: This study explored the relationship between body mass index (BMI and weight perception, self-esteem, positive body image, food beliefs, and mental health status, along with any gender differences in weight perception, in a sample of adolescents in Spain.Methods: The sample comprised 85 students (53 females and 32 males, mean age 17.4 ± 5.5 years with no psychiatric history who were recruited from a high school in Écija, Seville. Weight and height were recorded for all participants, who were then classified according to whether they perceived themselves as slightly overweight, very overweight, very underweight, slightly underweight, or about the right weight, using the question “How do you think of yourself in terms of weight?”. Finally, a series of questionnaires were administered, including the Irrational Food Beliefs Scale, Body Appreciation Scale, Self Esteem Scale, and General Health Questionnaire.Results: Overall, 23.5% of participants misperceived their weight. Taking into account only those with a normal BMI (percentile 5–85, there was a significant gender difference with respect to those who perceived themselves as overweight (slightly overweight and very overweight; 13.9% of females and 7.9% of males perceived themselves as overweight (χ2 = 3.957, P < 0.05. There was a significant difference for age, with participants who perceived their weight adequately being of mean age 16.34 ± 3.17 years and those who misperceived their weight being of mean age 18.50 ± 4.02 years (F = 3.112, P < 0.05.Conclusion: Misperception of overweight seems to be more frequent in female adolescents, and mainly among

AI and Mathematical Education

Directory of Open Access Journals (Sweden)

Angel Garrido

2012-01-01

Full Text Available From ancient times, the history of human beings has developed by a succession of steps and sometimes jumps, until reaching the relative sophistication of the modern brain and culture. Researchers are attempting to create systems that mimic human thinking, understand speech, or beat the best human chess player. Understanding the mechanisms of intelligence, and creating intelligent artifacts are the twin goals of Artificial Intelligence (AI. Great mathematical minds have played a key role in AI in recent years; to name only a few: Janos Neumann (also known as John von Neumann, Konrad Zuse, Norbert Wiener, Claude E. Shannon, Alan M. Turing, Grigore Moisil, Lofti A. Zadeh, Ronald R. Yager, Michio Sugeno, Solomon Marcus, or Lászlo A. Barabási. Introducing the study of AI is not merely useful because of its capability for solving difficult problems, but also because of its mathematical nature. It prepares us to understand the current world, enabling us to act on the challenges of the future.

"All-In-One Test" (AI1)

DEFF Research Database (Denmark)

Giacalone, Davide; Bredie, Wender Laurentius Petrus; Frøst, Michael Bom

2013-01-01

by the Check-All-That-Apply (CATA) technique is reported. In this exploratory "All-In-One Test"(AI1), subjects (N = 160) filled out a questionnaire with demographic and psychographic variables, and appropriateness ratings for specific sensory descriptors of beer. Subsequently, subjects gave hedonic ratings...... between appropriateness and actual hedonic response. Overall, the AI1 test provided interpretable results concerning consumer perception (sensory/hedonic) of the beers, and revealed relations with consumers' background information. Initial results with AI1 test show that it is an efficient and versatile...

AI in space: Past, present, and possible futures

Science.gov (United States)

Rose, Donald D.; Post, Jonathan V.

1992-01-01

While artificial intelligence (AI) has become increasingly present in recent space applications, new missions being planned will require even more incorporation of AI techniques. In this paper, we survey some of the progress made to date in implementing such programs, some current directions and issues, and speculate about the future of AI in space scenarios. We also provide examples of how thinkers from the realm of science fiction have envisioned AI's role in various aspects of space exploration.

The Potential of AI Techniques for Remote Sensing

Science.gov (United States)

Estes, J. E.; Sailer, C. T. (Principal Investigator); Tinney, L. R.

1984-01-01

The current status of artificial intelligence AI technology is discussed along with imagery data management, database interrogation, and decision making. Techniques adapted from the field of artificial intelligence (AI) have significant, wide ranging impacts upon computer-assisted remote sensing analysis. AI based techniques offer a powerful and fundamentally different approach to many remote sensing tasks. In addition to computer assisted analysis, AI techniques can also aid onboard spacecraft data processing and analysis and database access and query.

Radioimmunoassay of apolipoprotein A-I of rat serum

International Nuclear Information System (INIS)

Fainaru, M.; Havel, R.J.; Felker, T.E.

1976-01-01

A double antibody radioimmunoassay technique was developed for quantification of apolipoprotein A-I, the major apoprotein of rat high density lipoprotein. Apo A-I was labelled with 125 I by the chloramine-T method. 125 I-labeled apo A-I had the same electrophoretic mobility as unlabeled apo A-I and more than 80% of the 125 I was precipitated by rabbit anti apo A-I antibodies. The assay is sensitive at the level of 0.5-5 ng, and has intraassay and interassay coefficients of variation of 4.5 and 6.5% respectively. The specificity of the assay was established by competitive displacement of 125 I-labeled apo A-I from its antibody by apo A-I and lipoproteins containing apo A-I, but not by rat albumin and other apoproteins. Immunoreactivity of high density lipoprotein and serum was only about 35% of that of their delipidated forms when Veronal buffer was used as a diluent. Inclusion of 5 mM sodium decyl sulfate in the incubation mixture brought out reactivity equivalent to that found after delipidation. Completeness of the reaction was verified by comparison with the amount of apo A-I in chromatographic fractions of the total apoprotein of high density lipoprotein. Content (weight %, mean values +- S.D.) of immunoassayable apo A-I was: 62.3 +- 5.9 in high density lipoprotein; 1.7 +- 0.3 in low density lipoprotein; 0.09 +- 0.03 in very low density lipoprotein and 25.0 +- 5.0 in lymph chylomicrons. Concentration in whole serum was 51.4 +- 8.9 mg/dl and 33.6 +- 4.1 mg/dl for female and male rats, respectively (p 1.21 g/ml and <1% in lipoproteins of d<1.063 g/ml

Beyond AI: Interdisciplinary Aspects of Artificial Intelligence

CERN Document Server

Romportl, Jan; Zackova, Eva; Beyond Artificial Intelligence : Contemplations, Expectations, Applications

2013-01-01

Products of modern artificial intelligence (AI) have mostly been formed by the views, opinions and goals of the “insiders”, i.e. people usually with engineering background who are driven by the force that can be metaphorically described as the pursuit of the craft of Hephaestus. However, since the present-day technology allows for tighter and tighter mergence of the “natural” everyday human life with machines of immense complexity, the responsible reaction of the scientific community should be based on cautious reflection of what really lies beyond AI, i.e. on the frontiers where the tumultuous ever-growing and ever-changing cloud of AI touches the rest of the world.   The chapters of this boo are based on the selected subset of the presentations that were delivered by their respective authors at the conference “Beyond AI: Interdisciplinary Aspects of Artificial Intelligence” held in Pilsen in December 2011.   From its very definition, the reflection of the phenomena that lie beyond AI must be i...

USACE AIS Transmit Technical Support Summary Report

Science.gov (United States)

2014-09-01

the TAG block for the correct transmitters, and then send to the USACE AIS network. B. Outbound openings in the USCG firewall for the USCG Message...USACE AIS Transmit Technical Support Summary Report Distribution Statement A: Approved for public release; distribution is unlimited...September 2014 Report No. CD-D-09-15 USACE AIS Transmit Technical Support Summary Report ii UNCLAS//Public | CG-926 RDC | I. Gonin et al. Public

AI applications in sheet metal forming

CERN Document Server

Hussein, Hussein

2017-01-01

This book comprises chapters on research work done around the globe in the area of artificial intelligence (AI) applications in sheet metal forming. The first chapter offers an introduction to various AI techniques and sheet metal forming, while subsequent chapters describe traditional procedures/methods used in various sheet metal forming processes, and focus on the automation of those processes by means of AI techniques, such as KBS, ANN, GA, CBR, etc. Feature recognition and the manufacturability assessment of sheet metal parts, process planning, strip-layout design, selecting the type and size of die components, die modeling, and predicting die life are some of the most important aspects of sheet metal work. Traditionally, these activities are highly experience-based, tedious and time consuming. In response, researchers in several countries have applied various AI techniques to automate these activities, which are covered in this book. This book will be useful for engineers working in sheet metal industri...

Adult Prevalence of Epilepsy in Spain: EPIBERIA, a Population-Based Study

Directory of Open Access Journals (Sweden)

Pedro J. Serrano-Castro

2015-01-01

Full Text Available Background. This study assesses the lifetime and active prevalence of epilepsy in Spain in people older than 18 years. Methods. EPIBERIA is a population-based epidemiological study of epilepsy prevalence using data from three representative Spanish regions (health districts in Zaragoza, Almería, and Seville between 2012 and 2013. The study consisted of two phases: screening and confirmation. Participants completed a previously validated questionnaire (EPIBERIA questionnaire over the telephone. Results. A total of 1741 valid questionnaires were obtained, including 261 (14.99% raising a suspicion of epilepsy. Of these suspected cases, 216 (82.75% agreed to participate in phase 2. Of the phase 2 participants, 22 met the International League Against Epilepsy’s diagnostic criteria for epilepsy. The estimated lifetime prevalence, adjusted by age and sex per 1,000 people, was 14.87 (95% CI: 9.8–21.9. Active prevalence was 5.79 (95% CI: 2.8–10.6. No significant age, sex, or regional differences in prevalence were detected. Conclusions. EPIBERIA provides the most accurate estimate of epilepsy prevalence in the Mediterranean region based on its original methodology and its adherence to ILAE recommendations. We highlight that the lifetime prevalence and inactive epilepsy prevalence figures observed here were compared to other epidemiological studies.

Adult Prevalence of Epilepsy in Spain: EPIBERIA, a Population-Based Study

Science.gov (United States)

Serrano-Castro, Pedro J.; Mauri-Llerda, Jose Angel; Hernández-Ramos, Francisco José; Sánchez-Alvarez, Juan Carlos; Parejo-Carbonell, Beatriz; Quiroga-Subirana, Pablo; Vázquez-Gutierrez, Fernando; Santos-Lasaosa, Sonia; Mendez-Lucena, Carolina; Redondo-Verge, Luis; Tejero-Juste, Carlos; Morandeira-Rivas, Clara; Sancho-Rieger, Jerónimo; Matías-Guiu, Jorge

2015-01-01

Background. This study assesses the lifetime and active prevalence of epilepsy in Spain in people older than 18 years. Methods. EPIBERIA is a population-based epidemiological study of epilepsy prevalence using data from three representative Spanish regions (health districts in Zaragoza, Almería, and Seville) between 2012 and 2013. The study consisted of two phases: screening and confirmation. Participants completed a previously validated questionnaire (EPIBERIA questionnaire) over the telephone. Results. A total of 1741 valid questionnaires were obtained, including 261 (14.99%) raising a suspicion of epilepsy. Of these suspected cases, 216 (82.75%) agreed to participate in phase 2. Of the phase 2 participants, 22 met the International League Against Epilepsy's diagnostic criteria for epilepsy. The estimated lifetime prevalence, adjusted by age and sex per 1,000 people, was 14.87 (95% CI: 9.8–21.9). Active prevalence was 5.79 (95% CI: 2.8–10.6). No significant age, sex, or regional differences in prevalence were detected. Conclusions. EPIBERIA provides the most accurate estimate of epilepsy prevalence in the Mediterranean region based on its original methodology and its adherence to ILAE recommendations. We highlight that the lifetime prevalence and inactive epilepsy prevalence figures observed here were compared to other epidemiological studies. PMID:26783554

The estimation of the return on firms' investments – as to ISO 9001

African Journals Online (AJOL)

user

3Faculty of Business and Economic Science, University of Seville, SPAIN ... companies said they had not yet recovered the initial investment made. ..... applied themselves more particularly in the production of tangible products produced in serie (Peyrat, .... greater than the costs of obtaining it, we using contingency tables.

T'ai Chi

Science.gov (United States)

... are different styles of t'ai chi, including: Chen style Hao (or Wu Shi) style Hu Lei ... medical advice, diagnoses, and treatment, consult your doctor. © 1995- The Nemours Foundation. All rights reserved. Images provided ...

Adaptive game AI with dynamic scripting

NARCIS (Netherlands)

Spronck, P.; Ponsen, M.J.V.; Sprinkhuizen-Kuyper, I.G.; Postma, E.O.

2006-01-01

Online learning in commercial computer games allows computer-controlled opponents to adapt to the way the game is being played. As such it provides a mechanism to deal with weaknesses in the game AI, and to respond to changes in human player tactics.We argue that online learning of game AI should

Risk Reducing Effect of AIS Implementation on Collision Risk

DEFF Research Database (Denmark)

Lützen, Marie; Friis-Hansen, Peter

2003-01-01

AIS (Automatic Identification System) is a transponder system developed for sea traffic purposes. The system sends and receives important ship information and other safety-related information between other ships and shore-based AIS stations. The implementation of AIS has now been initiated and......, as a result, the community will undoubtedly observe an increase in navigational safety. However, to the authors? knowledge, no study has so far rigorously quantified the risk reducing effect of using AIS as an integrated part of the navigational system. The objective of this study is to fill this gap....... The risk reducing effect of AIS is quantified by building a Bayesian network facilitating an evaluation of the effect of AIS on the navigational officer?s reaction ability in a potential, critical collision situation. The time-dependent change in the risk reducing effect on ship collisions is analysed...

JGOMAS: New Approach to AI Teaching

Science.gov (United States)

Barella, A.; Valero, S.; Carrascosa, C.

2009-01-01

This paper presents a new environment for teaching practical work in AI subjects. The main purpose of this environment is to make AI techniques more appealing to students and to facilitate the use of the toolkits which are currently widely used in research and development. This new environment has a toolkit for developing and executing agents,…

Artificial Intelligence Safety and Cybersecurity: a Timeline of AI Failures

OpenAIRE

Yampolskiy, Roman V.; Spellchecker, M. S.

2016-01-01

In this work, we present and analyze reported failures of artificially intelligent systems and extrapolate our analysis to future AIs. We suggest that both the frequency and the seriousness of future AI failures will steadily increase. AI Safety can be improved based on ideas developed by cybersecurity experts. For narrow AIs safety failures are at the same, moderate, level of criticality as in cybersecurity, however for general AI, failures have a fundamentally different impact. A single fai...

Study on AI-2 signaling molecules activity and the effect of matrine on AI-2 in Staphylococcus epidermidis LuxS/AI-2 quorum sensing%产膜表皮葡萄球菌LuxS/AI-2型密度感应系统AI-2的活性及苦参碱对其的影响

Institute of Scientific and Technical Information of China (English)

李雪; 何芳; 卢金霞; 管翠萍; 周学章

2017-01-01

[Objective] This study investigated the activity of AI-2 signaling molecules in Staphylococcus epidermidis planktonic bacteria and biofilm bacteria and the effect of matrine.[Method] The growth curve of Staphylococcus epidermidis planktonic bacteria and biofilm bacteria was drawn and AI-2 concentration was measured using the V.harveyi bioluminescence assay.The transcription level of luxS gene was analyzed using real-time PCR.The AI-2 signaling molecules of Staphylococcus epidermidis ATCC35984 were treated with matrine and the changes of AI-2 signaling molecules activity were determined.[Result] In Staphylococcus epidermidis planktonic bacteria growth process,AI-2 signaling molecule activity and the relative expression quantity of luxS gene reached the maximum in the logarithmic phase before decreasing gradually.Their change curves were similar with planktonic growth curve.However,in the growth process of Staphylococcus epidermidis biofilm bacteria,the activity trend was similar with the biofilm growth.The relative expression quantity of luxS gene had an opposite trend to biofilm growth.Matrine had inhibitory effect on AI-2 signaling molecule activity in planktonic and biofilm bacteria,and the inhibitory effect was stronger to planktonic bacteria.[Conclusion] AI-2 signaling molecule activity and relative expression quantity of luxS gene highly correlated with the growth of Staphylococcus epidermidis and its biofilm formation.Matrine significantly reduced the AI-2 signaling molecule activity of Staphylococcus epidermidis.%[目的]研究产膜表皮葡萄球菌生物被膜菌和液相浮游菌LuxS/AI-2型密度感应系统中AI-2信号分子的活性及苦参碱对其的影响.[方法]绘制产膜表皮葡萄球菌ATCC35984液相浮游菌及生物被膜菌的生长曲线;利用哈维氏弧菌BB170(Vibrio harveyi BB170)作为报告菌株检测表皮葡萄球菌AI-2�

6th International Conference in Methodologies and intelligent Systems for Technology Enhanced Learning

CERN Document Server

Prieta, Fernando; Mascio, Tania; Gennari, Rosella; Rodríguez, Javier; Vittorini, Pierpaolo

2016-01-01

The 6th International Conference in Methodologies and intelligent Systems for Technology Enhanced Learning held in Seville (Spain) is host by the University of Seville from 1st to 3rd June, 2016. The 6th edition of this conference expands the topics of the evidence-based TEL workshops series in order to provide an open forum for discussing intelligent systems for TEL, their roots in novel learning theories, empirical methodologies for their design or evaluation, stand-alone solutions or web-based ones. It intends to bring together researchers and developers from industry, the education field and the academic world to report on the latest scientific research, technical advances and methodologies.

Squeeze Casting Method Of AI-Si Alloy For Piston Material

International Nuclear Information System (INIS)

Wagiyo, H.; Dani, Muhammad; Sulistioso, G.S.; Pardede, Elman; Handayani, Ari; Teguh, Yulius S.P.P.

2001-01-01

The AI-Si alloy is an alloy used as piston material. This alloys could be as AI-Si hypereutectic alloy (Si content more than 12.5 % wt.), as AI-Si eutectic alloy (Si cuntent 12.5 % wt, and as AI-Si hypoeutectic alloy (Si content less than 12.5 % wt.). The synthesize of AI-Si alloy piston generally using the technique of gravity casting in a dies. This method is causing high porousity. By using the squeeze technique, amount ofporousity in AI-Si alloy is possibly reduced and the density of this alloy should be higher. The other factors such as alloying elements of AI-Si alloy (Mg. Cu, Zn) would increase the mechanical properties especially the hardness. The focuses of this research are the microstructure and the maximum hardness during the heat treatment of AI-Si alloy which was added by alloying elments. The result of hardness at test shows the maximum hardness at 94.7 kg/mm 2 obtained at aging temperature of 210 o C for hours with homogenous dendritic microstructure

Assessment of different surveillance systems for avian influenza in commercial poultry in Catalonia (North-Eastern Spain).

Science.gov (United States)

Alba, A; Casal, J; Napp, S; Martin, P A J

2010-11-01

Compulsory surveillance programmes for avian influenza (AI) have been implemented in domestic poultry and wild birds in all the European Member States since 2005. The implementation of these programmes is complex and requires a close evaluation. A good indicator to assess their efficacy is the sensitivity (Se) of the surveillance system. In this study, the sensitivities for different sampling designs proposed by the Spanish authorities for the commercial poultry population of Catalonia were assessed, using the scenario tree model methodology. These samplings were stratified throughout the territory of Spain and took into account the species, the types of production and their specific risks. The probabilities of detecting infection at different prevalences at both individual and holding level were estimated. Furthermore, those subpopulations that contributed more to the Se of the system were identified. The model estimated that all the designs met the requirements of the European Commission. The probability of detecting AI circulating in Catalonian poultry did not change significantly when the within-holding design prevalence varied from 30% to 10%. In contrast, when the among-holding design prevalence decreased from 5% to 1%, the probability of detecting AI was drastically reduced. The sampling of duck and goose holdings, and to a lesser extent the sampling of turkey and game bird holdings, increased the Se substantially. The Se of passive surveillance in chickens for highly pathogenic avian influenza (HPAI) and low pathogenicity avian influenza (LPAI) were also assessed. The probability of the infected birds manifesting apparent clinical signs and the awareness of veterinarians and farmers had great influence on the probability of detecting AI. In order to increase the probability of an early detection of HPAI in chicken, the probability of performing AI specific tests when AI is suspected would need to be increased. Copyright © 2010 Elsevier B.V. All rights

Towards a science of integrated AI and Robotics

OpenAIRE

Rajan, Kanna; Saffiotti, Alessandro

2017-01-01

The early promise of the impact of machine intelligence did not involve the partitioning of the nascent field of Artificial Intelligence. The founders of AI envisioned the notion of embedded intelligence as being conjoined between perception, reasoning and actuation. Yet over the years the fields of AI and Robotics drifted apart. Practitioners of AI focused on problems and algorithms abstracted from the real world. Roboticists, generally with a background in mechanical and electrical engineer...

New heuristics for planning operating rooms.

NARCIS (Netherlands)

Molina-Pariente, J.M.; Hans, Elias W.; Framinan, J.M.; Gomez-Cia, T.

2015-01-01

We tackle the operating room planning problem of the Plastic Surgery and Major Burns Specialty of the University Hospital “Virgen del Rocio” in Seville (Spain). The decision problem is to assign an intervention date and an operating room to a set of surgeries on the waiting list, minimizing access

El deporte en la ciudad de Sevilla durante el siglo XV=Sports in Seville during the XVth century

Directory of Open Access Journals (Sweden)

Gonzalo Ramírez Macías

2013-03-01

Full Text Available Esta investigación tiene como finalidad fundamental conocer y caracterizar los deportes que eran practicados durante el siglo XV en la ciudad de Sevilla, una de las capitales castellanas que más prosperidad experimentó en esa centuria. La primera parte de este estudio está dedicada a justificar y fundamentar la investigación, en la segunda parte se expone la metodología de investigación propuesta, la cual tiene un carácter novedoso dentro de la historia del deporte. En tercer lugar se presentan y analizan los resultados obtenidos en el estudio, que indican que los deportes practicados durante el siglo XV en la ciudad de Sevilla eran: juego de cañas, correr la sortija, correr monte, justas, torneos, carreras pedestres, carreras a caballo y correr toros. Finalmente se exponen las conclusiones de la investigación las cuales se fundamentan en los resultados de la misma y en las aportaciones de otros estudios anteriores.--------------------------------------------------------------------------The main purpose of this research is to know and characterize the sports practised during the XVth century in Seville, one of the most prosperous Castilian capitals at that time. The first part of this research is devoted to its justification and basis, whereas the second part puts forward the research methodology suggested, which has a new nature within the history of Sports. Thirdly, the results obtained in the research are presented and analysed, what points out that the sports practised during the XVth Century in Seville were: cane games,*correr la sortija, **correr monte, jousts, tournaments, races, horse races and bull races. Finally, the research conclusions are expounded, which are based on its results and on other contributions from previous researches.*Correr la sortija: A game in which two players riding horses had to catch a ring with a spear.**Correr monte: to hunt

Ada in AI or AI in Ada. On developing a rationale for integration

Science.gov (United States)

Collard, Philippe E.; Goforth, Andre

1988-01-01

The use of Ada as an Artificial Intelligence (AI) language is gaining interest in the NASA Community, i.e., by parties who have a need to deploy Knowledge Based-Systems (KBS) compatible with the use of Ada as the software standard for the Space Station. A fair number of KBS and pseudo-KBS implementations in Ada exist today. Currently, no widely used guidelines exist to compare and evaluate these with one another. The lack of guidelines illustrates a fundamental problem inherent in trying to compare and evaluate implementations of any sort in languages that are procedural or imperative in style, such as Ada, with those in languages that are functional in style, such as Lisp. Discussed are the strengths and weakness of using Ada as an AI language and a preliminary analysis provided of factors needed for the development of criteria for the integration of these two families of languages and the environments in which they are implemented. The intent for developing such criteria is to have a logical rationale that may be used to guide the development of Ada tools and methodology to support KBS requirements, and to identify those AI technology components that may most readily and effectively be deployed in Ada.

The Relevance of AI Research to CAI.

Science.gov (United States)

Kearsley, Greg P.

This article provides a tutorial introduction to Artificial Intelligence (AI) research for those involved in Computer Assisted Instruction (CAI). The general theme is that much of the current work in AI, particularly in the areas of natural language understanding systems, rule induction, programming languages, and socratic systems, has important…

Learning game AI programming with Lua

CERN Document Server

Young, David

2014-01-01

If you are a game developer or a general programmer who wishes to focus on programming systems and techniques to build your game AI without creating low-level interfaces in a game engine, then this book is for you. Knowledge of C++ will come in handy to debug the entirety of the AI sandbox and expand on the features present within the book, but it is not required.

Application of AI methods to aircraft guidance and control

Science.gov (United States)

Hueschen, Richard M.; Mcmanus, John W.

1988-01-01

A research program for integrating artificial intelligence (AI) techniques with tools and methods used for aircraft flight control system design, development, and implementation is discussed. The application of the AI methods for the development and implementation of the logic software which operates with the control mode panel (CMP) of an aircraft is presented. The CMP is the pilot control panel for the automatic flight control system of a commercial-type research aircraft of Langley Research Center's Advanced Transport Operating Systems (ATOPS) program. A mouse-driven color-display emulation of the CMP, which was developed with AI methods and used to test the AI software logic implementation, is discussed. The operation of the CMP was enhanced with the addition of a display which was quickly developed with AI methods. The display advises the pilot of conditions not satisfied when a mode does not arm or engage. The implementation of the CMP software logic has shown that the time required to develop, implement, and modify software systems can be significantly reduced with the use of the AI methods.

Discussion on AI Technology in Information Library Design

OpenAIRE

日比野, 省三; Shozo, HIBINO; 中京大学社会学部

1987-01-01

This paper deals with the discussion on the importance of AI (Artificial Intelligence) Technology in planning and designing a library information system in the near future. First of all, the history of Library and Information Science is reviewed and it is identified that the key technology in the future library will be AI as a mega-trend. After reviewing the concepts of AI technology, a model of a Knowledge-Base system is discussed as a case study, using micro-PROLOG.

Expanding the Possibilities of AIS Data with Heuristics

Directory of Open Access Journals (Sweden)

Bjørnar Brende Smestad

2017-06-01

Full Text Available Automatic Identification System (AIS is primarily used as a tracking system for ships, but with the launch of satellites to collect these data, new and previously untested possibilities are emerging. This paper presents the development of heuristics for establishing the specific ship type using information retrieved from AIS data alone. These heuristics expand the possibilities of AIS data, as the specific ship type is vital for several transportation research cases, such as emission analyses of ship traffic and studies on slow steaming. The presented method for developing heuristics can be used for a wider range of vessels. These heuristics may form the basis of large-scale studies on ship traffic using AIS data when it is not feasible or desirable to use commercial ship data registers.

Plasma physics and controlled nuclear fusion research 1994. V. 3. Proceedings of the fifteenth international conference

International Nuclear Information System (INIS)

1996-01-01

This is the third volume of the proceedings of the 15th International Atomic Energy Agency Conference on Plasma Physics and Controlled Nuclear Fusion Research held in Seville, Spain, from 26 September - 1 October 1994. Contained in it are 29 papers on inertial confinement and 46 papers on magnetic confinement. Refs, figs, tabs

Calibrating AIS images using the surface as a reference

Science.gov (United States)

Smith, M. O.; Roberts, D. A.; Shipman, H. M.; Adams, J. B.; Willis, S. C.; Gillespie, A. R.

1987-01-01

A method of evaluating the initial assumptions and uncertainties of the physical connection between Airborne Imaging Spectrometer (AIS) image data and laboratory/field spectrometer data was tested. The Tuscon AIS-2 image connects to lab reference spectra by an alignment to the image spectral endmembers through a system gain and offset for each band. Images were calibrated to reflectance so as to transform the image into a measure that is independent of the solar radiant flux. This transformation also makes the image spectra directly comparable to data from lab and field spectrometers. A method was tested for calibrating AIS images using the surface as a reference. The surface heterogeneity is defined by lab/field spectral measurements. It was found that the Tuscon AIS-2 image is consistent with each of the initial hypotheses: (1) that the AIS-2 instrument calibration is nearly linear; (2) the spectral variance is caused by sub-pixel mixtures of spectrally distinct materials and shade, and (3) that sub-pixel mixtures can be treated as linear mixtures of pure endmembers. It was also found that the image can be characterized by relatively few endmembers using the AIS-2 spectra.

Nuclear fuel strategies

International Nuclear Information System (INIS)

Rippon, S.

1989-01-01

The paper reports on two international meetings on nuclear fuel strategies, one organised by the World Nuclear Fuel Market in Seville (Spain) October 1988, and the other organised by the American and European nuclear societies in Washington (U.S.A.) November 1988. At the Washington meeting a description was given of the uranium supply and demand market, whereas free trade in uranium was considered in Seville. Considerable concern was expressed at both meetings on the effect on the uranium and enrichment services market of very low prices for spot deals being offered by China and the Soviet Union. Excess enrichment capacity, the procurement policies of the USA and other countries, and fuel cycle strategies, were also discussed. (U.K.)

Adaptive game AI with dynamic scripting

OpenAIRE

Spronck, P.; Ponsen, M.J.V.; Sprinkhuizen-Kuyper, I.G.; Postma, E.O.

2006-01-01

Online learning in commercial computer games allows computer-controlled opponents to adapt to the way the game is being played. As such it provides a mechanism to deal with weaknesses in the game AI, and to respond to changes in human player tactics.We argue that online learning of game AI should meet four computational and four functional requirements. The computational requirements are speed, effectiveness, robustness and ef- ficiency. The functional requirements are clarity, variety, consi...

the Lexique kikongo–français by

African Journals Online (AJOL)

Gilles-Maurice de Schryver

français by the Jesuit missionary Charles Polis, is analysed in great detail. Section 1 expounds on the goal and ... dictionary manuscript for Kikongo: the Lexique kikongo–français by Charles Polis. s.j. (1885–†1943). .... Inkisi River, and all but one (Leverville, the present Lusanga) are close to that river, which thus strongly ...

Does Pressing a Button Make It Easier to Pass an Exam? Evaluating the Effectiveness of Interactive Technologies in Higher Education

Science.gov (United States)

Castillo-Manzano, Jose I.; Castro-Nuño, Mercedes; Sanz Díaz, María Teresa; Yñiguez, Rocio

2016-01-01

The aim of this paper was to evaluate how audience response system (ARS) technology may increase improvements in academic performance in higher education, using the first year of the Administration and Business Management degree course at the University of Seville (Spain) as a case study. The experiment assesses whether the use of ARSs increases…

10 CFR 1017.28 - Processing on Automated Information Systems (AIS).

Science.gov (United States)

2010-01-01

... 10 Energy 4 2010-01-01 2010-01-01 false Processing on Automated Information Systems (AIS). 1017.28... UNCLASSIFIED CONTROLLED NUCLEAR INFORMATION Physical Protection Requirements § 1017.28 Processing on Automated Information Systems (AIS). UCNI may be processed or produced on any AIS that complies with the guidance in OMB...

Data of evolutionary structure change: 1AIFB-2AI0K [Confc[Archive

Lifescience Database Archive (English)

Full Text Available ignment> 0 n> 1AIF n>B 1AI... CA 272 n> 2AI0 n>K ...n>2AI0Kn> VAHPASSTKVD EEE EEEE...1AIFB-2AI0K 1AIF 2AI0 B K EVKLQESGGGLVQPGGSMKLSCVASGFTFNNYWMSWVRQ...SCAASGFTFRNYGMSWVRQTPEKRLEWVAAIS--GNSLYTSYPDSVKGRFTISRDNAKNNLYLQMSSLRSEDTALYFCARH

Seville City Hall Chapter Room ceiling decoration

Directory of Open Access Journals (Sweden)

Robador, M. D.

2010-02-01

Full Text Available The present article describes a chemical and physical study of the colour, chemical composition and mineral phases of the decorative materials in the Seville City Hall Chapter House ceiling. The findings showed that the inner most layer of material, calcite, was covered with white lead, in turn concealed under a layer of gilded bole. The ceiling underwent re-gilding, also over bole, due in all likelihood to wear on the original gold leaf. In the nineteenth century, the entire ceiling with the exception of the inscriptions was whitewashed with calcite and white lead. Silver was employed on King John I’s sword (coffer 27. Gold leaf was used to adorn the royal attributes: crowns, belts, sceptres, swords and rosary beads. The high reliefs were likewise gilded. The pigments identified on the ceiling adornments included azurite, malachite, vermilion and gas black. A lime and ground dolomite mortar was used throughout.

El objetivo de este trabajo es el estudio de diferentes aspectos, como el color, la composición química y las fases mineralógicas presentes en los diferentes materiales que forman la ornamentación del techo de la Sala Capitular del Ayuntamiento de Sevilla, mediante métodos físicos y químicos. Nuestros resultados muestran que el dorado fue realizado sobre una capa de bol previamente depositada sobre una lámina de blanco de plomo que cubría un estrato de calcita. Posteriormente, y probablemente debido a alteraciones en el dorado original, el techo fue de nuevo dorado usando una técnica similar. En el siglo XIX, casi todo el techo, excepto las zonas con inscripciones, fue blanqueado usando una mezcla de calcita y blanco de plomo. Se empleó plata para cubrir la espada del rey Juan I (casetón 27. Finísimas láminas de oro se usaron para decorar los atributos reales: coronas, cinturones, cetros, espadas y rosarios. En diferentes partes de la decoración fueron detectados pigmentos como azurita, malaquita, bermellón y

Integrating the Wall Street Journal into AIS Courses

Science.gov (United States)

Kohlmeyer, James M., III

2008-01-01

While it is important for accounting information systems (AIS) students to understand computer technology, internal controls and business processes, such knowledge is of little use without reference to appropriate contexts. Integrating Wall Street Journal (WSJ) readings and discussions into AIS classes can enrich learning by stimulating…

Recent progresses on AI-2 bacterial quorum sensing inhibitors.

Science.gov (United States)

Zhu, Peng; Li, Minyong

2012-01-01

Quorum sensing (QS) is a communication procedure that predominates gene expression in response to cell density and fluctuations in the neighboring environment as a result of discerning molecules termed autoinducers (AIs). It has been embroiled that QS can govern bacterial behaviors such as the secretion of virulence factors, biofilm formation, bioluminescence production, conjugation, sporulation and swarming motility. Autoinducer 2 (AI-2), a QS signaling molecule brought up to be involved in interspecies communication, exists in both gram-negative and -positive bacteria. Therefore, novel approaches to interrupt AI-2 quorum sensing are being recognized as next generation antimicrobials. In the present review article, we summarized recent progresses on AI-2 bacterial quorum sensing inhibitors and discussed their potential as the antibacterial agents.

On the homotopy equivalence of simple AI-algebras

International Nuclear Information System (INIS)

Aristov, O Yu

1999-01-01

Let A and B be simple unital AI-algebras (an AI-algebra is an inductive limit of C*-algebras of the form BigOplus i k C([0,1],M N i ). It is proved that two arbitrary unital homomorphisms from A into B such that the corresponding maps K 0 A→K 0 B coincide are homotopic. Necessary and sufficient conditions on the Elliott invariant for A and B to be homotopy equivalent are indicated. Moreover, two algebras in the above class having the same K-theory but not homotopy equivalent are constructed. A theorem on the homotopy of approximately unitarily equivalent homomorphisms between AI-algebras is used in the proof, which is deduced in its turn from a generalization to the case of AI-algebras of a theorem of Manuilov stating that a unitary matrix almost commuting with a self-adjoint matrix h can be joined to 1 by a continuous path consisting of unitary matrices almost commuting with h

AIS reception from a CubeSat in LEO

DEFF Research Database (Denmark)

Larsen, Jesper Abildgaard; Mortensen, Hans Peter; Nielsen, Jens Frederik Dalsgaard

2013-01-01

The primary payloads on board the AAUSAT3 satellite are two different AIS receivers, one is a traditional hardware-based receiver, the other one is a software-defined radio receiver. The hardware-based receiver has been developed around an ADF-7020 transceiver, with an appropriate LNA in front...... into a low-Earth orbit with a semi-major axis of 7156 km, i.e. 800 km altitude, near circular, dusk-dawn Sun-synchronous orbit. From this orbit the AIS antenna system, which consists of a dipole antenna, has a foot print diameter of approximately 6000 km. During the first pass over the primary ground station...... at Aalborg University, basic telemetry and the first few AIS messages were downloaded. During the first 14 days of the mission, the two receivers managed to detect more than 100,000 different AIS messages from ships all around the world, and more than 35,000 of these messages have been successfully...

Low doses of ionizing radiation: Biological effects and regulatory control. Contributed papers

International Nuclear Information System (INIS)

1997-11-01

The International Atomic Energy Agency and the World Health Organization, in cooperation with the United Nations Scientific Committee on the Effects of Atomic Radiation, organized an international conference on Low Doses of Ionizing Radiation: Biological Effects and Regulatory Control, held in seville, Spain, from 17 to 21 November 1997. This technical document contains concise papers submitted to the conference

77 FR 68150 - Meeting of the SANE/SART AI/AN Initiative Committee

Science.gov (United States)

2012-11-15

.../SART AI/AN Initiative Committee AGENCY: Office for Victims of Crime, Justice. ACTION: Notice of meeting... Response Team (SART) American Indian/Alaskan Native (AI/AN) Initiative (``SANE/SART AI/AN Initiative... violence within AI/AN communities. Dates and Locations: The meeting will be held on the reservation of the...

Proceedings of conference on AI applications in physical sciences

International Nuclear Information System (INIS)

1993-01-01

A Conference cum workshop on AI applications in Physical Sciences was organised by the Indian Physics Association at Bhabha Atomic Research Centre, Bombay during January 15-17, 1992. It was held in memory of Late Shri S.N. Seshadri, who was the moving spirit behind self reliance in instrumentation development for research and industry. The two day conference which was followed by one day workshop covered the following broad spectrum of topics in Artificial Intelligence: AI Tools and Techniques, Neural Networks, Robotics and Machine Vision, Fuzzy Control and Applications, Natural Language and Speech Processing, Knowledge based Systems, and AI and Allied applications. The conference dealt with recent advances and achievements in AI. It provided a forum for the exchange of valuable information and expertise in this fast emerging field. Over 200 scientists, engineers and computer professionals from various universities, R and D institutes and industries actively participated. 45 contributed papers and 8 invited talks were presented in the symposium. The volume contains selected papers which were contributed by the participants. Some of them dealt with AI applications in nuclear science and technology. (original)

Present status of application of AI in nuclear industry

International Nuclear Information System (INIS)

Kitamura, Masaharu

1989-01-01

Artificial intelligence (AL) techniques have been introduced actively in the nuclear industry in pursuit of increased safety and efficiency. The present report outlines some AI techniques currently used in nuclear facilities. This type of techniques have increasingly been introduced to such areas as design, construction, operation, maintenance, quality control and analysis. Most of them use knowledge engineering techniques including expert systems. Positive efforts at research and application of various more advance AI techniaues have started recently. For application of AI techniques, activities in nuclear power plants can be divided into two groups. One includes 'analytical' activities such as operation, maintenance and analysis, while the other includes 'synthetic' activities such as design, construction and fuel control. The most important AI technology for the analytical activities is diagnosis. Thus the report outlines major processes to which diagnostic techniques are applicable, and knowledge description and inference methods used for diagnosis. For AI techniques for synthetic activities, some problems and possible solutions are addressed. Development efforts in and outside Japan are also outlined. (Nogami, K.)

LuxS-independent formation of AI-2 from ribulose-5-phosphate

Directory of Open Access Journals (Sweden)

Hardie Kim R

2008-06-01

Full Text Available Abstract Background In many bacteria, the signal molecule AI-2 is generated from its precursor S-ribosyl-L-homocysteine in a reaction catalysed by the enzyme LuxS. However, generation of AI-2-like activity has also been reported for organisms lacking the luxS gene and the existence of alternative pathways for AI-2 formation in Escherichia coli has recently been predicted by stochastic modelling. Here, we investigate the possibility that spontaneous conversion of ribulose-5-phosphate could be responsible for AI-2 generation in the absence of luxS. Results Buffered solutions of ribulose-5-phosphate, but not ribose-5-phosphate, were found to contain high levels of AI-2 activity following incubation at concentrations similar to those reported in vivo. To test whether this process contributes to AI-2 formation by bacterial cells in vivo, an improved Vibrio harveyi bioassay was used. In agreement with previous studies, culture supernatants of E. coli and Staphylococcus aureus luxS mutants were found not to contain detectable levels of AI-2 activity. However, low activities were detected in an E. coli pgi-eda-edd-luxS mutant, a strain which degrades glucose entirely via the oxidative pentose phosphate pathway, with ribulose-5-phosphate as an obligatory intermediate. Conclusion Our results suggest that LuxS-independent formation of AI-2, via spontaneous conversion of ribulose-5-phosphate, may indeed occur in vivo. It does not contribute to AI-2 formation in wildtype E. coli and S. aureus under the conditions tested, but may be responsible for the AI-2-like activities reported for other organisms lacking the luxS gene.

Creating an AI modeling application for designers and developers

Science.gov (United States)

Houlette, Ryan; Fu, Daniel; Jensen, Randy

2003-09-01

Simulation developers often realize an entity's AI by writing a program that exhibits the intended behavior. These behaviors are often the product of design documents written by designers. These individuals, while possessing a vast knowledge of the subject matter, might not have any programming knowledge whatsoever. To address this disconnect between design and subsequent development, we have created an AI application whereby a designer or developer sketches an entity's AI using a graphical "drag and drop" interface to quickly articulate behavior using a UML-like representation of state charts. Aside from the design-level benefits, the application also features a runtime engine that takes the application's data as input along with a simulation or game interface, and makes the AI operational. We discuss our experience in creating such an application for both designer and developer.

4th June: AIS and NICE/MAIL unique authentication

CERN Multimedia

AIS and NICE teams

2007-01-01

Over the past few years, the IT department has been in the process of streamlining CERN users' access to all central computing services. The long term goal is to converge on a unique computer account, which will increase computer security and simplify account maintenance. The next step of this process will occur on 4th June 2007, as of when authenticating on the AIS applications (EDH, HRT, CET, APT, ERT, CRA, Foundation, ...) and on NICE (Windows) and MAIL will be done using the same username and password. As a reminder, this account can also be used on EDMS, INDICO, CDS and SIMBA. So starting on 4th June 2007, authentication on the AIS applications must be done using your AIS username and your MAIL/NICE password. Thanks for your understanding, The AIS and NICE teams

Data of evolutionary structure change: 1AIFH-2AI0K [Confc[Archive

Lifescience Database Archive (English)

Full Text Available > 0 n> 1AIF n>H ...n>1AIFHn> VAHPA-SSTKV n> 2AI0 n>K 2AI...1AIFH-2AI0K 1AIF 2AI0 H K EVKLQESGGGLVQPGGSMKLSCVASGFTFNNYWMSWVRQ...SCAASGFTFRNYGMSWVRQTPEKRLEWVAAIS--GNSLYTSYPDSVKGRFTISRDNAKNNLYLQMSSLRSEDTALYFCARH

Highlights on artificial insemination (AI technology in the pig

Directory of Open Access Journals (Sweden)

Tarek Khalifa

2014-03-01

Full Text Available Over the past decade, there has been a tremendous increase in the development of field AI services in the majority of countries concerned with pig production. The objective of this paper is to review: (a the current status of swine AI in the world, (b significance and limitation of AI with liquid and frozen semen, (c the biological traits of porcine semen in relation to in-vitro sperm storage, (d the criteria used for selection of a boar stud as a semen supplier, (e how to process boar semen for liquid and frozen storage in the commercial settings and (f how to improve fertility and prolificacy of boar semen. More than 99% of the inseminations conducted worldwide are made with liquid-stored semen. AI with frozen semen is used only for upgrading the genetic base in a particular country or herd. Determining the initial quality of semen ejaculates along with the selection of the optimum storage extender has a profound effect on the quality and fertility of AI doses. Different procedures have been used for improving the fertility of preserved spermatozoa including colloidal centrifugation of the semen, intrauterine insemination and modulation of the uterine defense mechanism after AI. Development of an efficient protocol for synchronizing the time of ovulation in sows and gilts coupled with improving uterine horn insemination technique will make a breakthrough in the commercial use of frozen boar semen.

The Heritage of Medieval Errors in the Latin Manuscripts of Johannes Hispalensis (John of Seville

Directory of Open Access Journals (Sweden)

Robinson, Maureen

2007-06-01

Full Text Available After the Christian reconquest of Islamic-held territory, many Arabic texts had to be translated into Latin in twelfth century Spain. Johannes Hispalensis (John of Seville knew both Arabic and Latin and worked alone, whereas others needed collaborators to complete the process. The duplication of Latin texts became popular and quickly spread. Over the following centuries, the medieval scribes involved made multiple copies of the manuscripts and during the reproduction process, many errors occurred. These contributed to confusion between the correct version of the translator's name and his identity. Consequently, Hispalensis appeared in later copies of his work with various titles such as “Master” or “Bishop”, or was coupled with a collaborator. Modern-day historians added to the complexities by creating one personality out of two diverse translators. At times, the ownership of some of the manuscripts rested solely on the names appearing in them, when only scribal errors had contributed them. An attempt is made to clarify the translations accredited to Johannes Hispalensis, working alone, and those working with collaborators.

Después de la Reconquista, se tuvieron que traducir al latín muchos textos árabes en la España del siglo XII. La mayoría de los copistas necesitaban colaboradores para concluir el proceso, sin embargo, Johannes Hispalensis (Juan de Sevilla conocía tanto la lengua árabe como el latín, por lo que podía trabajar solo. La duplicación de textos latinos se popularizó y divulgó rápidamente. Durante los siglos siguientes, los copistas medievales hicieron múltiples copias, y durante el proceso de reproducción cometieron muchos errores que contribuyeron a la confusión entre la versión correcta del nombre del traductor y su identidad.  Por consiguiente, Hispalensis apareció en copias

Discovering Knowledge from AIS Database for Application in VTS

Science.gov (United States)

Tsou, Ming-Cheng

The widespread use of the Automatic Identification System (AIS) has had a significant impact on maritime technology. AIS enables the Vessel Traffic Service (VTS) not only to offer commonly known functions such as identification, tracking and monitoring of vessels, but also to provide rich real-time information that is useful for marine traffic investigation, statistical analysis and theoretical research. However, due to the rapid accumulation of AIS observation data, the VTS platform is often unable quickly and effectively to absorb and analyze it. Traditional observation and analysis methods are becoming less suitable for the modern AIS generation of VTS. In view of this, we applied the same data mining technique used for business intelligence discovery (in Customer Relation Management (CRM) business marketing) to the analysis of AIS observation data. This recasts the marine traffic problem as a business-marketing problem and integrates technologies such as Geographic Information Systems (GIS), database management systems, data warehousing and data mining to facilitate the discovery of hidden and valuable information in a huge amount of observation data. Consequently, this provides the marine traffic managers with a useful strategic planning resource.

Quality measures and assurance for AI (Artificial Intelligence) software

Science.gov (United States)

Rushby, John

1988-01-01

This report is concerned with the application of software quality and evaluation measures to AI software and, more broadly, with the question of quality assurance for AI software. Considered are not only the metrics that attempt to measure some aspect of software quality, but also the methodologies and techniques (such as systematic testing) that attempt to improve some dimension of quality, without necessarily quantifying the extent of the improvement. The report is divided into three parts Part 1 reviews existing software quality measures, i.e., those that have been developed for, and applied to, conventional software. Part 2 considers the characteristics of AI software, the applicability and potential utility of measures and techniques identified in the first part, and reviews those few methods developed specifically for AI software. Part 3 presents an assessment and recommendations for the further exploration of this important area.

4th June: AIS and NICE/MAIL unique authentication

CERN Multimedia

The AIS and NICE teams

2007-01-01

Over the past few years, the IT department has been in the process of streamlining CERN users' access to all central computing services. The long term goal is to converge on a unique computer account, which will increase computer security and simplify account maintenance. The next step of this process will occur on the 4th June 2007, as of when authenticating on the AIS applications (EDH, HRT, CET, APT, ERT, CRA, Foundation, ...) and on NICE (Windows) and MAIL will be done using the same username and password. As a reminder, this account can also be used on EDMS, INDICO, CDS and SIMBA. Thus starting on the 4th June 2007, authentication on the AIS applications must be done using your AIS username and your MAIL/NICE password. Thanks for your understanding, The AIS and NICE teams

An Immune Agent for Web-Based AI Course

Science.gov (United States)

Gong, Tao; Cai, Zixing

2006-01-01

To overcome weakness and faults of a web-based e-learning course such as Artificial Intelligence (AI), an immune agent was proposed, simulating a natural immune mechanism against a virus. The immune agent was built on the multi-dimension education agent model and immune algorithm. The web-based AI course was comprised of many files, such as HTML…

Ai Weiwei - 21. sajandi märter? / Tanel Veenre

Index Scriptorium Estoniae

Veenre, Tanel, 1977-

2011-01-01

Hiina kunstniku, inimõiguslase ja teisitimõtleja Ai Weiwei elust, õpingutest, loomingust ja tegevusest. Hiinas kunstniku tagakiusamisest, arreteerimisest, maksupettuses süüdistamisest jm. Kunstniku toetajatest. Inglise kunstileht Art Review valis Ai Weiwei 2011. a. kõige mõjuvõimsamaks kunstitegelaseks

Research Directions for AI in Computer Games

OpenAIRE

Fairclough, Chris; Fagan, Michael; Cunningham, Padraig; Mac Namee, Brian

2001-01-01

The computer games industry is now bigger than the film industry. Until recently, technology in games was driven by a desire to achieve real-time, photo-realistic graphics. To a large extent, this has now been achieved. As game developers look for new and innovative technologies to drive games development, AI is coming to the fore. This paper will examine how sophisticated AI techniques, such as those being used in mainstream academic research, can be applied to computer games ...

The Chronica Maiora of Isidore of Seville

Directory of Open Access Journals (Sweden)

Sam KOON

2008-12-01

Full Text Available Isidore of Seville’s Chronica Maiora was written in two redactions in early seventh century and reveals a great deal about the political, religious and intellectual history of late antique and early medieval Spain. a comparative analysis of the different versions demonstrates the author in action, responding to a range of contemporary stimuli. On a series of levels, the changing form and contents of the chronicle can be mapped against a rapidly changing religious and political background to provide valuable historical data and insights into the working methods and intellectual world of the most important author of early medieval Spain. This article offers a brief introduction to the text and its context of production before presenting an English translation of the two redactions of the text.La Chronica Maiora de Isidoro de Sevilla fue redactada en dos versiones a principios del siglo VII y revela una gran variedad de datos acerca de la historia política, religiosa e intelectual de la España de la Antigüedad tardía y de la alta Edad Media. Un estudio comparativo de las versiones existentes revela un autor dinámico que responde a estímulos contemporáneos. Los cambios en la forma y el contenido de la crónica se pueden relacionar con rápidos cambios políticos y religiosos, y revelan valiosos datos históricos así como los métodos de trabajo y el panorama intelectual del autor más importante de la alta Edad Media en España. Este artículo presenta una breve introducción al texto y el contexto de su producción así como una traducción al inglés de las dos versiones.

Strategic Team AI Path Plans: Probabilistic Pathfinding

Directory of Open Access Journals (Sweden)

Tng C. H. John

2008-01-01

Full Text Available This paper proposes a novel method to generate strategic team AI pathfinding plans for computer games and simulations using probabilistic pathfinding. This method is inspired by genetic algorithms (Russell and Norvig, 2002, in that, a fitness function is used to test the quality of the path plans. The method generates high-quality path plans by eliminating the low-quality ones. The path plans are generated by probabilistic pathfinding, and the elimination is done by a fitness test of the path plans. This path plan generation method has the ability to generate variation or different high-quality paths, which is desired for games to increase replay values. This work is an extension of our earlier work on team AI: probabilistic pathfinding (John et al., 2006. We explore ways to combine probabilistic pathfinding and genetic algorithm to create a new method to generate strategic team AI pathfinding plans.

Towards AI-powered personalization in MOOC learning

Science.gov (United States)

Yu, Han; Miao, Chunyan; Leung, Cyril; White, Timothy John

2017-12-01

Massive Open Online Courses (MOOCs) represent a form of large-scale learning that is changing the landscape of higher education. In this paper, we offer a perspective on how advances in artificial intelligence (AI) may enhance learning and research on MOOCs. We focus on emerging AI techniques including how knowledge representation tools can enable students to adjust the sequence of learning to fit their own needs; how optimization techniques can efficiently match community teaching assistants to MOOC mediation tasks to offer personal attention to learners; and how virtual learning companions with human traits such as curiosity and emotions can enhance learning experience on a large scale. These new capabilities will also bring opportunities for educational researchers to analyse students' learning skills and uncover points along learning paths where students with different backgrounds may require different help. Ethical considerations related to the application of AI in MOOC education research are also discussed.

AI model for computer games based on case based reasoning and AI planning

NARCIS (Netherlands)

Menkovski, V.; Metafas, D.

2008-01-01

Making efficient AI models for games with imperfect information can be a particular challenge. Considering the large number of possible moves and the incorporated uncertainties building game trees for these games becomes very difficult due to the exponential growth of the number of nodes at each

Off The Beaten Lane: AI Challenges In MOBAs Beyond Player Control

OpenAIRE

Cook, Michael; Summerville, Adam; Colton, Simon

2017-01-01

MOBAs represent a huge segment of online gaming and are growing as both an eSport and a casual genre. The natural starting point for AI researchers interested in MOBAs is to develop an AI to play the game better than a human - but MOBAs have many more challenges besides adversarial AI. In this paper we introduce the reader to the wider context of MOBA culture, propose a range of challenges faced by the community today, and posit concrete AI projects that can be undertaken to begin solving them.

Training courses on radiation protection organized by the radioisotopes service of the University of Sevilla (Spain)

International Nuclear Information System (INIS)

Mateos, J. C.; Avalos, J.; Garcia-Leon, M.; Garcia-Tenorio, R.; Gomez-Puerto, A.; Gomez, M.; Herrador, M-; Lejeune, J.; Luis-simon, J.; Marquez, A.; Maranon, J.; Respaldiza, M. A.; Sanchez-Angulo, C.; Sanchez-Doblado, F.; Sarmiento, J. M.

2003-01-01

The University of Sevilla (Spain) through its Radioisotope Service has been organizing bi annually since 1995 Training courses for Supervisors and Operators of Radioactive Installations for university investigators that use radioactive sources or radiation equipment. The courses are imparted by professors from the university radioactive installations, hospital physicist specialists from medical physics services and medical doctors from prevention labour health service. The students are postgraduate students or professors that need operate, with ionising radiation in their research laboratories. Up to date, it has been organized 4 courses series with an average of 30 students per course. The courses are homologated by the Nuclear Security Council and let the student obtain the license for Supervisors or Operators of Radioactive Installations in each of the following applications fields. a) Laboratories with Non-Encapsulated Sources. This application includes research activities in Biology, Chemistry, Physics, Medicine and Pharmacy. b) Radiation Generator Equipment. This last one includes equipment such as X-Ray apparatus for diffraction studies in physics chemistry and art sciences, or Particle Accelerator for atomic physics research in the National Accelerator Centre. The practical sessions of the courses are imparted in the radioactive installations of the Seville university. In this study it is described the details of the organization of the courses. (Author) 4 refs

Spanish version of the Thought-Action Fusion Questionnaire and its application in eating disorders

Directory of Open Access Journals (Sweden)

Jáuregui-Lobera I

2013-09-01

Full Text Available I Jáuregui-Lobera,1,3 MA Santed-Germán,2 P Bolaños-Ríos,3 O Garrido-Casals3 1Molecular Biology and Biochemistry Engineering Department, Pablo de Olavide University, Seville, Spain; 2Personality, Evaluation and Psychological Treatments Department, UNED, Madrid, Spain; 3Behavioral Sciences Institute, Seville, Spain Purpose: The aims of the study were to analyze the psychometric properties of the Spanish version of the Thought-Action Fusion Questionnaire (TAF-SP, as well as to determine its validity by evaluating the relationship of the TAF-SP to different instruments. Patients and methods: Two groups were studied: one comprising 146 patients with eating disorders; and another a group of 200 students. Results: Three factors were obtained: TAF–Moral; TAF–Likelihood-others; and TAF–Likelihood-oneself. The internal consistency of the TAF-SP was determined by means of Cronbach’s α coefficient, with values ranging between 0.84–0.95. The correlations with other instruments reflected adequate validity. The three-factor structure was tested by means of a linear structural equation model, and the structure fit satisfactorily. Differences in TAF-SP scores between the diagnostic subgroups were also analyzed. Conclusion: The TAF-SP meets the psychometric requirements for measuring thought-action fusion and shows adequate internal consistency and validity. Keywords: thought-action fusion, cognitive distortions, validation, eating disorders

AI and health

OpenAIRE

Martin Anderson

2018-01-01

ntelligence refers to the ability of an individual to learn or understand something, or to deal with a new situation. When a machine or software exhibits such characteristics, it is referred to as artificial intelligence (AI). Artificial Intelligence is therefore defined as the theory and development of computer systems able to perform tasks that normally require human intelligence, such as visual perception, speech recognition, decision-making, and translation between languages.

Automatic Identification System (AIS) Transmit Testing in Louisville Phase 2

Science.gov (United States)

2014-08-01

Firewall Louisville QM 65.206.28.x NAIS Site Controller PC RS232 Serial cable TV32 Computer Cmd Center Serial splitter SAAB R40 AIS Base Station...172.17.14.6 Rack mount computer AIS Radio Interface Ethernet Switch 192.168.0.x Firewall Cable Modem 192.168.0.1 VTS Accred. Boundary serial connection...Automatic Identification System ( AIS ) Transmit Testing in Louisville Phase 2 Distribution Statement A: Approved for public release

Low doses of ionizing radiation: Biological effects and regulatory control. Contributed papers

Energy Technology Data Exchange (ETDEWEB)

NONE

1997-11-01

The International Atomic Energy Agency and the World Health Organization, in cooperation with the United Nations Scientific Committee on the Effects of Atomic Radiation, organized an international conference on Low Doses of Ionizing Radiation: Biological Effects and Regulatory Control, held in seville, Spain, from 17 to 21 November 1997. This technical document contains concise papers submitted to the conference. Refs, figs, tabs.

ITER EDA Newsletter. V.4, no.1

International Nuclear Information System (INIS)

1995-01-01

This ITER EDA (Engineering Design Activities) Newsletter issue reports on (i) the seventh ITER Council Meeting held at the Naka Joint Work Site on 14-15 December 1994, (ii) the ''Confinement Modelling and Database Expert Group Workshop'' held in Seville, Spain, 3-4 October 1994, and (iii) the first meeting of the International Organizing Committee for the Seventh International Fusion Reactor Materials Conference

Procedure for Marine Traffic Simulation with AIS Data

Directory of Open Access Journals (Sweden)

Rina Miyake

2015-03-01

Full Text Available It is essential to evaluate safety of marine traffic for the improvement of efficiency and safety of marine traffic. Spread of AIS makes observation of actual marine traffic more easily and faster than before. Besides, description of collision avoidance behaviours of ships are indispensable to simulate a realistic marine traffic. It is important to develop and implement an algorithm of collision avoidance corresponding to a target traffic or target area into the marine traffic simulation because actual actions for collision avoidance depend on circumstances where ships are sailing. The authors developed an automated marine traffic simulation system with AIS data. And in this paper, we proposed a series of systematic procedures for marine traffic simulation including analysing for collision avoidance behaviours using AIS data.

AI Based Personal Learning Environments: Directions for Long Term Research. AI Memo 384.

Science.gov (United States)

Goldstein, Ira P.; Miller, Mark L.

The application of artificial intelligence (AI) techniques to the design of personal learning environments is an enterprise of both theoretical and practical interest. In the short term, the process of developing and testing intelligent tutoring programs serves as a new experimental vehicle for exploring alternative cognitive and pedagogical…

Human-Assisted AI: an Intelligence Augmentation Approach

OpenAIRE

Alicea, Bradly

2018-01-01

As a flavor of Human-Computer Interaction (HCI), Human-Assisted AI can serve to both augment both human performance and artificial systems. This talk will feature a discussion of Human-assisted AI as an instance of Intelligence Augmentation (IA). We will discuss instances of weak and strong IA, in addition to contemporary examples of and paths forward for such systems. In the variety of models presented, data plays a critical role in the structure of interactions between human and artificial ...

Characterization and recovery proposal of polymer mortar coating plates of the parish of San Pablo in Seville

Directory of Open Access Journals (Sweden)

V. Flores-Alés

2017-06-01

Full Text Available This paper deals with the study of the facade elements of the parish of San Pablo in Seville (1961. They are made with polymer mortar. A characterization of the coating plates was carried out and possible solutions for recovering the altered material were analyzed in order to facilitate a future intervention. The resins used as a binder were identified as aliphatic polyester. The resin study was carried out to assure the compatibility of restoration products. Materials characterization provides information about the structural capacity of the plates and the properties achieved. The plates’ colorimetric control is an inexcusable necessity, since any action on the surface of the pieces leads to a color change. All the analyses and testing carried out have led to the creation of an appropriate treatment system for recovery of the plates that provides sufficient information to the intervention project managers to justify decision-making.

Data of evolutionary structure change: 1AIFL-2AI0L [Confc[Archive

Lifescience Database Archive (English)

Full Text Available /ss_2> 0 n> 1AIF L...n> 1AIFLn> VSSSI----SSSNL 2AI0 Ln> 2AI0L...1AIFL-2AI0L 1AIF 2AI0 L L DIQLTQSPAFMAASPGEKVTITCSVSSSI----SSSNLH...line> SER CA 273 SER CA 260 ASN CA 337 LEU CA 408

Humans and Machines in the Evolution of AI in Korea

OpenAIRE

Zhang, Byoung-Tak

2016-01-01

Artificial intelligence in Korea is currently prospering. The media is regularly reporting AI-enabled products such as smart advisors, personal robots, autonomous cars, and human-level intelligence machines. The IT industry is investing in deep learning and AI to maintain the global competitive edge in their services and products. The Ministry of Science, ICT, and Future Planning (MSIP) has launched new funding programs in AI and cognitive science to implement the government’s newly adopted e...

Data of evolutionary structure change: 1AIFA-2AI0L [Confc[Archive

Lifescience Database Archive (English)

Full Text Available 2> 0 n> 1AIF n>A ...n>1AIFAn> VSSSI----SSSNL...n> 2AI0 n>L 2AI...1AIFA-2AI0L 1AIF 2AI0 A L DIQLTQSPAFMAASPGEKVTITCSVSSSI----SSSNLH...SER CA 251 SER CA 276 SER CA 258 ASN CA 337 LEU CA 410

harnessing_ai_20180319.pptx

OpenAIRE

Johnson, Matthew

2018-01-01

There have been great strides made in Artificial Intelligence in recent years, but it is often not clear how to apply these recent advances to new problems. In this talk I propose one method of thinking about problems in the sciences and how to find the right AI techniques to aid in research.

AI-2 of Aggregatibacter actinomycetemcomitans Inhibits Candida albicans Biofilm Formation

Directory of Open Access Journals (Sweden)

Endang W. Bachtiar

2014-07-01

Full Text Available Aggregatibacter actinomycetemcomitans, a Gram-negative bacterium, and Candida albicans, a polymorphic fungus, are both commensals of the oral cavity but both are opportunistic pathogens that can cause oral diseases. A. actinomycetemcomitans produces a quorum-sensing molecule called autoinducer-2 (AI-2, synthesized by LuxS, that plays an important role in expression of virulence factors, in intra- but also in interspecies communication. The aim of this study was to investigate the role of AI-2 based signaling in the interactions between C. albicans and A. actinomycetemcomitans. A. actinomycetemcomitans adhered to C. albicans and inhibited biofilm formation by means of a molecule that was secreted during growth. C. albicans biofilm formation increased significantly when co-cultured with A. actinomycetemcomitans luxS, lacking AI-2 production. Addition of wild-type-derived spent medium or synthetic AI-2 to spent medium of the luxS strain, restored inhibition of C. albicans biofilm formation to wild-type levels. Addition of synthetic AI-2 significantly inhibited hypha formation of C. albicans possibly explaining the inhibition of biofilm formation. AI-2 of A. actinomycetemcomitans is synthesized by LuxS, accumulates during growth and inhibits C. albicans hypha- and biofilm formation. Identifying the molecular mechanisms underlying the interaction between bacteria and fungi may provide important insight into the balance within complex oral microbial communities.

Data of evolutionary structure change: 1AIFA-2AI0O [Confc[Archive

Lifescience Database Archive (English)

Full Text Available s_2> 0 n> 1AIF A...n> 1AIFAn> VSSSI----SSSNL n> 2AI0 n>O 2AI...1AIFA-2AI0O 1AIF 2AI0 A O DIQLTQSPAFMAASPGEKVTITCSVSSSI----SSSNLH...e>SER CA 251 SER CA 276 SER CA 258 ASN CA 337 LEU CA 410

AI Researchers, Video Games Are Your Friends!

OpenAIRE

Togelius, Julian

2016-01-01

If you are an artificial intelligence researcher, you should look to video games as ideal testbeds for the work you do. If you are a video game developer, you should look to AI for the technology that makes completely new types of games possible. This chapter lays out the case for both of these propositions. It asks the question "what can video games do for AI", and discusses how in particular general video game playing is the ideal testbed for artificial general intelligence research. It the...

Brosimacutins A-I, nine new flavonoids from Brosimum acutifolium.

Science.gov (United States)

Takashima, Junko; Ohsaki, Ayumi

2002-12-01

Nine new flavonoids, brosimacutins A-I (1-9), and four known flavonoids were isolated from the bark of Brosimum acutifolium, a Brazilian folk medicine ("Mururé"). Their structures were elucidated by spectroscopic methods, including 2D NMR. Brosimacutins A-I possess differentially functionalized isoprene units at C-8.

QML-AiNet: An immune network approach to learning qualitative differential equation models.

Science.gov (United States)

Pang, Wei; Coghill, George M

2015-02-01

In this paper, we explore the application of Opt-AiNet, an immune network approach for search and optimisation problems, to learning qualitative models in the form of qualitative differential equations. The Opt-AiNet algorithm is adapted to qualitative model learning problems, resulting in the proposed system QML-AiNet. The potential of QML-AiNet to address the scalability and multimodal search space issues of qualitative model learning has been investigated. More importantly, to further improve the efficiency of QML-AiNet, we also modify the mutation operator according to the features of discrete qualitative model space. Experimental results show that the performance of QML-AiNet is comparable to QML-CLONALG, a QML system using the clonal selection algorithm (CLONALG). More importantly, QML-AiNet with the modified mutation operator can significantly improve the scalability of QML and is much more efficient than QML-CLONALG.

76 FR 44045 - Establishment of the SANE/SART AI/AN Initiative Committee

Science.gov (United States)

2011-07-22

... SANE/SART AI/AN Initiative Committee AGENCY: Office for Victims of Crime, Justice. ACTION: Notice of... Nurse Examiner (SANE) Sexual Assault Response Team (SART) American Indian/Alaskan Native (AI/AN) Initiative (``SANE/SART AI/AN Initiative Committee'' or ``Committee'') is being established in accordance...

Validation of the Avoidance and Inflexibility Scale (AIS) among treatment-seeking smokers.

Science.gov (United States)

Farris, Samantha G; Zvolensky, Michael J; DiBello, Angelo M; Schmidt, Norman B

2015-06-01

The Avoidance and Inflexibility Scale (AIS; Gifford et al., 2004) was derived as a smoking-specific measure of experiential avoidance. However, there has been little investigation of the psychometric proprieties of the AIS and no published work on the topic. The current study aimed to test the reliability and validity of the AIS among a sample of adult treatment-seeking daily smokers (n = 465; 48.2% female, 17.8 [SD = 9.60] cigarettes per day). The AIS was administered at 3 time points (baseline, quit-day, and 1 month postquit) as part of a larger smoking cessation trial. An exploratory factor analysis indicated a 2-factor solution, described by inflexibility and avoidance because of smoking related "thoughts/feelings" (9 items) and "somatic sensations" (4 items). Results revealed that the AIS-total and factor scores demonstrated high internal consistency and test-retest reliability. The AIS total and factor scores also displayed high convergent, discriminant, and incremental predictive validity with theoretically relevant smoking and affective variables. The present data suggest that the AIS measure appears to be a valid and reliable smoking-specific index of experiential avoidance. (c) 2015 APA, all rights reserved).

Validation of the Avoidance and Inflexibility Scale (AIS) among Treatment-Seeking Smoker

Science.gov (United States)

Farris, Samantha G.; Zvolensky, Michael J.; DiBello, Angelo M.; Schmidt, Norman B.

2015-01-01

The Avoidance and Inflexibility Scale (AIS; Gifford et al., 2004) was derived as smoking-specific measure of experiential avoidance. However, there has been little investigation of the psychometric proprieties of the AIS and no published work on the topic. The current study aimed to test the reliability and validity of the AIS among a sample of adult treatment-seeking daily smokers (n = 465; 48.1% female, 17.8 [SD = 9.60] cigarettes per day). The AIS was administered at three time points (Baseline, Quit day, 1 month post-quit) as part of a larger smoking cessation trial. An exploratory factor analysis indicated a two-factor solution, described by inflexibility and avoidance due to smoking related “thoughts/feelings” (9 items) and “somatic sensations” (4 items). Results revealed that the AIS-total and factor scores demonstrated high internal consistency and test-retest reliability. The AIS total and factor scores also displayed high convergent, discriminant, and incremental predictive validity with theoretically-relevant smoking and affective variables. The present data suggest that the AIS measure appears to be a valid and reliable smoking-specific index of experiential avoidance. PMID:25642937

Validation of the Avoidance and Inflexibility Scale (AIS) among Treatment-Seeking Smoker

OpenAIRE

Farris, Samantha G.; Zvolensky, Michael J.; DiBello, Angelo M.; Schmidt, Norman B.

2015-01-01

The Avoidance and Inflexibility Scale (AIS; Gifford et al., 2004) was derived as smoking-specific measure of experiential avoidance. However, there has been little investigation of the psychometric proprieties of the AIS and no published work on the topic. The current study aimed to test the reliability and validity of the AIS among a sample of adult treatment-seeking daily smokers (n = 465; 48.1% female, 17.8 [SD = 9.60] cigarettes per day). The AIS was administered at three time points (Bas...

Code AI Personal Web Pages

Science.gov (United States)

Garcia, Joseph A.; Smith, Charles A. (Technical Monitor)

1998-01-01

The document consists of a publicly available web site (george.arc.nasa.gov) for Joseph A. Garcia's personal web pages in the AI division. Only general information will be posted and no technical material. All the information is unclassified.

AI, automation and the Flight Telerobotic Servicer

Science.gov (United States)

Goforth, Andre; Dominy, Robert

1988-01-01

A NASA study for the preliminary definition of a teleoperated robotic device has been recently completed. The Fligt Telerobotic Servicer (FTS) will be used to assist astronauts in many of the on-board tasks of assembly, maintenance, servicing, and inspection of the Space Station. The role of artificial intelligence (AI) in furthering the FTS automation capabilities and, hence, extending its capacity for growth and evolution is discussed. Relevant system engineering issues are identified, and an approach for insertion of AI technology is presented in terms of the NASA/NBS Standard Reference Model control architecture NASREM.

Substituted Benzamides Containing Azaspiro Rings as Upregulators of Apolipoprotein A-I Transcription

Directory of Open Access Journals (Sweden)

Bin Hong

2012-06-01

Full Text Available Apolipoprotein A-I (Apo A-I is the principal protein component of high density lipoprotein (HDL, which is generally considered as a potential therapeutic target against atherosclerosis. The understanding of the Apo A-I regulation mechanism has fuelled the development of novel HDL targeted therapeutic approaches. To identify novel agents that can upregulate Apo A-I expression, we performed a cell-based reporter assay to screen 25,600 small molecules. Based on the dataset obtained from screening, a series of novel analogs of substituted benzamides containing azaspiro rings were assessed for their ability to induce the transcription of the Apo A-I gene, and the structure-activity relationship (SAR around these analogs was also proposed. The results indicated that the trifluoromethyl substituted benzamide containing an azaspiro ring is a promising backbone for designing Apo A-I transcriptional upregulator and could be viable leads for development of new drugs to prevent and treat atherosclerosis in the future.

78 FR 17232 - Meeting of the SANE/SART AI/AN Initiative Committee

Science.gov (United States)

2013-03-20

.../SART AI/AN Initiative Committee AGENCY: Office for Victims of Crime, Justice. ACTION: Notice of meeting. SUMMARY: The National Coordination Committee on the American Indian/ Alaska Native (AI/AN) Sexual Assault... violence within AI/AN communities. DATES AND LOCATIONS: The meeting will be held via webinar on Wednesday...

AI-guided parameter optimization in inverse treatment planning

International Nuclear Information System (INIS)

Yan Hui; Yin Fangfang; Guan Huaiqun; Kim, Jae Ho

2003-01-01

An artificial intelligence (AI)-guided inverse planning system was developed to optimize the combination of parameters in the objective function for intensity-modulated radiation therapy (IMRT). In this system, the empirical knowledge of inverse planning was formulated with fuzzy if-then rules, which then guide the parameter modification based on the on-line calculated dose. Three kinds of parameters (weighting factor, dose specification, and dose prescription) were automatically modified using the fuzzy inference system (FIS). The performance of the AI-guided inverse planning system (AIGIPS) was examined using the simulated and clinical examples. Preliminary results indicate that the expected dose distribution was automatically achieved using the AI-guided inverse planning system, with the complicated compromising between different parameters accomplished by the fuzzy inference technique. The AIGIPS provides a highly promising method to replace the current trial-and-error approach

Physical self-concept in adolescents from Seville in relation with gender and the evolution of sport career

Directory of Open Access Journals (Sweden)

Francis Ries

2011-01-01

Full Text Available The aim of this study was to examine the physical capacities and the physical attractiveness of Seville adolescent athletes and whether these perceptions vary by gender and sport career development. 90 adolescents from 12 to 18 years (50 girls and 40 boys completed a Spanish adaptation of the Physical Self Description Questionnaire (Marsh, Richards, Johnson, Roche y Tremaye, 1994; Tomás, 1998 and a scale to collect physical attractiveness perceived (Alfermann, Saborowski y Würth, 1997. The results show that males have a more positive physical self-concept than females. There were no relationships of the variables with the level of sports performance. The follow-up survey, one year later, noted an increase in some subdomains of self-concept in terms of positive developments in the sport career. In this study the physical changes associated with maturation in adolescence seem to have fewer influences on the perception of the body as it has been reported in other studies

A framework for AI-based nuclear design support system

International Nuclear Information System (INIS)

Furuta, Kazuo; Kondo, Shunsuke

1991-01-01

Nowadays many computer programs are being developed and used for the analytic tasks in nuclear reactor design, but experienced designers are still responsible for most of the synthetic tasks which are not amenable to algorithmic computer processes. Artificial intelligence (AI) is a promising technology to deal with these intractable tasks in design. In development of AI-based design support systems, it is desirable to choose a comprehensive framework based on the scientific theory of design. In this work a framework for AI-based design support systems for nuclear reactor design will be proposed based on an exploration model of design. The fundamental architectures of this framework will be described especially on knowledge representation, context management and design planning. (author)

AI technology and automobile. ; Toward vehicle autonomy. AI gijutsu to jidosha. ; Sharyo no jiritsuka ni mukatte

Energy Technology Data Exchange (ETDEWEB)

Okuno, A. (Mazda Motor Corp., Hiroshima (Japan))

1991-01-01

This report describes the vehicle autonomy by using artificial intelligence (AI) technology. Owing to a remarkable progress of AI technology, it is forecasted that driving support system will be introduced into the market till 2000, and higher autonomous navigation system will be introduced since about 2010. Autonomous vehicles have capacities of recognizing the outside world and of navigating roads by themselves, and with their enfanced environment adaptability the road transportation in the future is expected to be much more safer than in the present. The autonomous vehicle can warn its driver of potential dangers and correct operational errors of the driver. In order to realize such autonomous vehicles, extensive researches on perception systems, decision making systems and driving support systems are needed. 9 refs., 10 figs., 1 tab.

Elasticidad precio de la demanda y perfil de los usuarios de la parada “Pablo de Olavide" de Metro de Sevilla || Price Elasticity of Demand and Profile of “Pablo de Olavide" Metro Stop's Users of Seville Metro

Directory of Open Access Journals (Sweden)

Hernández-Díaz, Alfredo G.

2014-06-01

Full Text Available En el presente trabajo mostramos los resultados más relevantes obtenidos en un proceso de encuestación a 300 usuarios de la estación “Pablo de Olavide" del metro de Sevilla. El objetivo del trabajo es doble: por un lado, analizar el perfil del usuario (motivaciones por las que usan el metro, intermodalidad y flujos; mientras que, por otro lado, a partir de las disposiciones a pagar con respecto a posibles incrementos en el precio del servicio, estimamos parcialmente la elasticidad precio de la demanda para esta población objetivo tan concreta. El perfil tan específico de los usuarios de dicha parada así como las características propias del metro de Sevilla explican algunos de los resultados obtenidos esperando ayuden a los gestores y administradores de Metro de Sevilla en la toma de decisiones. || In this paper the most relevant results obtained in a survey conducted by 300 users of the “Pablo de Olavide" Seville metro stop are presented. The aim of the paper is twofold. On the one hand, the user profile is analysed: motivations for using the subway, intermodality and ows, whereas, on the other hand, the price elasticity of demand is partially computed by means of the willingness to pay for that specic user profile. In fact, both the particular user profile and Seville metro's characteristics explain some of the obtained results that hopefully will help managers of Seville Metro in making decisions.

Spain

International Nuclear Information System (INIS)

Zoppo, C.E.

1990-01-01

This paper reports on nuclear export activities in Spain, as elsewhere, which occur in a political, economic, and technological context. The factors operating the process are not always explicitly related in the public and the private sectors, nor between these sectors, by the relevant decision makers. A redefinition of Spain's policies in the nuclear sector has been going on since at least 1984, when a new energy plan was legislated by the newly elected Socialist government. It would be accurate to suggest that this process remains dynamic and not fully completed for policy purposes. This condition has resulted from the fact that Spain underwent a crucial political regime change from dictatorship to parliamentary democracy about a decade ago, with the transition to democracy only recently consolidated. Moreover, no policy in regard to nuclear nonproliferation existed during the Franco regime. Instead, Spain's official position was to maintain the right to preserve a nuclear option for national defense. However, this option was not developed into a concerted program to develop a nuclear military capability

Framework for AI-based nuclear reactor design support system

International Nuclear Information System (INIS)

Furuta, Kazuo; Kondo, Shunsuke

1992-01-01

Nowadays many computer programs are being developed and used for the analytic tasks in nuclear reactor design, but experienced designers are still responsible for most of the synthetic tasks which are not amenable to algorithmic computer processes. Artificial intelligence (AI) is a promising technology to deal with these intractable tasks in design. In development of AI-based design support systems, it is desirable to choose a comprehensive framework based on the scientific theory of design. In this work a framework for AI-based design support systems for nuclear reactor design will be proposed based on an explorative abduction model of design. The fundamental architectures of this framework will be described especially on knowledge representation, context management and design planning. (author)

National AIS at 1 Minute Intervals

Data.gov (United States)

National Oceanic and Atmospheric Administration, Department of Commerce — OCM plans to contract for AIS data per the following description. The United States Automatic Identification System Database contains vessel traffic data for...

Physical activity practice´s characteristics of students of Faculty of Education (University of Seville

Directory of Open Access Journals (Sweden)

Carolina Castañeda Vázquez

2012-02-01

Full Text Available The aim of this research is to know about students´ physical activity from Faculty of Education of University of Seville, and its characteristics.The sample (N=409 is constituted for students from the different degrees of this Faculty (±4.8%; 95%CI. A specific questionnaire, built to that effect, was used to obtain dates. This instrument was validated by different experts on this area of studies, and statistic tests was done to check its reliability (Alpha Cronbach: .78 using SPSS V.15. The main results showed that 62.19% of students do physical activity regularly. Students prefer recreational activities or exercise aimed at being fit or watching health instead competitive games. Activities done by students inside University are very similar to activities done out of this. They also do exercise during all academic year, preferably along the all week or from Monday to Friday, and especially in the afternoon. This group usually practice with friends, classmates or workmates, but lonely too, and they prefer public areas and public or private sport facilities for their sport practice.Key Words: University students, physical activity practice, leisure time.

Monitoring severe accidents using AI techniques

Energy Technology Data Exchange (ETDEWEB)

No, Young Gyu; Ahn, Kwang Il [Korea Atomic Energy Research Institute, Daejeon (Korea, Republic of); Kim, Ju Hyun; Na, Man Gyun [Dept. of Nuclear Engineering, Chosun University, Gwangju (Korea, Republic of); Lim, Dong Hyuk [Korea Institute of Nuclear Nonproliferation and Control, Daejon (Korea, Republic of)

2012-05-15

After the Fukushima nuclear accident in 2011, there has been increasing concern regarding severe accidents in nuclear facilities. Severe accident scenarios are difficult for operators to monitor and identify. Therefore, accurate prediction of a severe accident is important in order to manage it appropriately in the unfavorable conditions. In this study, artificial intelligence (AI) techniques, such as support vector classification (SVC), probabilistic neural network (PNN), group method of data handling (GMDH), and fuzzy neural network (FNN), were used to monitor the major transient scenarios of a severe accident caused by three different initiating events, the hot-leg loss of coolant accident (LOCA), the cold-leg LOCA, and the steam generator tube rupture in pressurized water reactors (PWRs). The SVC and PNN models were used for the event classification. The GMDH and FNN models were employed to accurately predict the important timing representing severe accident scenarios. In addition, in order to verify the proposed algorithm, data from a number of numerical simulations were required in order to train the AI techniques due to the shortage of real LOCA data. The data was acquired by performing simulations using the MAAP4 code. The prediction accuracy of the three types of initiating events was sufficiently high to predict severe accident scenarios. Therefore, the AI techniques can be applied successfully in the identification and monitoring of severe accident scenarios in real PWRs.

Monitoring severe accidents using AI techniques

International Nuclear Information System (INIS)

No, Young Gyu; Ahn, Kwang Il; Kim, Ju Hyun; Na, Man Gyun; Lim, Dong Hyuk

2012-01-01

After the Fukushima nuclear accident in 2011, there has been increasing concern regarding severe accidents in nuclear facilities. Severe accident scenarios are difficult for operators to monitor and identify. Therefore, accurate prediction of a severe accident is important in order to manage it appropriately in the unfavorable conditions. In this study, artificial intelligence (AI) techniques, such as support vector classification (SVC), probabilistic neural network (PNN), group method of data handling (GMDH), and fuzzy neural network (FNN), were used to monitor the major transient scenarios of a severe accident caused by three different initiating events, the hot-leg loss of coolant accident (LOCA), the cold-leg LOCA, and the steam generator tube rupture in pressurized water reactors (PWRs). The SVC and PNN models were used for the event classification. The GMDH and FNN models were employed to accurately predict the important timing representing severe accident scenarios. In addition, in order to verify the proposed algorithm, data from a number of numerical simulations were required in order to train the AI techniques due to the shortage of real LOCA data. The data was acquired by performing simulations using the MAAP4 code. The prediction accuracy of the three types of initiating events was sufficiently high to predict severe accident scenarios. Therefore, the AI techniques can be applied successfully in the identification and monitoring of severe accident scenarios in real PWRs.

NASA space station automation: AI-based technology review

Science.gov (United States)

Firschein, O.; Georgeff, M. P.; Park, W.; Neumann, P.; Kautz, W. H.; Levitt, K. N.; Rom, R. J.; Poggio, A. A.

1985-01-01

Research and Development projects in automation for the Space Station are discussed. Artificial Intelligence (AI) based automation technologies are planned to enhance crew safety through reduced need for EVA, increase crew productivity through the reduction of routine operations, increase space station autonomy, and augment space station capability through the use of teleoperation and robotics. AI technology will also be developed for the servicing of satellites at the Space Station, system monitoring and diagnosis, space manufacturing, and the assembly of large space structures.

Enabling technologies and methods for the retro-fitting of AI software into NPPS

International Nuclear Information System (INIS)

Pymm, P.

1994-01-01

Scottish Nuclear have a number of plant monitoring and training applications at their operational nuclear power plant which could benefit from the introduction of artificial intelligence (AI) software. An outline of early work on two current AI developments in the areas of advanced operator aids and intelligent training is given. A generic workstation based engineering simulator (WES) which provides a prototyping environment for AI product application development and evaluation and development of human-computer interface (HCI) designs for plant installation is described. It is concluded that the WES architecture facilitates both migration of the prototype AI application to the plant and collaboration in the AI field between Scottish Nuclear and other organizations. (author). 1 ref., 6 figs

A Review of Future and Ethical Perspectives of Robotics and AI

OpenAIRE

Jim Torresen

2018-01-01

In recent years, there has been increased attention on the possible impact of future robotics and AI systems. Prominent thinkers have publicly warned about the risk of a dystopian future when the complexity of these systems progresses further. These warnings stand in contrast to the current state-of-the-art of the robotics and AI technology. This article reviews work considering both the future potential of robotics and AI systems, and ethical considerations that need to be taken in order to ...

Using experimental game theory to transit human values to ethical AI

OpenAIRE

Wang, Yijia; Wan, Yan; Wang, Zhijian

2017-01-01

Knowing the reflection of game theory and ethics, we develop a mathematical representation to bridge the gap between the concepts in moral philosophy (e.g., Kantian and Utilitarian) and AI ethics industry technology standard (e.g., IEEE P7000 standard series for Ethical AI). As an application, we demonstrate how human value can be obtained from the experimental game theory (e.g., trust game experiment) so as to build an ethical AI. Moreover, an approach to test the ethics (rightness or wrongn...

Accretion in Radiative Equipartition (AiRE) Disks

Energy Technology Data Exchange (ETDEWEB)

Yazdi, Yasaman K.; Afshordi, Niayesh, E-mail: yyazdi@pitp.ca, E-mail: nafshordi@pitp.ca [Perimeter Institute for Theoretical Physics, 31 Caroline Street N, Waterloo, ON N2L 2Y5 (Canada)

2017-07-01

Standard accretion disk theory predicts that the total pressure in disks at typical (sub-)Eddington accretion rates becomes radiation pressure dominated. However, radiation pressure dominated disks are thermally unstable. Since these disks are observed in approximate steady state over the instability timescale, our accretion models in the radiation-pressure-dominated regime (i.e., inner disk) need to be modified. Here, we present a modification to the Shakura and Sunyaev model, where the radiation pressure is in equipartition with the gas pressure in the inner region. We call these flows accretion in radiative equipartition (AiRE) disks. We introduce the basic features of AiRE disks and show how they modify disk properties such as the Toomre parameter and the central temperature. We then show that the accretion rate of AiRE disks is limited from above and below, by Toomre and nodal sonic point instabilities, respectively. The former leads to a strict upper limit on the mass of supermassive black holes as a function of cosmic time (and spin), while the latter could explain the transition between hard and soft states of X-ray binaries.

Development and Validation of the Alcohol Identity Implicit Associations Test (AI-IAT)

Science.gov (United States)

Gray, Heather M.; LaPlante, Debi A.; Bannon, Brittany L.; Ambady, Nalini; Shaffer, Howard J.

2011-01-01

Alcohol identity is the extent to which an individual perceives drinking alcohol to be a defining characteristic of his or her self-identity. Although alcohol identity might play an important role in risky college drinking practices, there is currently no easily administered, implicit measure of this concept. Therefore we developed a computerized implicit measure of alcohol identity (the Alcohol Identity Implicit Associations Test; AI-IAT) and assessed its reliability and predictive validity in relation to risky college drinking practices. One hundred forty-one college students completed the AI-IAT. Again 3- and 6-months later, we administered the AI-IAT and indices of engagement in risky college drinking practices. A subset of participants also completed the previously-validated implicit measure of alcohol identity. Scores on the AI-IAT were stable over time, internally consistent, and positively correlated with the previously-validated measure of alcohol identity. Baseline AI-IAT scores predicted future engagement in risky college drinking practices, even after controlling for standard alcohol consumption measures. We conclude that the AI-IAT reliably measures alcohol identity, a concept that appears to play an important role in risky college drinking practices. PMID:21621924

Combining AI Methods for Learning Bots in a Real-Time Strategy Game

Directory of Open Access Journals (Sweden)

Robin Baumgarten

2009-01-01

Full Text Available We describe an approach for simulating human game-play in strategy games using a variety of AI techniques, including simulated annealing, decision tree learning, and case-based reasoning. We have implemented an AI-bot that uses these techniques to form a novel approach for planning fleet movements and attacks in DEFCON, a nuclear war simulation strategy game released in 2006 by Introversion Software Ltd. The AI-bot retrieves plans from a case-base of recorded games, then uses these to generate a new plan using a method based on decision tree learning. In addition, we have implemented more sophisticated control over low-level actions that enable the AI-bot to synchronize bombing runs, and used a simulated annealing approach for assigning bombing targets to planes and opponent cities to missiles. We describe how our AI-bot operates, and the experimentation we have performed in order to determine an optimal configuration for it. With this configuration, our AI-bot beats Introversion's finite state machine automated player in 76.7% of 150 matches played. We briefly introduce the notion of ability versus enjoyability and discuss initial results of a survey we conducted with human players.

AIS Ship Traffic: Hawaii: 2011-2012

Data.gov (United States)

National Oceanic and Atmospheric Administration, Department of Commerce — Ship position data from a satellite-based Automatic Identification System (AIS) were obtained jointly by PacIOOS (J. Potemra), SOEST/ORE of the University of Hawaii...

Artemisiae Argyi Folium and its geo-authentic crude drug qi ai

Directory of Open Access Journals (Sweden)

Diangang Liu

2017-01-01

Conclusion: The superior quality of qi ai compared with general AAF may be due to relatively higher contents of bioactive components. This study provides basic information for further study and utilization of AAF and qi ai.

Apolipoprotein A-I metabolism in cynomolgus monkey. Identification and characterization of beta-migrating pools

International Nuclear Information System (INIS)

Melchior, G.W.; Castle, C.K.

1989-01-01

Fresh plasma from control (C) and hypercholesterolemic (HC) cynomolgus monkeys was analyzed by agarose electrophoresis-immunoblotting with antibody to cynomolgus monkey apolipoprotein (apo) A-I. Two bands were evident on the autoradiogram: an alpha-migrating band (high density lipoprotein) and a beta-migrating band that comigrated exactly with cynomolgus monkey low density lipoprotein (LDL). The presence of beta-migrating apo A-I in the plasma of these monkeys was confirmed by Geon-Pevikon preparative electrophoresis, crossed immunoelectrophoresis, and isotope dilution studies in which radiolabeled apo A-I was found to equilibrate also with alpha- and beta-migrating pools of apo A-I in the plasma. Subfractionation of C and HC plasma by agarose column chromatography (Bio-Gel A-0.5M and A-15M) followed by agarose electrophoresis-immunoblotting indicated that the beta-migrating apo A-I in C was relatively homogeneous and eluted with proteins of Mr approximately 50 kD [apo A-I(50 kD)], whereas two beta-migrating fractions were identified in HC, one that eluted with the 50-kD proteins, and the other that eluted in the LDL Mr range [apo A-I(LDL)]. The apo A-I(LDL) was precipitated by antibody to cynomolgus monkey apo B. The apo A-I(50 kD) accounted for 5 +/- 1% (mean +/- SD) of the plasma apo A-I in C plasma, and 15 +/- 7% in HC plasma. No apo A-I(LDL) was detected in C plasma, but that fraction accounted for 9 +/- 7% of the apo A-I in HC plasma. These data establish the presence of multiple pools of apo A-I in the cynomolgus monkey, which must be taken into consideration in any comprehensive model of apo A-I metabolism in this species

General general game AI

OpenAIRE

Togelius, Julian; Yannakakis, Georgios N.; 2016 IEEE Conference on Computational Intelligence and Games (CIG)

2016-01-01

Arguably the grand goal of artificial intelligence research is to produce machines with general intelligence: the capacity to solve multiple problems, not just one. Artificial intelligence (AI) has investigated the general intelligence capacity of machines within the domain of games more than any other domain given the ideal properties of games for that purpose: controlled yet interesting and computationally hard problems. This line of research, however, has so far focuse...

ITER EDA Newsletter. V. 3, no. 11

International Nuclear Information System (INIS)

1994-11-01

This ITER EDA (Engineering Design Activities) Newsletter issue reports on (i) the third Technical Meeting on Safety and Environment held at the San Diego Joint Work Site, October 10-14, 1994; (ii) the ITER Expert Group Meeting on Disruptions, Plasma Control and MHD, held in Seville, Spain, September 29-30, 1994; in addition to a brief contribution on aspects of family life for foreigners at the Naka Joint Work Site

Emotion Oriented Programming: Computational Abstractions for AI Problem Solving

OpenAIRE

Darty , Kevin; Sabouret , Nicolas

2012-01-01

International audience; In this paper, we present a programming paradigm for AI problem solving based on computational concepts drawn from Affective Computing. It is believed that emotions participate in human adaptability and reactivity, in behaviour selection and in complex and dynamic environments. We propose to define a mechanism inspired from this observation for general AI problem solving. To this purpose, we synthesize emotions as programming abstractions that represent the perception ...

Do older t'ai chi practitioners have better attention and memory function?

Science.gov (United States)

Man, David W K; Tsang, William W N; Hui-Chan, Christina W Y

2010-12-01

Cognitive declines are common in older people and can be a major health issue in an aging world. One type of body-mind exercises, t'ai chi, can be a possible means to help maintaining older adults' cognitive abilities, in addition to beneficial effects of physical exercises. The purpose of this study was to investigate whether t'ai chi practitioners had better attention and memory functions than older people with or without regular exercises. A cross-sectional study examining the relationship between t'ai chi practice and age-, gender- and education-similar older peoples' attention and memory functions. Forty-two (42) community-dwelling elderly subjects, aged 60 or older, recruited from t'ai chi clubs in Hong Kong formed the t'ai chi group. Another 49 elderly having regular exercise habits were recruited from community centers for inclusion in the exercise group. A nonexercise group (normal healthy control) consisting of 44 subjects were also recruited by random selection and through contacting local elderly centers. They were also screened by the Modified Barthel Index, Chinese Mini-mental Status Examination, Geriatric Depression Scale, and evaluated by attention tests (Color Trail Form A-1 and 2) and memory tests (including Rivermead Behavioral Memory Test and The Hong Kong List Learning Test). The main finding was that the three groups differed in attention and memory functions, and the t'ai chi group had demonstrated better performance than the other two groups in most subtests. As a causal relationship cannot be assumed in the present cross-sectional study, future research is required to examine how t'ai chi can improve cognitive function using a randomized control trial as well as determining whether t'ai chi practice can lead to better health status among elderly people.

Application of AI technology to nuclear plant operations

International Nuclear Information System (INIS)

Sackett, J.I.

1988-01-01

In this paper, applications of Artificial Intelligence (AI) Technology to nuclear-power plant operation are reviewed. AI Technology is advancing rapidly and in the next five years is expected to enjoy widespread application to operation, maintenance, management and safety. Near term emphasis on a sensor validation, scheduling, alarm handling, and expert systems for procedural assistance. Ultimate applications are envisioned to culminate in autonomous control such as would be necessary for a power system in space, where automatic control actions are taken based upon reasoned conclusions regarding plant conditions, capability and control objectives

Teaching AI Search Algorithms in a Web-Based Educational System

Science.gov (United States)

Grivokostopoulou, Foteini; Hatzilygeroudis, Ioannis

2013-01-01

In this paper, we present a way of teaching AI search algorithms in a web-based adaptive educational system. Teaching is based on interactive examples and exercises. Interactive examples, which use visualized animations to present AI search algorithms in a step-by-step way with explanations, are used to make learning more attractive. Practice…

Managing bioengineering complexity with AI techniques.

Science.gov (United States)

Beal, Jacob; Adler, Aaron; Yaman, Fusun

2016-10-01

Our capabilities for systematic design and engineering of biological systems are rapidly increasing. Effectively engineering such systems, however, requires the synthesis of a rapidly expanding and changing complex body of knowledge, protocols, and methodologies. Many of the problems in managing this complexity, however, appear susceptible to being addressed by artificial intelligence (AI) techniques, i.e., methods enabling computers to represent, acquire, and employ knowledge. Such methods can be employed to automate physical and informational "routine" work and thus better allow humans to focus their attention on the deeper scientific and engineering issues. This paper examines the potential impact of AI on the engineering of biological organisms through the lens of a typical organism engineering workflow. We identify a number of key opportunities for significant impact, as well as challenges that must be overcome. Copyright © 2015 Elsevier Ireland Ltd. All rights reserved.

SDI satellite autonomy using AI and Ada

Science.gov (United States)

Fiala, Harvey E.

1990-01-01

The use of Artificial Intelligence (AI) and the programming language Ada to help a satellite recover from selected failures that could lead to mission failure are described. An unmanned satellite will have a separate AI subsystem running in parallel with the normal satellite subsystems. A satellite monitoring subsystem (SMS), under the control of a blackboard system, will continuously monitor selected satellite subsystems to become alert to any actual or potential problems. In the case of loss of communications with the earth or the home base, the satellite will go into a survival mode to reestablish communications with the earth. The use of an AI subsystem in this manner would have avoided the tragic loss of the two recent Soviet probes that were sent to investigate the planet Mars and its moons. The blackboard system works in conjunction with an SMS and a reconfiguration control subsystem (RCS). It can be shown to be an effective way for one central control subsystem to monitor and coordinate the activities and loads of many interacting subsystems that may or may not contain redundant and/or fault-tolerant elements. The blackboard system will be coded in Ada using tools such as the ABLE development system and the Ada Production system.

Selective oxidation of methionine residues in apolipoprotein A-I and its potential biological consequences

International Nuclear Information System (INIS)

Panzenboeck, U.; Waldeck, R.; Rye, K.A.; Sloane, T.; Kritharides, L.; Stocker, R.

1998-01-01

The earliest stages of HDL oxidation are accompanied by the oxidation of specific Met residues in apolipoprotein AI and AII and the formation of Met sulfoxides (Met(O)) has been proposed to play a significant role in the reduction and hence detoxification of lipid hydroperoxides associated with HDL. Oxidation of HDL may generally decrease the anti-atherogenic properties of this lipoprotein, although both, the inhibition and the enhancement of cholesterol removal from cells has been reported for different types of oxidation. In light of these findings we have investigated the secondary structure, lipid affinity, LCAT activation and cholesterol-efflux promoting properties of native and selectively oxidized apo A-I(apo A-I +32 , containing Met(O) at Met l12 and Met l48 ) in purified or reconstituted forms. Data obtained by circular dichroism revealed that selective oxidation of Met residues 112 and 148 does not alter alpha helicity of the protein in solution, indicating that this oxidation is not sufficient to influence significantly this type of secondary structure of apo A-I in its 'lipid-free' form. The lipid affinity of native apo A-I and apo A-I +32 was determined as the rate of clearance of DMPC multilamellar to small unilamellar vesicles. Compared with the native protein, apo A-I +32 induced a 2-3 fold faster rate of clearance, suggesting that the increased hydrophilicity due Met(O) increased the rate for protein-lipid interactions. Met residues 112 and 148 reside in the hydrophobic faces of helices 5 and 7, and both these regions have been suggested to be important for both, LCAT activation and cholesterol efflux. Kinetic experiments have revealed that the affinity for LCAT is comparable for HDL reconstituted with either apo A-I or apo A-I +32 . Efflux of [ 3 H]-cholesterol from lipid-laden human monocytederived macrophages to isolated apolipoproteins was enhanced for apo A-I +32 compared with apo A-I, consistent with the DMPC clearance data. Together these

Annealing Induced Softening in Deformed AI-4043 Alloy

International Nuclear Information System (INIS)

Saad, G.; Fawzy, A.; Soliman, H.N.; Mohammed, Gh.; Fayek, S.A.

2011-01-01

The present paper is devoted to study the effect of annealing temperature for different annealing periods of time on the structure and consequently on the tensile properties of Al-4043 alloy. The obtained results showed that the microstructure of AI-4043 alloy is characterized by the presence of spherically shaped Si-particles, which were found to be uniformly distributed within the AI-matrix. Stress-strain characterizations of AI-4043 samples annealed at different temperatures (T a = 573, 673 and 773 K) for different periods of time (t a = 0.5, 1,2.5,5 and 10 h), showed that the tensile parameters; yield stress ε y 0.2 and fracture stress ε f were decreased with increasing Ta and/or ta while the total strain ε T was increased. This was interpreted in terms of growth of Si-particles with increasing T a and/or t a . Attention has been also paid to the role of the minor elements Fe, Cu and Ti on the structure and tensile response behavior of the alloy under investigation

Beyond AI: Multi-Intelligence (MI Combining Natural and Artificial Intelligences in Hybrid Beings and Systems

Directory of Open Access Journals (Sweden)

Stephen Fox

2017-06-01

Full Text Available Framing strongly influences actions among technology proponents and end-users. Underlying much debate about artificial intelligence (AI are several fundamental shortcomings in its framing. First, discussion of AI is atheoretical, and therefore has limited potential for addressing the complexity of causation. Second, intelligence is considered from an anthropocentric perspective that sees human intelligence, and intelligence developed by humans, as superior to all other intelligences. Thus, the extensive post-anthropocentric research into intelligence is not given sufficient consideration. Third, AI is discussed often in reductionist mechanistic terms. Rather than in organicist emergentist terms as a contributor to multi-intelligence (MI hybrid beings and/or systems. Thus, current framing of AI can be a self-validating reduction within which AI development is focused upon AI becoming the single-variable mechanism causing future effects. In this paper, AI is reframed as a contributor to MI.

In-situ volatile organic compounds measurements with GC-MSD during the DOMINO campaign in Spain, December 2008

Science.gov (United States)

Song, W.; Yassaa, N.; Williams, J.

2009-04-01

This study presents a new volatile organic compounds (VOC) dataset measured during the DOMINO field campaign in December 2008. The measurements were made from a 10m tower located in a nature reserve on the south west coast of Spain. For the analysis, the VOCs were collected and concentrated on a thermal desorber unit, separated on a gas chromotagraph equipped with an enantiomerically selective column, and detected by mass spectrometry. This experimental set-up allowed the measurement of anthropogenic VOCs such as ethyl benzene, and all xylene isomers, and biogenic species such as isoprene and monoterpenes. Here we examine the VOC mixing ratio variations as a function of air mass origin to characterize the measurement site in terms of biogenic and anthropogenic influences. Mixing ratios of biogenic species were generally low, consistent with the low winter season growth rates. The ratio of (-)-alpha-pinene to (+)-alpha-pinene was variable but showed a clear dominance of the (-)-enantiomer, similar to previous results obtained with the same system in the Tropical rainforest. High mixing ratios of benzene and toluene were related to transport events from Seville (to the northeast) and Huelva (to the west). The ratio of two short lived anthropogenic species ethylbenzene and meta-xylene was found to peak at midday and indicative of the levels of oxidant levels.

Novel cross-linked alcohol-insoluble solid (CL-AIS) affinity gel from pea pod for pectinesterase purification.

Science.gov (United States)

Wu, Ming-Chang; Lin, Guan-Hui; Wang, Yuh-Tai; Jiang, Chii-Ming; Chang, Hung-Min

2005-10-05

Alcohol-insoluble solids (AIS) from pea pod were cross-linked (CL-AIS) and used as an affinity gel matrix to isolate pectin esterases (PEs) from tendril shoots of chayote (TSC) and jelly fig achenes (JFA), and the results were compared with those isolated by ion-exchange chromatography with a commercial resin. CL-AIS gel matrix in a column displayed poor absorption and purification fold of PE; however, highly methoxylated CL-AIS (HM-CL-AIS), by exposing CL-AIS to methanolic sulfuric acid to increase the degree of esterification (DE) to 92%, facilitated the enzyme purification. The purified TSC PE and JFA PE by the HM-CL-AIS column were proofed as a single band on an SDS-PAGE gel, showing that the HM-CL-AIS column was a good matrix for purification of PE, either with alkaline isoelectric point (pI) (TSC PE) or with acidic pI (JFA PE).

Focus: Spain

International Nuclear Information System (INIS)

Ferguson, M.P.

1992-01-01

Historically, Spain's nuclear program has had its share of successes and challenges. The country currently operates nine nuclear reactors totalling over 7,100 MWe of capacity and accounting for more than a third of Spain's electricity generation. Yet four reactors at advanced stages of construction remain mothballed due to a government-imposed moratorium, and a fire at one reactor in 1989 led to its premature closure and to a revival of anti-nuclear sentiment in the country. In the new national energy plan, Spain opted to continue the moratorium and rely upon conservation measures, additional natural gas imports, and electricity imports to meet expected demand. The current nuclear facilities will continue to operate, and the government will continue to pursue advanced reactor research, and expansion of the country's domestic uranium industry. Spain's integration into the European Community also is affecting the country's energy plans, prompting consolidation within the Spanish electricity sector in order to be more competitive in Europe

«En los mayores peligros se conoce la amistad» («Friendship is Best Acknowledged when in Danger», an Auto Sacramental (Eucharistic Morality Play by José de Valdivieso, Staged at the Corpus Christi Feast in Seville, in 1619. An Analysis and a Virtual Reconstruction

Directory of Open Access Journals (Sweden)

Mercedes de los Reyes Peña

2017-11-01

Full Text Available This paper studies José de Valdivieso’s En los mayores peligros se conoce la amistad (Friendship is best acknowledged when in danger one of the five autos sacramentales (Eucharistic morality plays staged at the Corpus Christi feast in Seville, in 1619, by Diego de Vallejo. It also bears the title La amistad en el peligro (Friendship when in danger, and has never been published in a modern critical edition, though two published records (1622 and 1624 bear witness to the play, of which there are two 17 th Century manuscript versions extant. This article, based on contemporary records, studies the historical socio-religious- urban context of the Corpus Christi feast in Seville and virtually reconstructs the play’s performance, on pageant wagons, and its subsequent procession within the town.

Launching AI in NASA ground systems

Science.gov (United States)

Perkins, Dorothy C.; Truszkowski, Walter F.

1990-01-01

This paper will discuss recent operational successes in implementing expert systems to support the complex functions of NASA mission control systems at the Goddard Space Flight Center, including fault detection and diagnosis for real time and engineering analysis functions in the Cosmic Background Explorer and Gamma Ray Observatory missions and automation of resource planning and scheduling functions for various missions. It will also discuss ongoing developments and prototypes that will lead to increasingly sophisticated applications of artificial intelligence. These include the use of neural networks to perform telemetry monitoring functions, the implementation of generic expert system shells that can be customized to telemetry handling functions specific to NASA control centers, the applications of AI in training and user support, the long-term potential of implementing systems based around distributed, cooperative problem solving, and the use of AI to control and assist system development activities.

Deploying Embodied AI into Virtual Worlds

Science.gov (United States)

Burden, David J. H.

The last two years have seen the start of commercial activity within virtual worlds. Unlike computer games where Non-Player-Character avatars are common, in most virtual worlds they are the exception — and until recently in Second Life they were non-existent. However there is real commercial scope for Als in these worlds — in roles from virtual sales staff and tutors to personal assistants. Deploying an embodied AI into a virtual world offers a unique opportunity to evaluate embodied Als, and to develop them within an environment where human and computer are on almost equal terms. This paper presents an architecture being used for the deployment of chatbot driven avatars within the Second Life virtual world, looks at the challenges of deploying an AI within such a virtual world, the possible implications for the Turing Test, and identifies research directions for the future.

AI systems approach in particle accelerators

International Nuclear Information System (INIS)

Kataria, S.K.; Bhagwat, P.V.; Kori, S.A.

1992-01-01

The large particle accelerators machines like pelletron accelerator at Tata Institute of Fundamental Research (T.I.F.R) have several levels of controls with operators responsible for overall global control decisions and closed loop feedback controllers for relatively small subsystems of the machines. As the accelerator machines are becoming more complicated and the requirements more stringent, there is a need to provide the operators with an artificial intelligence (AI) system to aid in the tuning the machine and in failure diagnosis. There are few major areas in the pelletron operation, which can be done more efficiently using AI systems approach so that useful beam is available for much more time: 1) Accelerator Conditioning, 2) Accelerator Tuning, and 3) Maintaining the Tune beams. The feasibility study for using expert system for above areas and also for safety evaluation of the various subsystems is carried out. (author). 10 refs., 4 figs

Computing Facilities for AI: A Survey of Present and Near-Future Options

OpenAIRE

Fahlman, Scott

1981-01-01

At the recent AAAI conference at Stanford, it became apparent that many new AI research centers are being established around the country in industrial and governmental settings and in universities that have not paid much attention to AI in the past. At the same time, many of the established AI centers are in the process of converting from older facilities, primarily based on Decsystem-10 and Decsystem-20 machines, to a variety of newer options. At present, unfortunately, there is no simple an...

Combining AI Methods for Learning Bots in a Real-Time Strategy Game

OpenAIRE

Robin Baumgarten; Simon Colton; Mark Morris

2009-01-01

We describe an approach for simulating human game-play in strategy games using a variety of AI techniques, including simulated annealing, decision tree learning, and case-based reasoning. We have implemented an AI-bot that uses these techniques to form a novel approach for planning fleet movements and attacks in DEFCON, a nuclear war simulation strategy game released in 2006 by Introversion Software Ltd. The AI-bot retrieves plans from a case-base of recorded games, then uses these to generat...

In Orbit Validation of the AAUSAT3 SDR based AIS receiver

DEFF Research Database (Denmark)

Larsen, Jesper Abildgaard; Mortensen, Hans Peter

2013-01-01

During the past years, there has been a high interest in monitoring the global ship traffic from space. The recently launched AAUSAT3 satellite carries an SDR based AIS receiver, which during the past months have been transmitting space based AIS data down to the Aalborg University Ground Station...

SNAP and AI Fuel Summary Report

International Nuclear Information System (INIS)

Lords, R.E.

1994-08-01

The SNAP and AI Fuel Summary Report provides a detailed overview of treatment and storage of these fuels from fabrication through current storage including design parameters and reactor history. Chemical and physical characteristics are described, and potential indicators of as-stored fuel conditions are emphasized

AI, Native Supercomputing and The Revival of Moore's Law

OpenAIRE

Lu, Chien-Ping

2017-01-01

Based on Alan Turing's proposition on AI and computing machinery, which shaped Computing as we know it today, the new AI computing machinery should comprise a universal computer and a universal learning machine. The later should understand linear algebra natively to overcome the slowdown of Moore's law. In such a universal learnig machine, a computing unit does not need to keep the legacy of a universal computing core. The data can be distributed to the computing units, and the results can be...

AiGERM: A logic programming front end for GERM

Science.gov (United States)

Hashim, Safaa H.

1990-01-01

AiGerm (Artificially Intelligent Graphical Entity Relation Modeler) is a relational data base query and programming language front end for MCC (Mission Control Center)/STP's (Space Test Program) Germ (Graphical Entity Relational Modeling) system. It is intended as an add-on component of the Germ system to be used for navigating very large networks of information. It can also function as an expert system shell for prototyping knowledge-based systems. AiGerm provides an interface between the programming language and Germ.

Bibliotecas de Nueva Generación (Biblioteca 2.0)

OpenAIRE

González-Fernández-Villavicencio, Nieves

2007-01-01

This article study the definition of "Library 2.0" and describes implications for all types of libraries inside and outside Spain, with special attention to Seville University library. The paper focusses on the practice of librarianship, specifically addressing how Web 2.0 technologies such as synchronous messaging and streaming media, blogs, wikis, social networks, tagging, RSS feeds, and mashups are changing how libraries provide access to their collections and user support for that access.

«El aguador» de Velázquez o una meditación sóbre la cultura clásica: «Diógenes y los hijos de Xeníades»

Directory of Open Access Journals (Sweden)

Mena Marqués, Manuela B.

1999-12-01

Full Text Available Considered traditionally as the best example of Velazquez early «pintura de bodegones», or genre and still life The Water-seller is presented here as a clear representation of the Greek philosopher Diogenes, in his most essential role of mentor of youth. Based on texts of Diogenes Laertius, well known in Spain at the time, Velazquez painted it for Juan de Fonseca, canon «maestrescuela» of Seville Cathedral.No disponible

A Review of Future and Ethical Perspectives of Robotics and AI

Directory of Open Access Journals (Sweden)

Jim Torresen

2018-01-01

Full Text Available In recent years, there has been increased attention on the possible impact of future robotics and AI systems. Prominent thinkers have publicly warned about the risk of a dystopian future when the complexity of these systems progresses further. These warnings stand in contrast to the current state-of-the-art of the robotics and AI technology. This article reviews work considering both the future potential of robotics and AI systems, and ethical considerations that need to be taken in order to avoid a dystopian future. References to recent initiatives to outline ethical guidelines for both the design of systems and how they should operate are included.

Functional subdivisions in low-frequency primary auditory cortex (AI).

Science.gov (United States)

Wallace, M N; Palmer, A R

2009-04-01

We wished to test the hypothesis that there are modules in low-frequency AI that can be identified by their responsiveness to communication calls or particular regions of space. Units were recorded in anaesthetised guinea pig AI and stimulated with conspecific vocalizations and a virtual motion stimulus (binaural beats) presented via a closed sound system. Recording tracks were mainly oriented orthogonally to the cortical surface. Some of these contained units that were all time-locked to the structure of the chutter call (14/22 tracks) and/or the purr call (12/22 tracks) and/or that had a preference for stimuli from a particular region of space (8/20 tracks with four contralateral, two ipsilateral and two midline), or where there was a strong asymmetry in the response to beats of different direction (two tracks). We conclude that about half of low-frequency AI is organized into modules that are consistent with separate "what" and "where" pathways.

An AI-based layout design system for nuclear power plants

International Nuclear Information System (INIS)

Fujita, Kikuo; Akagi, Shinsuke; Nakatogawa, Tetsundo; Tanaka, Kazuo; Takeuchi, Makoto.

1991-01-01

An AI-based layout design system for nuclear power plants has been developed. The design of the layout of nuclear power plants is a time-consuming task requiring expertise, in which a lot of machinery and equipment must be arranged in a plant building considering various kinds of design constraints, i.e. spatial, functional, economical etc. Computer aided layout design systems have been widely expected and the application of AI technology is expected as a promising approach for the synthesis phase of this task. In this paper, we present an approach to the layout design of nuclear power plants based on a constraint-directed search; one of the AI techniques. In addition, we show how it was implemented with an object-oriented programming technique and give an example of its application. (author)

Body image and quality of life in a Spanish population

Directory of Open Access Journals (Sweden)

Ignacio Jáuregui Lobera

2011-01-01

Full Text Available Ignacio Jáuregui Lobera1, Patricia Bolaños Ríos21Department of Nutrition and Bromatology, Pablo de Olavide University, Seville, Spain; 2Behavior Science Institute, Seville, SpainPurpose: The aim of the current study was to analyze the psychometric properties, factor structure, and internal consistency of the Spanish version of the Body Image Quality of Life Inventory (BIQLI-SP as well as its test–retest reliability. Further objectives were to analyze different relationships with key dimensions of psychosocial functioning (ie, self-esteem, presence of psychopathological symptoms, eating and body image-related problems, and perceived stress and to evaluate differences in body image quality of life due to gender.Patients and methods: The sample comprised 417 students without any psychiatric history, recruited from the Pablo de Olavide University and the University of Seville. There were 140 men (33.57% and 277 women (66.43%, and the mean age was 21.62 years (standard deviation = 5.12. After obtaining informed consent from all participants, the following questionnaires were administered: BIQLI, Eating Disorder Inventory-2 (EDI-2, Perceived Stress Questionnaire (PSQ, Self-Esteem Scale (SES, and Symptom Checklist-90-Revised (SCL-90-R.Results: The BIQLI-SP shows adequate psychometric properties, and it may be useful to determine the body image quality of life in different physical conditions. A more positive body image quality of life is associated with better self-esteem, better psychological wellbeing, and fewer eating-related dysfunctional attitudes, this being more evident among women.Conclusion: The BIQLI-SP may be useful to determine the body image quality of life in different contexts with regard to dermatology, cosmetic and reconstructive surgery, and endocrinology, among others. In these fields of study, a new trend has emerged to assess body image-related quality of life.Keywords: body appreciation, wellbeing, self-esteem, social

Dissecting phenotypic variation among AIS patients

International Nuclear Information System (INIS)

Wang Minghua; Wang Jiucun; Zhang Zhen; Zhao Zhimin; Zhang Rongmei; Hu Xiaohua; Tan Tao; Luo Shijing; Luo Zewei

2005-01-01

We have created genital skin fibroblast cell lines directly from three patients in a Chinese family affected by androgen insensitivity syndrome (AIS). All patients in the family share an identical AR Arg 840 Cys mutant but show different disease phenotypes. By using the cell lines, we find that the mutation has not influenced a normal androgen-binding capacity at 37 deg C but has reduced the affinity for androgens and may cause thermolability of the androgen-receptor complex. The impaired nuclear trafficking of the androgen receptor in the cell lines is highly correlated with the severity of donors' disease phenotype. The transactivity of the mutant is substantially weakened and the extent of the reduced transactivity reflects severity of the donors' disease symptom. Our data reveal that although etiology of AIS is monogenic and the mutant may alter the major biological functions of its wild allele, the function of the mutant AR can also be influenced by the different genetic backgrounds and thus explains the divergent disease phenotypes

Digital models applied to the intervention of the architectural heritage: Restoration Southeast closing of the door of San Cristobal Cathedral of Seville

Directory of Open Access Journals (Sweden)

Francisco Pinto Puerto

2015-10-01

Full Text Available Interventions in historical heritage present an opportunity to gain a deeper knowledge of the element in question. The use of an appropriate methodology and the rational application of the technologies now available allow researchers from different disciplines to obtain valuable information that must be recorded and placed at the disposal of society in general. The recent consolidation works carried out on the finial of the spiral staircase of the San Cristóbal Door of Seville Cathedral is a case in point. In addition to creating an elevation of this architectural element, a virtual model was generated, incorporating all the data obtained during the course of the works. The theoretical bases were explored prior to creating the model, highlighting the importance of a profound preliminary analysis as well as the dissemination possibilities.

Augmentation index (AI) in a dose–response relationship with smoking habits in males

Science.gov (United States)

Tsuru, Tomoko; Adachi, Hisashi; Enomoto, Mika; Fukami, Ako; Kumagai, Eita; Nakamura, Sachiko; Nohara, Yume; Kono, Shoko; Nakao, Erika; Sakaue, Akiko; Morikawa, Nagisa; Fukumoto, Yoshihiro

2016-01-01

Abstract We investigated the relationship between augmentation index (AI) and smoking habits in community-dwelling Japanese. This cross-sectional study enrolled 1926 subjects (769 males and 1157 females) aged 40 to 95 years who underwent a health check-up in a Japanese cohort of the Seven Countries Study, in Tanushimaru, a typical farming town in Kyushu Island in 2009. The subjects’ medical history, alcohol intake, smoking habit, and current medications for hypertension, dyslipidemia, and diabetes were ascertained by questionnaire. Radial arterial pressure wave analysis was used to obtain AI. We analyzed the data stratified by gender. Age-adjusted means of AI in males showed a clear dose–response relationship in 4 categories of smoking habits (P = 0.010). There was no significant relationship between AI and smoking habits in females (P = 0.127). The significant dose–response relationship (P = 0.036) in males between AI and 4 categories of smoking habits still remained even after adjustment for age, body mass index, systolic blood pressure, estimated glomerular filtration rate, glucose, hypertensive medication, and alcohol intake. The present study demonstrated that AI values were significantly associated with smoking habits in a dose-dependent manner in Japanese males. PMID:28002323

Cracks appear in the AI gravy train

Energy Technology Data Exchange (ETDEWEB)

Mill, J.

1983-10-01

This article highlights some of the problems facing the Alvey committee and outlines some reasons for believing that the optimistically founded Alvey and Esprit funding programmes are no guarantee Britain will win the AI race.

Grammaire progressive du français niveau intermédiaire

CERN Document Server

Grégoire, Maïa

2017-01-01

Quatrième édition de l'ouvrage de Grammaire de français langue étrangère (FLE), niveau intermédiaire, dans la collection Progressive du français destiné aux grands adolescents et adultes. Ce qui fait le succès de cet ouvrage de Grammaire: une organisation claire : la leçon de grammaire sur la page de gauche; les exercices d'entraînement sur la page de droite 52 chapitres présentant les points généralement abordés aux niveaux A2 et B1 du Cadre européen commun de référence pour les langues un apprentissage progressif : il suit la progression naturelle des méthodes de français un usage souple : pour la classe ou en auto-apprentissage une préparation adaptée aux certifications : un entreînement efficace pour mieux réussir aux examens NOUVEAU! Appli-web de la Grammaire progressive du français incluse Pour s'entraîner et s'évaluer en ligne en sollicitant toutes les compétences écrites et orales : près de 300 exercices interactifs avec dialogues, instructions, exemples et corrigés ora...

A model of lipid-free apolipoprotein A-I revealed by iterative molecular dynamics simulation.

Directory of Open Access Journals (Sweden)

Xing Zhang

Full Text Available Apolipoprotein A-I (apo A-I, the major protein component of high-density lipoprotein, has been proven inversely correlated to cardiovascular risk in past decades. The lipid-free state of apo A-I is the initial stage which binds to lipids forming high-density lipoprotein. Molecular models of lipid-free apo A-I have been reported by methods like X-ray crystallography and chemical cross-linking/mass spectrometry (CCL/MS. Through structural analysis we found that those current models had limited consistency with other experimental results, such as those from hydrogen exchange with mass spectrometry. Through molecular dynamics simulations, we also found those models could not reach a stable equilibrium state. Therefore, by integrating various experimental results, we proposed a new structural model for lipid-free apo A-I, which contains a bundled four-helix N-terminal domain (1-192 that forms a variable hydrophobic groove and a mobile short hairpin C-terminal domain (193-243. This model exhibits an equilibrium state through molecular dynamics simulation and is consistent with most of the experimental results known from CCL/MS on lysine pairs, fluorescence resonance energy transfer and hydrogen exchange. This solution-state lipid-free apo A-I model may elucidate the possible conformational transitions of apo A-I binding with lipids in high-density lipoprotein formation.

So Sorry––Never Sorry. Ai Weiwei’s Art between Tradition and Modernity

Directory of Open Access Journals (Sweden)

Tania Becker

2011-12-01

Full Text Available Ai Weiwei’s 艾未未 (b. 1957 artistic expression revolves around his use of traditional Chinese techniques to create new designs and forms, shaping traditional materials into contemporary configurations. In the face of obstruction from state officials and local politicians, Ai Weiwei exposes himself to considerable personal risk in order to continue his activities as an artist and stay loyal to his convictions. This paper examines the roots of Ai Weiwei’s work in Chinese art history and looks at how the artist has deliberately adapted traditional motifs to bring about a sense of alienation. Ai Weiwei’s unique stance between current trends in western art and the Chinese feeling for handicrafts is also explored.

Emerging trends in geospatial artificial intelligence (geoAI): potential applications for environmental epidemiology.

Science.gov (United States)

VoPham, Trang; Hart, Jaime E; Laden, Francine; Chiang, Yao-Yi

2018-04-17

Geospatial artificial intelligence (geoAI) is an emerging scientific discipline that combines innovations in spatial science, artificial intelligence methods in machine learning (e.g., deep learning), data mining, and high-performance computing to extract knowledge from spatial big data. In environmental epidemiology, exposure modeling is a commonly used approach to conduct exposure assessment to determine the distribution of exposures in study populations. geoAI technologies provide important advantages for exposure modeling in environmental epidemiology, including the ability to incorporate large amounts of big spatial and temporal data in a variety of formats; computational efficiency; flexibility in algorithms and workflows to accommodate relevant characteristics of spatial (environmental) processes including spatial nonstationarity; and scalability to model other environmental exposures across different geographic areas. The objectives of this commentary are to provide an overview of key concepts surrounding the evolving and interdisciplinary field of geoAI including spatial data science, machine learning, deep learning, and data mining; recent geoAI applications in research; and potential future directions for geoAI in environmental epidemiology.

A regulator's viewpoint on the use of AI in the nuclear industry

International Nuclear Information System (INIS)

Wainwright, N.

1995-01-01

The regulatory position within the UK places the responsibility for safety on a nuclear site with the licensee. The licensee must produce a safety case that demonstrates that the plant is safe. Assessment of this safety case is performed by the regulator in the Health and Safety Executive (HSE) using HSE's published Safety Assessment Principles. This paper presents the personal views of a regulator on the use of artificial intelligence (AI) in the nuclear industry. The AI-based system considered are restricted to expert systems, neural networks and fuzzy logic. Some of the safety issues are discussed. The particular concerns associated with software-based systems are compounded by some of the inherent problems of AI-based systems. Such is the nature of these concerns that an acceptable safety case will be difficult to mount for safety systems and post-accident monitoring systems. However, given the present maturity of the technology, acceptable safety cases might be formulated in the areas of operator advisory systems designed to reduce accident frequencies, and robotics where dose reduction is important. There are also arguments that suggests that suitable safety cases could be formulated for AI-based plant control systems. Nevertheless, AI-based systems should be treated with caution - further research is required into suitable designs and safety demonstration techniques. (author)

Organisational intelligence and distributed AI

OpenAIRE

Kirn, Stefan

1995-01-01

The analysis of this chapter starts from organisational theory, and from this it draws conclusions for the design, and possible organisational applications, of Distributed AI systems. We first review how the concept of organisations has emerged from non-organised black-box entities to so-called computerised organisations. Within this context, organisational researchers have started to redesign their models of intelligent organisations with respect to the availability of advanced computing tec...

Development and application of AI technology to plant operation and support

International Nuclear Information System (INIS)

Sackett, J.I.; Mott, J.E.

1989-01-01

This paper discusses a framework for the development and application of artificial intelligence (AI) technology in existing nuclear facilities and reviews the status of development. We consider those areas best addressed by AI technology, e.g., equipment diagnostics, sensor validation, and expert systems for procedural response or planning. A brief discussion of work in computer displays is also given. (orig./GL)

AIS Algorithm for Smart Antenna Application in WLAN

Directory of Open Access Journals (Sweden)

Evizal Abdul Kadir

2015-07-01

Full Text Available Increasing numbers of wireless local area networks (WLAN replacing wired networks have an impact on wireless network systems, causing issues such as interference. The smart antenna system is a method to overcome interference issues in WLANs. This paper proposes an artificial immune system (AIS for a switch beam smart antenna system. A directional antenna is introduced to aim the beam at the desired user. The antenna consists of 8 directional antennas, each of which covers 45 degrees, thus creating an omnidirectional configuration of which the beams cover 360 degrees. To control the beam switching, an inexpensive PIC 16F877 microchip was used. An AIS algorithm was implemented in the microcontroller, which uses the received radio signal strength of the mobile device as reference. This is compared for each of the eight beams, after which the AIS algorithm selects the strongest signal received by the system and the microcontroller will then lock to the desired beam. In the experiment a frequency of 2.4 GHz (ISM band was used for transmitting and receiving. A test of the system was conducted in an outdoor environment. The results show that the switch beam smart antenna worked fine based on locating the mobile device.

It Takes Two to Tango: Towards Theory of AI's Mind

OpenAIRE

Chandrasekaran, Arjun; Yadav, Deshraj; Chattopadhyay, Prithvijit; Prabhu, Viraj; Parikh, Devi

2017-01-01

Theory of Mind is the ability to attribute mental states (beliefs, intents, knowledge, perspectives, etc.) to others and recognize that these mental states may differ from one's own. Theory of Mind is critical to effective communication and to teams demonstrating higher collective performance. To effectively leverage the progress in Artificial Intelligence (AI) to make our lives more productive, it is important for humans and AI to work well together in a team. Traditionally, there has been m...

A chronology of El niño events from primary documentary sources in northern Peru

OpenAIRE

García Herrera, Ricardo; Díaz, H. F.; García, R. R.; Prieto, M. R.; Barriopedro Cepero, David; Moyano, R.; Hernández Martín, Emiliano

2008-01-01

The authors present a chronology of El Niño (EN) events based on documentary records from northern Peru. The chronology, which covers the period 1550-1900, is constructed mainly from primary sources from the city of Trujillo (Peru), the Archivo General de Indias in Seville (Spain), and the Archivo General de la Nacion in Lima (Peru), supplemented by a reassessment of documentary evidence included in previously published literature. The archive in Trujillo has never been systematically evaluat...

Alien rose-ringed parakeets (Psittacula krameri) attack black rats (Rattus rattus) sometimes resulting in death

OpenAIRE

Hernández-Brito, Dailos; Luna, Amparo; Carrete, Martina; Tella, José Luis

2014-01-01

The rose-ring parakeet (Psittacula krameri) is one of the most successful invasive birds in its establishment worldwide. Studies addressing its potential impact on native biota mostly focus on birds and little is known about how these and other parakeet species interact with native mammals. Here, we report 21 aggressions of rose-ringed parakeets towards black rats (Rattus rattus) in urban parks in Seville (Southern Spain) and Tenerife (Canary Islands). Either solitary parakeets or, more often...

Study of the Wall Paintings of the Cenador Del Leon in the Real Alcazar of Seville

Science.gov (United States)

Robador, Maria Dolores; Mancera, Inmaculada; Perez-Maqueda, Rafael; Albardonedo, Antonio

2017-10-01

The paintings on the walls of the Cenador del Leon located in the gardens of the Real Alcazar in Seville next to the Pabellon de Carlos V in the Jardin Ingles area have been studied. The components of the wall paintings cross-sections, which were prepared using small samples taken from the walls of Cenador del Leon, were characterized using infrared spectroscopy (FTIR), X-ray diffraction (XRD) and scanning electron microscopy (SEM) with energy dispersive X-ray (EDX) analysis. The cross-sections of the collected samples indicated that the paint layer is well adhered to the preparation layer without any discontinuity, and only one carbonation layer exists at the top of the sequence of layers. These data suggest that the paint was applied on a fresco surface, and therefore, the adopted technique was fresco. Based on the different elements detected by EDX analysis of the cross-sections, the detected pigments included iron oxides accompanied by clay minerals (or earths) in the red pink, golden yellow and yellow colours, blue smelt for the blue colour and basic copper chloride (atacamite) for the green colour. In one sample, the particles were composed of Ba and S from barium sulphate and Ti and O from rutile titanium oxide due to a modern pigment.

Spain: Europe's California.

Science.gov (United States)

Wilvert, Calvin

1994-01-01

Contends that, as Spain integrates into the European Economic Community, it is considered to be Europe's California. Asserts that making regional comparisons between California and Spain can be an effective teaching method. Provides comparisons in such areas as agriculture and tourism. (CFR)

Rapid and simple colorimetric method for the quantification of AI-2 produced from Salmonella Typhimurium.

Science.gov (United States)

Wattanavanitchakorn, Siriluck; Prakitchaiwattana, Cheunjit; Thamyongkit, Patchanita

2014-04-01

The aim of this study was to evaluate the feasibility of Fe(III) ion reduction for the simple and rapid quantification of autoinducer-2 (AI-2) produced from bacteria using Salmonella Typhimurium as a model. Since the molecular structure of AI-2 is somewhat similar to ascorbic acid it was expected that AI-2 would also act as a reducing agent and reduce Fe(III) ions in the presence of 1,10-phenanthroline to form the colored [(o-phen)3 Fe(II)]SO4 ferroin complex that could be quantified colorimetrically. In support of this, colony rinses and cell free supernatants from cultures of all tested AI-2 producing strains, but not the AI-2 negative Sinorhizobium meliloti, formed a colored complex with a λmax of 510nm. The OD510 values of these culture supernatants or colony rinses were in broad agreement with the % activity observed in the same samples using the standard Vibrio harveyi bioluminescence assay for AI-2 detection, and with previously reported results. This methodology could potentially be developed as an alternative method for the simple and rapid quantification of AI-2 levels produced in bacterial cultures. Copyright © 2014 Elsevier B.V. All rights reserved.

Artificial Intelligence (AI), Operations Research (OR), and Decision Support Systems (DSS): A conceptual framework

Science.gov (United States)

Parnell, Gregory S.; Rowell, William F.; Valusek, John R.

1987-01-01

In recent years there has been increasing interest in applying the computer based problem solving techniques of Artificial Intelligence (AI), Operations Research (OR), and Decision Support Systems (DSS) to analyze extremely complex problems. A conceptual framework is developed for successfully integrating these three techniques. First, the fields of AI, OR, and DSS are defined and the relationships among the three fields are explored. Next, a comprehensive adaptive design methodology for AI and OR modeling within the context of a DSS is described. These observations are made: (1) the solution of extremely complex knowledge problems with ill-defined, changing requirements can benefit greatly from the use of the adaptive design process, (2) the field of DSS provides the focus on the decision making process essential for tailoring solutions to these complex problems, (3) the characteristics of AI, OR, and DSS tools appears to be converging rapidly, and (4) there is a growing need for an interdisciplinary AI/OR/DSS education.

Rétrospective de la diffusion du français en Espagne

Directory of Open Access Journals (Sweden)

Isabelle Cros

2014-12-01

Full Text Available Le français bénéficia longtemps en Espagne d’une vieille tradition francophile et de la forte implantation de l’Alliance française. Ainsi, il prédomina dans le système éducatif espagnol jusqu’au milieu du 20ème siècle sans intervention de l’État français pour en assurer la diffusion. Son déclin, amorcé sous Franco, nécessita toutefois la mise en place d’une politique linguistique et éducative compensatoire qui aboutit à un premier accord bilatéral favorisant surtout le développement de l’enseignement en français au sein du réseau de la Mission laïque mais qui eut peu d’effets à l’école espagnole où le français fut relégué au rang de deuxième langue étrangère. Cependant, suite à son adhésion à l’Europe, l’Espagne a recréé, en partenariat avec la France, une dynamique pour le français, notamment grâce aux sections bilingues qui connaissent un succès croissant. La langue française, considérée à présent davantage comme une langue utile, de communication et de travail, est enseignée suivant une méthodologie communicative plus adaptée aux réalités socio-économiques.

Inicios del Hockey patines en Sevilla. El Patín Claret en la década de los 70 del siglo XX = Beginnings of Roller Hockey in Seville. Claret Skate in the Decade of the Twenthieh Century 70

Directory of Open Access Journals (Sweden)

Jaime Segundo Cuesta Pérez

2013-10-01

Full Text Available En el siguiente artículo, se trata de presentar una de las páginas más importantes de la historia del Hockey Patines en Andalucía y más concretamente en la ciudad de Sevilla. Un deporte prácticamente copado desde sus inicios por equipos catalanes y cuya implantación en el resto del país ha sido muy complicada, siendo aún hoy en día muy escasa por toda España, salvo en regiones muy localizadas como Cataluña, Madrid, o Galicia. Estos que ahora presentamos son parte de los orígenes de este deporte en la capital andaluza, de los cuales nacería, para sorpresa de muchos, un equipo que alcanzaría importantes hitos en la División de Honor Nacional de este deporte.---------------------------------------------------------------------In the next article, we try to present one of the most important papers of the roller hockey history in Andalucía, concretely in Seville. This sport has been surrounded from its beginning by teams from Cataluña, while the establishment in the rest of the country has been very difficult, being still today quite scarce all over Spain, except in some regions such as Cataluña, Madrid or Galicia. We will try to show you the origin of this sport in the capital of Andalucía, from where was born, surprising everybody, a team wich achieved great landmark in the Pride National Division of this sport.

Spain's uranium industry

International Nuclear Information System (INIS)

Ferguson, M.P.

1992-01-01

Spain currently operates nine nuclear reactors totalling over 7,100 MWe of capacity, contributing about one-third of all electricity generated in Spain. Four reactors at advanced stages of construction remain mothballed as the result of a government-imposed moratorium, and a fire at Vandellos 1 in 1989 led to its premature closure and to a revival of anti-nuclear sentiment in the country. In the new national energy plan, which was sent to the Spanish Parliament on July 25, 1991, Spain opted to continue the nuclear moratorium that began in 1984 and rely upon conservation measures, additional natural gas imports, and electricity imports to meet expected demand. Under the new plan, nuclear power's share of Spain's total installed electrical generating capacity will fall from about 17 percent in 1990, to approximately 14 percent by the end of the century, as only the current nuclear facilities will continue to operate and no new nuclear plants will be built. Spain's integration into the European Community also is affecting the country's energy plans, prompting consolidation within the Spanish electricity sector in order to be more competitive in Europe. To supply the existing reactors, the government is supporting a major expansion of the country's domestic uranium industry

The deep learning AI playbook strategy for disruptive artificial intelligence

CERN Document Server

Perez, Carlos E

2017-01-01

Deep Learning Artificial Intelligence involves the interplay of Computer Science, Physics, Biology, Linguistics and Psychology. In addition to that, it is technology that can be extremely disruptive. The ramifications to society and even our own humanity will be profound. There are few subjects that are as captivating and as consequential as this. Surprisingly, there is very little that is written about this new technology in a more comprehensive and cohesive way. This book is an opinionated take on the developments of Deep Learning AI. One question many have will be "how to apply Deep Learning AI in a business context?" Technology that is disruptive does not automatically imply that its application to valuable use cases will be apparent. For years, many people could not figure out how to monetize the World Wide Web. We are in a similar situation with Deep Learning AI. The developments may be mind-boggling but its monetization is far from being obvious. This book presents a framework to address this shortcomi...

Analysis of raw AIS spectrum recordings from a LEO satellite

DEFF Research Database (Denmark)

Larsen, Jesper Abildgaard; Mortensen, Hans Peter

2014-01-01

The AAUSAT3 satellite is a 1U cubesat, which has been developed by students at Aalborg University, Denmark in collaboration with the Danish Maritime Authority. The satellite was launched in February 2013 on a mission to monitor ships from space using their AIS broadcast signals as an indication...... of position. The SDR receiver developed to listen for these AIS signals also allows for sampling and storing of the raw intermediate frequency spectrum, which has been used in order to map channel utilization over the areas of interest for the mission, which is mainly the arctic regions. The SDR based...... receiver used onboard the satellite is using a single chip front-end solution, which down converts the AIS signal located around 162 MHz into an intermediate frequency, with a up to 200 kHz bandwidth. This I/F signal is sampled with a 750 kSPS A/D converter and further processed by an Analog Devices DSP...

Explanation and trust: what to tell the user in security and AI?

NARCIS (Netherlands)

Pieters, Wolter

There is a common problem in artificial intelligence (AI) and information security. In AI, an expert system needs to be able to justify and explain a decision to the user. In information security, experts need to be able to explain to the public why a system is secure. In both cases, an important

9-cis-retinoic acid increases apolipoprotein AI secretion and mRNA expression in HepG2 cells.

Science.gov (United States)

Haghpassand, M; Moberly, J B

1995-10-01

HepG2 cells were studied as a model for regulation of hepatic apolipoprotein AI (apo AI) secretion and gene expression by 9-cis-retinoic acid. HepG2 cells cultured on plastic dishes were exposed to 9-cis-retinoic acid (9-cis-RA) for 48 h with a complete media change at 24 h. Apo AI mass in cultured media was determined by ELISA, by quantitative immunoblotting and by steady-state 35S-methionine labeling. Messenger RNA levels were determined by RNase protection using probes for apo AI and the housekeeping gene, glyceraldehyde 3-phosphate dehydrogenase (G3PDH). 9-cis-RA increased secretion of apo AI by 52% at doses of 10 and 1 microM (6.3 +/- 0.6 vs. 4.2 +/- 0.3; P G3PDH mRNA was slightly decreased (14%, P < 0.05). Thus, 9-cis-RA stimulates apo AI expression in HepG2 cells, suggesting a role for retinoids in activating endogenous apo AI gene expression.

Explanation and trust: what to tell the user in security and AI?

NARCIS (Netherlands)

Pieters, Wolter

2010-01-01

There is a common problem in artificial intelligence (AI) and information security. In AI, an expert system needs to be able to justify and explain a decision to the user. In information security, experts need to be able to explain to the public why a system is secure. In both cases, the goal of

Artificial Intelligence (AI) Based Tactical Guidance for Fighter Aircraft

Science.gov (United States)

McManus, John W.; Goodrich, Kenneth H.

1990-01-01

A research program investigating the use of Artificial Intelligence (AI) techniques to aid in the development of a Tactical Decision Generator (TDG) for Within Visual Range (WVR) air combat engagements is discussed. The application of AI programming and problem solving methods in the development and implementation of the Computerized Logic For Air-to-Air Warfare Simulations (CLAWS), a second generation TDG, is presented. The Knowledge-Based Systems used by CLAWS to aid in the tactical decision-making process are outlined in detail, and the results of tests to evaluate the performance of CLAWS versus a baseline TDG developed in FORTRAN to run in real-time in the Langley Differential Maneuvering Simulator (DMS), are presented. To date, these test results have shown significant performance gains with respect to the TDG baseline in one-versus-one air combat engagements, and the AI-based TDG software has proven to be much easier to modify and maintain than the baseline FORTRAN TDG programs. Alternate computing environments and programming approaches, including the use of parallel algorithms and heterogeneous computer networks are discussed, and the design and performance of a prototype concurrent TDG system are presented.

78 FR 63494 - Meeting of the National Coordination Committee on the AI/AN SANE-SART Initiative

Science.gov (United States)

2013-10-24

... National Coordination Committee on the AI/AN SANE--SART Initiative AGENCY: Office for Victims of Crime.../ Alaska Native (AI/AN) Sexual Assault Nurse Examiner (SANE)--Sexual Assault Response Team (SART..., victim-centered responses to sexual violence within AI/AN communities. DATES: The meeting will be held...

210Po content in human urine of people living in south of Spain

International Nuclear Information System (INIS)

Díaz-Francés, I.; García-Tenorio, R.; Mantero, J.; Manjón, G.

2013-01-01

The death of the former secret service agent Alexander Livitnenko in 2006 due to a lethal intake of 210 Po, presumably via ingestion, sparked renewed interest in the field of 210 Po toxicity to humans. 210 Po occurs widely in nature and is an important component of man' s natural radiation background. The main route of 210 Po intake by the human body is the ingestion with foodstuffs, although ingestion with drinking water especially of underground origin represents another route of 210 Po intakes. Inhalation of 222 Rn released from the soil also contributes in 210 Po body burden. However, the body burden of 210 Po in normal human body may differ from one person to another depending upon the mode life including diet habits, origin of drinking water, residence place (radon exposure rate) and also smoking habits. Therefore, many factors may affect the 210 Po intake and lead to variations in the body burden in different individuals, and consequently in their urine. To see the influence of the diet habits in the amount of 210 Po excreted by urine, some volunteers in Seville (south of Spain) follow defined diets during approximately one month, with daily urine collection followed by 210 Po determination by alpha-particle spectrometry. Depending on the type of diet ingested by the different volunteers, it was observed differences approaching even an order of magnitude in their levels of 210 Po in urine. This fact difficult enormously the adoption of a predefined value of this nuclide in urine with natural origin with the consequence difficulties for screening through urine the possible anthropogenic intake of this element. (author)

Adolescent idiopathic scoliosis (AIS, environment, exposome and epigenetics: a molecular perspective of postnatal normal spinal growth and the etiopathogenesis of AIS with consideration of a network approach and possible implications for medical therapy

Directory of Open Access Journals (Sweden)

Burwell R Geoffrey

2011-12-01

Full Text Available Abstract Genetic factors are believed to play an important role in the etiology of adolescent idiopathic scoliosis (AIS. Discordant findings for monozygotic (MZ twins with AIS show that environmental factors including different intrauterine environments are important in etiology, but what these environmental factors may be is unknown. Recent evidence for common chronic non-communicable diseases suggests epigenetic differences may underlie MZ twin discordance, and be the link between environmental factors and phenotypic differences. DNA methylation is one important epigenetic mechanism operating at the interface between genome and environment to regulate phenotypic plasticity with a complex regulation across the genome during the first decade of life. The word exposome refers to the totality of environmental exposures from conception onwards, comprising factors in external and internal environments. The word exposome is used here also in relation to physiologic and etiopathogenetic factors that affect normal spinal growth and may induce the deformity of AIS. In normal postnatal spinal growth we propose a new term and concept, physiologic growth-plate exposome for the normal processes particularly of the internal environments that may have epigenetic effects on growth plates of vertebrae. In AIS, we propose a new term and concept pathophysiologic scoliogenic exposome for the abnormal processes in molecular pathways particularly of the internal environment currently expressed as etiopathogenetic hypotheses; these are suggested to have deforming effects on the growth plates of vertebrae at cell, tissue, structure and/or organ levels that are considered to be epigenetic. New research is required for chromatin modifications including DNA methylation in AIS subjects and vertebral growth plates excised at surgery. In addition, consideration is needed for a possible network approach to etiopathogenesis by constructing AIS diseasomes. These approaches may

Activity of autoinducer two (AI-2) in bacteria isolated from surface ripened cheeses

DEFF Research Database (Denmark)

Gori, Klaus; Jespersen, Lene

2007-01-01

). Corynebacterium casei, Microbacterium barkeri, Microbacterium gubbeenense and S. equorum subsp. linens (all isolated from the smear of surface ripened cheeses) using the AI-2 bioluminescence assay. This indicates that AI-2 signaling could take place between bacteria found in the smear of surface ripened cheeses....

Dry eyes and AIs: If you don't ask you won't find out.

Science.gov (United States)

Inglis, Holly; Boyle, Frances M; Friedlander, Michael L; Watson, Stephanie L

2015-12-01

Our objective was to investigate the hypothesis that women on adjuvant aromatase inhibitors (AIs) for treatment of breast cancer have a higher prevalence of dry eye syndrome (DES) compared with controls. Exposure and control groups were recruited. A cross sectional questionnaire-based study was performed. Demographic data and medical histories were collected. The presence of dry eye syndrome was determined by the ocular surface disease index (OSDI). The Functional Assessment of Cancer Treatment - Endocrine Subscale (FACT-ES) was performed to investigate correlations with other side effects of AIs. 93 exposure group and 100 control group questionnaires were included. The groups were similar in all demographic variables. The prevalence of dry eye syndrome was 35% (exposure) and 18% (control) (p dry eyes. The OSDI score was negatively correlated with the total FACT-ES score and positively correlated with duration of treatment. Our study is the first to use a validated questionnaire to assess for DES in this population. DES is significantly more prevalent in women on AIs compared with controls. This is a newly emerging, and easily treated side effect of AIs. Self-reporting of dry eye symptoms underestimates the prevalence of DES with AIs. We recommend routine screening of patients on AIs with the OSDI with the aim of improving patient quality of life and possibly adherence. Copyright © 2015 Elsevier Ltd. All rights reserved.

A study on the applications of AI in finishing of additive manufacturing parts

Science.gov (United States)

Fathima Patham, K.

2017-06-01

Artificial intelligent and computer simulation are the technological powerful tools for solving complex problems in the manufacturing industries. Additive Manufacturing is one of the powerful manufacturing techniques that provide design flexibilities to the products. The products with complex shapes are directly manufactured without the need of any machining and tooling using Additive Manufacturing. However, the main drawback of the components produced using the Additive Manufacturing processes is the quality of the surfaces. This study aims to minimize the defects caused during Additive Manufacturing with the aid of Artificial Intelligence. The developed AI system has three layers, each layer is trying to eliminate or minimize the production errors. The first layer of the AI system optimizes the digitization of the 3D CAD model of the product and hence reduces the stair case errors. The second layer of the AI system optimizes the 3D printing machine parameters in order to eliminate the warping effect. The third layer of AI system helps to choose the surface finishing technique suitable for the printed component based on the Degree of Complexity of the product and the material. The efficiency of the developed AI system was examined on the functional parts such as gears.

Do adolescent idiopathic scoliosis (AIS neglect proprioceptive information in sensory integration of postural control?

Directory of Open Access Journals (Sweden)

Christine Assaiante

Full Text Available INTRODUCTION: It has been reported that AIS rely much more on ankle proprioception to control the amplitude of the balance control commands as compared to age-matched healthy adolescents. Our hypothesis was that AIS do not neglect proprioceptive information to control posture probably because of their vestibular deficits. We investigated the proprioceptive contribution to postural control in AIS which expresses spinal deformity during a crucial transitional period of ontogenesis. METHODS: 10 adolescents with idiopathic scoliosis (AIS with moderate spinal deformity (10° 35° and 10 control adolescents (CA had to maintain vertical stance while very slow oscillations in the frontal plane (below the detection threshold of the semicircular canal system were applied to the support with the eyes open and closed. Postural orientation and segmental stabilisation were analysed at head, shoulder, trunk and pelvis levels. RESULTS: Scoliosis did not affect vertical orientation control and segmental stabilization strategies. Vision improves postural control in both CA and AIS, which seem more dependent on visual cues than adults. CONCLUSIONS: AIS as CA were unable to control efficiently their postural orientation on the basis of the proprioceptive cues, the only sensory information available in the EC situation, whereas in the same condition healthy young adults present no difficulty to achieve the postural control. This suggests that AIS as CA transitory neglect proprioceptive information to control their posture. These results and previous studies suggest the existence of different afferent pathways for proprioceptive information subserving different parts in sensory integration of postural control. We conclude that the static proprioceptive system is not affected by the idiopathic scoliosis, while the dynamic proprioceptive system would be mainly affected.

Optimizing Limousine Service with AI

OpenAIRE

Chun, Andy Hon Wai

2011-01-01

A common problem for companies with strong business growth is that it is hard to find enough experienced staff to support expansion needs. This problem is particular pronounced for operations planners and controllers who must be very highly knowledgeable and experienced with the business domain. This article is a case study of how one of the largest travel agencies in Hong Kong alleviated this problem by using AI to support decision-making and problem-solving so that their planners and contro...

AI Reloaded: Objectives, Potentials, and Challenges of the Novel Field of Brain-Like Artificial Intelligence

Directory of Open Access Journals (Sweden)

Rosemarie Velik

2012-11-01

Full Text Available The general objective of Artificial Intelligence (AI is to make machines – particularly computers – do things that require intelligence when done by humans. In the last 60 years, AI has significantly progressed and today forms an important part of industry and technology. However, despite the many successes, fundamental questions concerning the creation of human-level intelligence in machines still remain open and will probably not be answerable when continuing on the current, mainly mathematic-algorithmically-guided path of AI. With the novel discipline of
Brain-Like Artificial Intelligence, one potential way out of this dilemma has been suggested. Brain-Like AI aims at analyzing and deciphering the working mechanisms of the brain and translating this knowledge into implementable AI architectures with the objective to develop in this way more efficient, flexible, and capable technical systems This article aims at giving a review about this young and still heterogeneous and dynamic research field.

Constitution d’un Corpus de Français Langue Etrangère destiné aux Apprenants Allemands

Directory of Open Access Journals (Sweden)

Fauth Camille

2014-07-01

Nationale de la Recherche et Deutsche Forschungsgemeinschaft attribué à l’équipe Parole du LORIA UMR 7503, Nancy – France et à l’Equipe de Linguistique Computationnelle et de Phonétique FR 4.7 de l’Université de la Sarre Sarrebruck – Allemagne dans lequel le français et l’allemand sont des langues cibles. Pour la paire allemand-français, peu de corpus parallèles sont disponibles. Nous présentons ici l’élaboration d’un corpus de productions orales de locuteurs natifs et non natifs pour la paire allemand-français. Notre corpus entend mettre au jour les déviations phonétiques et phonologiques que les locuteurs allemands produisent lorsqu’ils apprennent le français. Ce travail s’insère dans un projet plus global, Ce projet entend étudier les difficultés que les locuteurs français rencontrent lorsqu’ils apprennent l’allemand, et réciproquement. Aussi, cinquante locuteurs allemands seront recrutés dans des milieux universitaires et scolaires (niveau lycée en Allemagne et cinquante locuteurs français dans les mêmes milieux en France. Il s’agit pour les deux populations de produire d’une part le corpus en langue étrangère (en langue française pour les locuteurs allemands et en langue allemande pour les locuteurs français mais également le corpus en langue maternelle (en allemand pour les allemands et en français pour les français. Les corpus ainsi obtenus devraient nous permettre d’identifier les difficultés que les locuteurs allemands ou français rencontrent lorsqu’ils apprennent le français ou l’allemand. Les données de contrôle sont doubles puisque l’on pourra à la fois se référer aux productions des apprenants dans leur langue maternelle (ici l’allemand, mais également à celles de locuteurs natifs (ici germanophones. Nous ne présenterons ici que la constitution du corpus en français.

Spain: NATO or Neutrality,

Science.gov (United States)

1980-04-01

having Spain as a member. Spain is a traditional country in many ways. Religion is still a strongly-felt part of national life and atheism is looked at... Siglo XXI, 30 April 1979. Pedro J. Ramirez, "Diez Razones a favor de la OTAN," ABC, 17 September 1978, p. 7. 8 Ibid. Il 167 - SPAIN - WHAT’S IN IT...Cordoba and Granada. All three of the country’s major religions lived in relative harmony primarily in Moorish kingdoms, where the arts, commerce, and the

Archiving AIS messages in a Geo-DBMS

NARCIS (Netherlands)

Meijers, B.M.; Quak, C.W.; van Oosterom, P.J.M.; Bregt, Arnold; Sarjakoski, Tapani; Lammeren, Ron van; Rip, Frans

2017-01-01

This paper reports on the result of two studies for using a geographical database management system for archiving Automated Identification System (AIS) message data. In this paper, we analyse the storage (using MongoDB and PostgreSQL) and we give a more in-depth description of a possible data model

Detection of possible AI-2-mediated quorum sensing system in commensal intestinal bacteria.

Science.gov (United States)

Lukás, F; Gorenc, G; Kopecný, J

2008-01-01

The Vibrio harveyi strain BB170-autoinducer bioassay was used to detect possible quorum sensing autoinducer-2 molecule (AI-2) in culture fluids of commensal intestinal bacteria. Culture fluids of Bacteroides vulgatus, Clostridium proteoclasticum, Escherichia coli, Eubacterium rectale, Lachnospira multipara, Pseudobutyrivibrio ruminis, Roseburia intestinalis, Ruminococcus albus and Ruminococcus flavefaciens contained AI-2-like molecules. The PCR bands from some of the tested strains could be also amplified using primers designed for the luxS gene. These findings suggest that AI-2 is present in the gastrointestinal tract; however, it has not yet been proved whether it is used for bacterial cell-to-cell communication.

How AI localisation in plant tissues determines the targeted pest spectrum of different chemistries

DEFF Research Database (Denmark)

Buchholz, Anke; Trapp, Stefan

penetration as first crucial step can be modified by formulation whereas the active ingredient (AI) distribution within cells is usually solely determined by physicochemical properties. This passive AI distribution was calculated with the Fick-Nernst-Planck equation implemented in a cell model....... The predictions were compared to the measured biological effects against three different arthropods. Test compounds differed in log P (-0.1 to 4.3) and pKa (4.1 to 10.7). Efficacies in different bioassays are discussed with the postulated cellular AI localisation and the individual feeding behaviour...

Future role of AI/Robotics in physical security

International Nuclear Information System (INIS)

Jacobs, J.

1986-01-01

Manpower requirements for physical security systems place a heavy burden on operating security budgets. Technology innovations which free personnel or which make security personnel more efficient in carrying out their tasks is an important means of dealing with budget and manpower constraints. It is believed that AI/Robotics will be important technologies to alleviate these problems in the future. There are three types of applications for AI and Robotics technology that may: (l) help security personnel perform their tasks more effectively or efficiently, (2) perform tasks that security personnel would otherwise perform (free up people), and (3) perform tasks that cannot be performed by security personnel at this time. This paper discusses the various types of security applications that are presently being considered for the above areas and briefly describes a few examples of the application of this technology

AI mass spectrometers for space shuttle health monitoring

Science.gov (United States)

Adams, F. W.

1991-01-01

The facility Hazardous Gas Detection System (HGDS) at Kennedy Space Center (KSC) is a mass spectrometer based gas analyzer. Two instruments make up the HGDS, which is installed in a prime/backup arrangement, with the option of using both analyzers on the same sample line, or on two different lines simultaneously. It is used for monitoring the Shuttle during fuel loading, countdown, and drainback, if necessary. The use of complex instruments, operated over many shifts, has caused problems in tracking the status of the ground support equipment (GSE) and the vehicle. A requirement for overall system reliability has been a major force in the development of Shuttle GSE, and is the ultimate driver in the choice to pursue artificial intelligence (AI) techniques for Shuttle and Advanced Launch System (ALS) mass spectrometer systems. Shuttle applications of AI are detailed.

Spain.

Science.gov (United States)

1985-03-01

Spain is a constitutional monarchy with a population of 38.3 million growing at .5%/year. The most striking topographical features are the high plateaus and internal compartmentalization by mountain and river barriers. Nearly 3/4 of the country is arid. The Iberian peninsula was the scene of successive invasions and warfare for centuries. Phoenicians, Greeks, Carthaginians, Moors, Celts, Romans, and Visigoths all invaded at some time. The present language, religion, and laws stem from the Roman Period. The Reconquest from the North African Moors lasted over 700 years until they were driven out in 1492. The unification of present day Spain was complete by 1512. A period of dictatorial rule from 1923-31 ended with establishment of the Second Republic which saw increasing political polarization culminating in the Spanish Civil War. Franco's victory in 1939 was followed by official neutrality but pro-Axis policies during World War II. Spain's economy began to recover during the 1950s, but large scale modernization and development did not occur until the 1960s. Prince Juan Carlos de Borbon y Borbon, Franco's personally designated heir, assumed the title of king and chief of state with Franco's death in 1975. Franco's last prime minister was replaced in July 1976 in order to speed the pace of post-Franco liberalization. Spain's 1st parliamentary elections since 1936 were held in 1977, and a new constitution protecting human and civil rights and granting due process was overwhelmingly approved in 1978. The constitution also authorized creation of regional autonomous governments. By the mid-1970s, Spain had developed a strong and diversified industrial sector and a thriving tourist industry. From 1975-83, there were 8 years of double-digit inflation, an average growth rate of 1.5% in real terms, and an increase in unemployment from about 4.7% to 18.4%. By 1984 there was substantial improvement in inflation and the balance of payments. Goals of current government economic

Represión en Sevilla: el tribunal de responsabilidades políticas. Fondo del Archivo Histórico Provincial de Sevilla (Repression in Seville: the court of political responsibilities. Fund of the Historical Provincial Archive of Seville

Directory of Open Access Journals (Sweden)

Antonio Rosa Félix

2013-12-01

Full Text Available Resumen: El Archivo Histórico Provincial de Sevilla guarda un fondo de expedientes de Responsabilidades Políticas, procedentes del Juzgado de Primera Instancia e Instrucción de Sanlúcar la Mayor. La Ley de Responsabilidades Políticas de 1939 aglutina la normativa que los generales golpistas aplicaron desde el verano de 1936. Había que arruinar al vencido y para ello se creó esta jurisdicción especial, una inversión en la represión para crear y mantener un régimen lleno de adeptos. En el mundo rural se quería recuperar la hegemonía de la oligarquía agraria y mantener la situación anterior a la reforma agraria.Abstract: The Historical Provincial Archive of Seville keeps a collection of files record of Political Responsibilities, proceeding from the Court of The First Instance and Sanlúcar's Instruction. The Law of Political Responsibilities of 1939 agglutinates the regulation that the general rebels applied from the summer of 1936. It was necessary to ruin the defeated one and for it this special jurisdiction, an investment was created in the repression to create and to support a regime full followers'. In the rural world one wanted to recover the hegemony of the agrarian oligarchy and to support the situation previous to the agrarian reform.

Uptake of heavy metals and As by Brassica juncea grown in a contaminated soil in Aznalcollar (Spain): The effect of soil amendments

Energy Technology Data Exchange (ETDEWEB)

Clemente, Rafael [Department of Soil and Water Conservation and Organic Waste Management. Centro de Edafologia y Biologia Aplicada del Segura, CSIC. Apartado 164, 30100 Espinardo, Murcia (Spain); Walker, David J. [Department of Soil and Water Conservation and Organic Waste Management. Centro de Edafologia y Biologia Aplicada del Segura, CSIC. Apartado 164, 30100 Espinardo, Murcia (Spain); Bernal, M. Pilar [Department of Soil and Water Conservation and Organic Waste Management. Centro de Edafologia y Biologia Aplicada del Segura, CSIC. Apartado 164, 30100 Espinardo, Murcia (Spain)]. E-mail: pbernal@cebas.csic.es

2005-11-15

Two crops of Brassica juncea (L.) Czern. were grown in a field experiment, at the site affected by the toxic spillage of acidic, metal-rich waste in Aznalcollar (Seville, Spain), to study its metal accumulation and the feasibility of its use for metal phytoextraction. The effects of organic soil amendments (cow manure and mature compost) and lime on biomass production and plant survival were also assessed; plots without organic amendment and without lime were used as controls. Plots, with or without organic amendment, having pH<5 were limed for the second crop. Soil acidification conditioned plant growth and metal accumulation. The addition of lime and the organic amendments achieved higher plant biomass production, although effects concerning metal bioavailability and accumulation were masked somewhat by pH variability with time and between and within plots. Tissue metal concentrations of B. juncea were elevated for Zn, Cu and Pb, especially in leaves of plants from plots with low pH values (maxima of 2029, 71 and 55 {mu}g g{sup -1}, respectively). The total uptake of heavy metals in the plants was relatively low, emphasising the problems faced when attempting to employ phytoextraction for clean-up of pluri-contaminated sites. - Although organic amendments improved soil conditions and plant growth, the phytoextraction capacity of Brassica juncea (cv. Z1) is too low for efficient soil remediation.

AIS as key component in modern vessel traffic management and information systems

Energy Technology Data Exchange (ETDEWEB)

Lamers, W. [DaimlerChrysler Aerospace AG (DASA), Ulm (Germany)

1999-07-01

The objective of this paper is to provide information in respect to universal shipborne identification system (UAIS) as main sensor in various vessel traffic applications. The presented paper will give general information concerning AIS functionality and the standardisation process. Based on experience from recent projects and various IALA working group activities, a typical future VTMIS architectures is also presented being based on AIS as key sensor. The required key performance of AIS associated with the HW components will be described. The results from European technology study Indris are presented and discussed. Finally, a summary and conclusion from the presented material will complete the technical paper. The elaboration of this presentation has been carried out as a joint task between Mr. Andre van Berg, MDS Suedafrika und Mr. Walter Lamers, DASA Ulm. (orig.)

Energy Made in Spain

International Nuclear Information System (INIS)

Ruiz del Arbol, M.

2011-01-01

Spain is the first country in Europe and the second worldwide in installed thermoelectric solar power, the second place in Europe and fourth worldwide in wind energy. Moreover, Spain is the second country in photovoltaic energy so in Europe as in the World.

Augmentation index (AI) in a dose-response relationship with smoking habits in males: The Tanushimaru study.

Science.gov (United States)

Tsuru, Tomoko; Adachi, Hisashi; Enomoto, Mika; Fukami, Ako; Kumagai, Eita; Nakamura, Sachiko; Nohara, Yume; Kono, Shoko; Nakao, Erika; Sakaue, Akiko; Morikawa, Nagisa; Fukumoto, Yoshihiro

2016-12-01

We investigated the relationship between augmentation index (AI) and smoking habits in community-dwelling Japanese.This cross-sectional study enrolled 1926 subjects (769 males and 1157 females) aged 40 to 95 years who underwent a health check-up in a Japanese cohort of the Seven Countries Study, in Tanushimaru, a typical farming town in Kyushu Island in 2009. The subjects' medical history, alcohol intake, smoking habit, and current medications for hypertension, dyslipidemia, and diabetes were ascertained by questionnaire. Radial arterial pressure wave analysis was used to obtain AI. We analyzed the data stratified by gender.Age-adjusted means of AI in males showed a clear dose-response relationship in 4 categories of smoking habits (P = 0.010). There was no significant relationship between AI and smoking habits in females (P = 0.127). The significant dose-response relationship (P = 0.036) in males between AI and 4 categories of smoking habits still remained even after adjustment for age, body mass index, systolic blood pressure, estimated glomerular filtration rate, glucose, hypertensive medication, and alcohol intake.The present study demonstrated that AI values were significantly associated with smoking habits in a dose-dependent manner in Japanese males.

An artificial intelligence (AI) NOx/heat rate optimization system for Ontario Hydro`s fossil generating stations

Energy Technology Data Exchange (ETDEWEB)

Luk, J.; Frank, A.; Bodach, P. [Ontario Hydro, Toronto, ON (Canada); Warriner, G. [Radian International, Tucker, GA (United States); Noblett, J. [Radian International, Austin, TX (United States); Slatsky, M. [Southern Company, Birmingham, AL (United States)

1999-08-01

Artificial intelligence (AI)-based software packages which can optimize power plant operations that improves heat rate and also reduces nitrogen oxide emissions are now commonly available for commercial use. This paper discusses the implementation of the AI-based NOx and Heat Rate Optimization System at Ontario Hydro`s generation stations, emphasizing the current AI Optimization Project at Units 5 and 6 of the Lakeview Generating Station. These demonstration programs are showing promising results in NOx reduction and plant performance improvement. The availability of the plant Digital Control System (DCS) in implementing AI optimization in a closed-loop system was shown to be an important criterion for success. Implementation of AI technology at other Ontario Hydro fossil generating units as part of the overall NOx emission reduction system is envisaged to coincide with the retrofit of the original plant control system with the latest DCS systems. 14 refs., 3 figs.

Protection level of AI H5N1 vaccine clade 2.1.3 commercial against AI H5N1 clade 2.3.2 virus from Ducks to SPF chicken in laboratory conditions

Directory of Open Access Journals (Sweden)

Indriani R

2015-03-01

Full Text Available Highly Pathogenic Avian Influenza (HPAI subtype H5N1 clade 2.3.2 has infected chickens in farms, causing mortality and a decrease in egg production. Vaccination is one of the strategies to control disease of AI subtype H5N1. AI H5N1 clade 2.1.3 vaccine is available commercially. The effectiveness of two vaccines of AI H5N1 clade 2.1.3 (product A and B, and AI H5N1 clade 2.3.2 (Sukoharjo against AI H5N1 clade 2.3.2 (Sukoharjo virus SPF chickens was tested in laboratory. Four groups of SPF chickens were used in this study, there were (1 vaccinated with H5N1 clade 2.1.3 (product A, (2 vaccinated with H5N1 clade 2.1.3 (product B, (3 vaccinated with AI H5N1 clade 2.3.2 and (4 unvaccinated (as a control. Each vaccinated group consisted of 10 chicken except 8 chicken for control group. SPF chicken were vaccinated with 1 dose of vaccine at 3 weeks olds, and then after 3 weeks post vaccination (at 6 weeks olds. All group of chicken were challenged with 106 EID50 per 0.1 ml via intranasal. The results showed, chicken vaccinated with H5N1 clade 2.1.3 product A and B gave 100 and 80% protection respectively, but showed challenged virus shedding, whereas vaccine of H5N1 clade 2.3.2 gave 100% protection from mortality and without virus shedding. Vaccines of AI H5N1 clade 2.1.3 product A was better than vaccine product B, and when chicken vaccinated against H5N1 clade 2.3.2, H5N1 clade 2.3.2 vaccine was the best to be used. In order to protect chicken from AI subtype H5N1 clade 2.1.3 and 2.3.2 in the field, a bivalent vaccine of H5N1 clade 2.1.3 and 2.3.2 subtypes should be developed.

Os efeitos do método Ai Chi em pacientes portadoras da síndrome fibromiálgica The effect of Ai Chi method in fybromialgic patients

Directory of Open Access Journals (Sweden)

Jacqueline Soares de Santana

2010-06-01

Full Text Available O objetivo do estudo é demonstrar os efeitos do método Ai Chi como forma alternativa de abordagem hidroterapêutica em pacientes portadoras da síndrome fibromiálgica. Foram estudados dez pacientes; quatro fizeram parte do grupo experimento e cinco, do grupo controle, com uma desistência. As pacientes foram avaliadas através do Questionário de Impacto da Fibromialgia (QIF e da Escala de Intensidade e Índice de dor nos Pontos Sensíveis. Foram realizadas duas avaliações, uma antes e outra após o tratamento. As pacientes foram submetidas a dez sessões do método Ai Chi, com duração de quarenta minutos. Houve melhora na intensidade da dor, de acordo com a escala da intensidade de dor nos pontos sensíveis, após a intervenção; já a qualidade de vida manteve-se sem alteração. Na qualidade de vida, observou-se que os grupos obtiveram resultados semelhantes; isso se deve ao fato que as pacientes não apresentaram melhora no seu estado depressivo. No índice dos pontos sensíveis, verificou-se diferença entre os grupos. A explicação para essa diferença deve-se possivelmente aos benefícios da imersão em água aquecida e aos efeitos do método Ai Chi. Não houve diferença significativa entre os grupos, o que pode ser atribuído às limitações do estudo. Desta forma, torna-se relevante a realização de novos estudos referentes à aplicação do método Ai Chi em pacientes portadoras da síndrome fibromiálgica.The objective of this article is to show the effect of the Ai Chi method, as an alternative form of hydrotherapeutic approach in fibromyalgia syndrome patients. Ten patients were studied, four were part of the experiment group and five of the control group, with one desistance. The patients were evaluated through the Fibromyalgia Impact Questionnaire (QIF and Scale of Intensity and Index of pain in Sensible Points. Two evaluations were performed, before and after the treatment. The patients were submitted to ten sessions

7 CFR 319.56-34 - Clementines from Spain.

Science.gov (United States)

2010-01-01

... 7 Agriculture 5 2010-01-01 2010-01-01 false Clementines from Spain. 319.56-34 Section 319.56-34... Clementines from Spain. Clementines (Citrus reticulata) from Spain may only be imported into the United States... agreement. Clementines from Spain may be imported only if the Government of Spain or its designated...

BanII dimorphic site located in the third intron of the human apolipoprotein AI (APOA1) gene

Energy Technology Data Exchange (ETDEWEB)

Coleman, R T; Kresnak, M T; Frossard, P M

1988-02-11

A 0.7kb fragment generated by AvaII digestion of pBL13AI, a 0.965kb full-length human apolipoprotein AI cDNA was cloned into the EcoRI site of pBR322. The apoAI cDNA was isolated from a lambdagt10 human fetal liver cDNA library. BanII (GPuGCPyC) (International Biotechnologies, Inc.) identifies two invariant bands at 1122bp and 417bp, and a single two-allele polymorphism with bands at either 274bp or 452bp. The human apolipoprotein AI-CIII-AIV gene complex has been localized on the long arm of chromosome 11 by Southern blot analysis of human-chinese hamster cell hybrids. Co-dominant segregation has been observed in two families (13 individuals). The BanII restriction map was constructed from DNA sequence data of the human apoAI gene. The 452bp fragment is generated by the loss of a BanII dimorphic site in the third intron of the apoAI gene, between the 178bp and the 274bp fragments.

Spain's marketing sector seeing more changes

International Nuclear Information System (INIS)

Anon.

1992-01-01

This paper reports that Spain's petroleum marketing sector continues to restructure. Partly state owned Repsol SA and Royal Dutch/Shell Group are discussing supplying each other's retail outlets in the UK and Spain. And Portugal's state owned Petroleos de Portugal (Petrogal), seeking to sharply expand retail operations in Spain, complains of government interference with foreign investment in Spanish marketing. Meantime, Conoco Inc. Has agreed with Saras SpA Raffinerie Sarde, Milan, to set up a network of service stations in northern Spain and Portugal at a cost of 100 billion pesetas (%972 million). The two are considering building an oil terminal at the port city of Gijon in Asturias, Spain, and the Exxon Corp., Total, and Shell are interested in participating in the project

PASTURE ffPROVEMENT POSSIBILTTIES IN EFFECTIVE AI{IMAL ...

African Journals Online (AJOL)

PASTURE ffPROVEMENT POSSIBILTTIES IN EFFECTIVE AI{IMAL PRODUCTION SYSTEMS. P. de V. Booysen. University of Natal, King George V Avenue, Durban. (Key words: .... inherent in biotic simplification is the danger of increased susceptibility of the abiotic component to degradation. So as the agriculturalist ...

The hidden dangers of experimenting in distributed AI

NARCIS (Netherlands)

Meyer, A.P.; Smit, A.; Kempen, M.; Wijngaards, N.

2006-01-01

Research on multi-agent systems often involves experiments, also in situations where humans interact with agents. Consequently, the field of experimental (human) sciences becomes more and more relevant. This paper clarifies how things can and often do go wrong in distributed AI experiments. We show

The 2010 Mario AI Championship: Level Generation Track

DEFF Research Database (Denmark)

Shaker, Noor; Togelius, Julian; Yannakakis, Georgios N.

2011-01-01

The Level Generation Competition, part of the IEEE CIS-sponsored 2010 Mario AI Championship, was to our knowledge the world’s first procedural content generation competition. Competitors participated by submitting level generators — software that generates new levels for a version of Super Mario...

Synthesized and characterization of AI and Gd substitute ferrite for microwave

International Nuclear Information System (INIS)

Sudjono, Hans K.; Muljadi; Soepriyanto, Syony

2000-01-01

Ferrite for microwave components has been synthesized from garnet ceramics (YIG)substituted by AI and Gd. Magnetic permeability and magnetic polarization changes according to the AI 3+ ion addition. XRD is performed to determined the sintering products at various temperatures. For some samples the magnetic property and performance in microwave region was tested. The testing is conducted in the form of completely assembled circulator which gives data on isolation, insertion loss when microwave circuit analyzer was employed. Due to high level of porosity insertion lost is still to large, improved process is necessary

AIS radiometry and the problem of contamination from mixed spectral orders

Science.gov (United States)

Conel, J. E.; Adams, S.; Alley, R. E.; Hoover, G.; Schultz, S.

1988-01-01

The spectral radiance of test areas under solar illumination is ascertained in view of Airborne Imaging Spectrometer (AIS) data from Mono Lake, CA, establishing an atmospheric correction method for major absorbers on the basis of the spectrometric data themselves. The apparent low contrast of all atmospheric absorption bands leads to a study of contamination from overlapping spectral orders in the AIS data; this contamination is found unambiguously above 1500 nm with a magnitude that is a factor of 1.5-2.0 greater than the expected uncontaminated signal alone.

Purification and Characterization of BmooAi: A New Toxin from Bothrops moojeni Snake Venom That Inhibits Platelet Aggregation

Directory of Open Access Journals (Sweden)

Mayara Ribeiro de Queiroz

2014-01-01

Full Text Available In this paper, we describe the purification/characterization of BmooAi, a new toxin from Bothrops moojeni that inhibits platelet aggregation. The purification of BmooAi was carried out through three chromatographic steps (ion-exchange on a DEAE-Sephacel column, molecular exclusion on a Sephadex G-75 column, and reverse-phase HPLC chromatography on a C2/C18 column. BmooAi was homogeneous by SDS-PAGE and shown to be a single-chain protein of 15,000 Da. BmooAi was analysed by MALDI-TOF Spectrometry and revealed two major components with molecular masses 7824.4 and 7409.2 as well as a trace of protein with a molecular mass of 15,237.4 Da. Sequencing of BmooAi by Edman degradation showed two amino acid sequences: IRDFDPLTNAPENTA and ETEEGAEEGTQ, which revealed no homology to any known toxin from snake venom. BmooAi showed a rather specific inhibitory effect on platelet aggregation induced by collagen, adenosine diphosphate, or epinephrine in human platelet-rich plasma in a dose-dependent manner, whereas it had little or no effect on platelet aggregation induced by ristocetin. The effect on platelet aggregation induced by BmooAi remained active even when heated to 100°C. BmooAi could be of medical interest as a new tool for the development of novel therapeutic agents for the prevention and treatment of thrombotic disorders.

On how AI & Law can help autonomous systems obey the law: a position paper

NARCIS (Netherlands)

Prakken, Hendrik

2016-01-01

In this position paper I discuss to what extent current and past AI & law research is relevant for research on autonomous intelligent systems that exhibit legally relevant behaviour. After a brief review of the history of AI & law, I will compare the problems faced by autonomous intelligent systems

Artificial Intelligence techniques for big data analysis

OpenAIRE

Aditya Khatri

2017-01-01

During my stay in Salamanca (Spain), I was fortunate enough to participate in the BISITE Research Group of the University of Salamanca. The University of Salamanca is the oldest university in Spain and in 2018 it celebrates its 8th centenary. As a computer science researcher, I participated in one of the many international projects that the research group has active, especially in big data analysis using Artificial Intelligence (AI) techniques. AI is one of BISITE's main lines of rese...

Forum on stakeholder confidence: Spain

International Nuclear Information System (INIS)

Vari, A.; Pescatore, C.

2006-01-01

The FSC workshop in Spain provided an important opportunity to carry out an in-depth examination of decision-making processes undertaken in an NEA member country, and to reflect on the evolution that has taken place over time. It offered a well-rounded perspective on the inclusion of stakeholders in decision making, and the atmosphere of the meetings was conducive to an honest and open exchange of ideas. The workshop started with the introduction of two case studies: the earlier attempt in Spain to locate a potential site for a high-level waste (HLW) disposal facility, and the dismantling of the Vandellos-I nuclear power plant. This was followed by two days of presentations and round-table discussions based on the recent COWAM Spain initiative (stemming from the EU-wide project on Community Waste Management), which aims at developing recommendations for institutional arrangements and decision-making processes concerning the siting of waste management facilities in Spain. This article provides a brief summary of the case studies and the COWAM Spain initiative, followed by some of the lessons learnt from an international perspective. (authors)

An Empirical Study of AI Population Dynamics with Million-agent Reinforcement Learning

OpenAIRE

Yang, Yaodong; Yu, Lantao; Bai, Yiwei; Wang, Jun; Zhang, Weinan; Wen, Ying; Yu, Yong

2017-01-01

In this paper, we conduct an empirical study on discovering the ordered collective dynamics obtained by a population of artificial intelligence (AI) agents. Our intention is to put AI agents into a simulated natural context, and then to understand their induced dynamics at the population level. In particular, we aim to verify if the principles developed in the real world could also be used in understanding an artificially-created intelligent population. To achieve this, we simulate a large-sc...

The artisans of ‘Plus Ultra’: Pilots, cartographers and cosmographers in the House of Trade in Seville during the sixteenth century

Directory of Open Access Journals (Sweden)

Antonio Sánchez Martínez

2010-12-01

Full Text Available This article demonstrates how the institutionalization of cosmography and navigation ended with the slogan Non Terrae Plus Ultra, and led to the emergence of imperial heading Plus Ultra helped by the navigation of a Mare Tenebrosum (the Atlantic Ocean, and the delineation of the contours of a new world that began beyond the Columns of Hercules. This process was made possible by the establishment in Seville of the House of Trade in 1503 and the creation of scientific offices such as Pilot Major, master of making nautical charts or cosmographer. The ship appears on the cover of the Regimiento de navegación (1606 by Andres García de Céspedes across the pillars of the hero of Greek mythology highlights the Baconian premise of man's dominion over nature, the knowledge gained through the conquest of the West Indies, and also the wishes of the Spanish monarchy by taking advantage of the usefulness of scientific knowledge by joining the nautical experience and cosmographical theory.

Monitoring Severe Accidents Using AI Techniques

International Nuclear Information System (INIS)

No, Young Gyu; Kim, Ju Hyun; Na, Man Gyun; Ahn, Kwang Il

2011-01-01

It is very difficult for nuclear power plant operators to monitor and identify the major severe accident scenarios following an initiating event by staring at temporal trends of important parameters. The objective of this study is to develop and verify the monitoring for severe accidents using artificial intelligence (AI) techniques such as support vector classification (SVC), probabilistic neural network (PNN), group method of data handling (GMDH) and fuzzy neural network (FNN). The SVC and PNN are used for event classification among the severe accidents. Also, GMDH and FNN are used to monitor for severe accidents. The inputs to AI techniques are initial time-integrated values obtained by integrating measurement signals during a short time interval after reactor scram. In this study, 3 types of initiating events such as the hot-leg LOCA, the cold-leg LOCA and SGTR are considered and it is verified how well the proposed scenario identification algorithm using the GMDH and FNN models identifies the timings when the reactor core will be uncovered, when CET will exceed 1200 .deg. F and when the reactor vessel will fail. In cases that an initiating event develops into a severe accident, the proposed algorithm showed accurate classification of initiating events. Also, it well predicted timings for important occurrences during severe accident progression scenarios, which is very helpful for operators to perform severe accident management

AI techniques in geomagnetic storm forecasting

Science.gov (United States)

Lundstedt, Henrik

This review deals with how geomagnetic storms can be predicted with the use of Artificial Intelligence (AI) techniques. Today many different Al techniques have been developed, such as symbolic systems (expert and fuzzy systems) and connectionism systems (neural networks). Even integrations of AI techniques exist, so called Intelligent Hybrid Systems (IHS). These systems are capable of learning the mathematical functions underlying the operation of non-linear dynamic systems and also to explain the knowledge they have learned. Very few such powerful systems exist at present. Two such examples are the Magnetospheric Specification Forecast Model of Rice University and the Lund Space Weather Model of Lund University. Various attempts to predict geomagnetic storms on long to short-term are reviewed in this article. Predictions of a month to days ahead most often use solar data as input. The first SOHO data are now available. Due to the high temporal and spatial resolution new solar physics have been revealed. These SOHO data might lead to a breakthrough in these predictions. Predictions hours ahead and shorter rely on real-time solar wind data. WIND gives us real-time data for only part of the day. However, with the launch of the ACE spacecraft in 1997, real-time data during 24 hours will be available. That might lead to the second breakthrough for predictions of geomagnetic storms.

Integration of AI-2 Based Cell-Cell Signaling with Metabolic Cues in Escherichia coli.

Directory of Open Access Journals (Sweden)

Arindam Mitra

Full Text Available The quorum sensing molecule Autoinducer-2 (AI-2 is generated as a byproduct of activated methyl cycle by the action of LuxS in Escherichia coli. AI-2 is synthesized, released and later internalized in a cell-density dependent manner. Here, by mutational analysis of the genes, uvrY and csrA, we describe a regulatory circuit of accumulation and uptake of AI-2. We constructed a single-copy chromosomal luxS-lacZ fusion in a luxS + merodiploid strain and evaluated its relative expression in uvrY and csrA mutants. At the entry of stationary phase, the expression of the fusion and AI-2 accumulation was positively regulated by uvrY and negatively regulated by csrA respectively. A deletion of csrA altered message stability of the luxS transcript and CsrA protein exhibited weak binding to 5' luxS regulatory region. DNA protein interaction and chromatin immunoprecipitation analysis confirmed direct interaction of UvrY with the luxS promoter. Additionally, reduced expression of the fusion in hfq deletion mutant suggested involvement of small RNA interactions in luxS regulation. In contrast, the expression of lsrA operon involved in AI-2 uptake, is negatively regulated by uvrY and positively by csrA in a cell-density dependent manner. The dual role of csrA in AI-2 synthesis and uptake suggested a regulatory crosstalk of cell signaling with carbon regulation in Escherichia coli. We found that the cAMP-CRP mediated catabolite repression of luxS expression was uvrY dependent. This study suggests that luxS expression is complex and regulated at the level of transcription and translation. The multifactorial regulation supports the notion that cell-cell communication requires interaction and integration of multiple metabolic signals.

Using a Tandem Pelletron accelerator to produce a thermal neutron beam for detector testing purposes.

Science.gov (United States)

Irazola, L; Praena, J; Fernández, B; Macías, M; Bedogni, R; Terrón, J A; Sánchez-Nieto, B; Arias de Saavedra, F; Porras, I; Sánchez-Doblado, F

2016-01-01

Active thermal neutron detectors are used in a wide range of measuring devices in medicine, industry and research. For many applications, the long-term stability of these devices is crucial, so that very well controlled neutron fields are needed to perform calibrations and repeatability tests. A way to achieve such reference neutron fields, relying on a 3 MV Tandem Pelletron accelerator available at the CNA (Seville, Spain), is reported here. This paper shows thermal neutron field production and reproducibility characteristics over few days. Copyright © 2015 Elsevier Ltd. All rights reserved.

Journal of Environmental Radioactivity special issue: II International Conference on Radioecological Concentration Processes. (50 years later).

Science.gov (United States)

Garcia-Tenorio, Rafael; Holm, Elis

2018-06-01

An international conference on Radioecological Concentration Processes was held in Seville, Spain, 6-9 November 2016 at the Centro Nacional de Aceleradores. It was attended by 160 participants from 35 different countries. This was the 2nd conference on this item since 1966, 50 years ago. The conference covered aspects of radiological important radionuclides on terrestrial, marine and freshwater environments and has allowed obtaining a clear picture of the status of the Radioecology as a consolidated discipline in the 21st century. Copyright © 2017 Elsevier Ltd. All rights reserved.

Swapping the N- and C-terminal domains of human apolipoprotein E3 and AI reveals insights into their structure/activity relationship.

Directory of Open Access Journals (Sweden)

Mark T Lek

Full Text Available Apolipoprotein (apo E3 and apoAI are exchangeable apolipoproteins that play a dominant role in regulating plasma lipoprotein metabolism. ApoE3 (299 residues is composed of an N-terminal (NT domain bearing a 4-helix bundle and a C-terminal (CT domain bearing a series of amphipathic α-helices. ApoAI (243 residues also comprises a highly helical NT domain and a less structured CT tail. The objective of this study was to understand their structural and functional role by generating domain swapped chimeras: apoE3-NT/apoAI-CT and apoAI-NT/apoE-CT. The bacterially overexpressed chimeras were purified by affinity chromatography and their identity confirmed by immunoblotting and mass spectrometry. Their α-helical content was comparable to that of the parent proteins. ApoE3-NT/apoAI-CT retained the denaturation profile of apoE3 NT domain, with apoAI CT tail eliciting a relatively unstructured state; its lipid binding ability improved dramatically compared to apoE3 indicative of a significant role of apoAI CT tail in lipid binding interaction. The LDL receptor interaction and ability to promote ABCA1-mediated cholesterol efflux of apoE3-NT/apoAI-CT was comparable to that of apoE3. In contrast, apoAI-NT/apoE-CT elicited an unfolding pattern and lipid binding ability that were similar to that of apoAI. As expected, DMPC/apoAI-NT/apoE-CT discoidal particles did not elicit LDLr binding ability, and promoted SR-B1 mediated cellular uptake of lipids to a limited extent. However, apoAI-NT/apoE-CT displayed an enhanced ability to promote cholesterol efflux compared to apoAI, indicative of a significant role for apoE CT domain in mediating this function. Together, these results indicate that the functional attributes of apoAI and apoE3 can be conferred on each other and that NT-CT domain interactions significantly modulate their structure and function.

Microstructural studies of suck cast (Zr-SS)-3 and 5 AI alloys for nuclear metallic waste form

International Nuclear Information System (INIS)

Kumar, P.; Das, N.; Sengupta, P.; Arya, A.; Dey, G.K.

2015-01-01

Management of radioactive metallic waste using 'alloy melting route' is currently being investigated. For disposal of Zr and SS base nuclear metallic wastes, Zr-stainless steel (SS) hybrid alloys are being considered as baseline alloys for developing metallic-waste-form (MWF) alloys. In this context Zr-16 wt. %55 has been selected for MWF alloy in our previous study. In present study, to include amorphous phase in this alloy, 3 and 5 wt. % Al has been added in order to improve desirable properties and useful features of MWF and the two alloys have been prepared by suck casting techniques. Microstructure of these alloys have been investigated by optical and electron microscopy which shows occurrence of two different phases, e.g. dark grey and white phases, in (Zr-16 SS)-3 Al and three different phases, e.g. grey, dark grey and white phases in (Zr-16 SS)-5 AI. Electron diffraction and X-ray diffraction (XRD) analyses of these two alloy specimens revealed the occurrence of Zr (Fe, Cr, AI) (dark grey) and Zr 2 (Fe, Cr, AI) (white) phases in (Zr-16 SS)-3 Al whereas, Zr (Fe, Cr, AI) (dark grey), Zr 2 (Fe, Cr, AI) (grey) and Zr 3 (Fe, Cr, AI) (white) phases were found in (Zr-16 SS)-5 AI. In addition, presence of amorphous phase was indicated by XRD analysis that could be confirmed by transmission electron microscopy of these two alloys. (author)

LE CINÉMA FRANÇAIS EN ROUMANIE DANS L’ENTRE-DEUX-GUERRES

Directory of Open Access Journals (Sweden)

Georgiana MEDREA

2013-05-01

Full Text Available Avant même d’aborder la nature des films français importés en Roumanie dans l’entre-deux-guerres, il convient de situer cette production cinématographique dans l’ensemble de celles présentes sur le marché roumain, ce que permettent documents et articles critiques contemporains. La diversité des mises en scène et des acteurs, la variété des sujets traités plaisent à un large public. La plus grande place que connaît le cinéma français en Roumanie dans les années trente est sans doute due,également, à la présence, dans le monde cinématographique français, d’artistes roumains qui manifestent un souci d’intégration dans une culture d’accueil qu’ils admirent. Les exemplesde coopérations franco-roumaines sont nombreuses, jusqu’à se manifester parfois sous la forme de coproductions

AI-2 signalling is induced by acidic shock in probiotic strains of Lactobacillus spp.

Science.gov (United States)

Moslehi-Jenabian, Saloomeh; Gori, Klaus; Jespersen, Lene

2009-11-15

Survival and ability to respond to various environmental stresses such as low pH are important factors for lactobacilli for their function as probiotics. LuxS-mediated quorum sensing mechanism, which is based on the production of universal signal molecule called autoinducer-2 (AI-2), regulates important physiological traits and a variety of adaptive processes in different bacteria. The aim of this study was to investigate the effect of acidic stress on LuxS-mediated quorum sensing (AI-2 signalling) in four probiotic strains of different Lactobacillus species. Initially, the production of AI-2-like molecule was investigated in four strains of Lactobacillus spp. at standard growth conditions using Vibrio harveyi bioluminescence assay. Species variation in AI-2 activity was observed. AI-2 activity started at early-exponential growth phase and increased during the mid-exponential phase concomitant with the reduction of pH, reaching maximum at late exponential phase (L. rhamnosus GG) or at stationary phase (L. salivarius UCC118, L. acidophilus NCFM and L. johnsonii NCC533). Acidic shock experiments were conducted on L. rhamnosus GG and L. acidophilus NCFM after exposure to different acidic shocks (pH 5.0, 4.0 and 3.0) and to pH 6.5 as control, measuring AI-2 activity and transcription of the luxS gene. AI-2 activity increased by lowering the pH in a dose dependent manner and was negatively influenced by acid adaptation. In both species, the luxS gene was repressed after exposure to pH 6.5 as control. However, after acidic shock (pH 4.0) a transient response of luxS gene was observed and the transcription augmented over time, reaching a maximum level and decreased subsequently. Acid adaptation of cells attenuated the transcription of this gene. Based on the observations done in the present study, the luxS gene appears to have a clear role in acidic stress response in probiotic lactobacilli. This might be important in the survival of these bacteria during the passage

Demand for radiotherapy in Spain.

Science.gov (United States)

Rodríguez, A; Borrás, J M; López-Torrecilla, J; Algara, M; Palacios-Eito, A; Gómez-Caamaño, A; Olay, L; Lara, P C

2017-02-01

Assessing the demand for radiotherapy in Spain based on existing evidence to estimate the human resources and equipment needed so that every person in Spain has access to high-quality radiotherapy when they need it. We used data from the European Cancer Observatory on the estimated incidence of cancer in Spain in 2012, along with the evidence-based indications for radiotherapy developed by the Australian CCORE project, to obtain an optimal radiotherapy utilisation proportion (OUP) for each tumour. About 50.5 % of new cancers in Spain require radiotherapy at least once over the course of the disease. Additional demand for these services comes from reradiation therapy and non-melanoma skin cancer. Approximately, 25-30 % of cancer patients with an indication for radiotherapy do not receive it due to factors that include access, patient preference, familiarity with the treatment among physicians, and especially resource shortages, all of which contribute to its underutilisation. Radiotherapy is underused in Spain. The increasing incidence of cancer expected over the next decade and the greater frequency of reradiations necessitate the incorporation of radiotherapy demand into need-based calculations for cancer services planning.

[Relationship between family variables and conjugal adjustment].

Science.gov (United States)

Jiménez-Picón, Nerea; Lima-Rodríguez, Joaquín-Salvador; Lima-Serrano, Marta

2018-04-01

To determine whether family variables, such as type of relationship, years of marriage, existence of offspring, number of members of family, stage of family life cycle, transition between stages, perceived social support, and/or stressful life events are related to conjugal adjustment. A cross-sectional and correlational study using questionnaires. Primary care and hospital units of selected centres in the province of Seville, Spain. Consecutive stratified sampling by quotas of 369 heterosexual couples over 18years of age, who maintained a relationship, with or without children, living in Seville. A self-report questionnaire for the sociodemographic variables, and the abbreviated version of the Dyadic Adjustment Scale, Questionnaire MOS Perceived Social Support, and Social Readjustment Rating Scale, were used. Descriptive and inferential statistics were performed with correlation analysis and multivariate regression. Statistically significant associations were found between conjugal adjustment and marriage years (r=-10: Pfamily life cycle (F=2.65; Pfamily life cycle stage (mature-aged stage) on conjugal adjustment (R2=.21; F=9.9; df=356; Prelationship. Copyright © 2017 Elsevier España, S.L.U. All rights reserved.

Ship Emission Inventories in Estuary of the Yangtze River Using Terrestrial AIS Data

Directory of Open Access Journals (Sweden)

Xin Yao

2016-12-01

Full Text Available Estuary forms a transition zone between inland river and open sea. In China, the estuary of the Yangtze River plays a vital role in connecting the inland and oversea shipping, and witnesses heavy vessel traffic in the recent decades. Nowadays, more attentions have been directed to the issue of ship pollution in busy waterways. In order to investigate the ship emission inventory, this paper presents an Automatic Identification System(AIS based method. AIS data is the realistic data of vessel traffic including dynamic information (position, speed, course, etc. and static information (ship type, dimensions, name, etc.. According to ship dimensions, the power of engines is estimated for different ship types. By using AIS based bottom-up approach, ship emission inventories and shares of air pollutants and GHGs (Greenhouse gases are developed. Spatial distribution of ship emissions is illustrated in the form of heat map. As a case study, the emission inventories are analyzed using AIS data of 2010 in the estuary, and following results are made:(1 shares of the emission are cruise ships 6.59%, bulk carriers 5.16%, container ships 52.96%, tankers 15.16%, fishing ships 9.16%, other ships 10.97%; (2 CO2 is the dominant part of the emission. (3 Areas of highest emission intensity are generally clustered around the South Channel, the North Channel and ports in the vicinity. The proposed method is promising because it is derived from the AIS data which contains not only real data of individual ship but also vessel traffic situation in the study area. It can server as a reference for other researchers and policy makers working in this field.

GC/MS in the study of deterioration process of historical monuments: characterization of the black crust formed in the Cathedral of Seville; GC/MS en el estudio del proceso de deterioro de monumentos historicos: caracterizacion de la costra negra presente en la Catedral de Sevilla

Energy Technology Data Exchange (ETDEWEB)

Reyes, J. [Programa de Corrosion del Golfo de Mexico. Universidad Autonoma de Campeche. Av. Agustin Melgar s/n, Campeche (Mexico); Hermosin, B.; Saiz J, C. [Instituto de Recursos Naturales y Agrobiologia de Sevilla. Avenida de la Reina Mercedes 10. Sevilla, Espana (Spain)]. e-mail: javreyes@uacam.mx

2006-07-01

Here, we present an interesting application of Gas Chromatography/Mass Spectrometry (GC/MS) technique which permitted to differentiate successfully between natural and anthropogenic compounds present in the black crust formed in the Cathedral of Seville. This building, considered as one of the most important historic and cultural European monuments suffers from intense blackening of its outside walls and sculptures due to the interaction with the urban environment. Fragment of black crusts were removed from the Cathedral walls and extraction process with organic solvents was carried out. The aliphatic, aromatic and polar fractions were separated and analyzed using GC/MS. A complex organic composition of the black crusts indicated the accumulative character of the deposition process of atmospheric particles as a function of the time. The presence of high molecular weight n-alkanes, n-fatty acids and natural molecular markers identified during the study were indicative of current biogenic contributions. It was also found an important group of petrogenic molecular markers related with diesel soot emissions from motor engines. The diesel soot and molecular markers were entrapped within the black crust mineral matrix and contribute to the observed blackening of the Seville Cathedral. (Author)

Grammaire progressive du français corrigés : niveau intermédiaire

CERN Document Server

Thiévenaz, Odile

2017-01-01

Quatrième édition des corrigés de l'ouvrage de Grammaire de français langue étrangère (FLE), niveau intermédiaire, dans la collection Progressive du français destiné aux grands adolescents et adultes. Ce qui fait le succès de cet ouvrage de grammaire: Une organisation claire : la leçon de grammaire sur la page de gauche, les exercices d'entraînement sur la page de droite 52 chapitres présentant les points généralement abordés aux niveaux A2 et B1 du Cadre européen commun de référence pour les langues Un apprentissage progressif : il suit la progression naturelle des méthodes de français Un usage souple : pour la classe ou en auto-apprentissage Une préparation adaptée aux certifications : un entraînement efficace pour mieux réussir aux examens NOUVEAU!​ Appli-Web de la Grammaire progressive du français Pour s'entraîner et s'évaluer en ligne en sollicitant toutes les compétences écrites et orales: près de 300 exercices interactifs avec dialogues, instructions, exemples et corri...

Fragments of a Forgotten Aiōn. An Outline of a Gnostic Myth

Directory of Open Access Journals (Sweden)

Ezio Albrile

2005-07-01

Full Text Available Gnostics regard the cosmos as the result of an «error» or of a hybris begotten in the transcendent world. Reality is perceived as a great dream intentionally moulded by the Demiurge in order to forget the Light concealed in the creations. By consequence, the power of the Demiurge consists precisely in being the creator and keeper of a level of existence limited in space and time. Gnostic imagination plastically depicts the homicide and ignorant Demiurge with the features of an abnormous creature with the head of a lion and wings, enveloped in the coils of a snake. Thus, Gnostics reinterpreted a key figure in the syncretic pantheon of late Hellenism, i. e. Aiōn, the god of endless eternity, the Saeculum, the Iranic  Zurwān, the Jewish ‘Olām. This means that Aiōn involved contacts with two different visions: the Aiōnes are the creations that populate the gnostic plērōma, immortal and eternal entities, and outside the plērōma the demiurgic Aiōn arises as the result of a divine «fault», a monstrous being whose somatic features can be found in the Orphic and Mithriac iconography.

Exploring AI Language Assistants with Primary EFL Students

Science.gov (United States)

Underwood, Joshua

2017-01-01

The main objective of this study was to identify ways to incorporate voice-driven Artificial Intelligence (AI) effectively in classroom language learning. This nine month teacher-led design research study employed technology probes (Amazon's Alexa, Apple's Siri, Google voice search) and co-design methods with a class of primary age English as a…

PERFORMATIVITAS DALAM MANGA SHONEN-AI: SEKAIICHI HATSUKOI, HENSHIN DEKINAI DAN HIMANANODE HAJIMETE MIMASHITA

OpenAIRE

Savitri Paramita, Ni Made

2014-01-01

This research underlies the analysis on the performance and performativity of characters in shonen-ai: Sekaiichi Hatsukoi, Henshin Dekinai, and Himananode Hajimete Mimashita manga. Characterization in shonen-ai manga is based on the characters’ role within the same-sex relationship, which are the male role (seme) and the female role (uke). The character of Seme tends to be aggressive, protective, smart, good looking, and unemotional. On the other hand, Uke is feminine, smaller, physically wea...

7 CFR 319.56-31 - Peppers from Spain.

Science.gov (United States)

2010-01-01

... 7 Agriculture 5 2010-01-01 2010-01-01 false Peppers from Spain. 319.56-31 Section 319.56-31... from Spain. Peppers (fruit) (Capsicum spp.) may be imported into the United States from Spain only... subpart: (a) The peppers must be grown in the Alicante or Almeria Province of Spain in pest-proof...

Thiophenone Attenuates Enteropathogenic Escherichia coli O103:H2 Virulence by Interfering with AI-2 Signaling.

Science.gov (United States)

Witsø, Ingun Lund; Valen Rukke, Håkon; Benneche, Tore; Aamdal Scheie, Anne

2016-01-01

Interference with bacterial quorum sensing communication provides an anti-virulence strategy to control pathogenic bacteria. Here, using the Enteropathogenic E. coli (EPEC) O103:H2, we showed for the first time that thiophenone TF101 reduced expression of lsrB; the gene encoding the AI-2 receptor. Combined results of transcriptional and phenotypic analyses suggested that TF101 interfere with AI-2 signalling, possibly by competing with AI-2 for binding to LsrB. This is supported by in silico docking prediction of thiophenone TF101 in the LsrB pocket. Transcriptional analyses furthermore showed that thiophenone TF101 interfered with expression of the virulence genes eae and fimH. In addition, TF101 reduced AI-2 induced E. coli adhesion to colorectal adenocarcinoma cells. TF101, on the other hand, did not affect epinephrine or norepinephrine enhanced E. coli adhesion. Overall, our results showed that thiophenone TF101 interfered with virulence expression in E. coli O103:H2, suggestedly by interfering with AI-2 mediated quorum sensing. We thus conclude that thiophenone TF101 might represent a promising future anti-virulence agent in the fight against pathogenic E. coli.

Oil sector in Spain: Final adaptation

International Nuclear Information System (INIS)

Marin-Quemada, J.M.

1992-01-01

This paper analyzes organizational and marketing changes occurring in Spain's oil industry as a result of its conversion from a state run monopoly system to a free market system. The analysis uses statistical data to indicate national oil production, import and consumption trends and compares these with overall trends in the European Communities. An explanation of the way in which oil is marketed in Spain makes reference to data on Spain's refining capacity and pipeline network, deemed to be amongst the most complete and modern in Europe. Comments are also made on the efficacy of Spain's national energy policies which stress energy source diversification to lessen this country's heavy dependence on foreign supplied oil

The Actual Problems of Modern Spain

Directory of Open Access Journals (Sweden)

Natalya E. Anikeeva

2014-01-01

Full Text Available The important aim of national and Spanish historiography and political science is to study history and foreign policy of modern Spain. The author studied articles and monographies of spanish politicians and researchers ( M. Rahoy, I. Aries, A. Rubalcaba, I. Molina for the preparation of this article during the scientific trip to Madrid (Complutense University, Faculty of Political Science and Sociology, which was held in the framework of cooperation between the Bank Santander and MGIMO (University. The paper analyzes the political and economic aspects of life in Spain, and its foreign policy of the period of government of Mariano Rajoy (from 2011 to the present time. The article is dedicated to actual problems of modern Spain: the economy and the priorities of the government of M.Rajoy, the problem of separatism and political system of the country. Modern Spain is still recovering economically from the euro debt crisis and continues to struggle with near-record unemployment. Domestic economic recovery of Spain and the country's foreign position are closely linked. The European integration process still remains the main strategic task of the spanish foreign policy. Spain increases its role in world politics and obtains a non-permanent UN's Security Council seat for the 2015-2016 term.

Açai Palm Fruit (Euterpe oleracea Mart.) Pulp Improves Survival of Flies on a High Fat Diet

OpenAIRE

Sun, Xiaoping; Seeberger, Jeanne; Alberico, Thomas; Wang, Chunxu; Wheeler, Charles T.; Schauss, Alexander G.; Zou, Sige

2010-01-01

Reducing oxidative damage is thought to be an effective aging intervention. Açai, a fruit indigenous to the Amazon, is rich in phytochemicals that possesses high anti-oxidant activities, and has anti-inflammatory, anti-cancer and anti-cardiovascular disease properties. However, little is known about its potential anti-aging properties especially at the organismal level. Here we evaluated the effect of açai pulp on modulating lifespan in Drosophila melanogaster. We found that açai supplementat...

Molecular characterization of AI viruses from poultry and wild bird surveillance in Denmark

DEFF Research Database (Denmark)

Larsen, Lars Erik; Krog, Jesper Schak; Madsen, Jesper J.

Infection with avian influenza virus (AIV) in poultry may cause devastating disease although the same virus may not cause disease in wild birds. Since AI viruses can be exchanged between poultry and wild birds, surveillance in wild birds provides important knowledge for control of disease...... in poultry. AIV’s from the Danish wild bird active surveillance were characterized, focusing on viruses from 2012, and from outbreaks of AI in poultry in Denmark. The matrix (M) gene from more than 50 viruses of different subtypes and the hemagglutinin (HA) gene from more than 30 subtype H5 low pathogenic...... viruses were sequenced and compared by alignment and phylogenetic analyses. The aim was to evaluate: the origin of viruses from outbreaks of AI in Danish poultry, the design of active surveillance in Denmark, and the suitability of the molecular diagnostic RT-PCR tests employed. All M-genes from Danish...

De l’harmonie dans la construction des mots français

Directory of Open Access Journals (Sweden)

Roché Michel

2016-01-01

Full Text Available La formation des gentilés, particulièrement sensible aux contraintes d’euphonie, permet de mettre en évidence, pour le français, deux manifestations complémentaires de la contrainte dissimilative. L’une, négative, tend à éviter la consécution à faible distance du même phonème ou de deux phonèmes proches. Elle explique la sous-représentation des deux principaux suffixes, -ais et -ois, après une accroche en sifflante, à cause de la sifflante conte-nue par le suffixe au féminin, ainsi que la sous-représentation de -ais après /E/ et de -ois après /A/. L’autre, positive, favorise entre les voyelles une harmonie fondée sur les contrastes. De-vant les suffixes dont la voyelle est une voyelle d’avant moyenne ou haute (-ais, -ain, -in, -ier…, sont privilégiés les radicaux dont la dernière voyelle est une voyelle d’arrière moyenne ou basse, et de préférence un /O/ plutôt qu’un /A/. Devant les suffixes dont la voyelle est une voyelles d’arrière moyenne ou basse (-ois, -ot, -on, -and, -at, -ard…, sont privilégiés les radi-caux dont la dernière voyelle est une voyelle d’avant moyenne ou haute, et de préférence un /i/ plutôt qu’un /E/. Pour cela, un yod au contact du suffixe joue le même rôle qu’un /i/ dans la syllabe précédente. Cette harmonie est obtenue soit par la sélection du suffixe, soit par un aménagement – substitution, épenthèse, troncation, insertion d’un interfixe, etc. – du radical fourni par la base. On observe d’autre part une harmonisation de l’accroche consonantique du radical avec la voyelle du suffixe. Devant -ois, sont privilégiées les attaques en labiale ou en vélaire, en accord avec le double caractère du /w/ propre à ce suffixe. Devant -ais et -ain, ce sont les attaques en dentale. Devant -ot, -on, -and, -at, -ard, la tendance à rapprocher l’articu-lation de la consonne de celle de la voyelle peut aller jusqu’aux vélaires mais elle s’arrête sou

Sensor assignment to mission in AI-TECD

Science.gov (United States)

Ganger, Robert; de Mel, Geeth; Pham, Tien; Rudnicki, Ronald; Schreiber, Yonatan

2016-05-01

Sensor-mission assignment involves the allocation of sensors and other information-providing resources to missions in order to cover the information needs of the individual tasks within each mission. The importance of efficient and effective means to find appropriate resources for tasks is exacerbated in the coalition context where the operational environment is dynamic and a multitude of critically important tasks need to achieve their collective goals to meet the objectives of the coalition. The Sensor Assignment to Mission (SAM) framework—a research product of the International Technology Alliance in Network and Information Sciences (NIS-ITA) program—provided the first knowledge intensive resource selection approach for the sensor network domain so that contextual information could be used to effectively select resources for tasks in coalition environments. Recently, CUBRC, Inc. was tasked with operationalizing the SAM framework through the use of the I2WD Common Core Ontologies for the Communications-Electronics Research, Development and Engineering Center (CERDEC) sponsored Actionable Intelligence Technology Enabled Capabilities Demonstration (AI-TECD). The demonstration event took place at Fort Dix, New Jersey during July 2015, and this paper discusses the integration and the successful demonstration of the SAM framework within the AI-TECD, lessons learned, and its potential impact in future operations.

Nuclear material control in Spain

International Nuclear Information System (INIS)

Velilla, A.

1988-01-01

A general view about the safeguards activities in Spain is presented. The national system of accounting for and control of nuclear materials is described. The safeguards agreements signed by Spain are presented and the facilities and nuclear materials under these agreements are listed. (E.G.) [pt

Polychronous Zirconology of Navysh Volcanics of the Ai Formation (Southern Urals)

Science.gov (United States)

Krasnobaev, A. A.; Puchkov, V. N.; Sergeeva, N. D.

2018-01-01

In order to resolve the age of Navysh volcanics (NV), which is usually attributed to the Lower Riphean of the Ai Formation, we have used geochronological, petrologic, and mineralogical methods of zirconology, apart from the SHRIMP isotopic data of single zircon grains. Moreover, TIMS isotope age analyses have been conducted, the results of which can be regarded as both controlling and providing the most correct information. The TIMS and SHRIMP data make it possible to suggest a polychronous character of the NV, which include not only Riphean, but also Paleozoic groups of volcanics. In this situation, an assessment of the scales of such polychroneity of NV and, correspondingly, of the Ai Formation as a whole becomes urgent.

Early Childhood Inclusion in Spain

Science.gov (United States)

Giné, Climent; Balcells-Balcells, Anna; Cañadas, Margarita; Paniagua, Gema

2016-01-01

This article describes early childhood inclusion in educational settings in Spain. First, we address the legislative framework of preschool education in Spain and offer a brief analysis of some relevant issues, including the current situation of early childhood education and inclusion at this stage. Second, current policies and practices relating…

Application of Artificial Intelligence (AI) Programming Techniques to Tactical Guidance for Fighter Aircraft

Science.gov (United States)

McManus, John W.; Goodrich, Kenneth H.

1989-01-01

A research program investigating the use of Artificial Intelligence (AI) techniques to aid in the development of a Tactical Decision Generator (TDG) for Within-Visual-Range (WVR) air combat engagements is discussed. The application of AI methods for development and implementation of the TDG is presented. The history of the Adaptive Maneuvering Logic (AML) program is traced and current versions of the AML program are compared and contrasted with the TDG system. The Knowledge-Based Systems (KBS) used by the TDG to aid in the decision-making process are outlined in detail and example rules are presented. The results of tests to evaluate the performance of the TDG versus a version of AML and versus human pilots in the Langley Differential Maneuvering Simulator (DMS) are presented. To date, these results have shown significant performance gains in one-versus-one air combat engagements, and the AI-based TDG software has proven to be much easier to modify than the updated FORTRAN AML programs.

Predicting Vessel Trajectories from Ais Data Using R

Science.gov (United States)

2017-06-01

Source: Hampton (2009). A vessel operator with AIS is able to get useful information about the other vessels in the area by selecting a vessel icon ...random forest model on our computer. All calculations are done on a MacBook-Pro with 2.7GHz quad-core Intel Core i7, and 16GB of memory . H2O allows us

Molecular Gastronomy in Spain

OpenAIRE

García-Segovia, Purificación; Garrido, María Dolores; Vercet Tormo, Antonio; Arboleya, Juan Carlos; FISZMAN DAL SANTO, SUSANA; Martínez Monzó, Javier; Laguarda, Sergio; Palacios, Victor; Ruiz Carrascal, Jorge

2014-01-01

[EN] Beyond the overwhelming international success of Ferrán Adria, Spain has been one of the countries with a more active implication in molecular gastronomy as a scientific discipline but also in the use of ingredients, technologies, and equipment from the scientificand technological universe in the culinary area. Nowadays, this is a well-established discipline in Spain, with a number of research groups covering related topics, several companies commercializing appliances and additives worl...

PSA results and trends for Spain's NPPs

International Nuclear Information System (INIS)

Carretero, J.A.

1993-01-01

The Spain regulatory authority CSN demanded performance of PSA for all Spain nuclear power plants. The specific data analysis carried out as a part of the PSA has contributed to the realistic view on the results which could be achieved by the PSA. The main characteristics of the PSA in Spain and PSA trends in the development are presented in the paper

Liquid Robotics Wave Glider, Honey Badger (G3), 2015, AIS

Data.gov (United States)

National Oceanic and Atmospheric Administration, Department of Commerce — Liquid Robotics Wave Glider, Honey Badger (G3), 2015, AIS. The MAGI mission is to use the Wave Glider to sample the late summer chlorophyll bloom that develops near...

Spain: Success story in space

Science.gov (United States)

Longdon, Norman

From the early 1960's, European governments were aware that they had to take part in the exploration, and potential exploitation, of space, or be left behind in a field of high-technology that had far-reaching possibilities. It was also realized that financial and manpower constraints would limit the extent to which individual nations could carry out their own national programs. They, therefor, joined forces in two organizations: the European Space Research Organization (ESRO) and the European Launcher Development Organization (ELDO). By 1975, when the potential of space development had been more fully appreciated, the two organizations were merged into the Europeans Space Agency (ESA) of which Spain was a founding member. ESA looks after the interest of 13 member states, one associated member state (Finland), and one cooperating state (Canada) in the peaceful uses of space. Its programs center around a mandatory core of technological research and space science to which member states contribute on the basis of their Gross National Product. Spain in 1992 contributes 6.46% to this mandatory program budget. The member states then have the chance to join optional programs that include telecommunications, observation of the earth and its environment, space transportation systems, microgravity research, and participation in the European contribution to the International Space Station Freedom. Each government decides whether it is in its interest to join a particular optional program, and the percentage that it wishes to contribute to the budget. Although in the early days of ESA, Spain participated in only a few optional programs, today Spain makes a significant contribution to nearly all of ESA's optional programs. This document presents Spain's contributions to particular ESA Programs and discusses Spain's future involvement in ESA.

Association between cagA, vacAi, and dupA genes of Helicobacter pylori and gastroduodenal pathologies in Chilean patients.

Science.gov (United States)

Paredes-Osses, Esteban; Sáez, Katia; Sanhueza, Enrique; Hebel, Sonja; González, Carlos; Briceño, Carlos; García Cancino, Apolinaria

2017-09-01

In addition to the already known cagA gene, novel genetic markers have been associated with Helicobacter pylori (H. pylori) virulence: the dupA and vacAi genes. These genes might play an important role as specific markers to determine the clinical outcome of the disease, especially the vacAi gene, which has been expected to be a good marker of severe pathologies like gastric adenocarcinoma. In the present study, the association of cagA, dupA, and vacAi genes with gastroduodenal pathologies in Chilean patients was studied. One hundred and thirty-two patients positive for H. pylori were divided into two groups-non-severe and severe gastric pathologies-and investigated for the presence of cagA, dupA, and vacAi H. pylori virulence genes by PCR. The cagA gene was detected in 20/132 patients (15.2%), the vacAi1 gene was detected in 54/132 patients (40.9%), the vacAi2 gene was detected in 26/132 patients (19.7%), and the dupA gene was detected in 50/132 (37.9%) patients. Logistic regression model analysis showed that the vacAi1 isoform gene in the infected strains and the severity of the diseases outcome were highly associated, causing severe gastric damage that may lead to gastric cancer (p dupA gene was associated significantly with non-severe clinical outcome (p = 0.0032; OR = 0.25; 95% CI 0.09-0.65). In addition, dupA gene exerts protection against severe gastric pathologies induced by vacAi1 by delaying the outcome of the disease by approximately 20 years.

English Learners (ELs) Who Are American Indian and/or Alaska Native (AI/AN). Fast Facts

Science.gov (United States)

Office of English Language Acquisition, US Department of Education, 2016

2016-01-01

The Office of English Language Acquisition (OELA) has synthesized key data on English learners (ELs) into two-page PDF sheets, by topic, with graphics, plus key contacts. The topics for this report on English Learners (ELs) Who Are American Indian and/or Alaska Native (AI/AN) include: (1) States With the Highest Percentage of ELs Who Were AI/AN:…

AI based HealthCare Platform for Real Time, Predictive and Prescriptive Analytics using Reactive Programming

Science.gov (United States)

Kaur, Jagreet; Singh Mann, Kulwinder, Dr.

2018-01-01

AI in Healthcare needed to bring real, actionable insights and Individualized insights in real time for patients and Doctors to support treatment decisions., We need a Patient Centred Platform for integrating EHR Data, Patient Data, Prescriptions, Monitoring, Clinical research and Data. This paper proposes a generic architecture for enabling AI based healthcare analytics Platform by using open sources Technologies Apache beam, Apache Flink Apache Spark, Apache NiFi, Kafka, Tachyon, Gluster FS, NoSQL- Elasticsearch, Cassandra. This paper will show the importance of applying AI based predictive and prescriptive analytics techniques in Health sector. The system will be able to extract useful knowledge that helps in decision making and medical monitoring in real-time through an intelligent process analysis and big data processing.

Identification of AI-2 Quorum Sensing Inhibitors in Vibrio harveyi Through Structure-Based Virtual Screening.

Science.gov (United States)

Jiang, Tianyu; Zhu, Peng; Du, Lupei; Li, Minyong

2018-01-01

Quorum sensing (QS) is a cell-to-cell communication system that regulates gene expression as a result of the production and perception of signal molecules called autoinducers (AIs). AI-2 is a QS autoinducer produced by both Gram-negative and Gram-positive bacteria, in which it regulates intraspecies and interspecies communication. The identification of QS inhibitors is considered a promising strategy for the development of anti-virulence drugs with reduced selective pressure for resistance. Here we describe a high-throughput virtual screening approach to identify AI-2 quorum sensing inhibitors on the basis of Vibrio harveyi LuxPQ crystal structure. Seven potent inhibitors with IC 50 values in the micromolar range were selected with no effect or low effect on V. harveyi growth rate.

LE FRANÇAIS DANS LA PRESSE ECRITE DU NORD-CAMEROUN : DIAGNOSTIC, CRITIQUES ET ORIENTATIONS

Directory of Open Access Journals (Sweden)

Moïse MBEY MAKANG

2013-11-01

Full Text Available La présente réflexion tire son origine de la crise linguistique observée au sein de la presse écrite du Nord-Cameroun. Celle-ci fait échos des irrégularités de la langue de Voltaire dans la presse écrite de cette partie du pays. De plus en plus, on y assiste à une émergence des déviances syntaxiques et une profusion des écarts langagiers à connotation dépréciative. L’indécence verbale de la société, la mauvaise prestation des élèves en classe et lors des examens officiels en sont des indicateurs pertinents. Il est important de mentionner que la cohabitation entre les langues camerounaises et le français, la sous-scolarisation et ou l’ignorance, le laxisme des rédacteurs en chef, etc. sont les mobiles profonds de cette incorrection. Pourtant, nous savons tous que les media sont une forteresse où la langue doit être préservée de toute entorse et représentent un modèle pour la société. Néanmoins, des traits caractéristiques du français de la presse écrite du Nord-Cameroun s’inscrivent en faux par rapport à cette vocation naturelle des media. Dès lors, la question que nous pouvons nous poser est celle de savoir si ces mobiles ci-dessus cités sont des éléments qui favorisent l’émergence de cette dialectalisation du français. En clair qu’est-ce qui caractérise le français des journalistes? Quelle est la structure morphosyntaxique du français des rédacteurs des journaux? S’agit-il d’un français conforme à une norme locale ou (y retrouvons-nous des énoncés exogènes ? Quel type de morphosyntaxe utilisent les rédacteurs ? Une morphosyntaxe endogène, morphosyntaxe qui leur est propre, ou plutôt une morphosyntaxe exogène, supposée unique à tous les francophones ? Peut-on parler d’alternance codique, d’argotisation, ou de créolisation ? La présente analyse a pour ambitions de s’interroger sur les mobiles profonds qui incitent des journalistes à s’écarter de la norme du français

The Development of AI in Medicine and the Research Environment of the SPHINX Project at the Start of the 1980s.

Science.gov (United States)

Fieschi, M

2012-01-01

To review the history of AI in Medicine in the 1980's, placing the SPHINX system in the context of other research in this field. Summarize the main systems for AI in medicine developed in the 1970-1980 decade and their relationship to the development of clinical decision-making and consultation systems The approaches taken by AI in medicine research groups is compared and contrasted to those of others using statistical and logical methods for representing clinical inferences, and the different AI approaches are summarized, and related to the architecture and systems implementation of SPHINX CONCLUSION: The SPHINX system combined a number of advanced representational and inference choices from AI in designing a decision- support system for clinical consultation in the 1980s. The context within which the system was developed is outlined and related to the historical evolution of AI in medicine during that decade.

Training courses on radiation protection organized by the radioisotopes service of the University of Sevilla (Spain); Curos de formacion en proteccion radiologica organizados por el servicio de raioisotopos de la universidad de sevilla. Espana

Energy Technology Data Exchange (ETDEWEB)

Mateos, J. C.; Avalos, J.; Garcia-Leon, M.; Garcia-Tenorio, R.; Gomez-Puerto, A.; Gomez, M.; Herrador, M-; Lejeune, J.; Luis-simon, J.; Marquez, A.; Maranon, J.; Respaldiza, M. A.; Sanchez-Angulo, C.; Sanchez-Doblado, F.; Sarmiento, J. M.

2003-07-01

The University of Sevilla (Spain) through its Radioisotope Service has been organizing bi annually since 1995 Training courses for Supervisors and Operators of Radioactive Installations for university investigators that use radioactive sources or radiation equipment. The courses are imparted by professors from the university radioactive installations, hospital physicist specialists from medical physics services and medical doctors from prevention labour health service. The students are postgraduate students or professors that need operate, with ionising radiation in their research laboratories. Up to date, it has been organized 4 courses series with an average of 30 students per course. The courses are homologated by the Nuclear Security Council and let the student obtain the license for Supervisors or Operators of Radioactive Installations in each of the following applications fields. a) Laboratories with Non-Encapsulated Sources. This application includes research activities in Biology, Chemistry, Physics, Medicine and Pharmacy. b) Radiation Generator Equipment. This last one includes equipment such as X-Ray apparatus for diffraction studies in physics chemistry and art sciences, or Particle Accelerator for atomic physics research in the National Accelerator Centre. The practical sessions of the courses are imparted in the radioactive installations of the Seville university. In this study it is described the details of the organization of the courses. (Author) 4 refs.

Towards an unanimous international regulatory body for responsible use of Artificial Intelligence [UIRB-AI

OpenAIRE

Chidambaram, Rajesh

2017-01-01

Artificial Intelligence (AI), is once again in the phase of drastic advancements. Unarguably, the technology itself can revolutionize the way we live our everyday life. But the exponential growth of technology poses a daunting task for policy researchers and law makers in making amendments to the existing norms. In addition, not everyone in the society is studying the potential socio-economic intricacies and cultural drifts that AI can bring about. It is prudence to reflect from our historica...

AI-2 signalling is induced by acidic shock in probiotic strains of Lactobacillus spp

DEFF Research Database (Denmark)

Moslehi Jenabian, Saloomeh; Gori, Klaus; Jespersen, Lene

2009-01-01

Survival and ability to respond to various environmental stresses such as low pH are important factors for lactobacilli for their function as probiotics. LuxS-mediated quorum sensing mechanism, which is based on the production of universal signal molecule called autoinducer-2 (AI-2), regulates...... important physiological traits and a variety of adaptive processes in different bacteria. The aim of this study was to investigate the effect of acidic stress on LuxS-mediated quorum sensing (AI-2 signalling) in four probiotic strains of different Lactobacillus species. Initially, the production of AI-2...... concomitant with the reduction of pH, reaching maximum at late exponential phase (L. rhamnosus GG) or at stationary phase (L. salivarius UCC118, L. acidophilus NCFM and L. johnsonii NCC533). Acidic shock experiments were conducted on L. rhamnosus GG and L. acidophilus NCFM after exposure to different acidic...

Beyond AI: Multi-Intelligence (MI) Combining Natural and Artificial Intelligences in Hybrid Beings and Systems

OpenAIRE

Stephen Fox

2017-01-01

Framing strongly influences actions among technology proponents and end-users. Underlying much debate about artificial intelligence (AI) are several fundamental shortcomings in its framing. First, discussion of AI is atheoretical, and therefore has limited potential for addressing the complexity of causation. Second, intelligence is considered from an anthropocentric perspective that sees human intelligence, and intelligence developed by humans, as superior to all other intelligences. Thus, t...

ITER EDA Newsletter. V. 3, no. 10

Energy Technology Data Exchange (ETDEWEB)

NONE

1994-10-01

This ITER EDA (Engineering Design Activities) Newsletter issue reports on (i) the ITER-relevant statements made at the occasion of the 15th IAEA fusion conference in Seville, Spain, September 26 - October 1, 1994; (ii) a comprehensive technical presentation of the ITER EDA developments at the same conference; (iii) the first Workshop of the ITER Expert Group on Confinement and Transport, held at the San Diego Joint Work Site on 22-25 August 1994; and (iv) the visit to the San Diego Work Site of the representatives of a local philanthropic group, the ARCS Foundation (Achievement Rewards for College Scientists).

ITER EDA Newsletter. V. 3, no. 10

International Nuclear Information System (INIS)

1994-10-01

This ITER EDA (Engineering Design Activities) Newsletter issue reports on (i) the ITER-relevant statements made at the occasion of the 15th IAEA fusion conference in Seville, Spain, September 26 - October 1, 1994; (ii) a comprehensive technical presentation of the ITER EDA developments at the same conference; (iii) the first Workshop of the ITER Expert Group on Confinement and Transport, held at the San Diego Joint Work Site on 22-25 August 1994; and (iv) the visit to the San Diego Work Site of the representatives of a local philanthropic group, the ARCS Foundation (Achievement Rewards for College Scientists)

48 CFR 252.229-7005 - Tax exemptions (Spain).

Science.gov (United States)

2010-10-01

... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Tax exemptions (Spain... of Provisions And Clauses 252.229-7005 Tax exemptions (Spain). As prescribed in 229.402-70(e), use the following clause: Tax Exemptions (Spain) (JUN 1997) (a) The Contractor represents that the...

Measuring the Value of AI in Space Science and Exploration

Science.gov (United States)

Blair, B.; Parr, J.; Diamond, B.; Pittman, B.; Rasky, D.

2017-10-01

FDL is tackling knowledge gaps useful to the space program by forming small teams of industrial partners, cutting-edge AI researchers and space science domain experts, and tasking them to solve problems that are important to NASA as well as humanity's future.

Mapping Stress-Induced Changes in Autoinducer AI-2 Production in Chemostat-Cultivated Escherichia coli K-12

Science.gov (United States)

DeLisa, Matthew P.; Valdes, James J.; Bentley, William E.

2001-01-01

Numerous gram-negative bacteria employ a cell-to-cell signaling mechanism, termed quorum sensing, for controlling gene expression in response to population density. Recently, this phenomenon has been discovered in Escherichia coli, and while pathogenic E. coli utilize quorum sensing to regulate pathogenesis (i.e., expression of virulence genes), the role of quorum sensing in nonpathogenic E. coli is less clear, and in particular, there is no information regarding the role of quorum sensing during the overexpression of recombinant proteins. The production of autoinducer AI-2, a signaling molecule employed by E. coli for intercellular communication, was studied in E. coli W3110 chemostat cultures using a Vibrio harveyi AI-2 reporter assay (M. G. Surrette and B. L. Bassler, Proc. Natl. Acad. Sci. USA 95:7046–7050, 1998). Chemostat cultures enabled a study of AI-2 regulation through steady-state and transient responses to a variety of environmental stimuli. Results demonstrated that AI-2 levels increased with the steady-state culture growth rate. In addition, AI-2 increased following pulsed addition of glucose, Fe(III), NaCl, and dithiothreitol and decreased following aerobiosis, amino acid starvation, and isopropyl-β-d-thiogalactopyranoside-induced expression of human interleukin-2 (hIL-2). In general, the AI-2 responses to several perturbations were indicative of a shift in metabolic activity or state of the cells induced by the individual stress. Because of our interest in the expression of heterologous proteins in E. coli, the transcription of four quorum-regulated genes and 20 stress genes was mapped during the transient response to induced expression of hIL-2. Significant regulatory overlap was revealed among several stress and starvation genes and known quorum-sensing genes. PMID:11292813

Secondhand Tobacco Smoke Exposure and Lung Adenocarcinoma In Situ/Minimally Invasive Adenocarcinoma (AIS/MIA).

Science.gov (United States)

Kim, Claire H; Lee, Yuan-Chin Amy; Hung, Rayjean J; Boffetta, Paolo; Xie, Dong; Wampfler, Jason A; Cote, Michele L; Chang, Shen-Chih; Ugolini, Donatella; Neri, Monica; Le Marchand, Loic; Schwartz, Ann G; Morgenstern, Hal; Christiani, David C; Yang, Ping; Zhang, Zuo-Feng

2015-12-01

The aim of this study was to estimate the effect of exposure to secondhand tobacco smoke on the incidence of lung adenocarcinoma in situ/minimally invasive adenocarcinoma (AIS/MIA). Data from seven case-control studies participating in the International Lung Cancer Consortium (ILCCO) were pooled, resulting in 625 cases of AIS/MIA and 7,403 controls, of whom 170 cases and 3,035 controls were never smokers. Unconditional logistic regression was used to estimate adjusted ORs (ORadj) and 95% confidence intervals (CI), controlling for age, sex, race, smoking status (ever/never), and pack-years of smoking. Study center was included in the models as a random-effects intercept term. Ever versus never exposure to secondhand tobacco smoke was positively associated with AIS/MIA incidence in all subjects (ORadj = 1.48; 95% CI, 1.14-1.93) and in never smokers (ORadj = 1.45; 95% CI, 1.00-2.12). There was, however, appreciable heterogeneity of ORadj across studies (P = 0.01), and the pooled estimates were largely influenced by one large study (40% of all cases and 30% of all controls). These findings provide weak evidence for an effect of secondhand tobacco smoke exposure on AIS/MIA incidence. Further studies are needed to assess the impact of secondhand tobacco smoke exposure using the newly recommended classification of subtypes of lung adenocarcinoma. ©2015 American Association for Cancer Research.

AI in medical education--another grand challenge for medical informatics.

Science.gov (United States)

Lillehaug, S I; Lajoie, S P

1998-03-01

The potential benefits of artificial intelligence in medicine (AIM) were never realized as anticipated. This paper addresses ways in which such potential can be achieved. Recent discussions of this topic have proposed a stronger integration between AIM applications and health information systems, and emphasize computer guidelines to support the new health care paradigms of evidence-based medicine and cost-effectiveness. These proposals, however, promote the initial definition of AIM applications as being AI systems that can perform or aid in diagnoses. We challenge this traditional philosophy of AIM and propose a new approach aiming at empowering health care workers to become independent self-sufficient problem solvers and decision makers. Our philosophy is based on findings from a review of empirical research that examines the relationship between the health care personnel's level of knowledge and skills, their job satisfaction, and the quality of the health care they provide. This review supports addressing the quality of health care by empowering health care workers to reach their full potential. As an aid in this empowerment process we argue for reviving a long forgotten AIM research area, namely, AI based applications for medical education and training. There is a growing body of research in artificial intelligence in education that demonstrates that the use of artificial intelligence can enhance learning in numerous domains. By examining the strengths of these educational applications and the results from previous AIM research we derive a framework for empowering medical personnel and consequently raising the quality of health care through the use of advanced AI based technology.

Genetically elevated apolipoprotein A-I, high-density lipoprotein cholesterol levels, and risk of ischemic heart disease

DEFF Research Database (Denmark)

Lundegaard, Christiane; Tybjærg-Hansen, Anne; Grande, Peer

2010-01-01

Epidemiologically, levels of high-density lipoprotein (HDL) cholesterol and its major protein constituent, apolipoprotein A-I (apoA-I), are inversely related to risk of ischemic heart disease (IHD).......Epidemiologically, levels of high-density lipoprotein (HDL) cholesterol and its major protein constituent, apolipoprotein A-I (apoA-I), are inversely related to risk of ischemic heart disease (IHD)....

Spain investigates PLEX options

International Nuclear Information System (INIS)

Hevia, F.

1990-01-01

Spain's nuclear generation capacity will be reduced by some 6000MWe by the year 2015 if decommissioning of the units currently in operation takes place at the end of their 40-year design life. Bearing this in mind, in 1988 the Santa Maria de Garona BWR and the Jose Cabrera PWR were chosen by their respective owners as reference units for plant life extension (PLEX) activities. These plants are the oldest of their types operating in Spain and PLEX programmes were already under way. (author)

Developing Pokemon AI For Finding Comfortable Settings

OpenAIRE

Panumate, Chetprayoon; Iida, Hiroyuki

2016-01-01

This paper explores an innovative way to find a comfortable setting of video games. Pokemon is chosen as benchmark and game refinement measure is employed for the assessment. The number of Pokemon that one trainer can carry (i.e., setting with n=6) has never been changed after the first episode of Pokemon was released in 1996. Pokemon battle is simulated and various AIs are developed for the experiments. The results show that the original setting is the best for many players of various levels.

How Is Pulmonary Function and Exercise Tolerance Affected in Patients With AIS Who Have Undergone Spinal Fusion?

Science.gov (United States)

Jeans, Kelly A; Lovejoy, John F; Karol, Lori A; McClung, Anna M

2017-11-01

Prospectively enrolled AIS patients who underwent spinal fusion, with 2 year follow-up. To evaluate the cardiovascular fitness and activity level in patients with AIS pre- and post-spinal fusion and to determine if initial curve magnitude or pulmonary function is predictive of exercise capacity. Researchers have tried to link pulmonary function testing (PFT) to exercise capacity; the results are mixed. Some report no improvement in PFTs or aerobic activity after surgical correction, and PFT measures were not predictive of exercise capacity. Conflicting results have shown Vo 2max results to fall within normal range in AIS patients while PFTs show minimal impairment. AIS patients underwent PFT and oxygen consumption (VO 2 ) testing during a submaximal graded exercise test (GXT) pre- and post-spinal fusion. Vo 2max was predicted in those patients who completed the test to 85% of maximal heart rate. Pre- to postoperative changes were assessed and then compared to age-matched control subjects. Correlations between Vo 2max and curve severity, pulmonary function, and activity level were assessed. Thirty-seven patients participated. Vo 2max was predicted in 23 patients pre- and postoperation. There was a significant reduction in Vo 2max postfusion (39.5 ± 6.5 mL/kg/min vs 42.1 ± 8.1 mL/kg/min, p = .033); however, compared with controls (40.5 ± 6.5 mL/kg/min), all data were within the normal range (p > .05). AIS patients reporting high activity had significantly greater Vo 2max than those reporting low activity both pre and postoperatively, but this difference only met statistical significance preop (p .05). Vo 2max in patients with AIS is within normal range both pre- and postfusion. Pulmonary limitations are accommodated for with a slightly increased breathing rate and a slightly reduced overall workload. Activity level rather than curve severity affects Vo 2max outcomes following fusion in AIS. Copyright © 2017 Scoliosis Research Society. Published by Elsevier Inc

Campus 3 méthode de français

CERN Document Server

Pécheur, Jacques; Molinié, Muriel

2003-01-01

Méthode de français pour grands adolescents et adultes sur 3 niveaux. Ce niveau comprend : un livre de l'élève, un cahier d'exercices, un livre du professeur, une vidéo, des cassettes audio collectives au CD, et pour l'élève : une cassette audio individuelle ou CD.

Artificial Intelligence: Is the Future Now for A.I.?

Science.gov (United States)

Ramaswami, Rama

2009-01-01

In education, artificial intelligence (AI) has not made much headway. In the one area where it would seem poised to lend the most benefit--assessment--the reliance on standardized tests, intensified by the demands of the No Child Left Behind Act of 2001, which holds schools accountable for whether students pass statewide exams, precludes its use.…

Technological differences between açai and juçara pulps and their sorbets

Directory of Open Access Journals (Sweden)

Ana Paula Silva Siqueira

2017-11-01

Full Text Available Abstract Açai and juçara are palm trees that produce similar fruits. However, only the sale of açai is growing on the market for pulps and processed products for human consumption. The aim of this study was to compare açai and juçara pulps from the chemical, bioactive, rheological and technological points of view. Sorbets were elaborated with the pulps and evaluations were carried out regarding the antioxidant activity, polyphenols, anthocyanins, pH, acidity, soluble solids, ratio and colour. The pulps were evaluated rheologically and the sorbets for melting time. Juçara showed better results regarding the bioactive parameters (antioxidants ≈ 151 uM ferrous sulphate/ g and anthocyanins ≈ 77 mg.100g-1 and presented a more intense colour (Chroma 17. The pulps were physicochemically similar. The sorbet preserved much of the nutrients and presented a very intense colour, mainly in the juçara sorbet.

Marriage strategies among immigrants in Spain

NARCIS (Netherlands)

Sánchez-Domínguez, M.; de Valk, H.A.G.; Reher, D.S.

2011-01-01

This paper studies patterns of endogamous marriages of immigrants in Spain by using data from the National Immigrant Survey of Spain (2007). First of all, we examine patterns of endogamous marriage and links between migration and marriage. Second, we assess the factors influencing the likelihood of

Hebrew and Latin astrology in the twelfth century: the example of the location of pain.

Science.gov (United States)

Burnett, Charles

2010-06-01

The formative period of Latin and Hebrew astrology occurred virtually simultaneously in both cultures. In the second quarter of the twelfth century the terminology of the subject was established and the textbooks which became authoritative were written. The responsibility for this lay almost entirely with two scholars: John of Seville for the Latins, and Abraham ibn Ezra for the Jews. It is unlikely to have been by coincidence that the same developments in astrology occurred in these two cultures. John of Seville and Abraham ibn Ezra were both brought up within the Islamic culture of Spain, and their astrology was Arabic astrology. Moreover, some scholars have thought that John's origins were Jewish, while Ibn Ezra is known to have collaborated with Latin scholars (whose names are not recorded). It cannot be a coincidence that they forged the science of astrology for their respect co-religionists at almost the same time. Yet, very little research has been done on the possible relations between the two scholars. The purpose of this paper is to begin to explore this relationship, and to illustrate it in particular by their shared doctrine concern the location of pain.

Vertebrate Ticks Distribution and Their Role as Vectors in Relation to Road Edges and Underpasses.

Science.gov (United States)

Delgado, Juan D; Abreu-Yanes, Estefanía; Abreu-Acosta, Néstor; Flor, Manuel D; Foronda, Pilar

2017-06-01

Roads fragment vertebrate populations and affect the dynamics and dispersal patterns of vertebrate parasites. We evaluated how vertebrate ticks distribute near roads and road underpasses in human-caused road-fragmented landscapes in Seville, SW Spain. We sampled 49 stations with 93 individualized sampling points and assessed tick abundance. We explored the relationship between tick presence and abundance and distance to the nearest road and underpass (drainage culverts and other passages used by vertebrates), and landscape features through categorical regression and nonparametric statistics. The presence of the tick-borne pathogens Borrelia sp. and Bartonella sp. was also analyzed by PCR. We found preliminary evidence of high relative tick abundance next to roads and in the vicinity of road underpasses. Plant cover type was related to tick presence in this road context. Implications of road permeability and edge effect in patterns of vertebrate-tick relationships in road fragmentation contexts are discussed. Both Borrelia sp. and Bartonella sp. were detected in the ticks analyzed. This is the first report of these bacteria in ticks from Seville. The results confirm the potential risk of acquiring Lyme disease and bartonellosis in this area.

Modification of WC-Co Hard Metal by Ion Implantation with Ti+, AI+, N+, C+ and B+

International Nuclear Information System (INIS)

Rassoul, El.M.A.; Saleh, Z.A.; Waheed, A.F.; Abdel- Samad, S.M.; EI- Awadi, G.A.

2010-01-01

WC/Co hard metal was implanted by Ti + , AI + , N + , C + , and B + ions at a dose of 5x 10 17 ions/cm 2 at different energies ranging from 50 keV to 200 keV. The implanted layers were investigated by means of nano indentation, calotte measurements, SEM, X-ray diffraction XRD, tribometer and EDX. The maximum implanted zone was about 0.13 μm. The hardness of WC-Co was increased by a factor of 140% after its implantation by Ti, AI, and N and increased by a factor of 170 % after implantation by Ti + , AI + , C + , N + and B + ions as compared to the original value. Also friction coefficient of WC/Co was improved after ion implantation.

Appreciative Inquiry and Autonomy-Supportive Classes in Business Education: A Semilongitudinal Study of AI in the Classroom

Science.gov (United States)

Conklin, Thomas A.; Hartman, Nathan S.

2014-01-01

In this article, we describe 10 separate classroom experiences where an appreciative inquiry (AI) exercise was used for course creation. Post-exercise surveys of students showed that the AI exercise was perceived to be a successful practice. Students indicated putting effort toward reaching their peak learning experience and were satisfied with…

Effects of Additives on the Corrosion Resistance of Iron Aluminides(Fe-38at.%AI-5at.%Cr)

International Nuclear Information System (INIS)

Choi, H. C.; Kim, C. W.; Joo, S. M.; Choi, D. C.; Kim, K. H.

2001-01-01

The effects of additives on the corrosion resistance of iron aluminides(Fe-38at.%AI-5at.%Cr) were investigated using potentiostat. The specimens were cast by vacuum arc melting. The subsequent homogenization was carried out in Ar gas atmosphere at 1000 .deg. C for 7 days. The corroded surfaces of the tested specimens were observed using an optical microscope and a scanning electron microscope(SEM) after electrochemical tests were carried out in various solutions. While the Hf addition to Fe-38at.%AI-5at.%Cr resulted in equiaxial microstructure, the Zr addition resulted in dendritic microstructure. However, no change in microstructure was observed when Mo was added. The addition of Mo to Fe-38at.%AI-5at.%Cr intermetallic compound was found to increase the pitting potential, which improved the resistance against the pitting corrosion attack. The addition of Hf and Zr resulted in a higher activation current density and a lower pitting potential. These results may indicate that the dendrite structure played a major role in decreasing the pitting corrosion resistance of Fe-38at.%AI-5at%Cr intermetallic compound. The Mo addition to Fe-38at.%AI-5at.%Cr decreased the number and size of pits. In the case of Zr addition, the pits nucleated and grew remarkably at dendritic branches

Influence of temperament score and handling facility on stress, reproductive hormone concentrations, and fixed time AI pregnancy rates in beef heifers.

Science.gov (United States)

Kasimanickam, R; Schroeder, S; Assay, M; Kasimanickam, V; Moore, D A; Gay, J M; Whittier, W D

2014-10-01

The objectives were (i) to evaluate the effect of temperament, determined by modified 2-point chute exit and gait score, on artificial insemination (AI) pregnancy rates in beef heifers following fixed time AI and (ii) to determine the effect of temperament on cortisol, substance-P, prolactin and progesterone at initiation of synchronization and at the time of AI. Angus beef heifers (n = 967) at eight locations were included in this study. At the initiation of synchronization (Day 0 = initiation of synchronization), all heifers received a body condition score (BCS), and temperament score (0 = calm; slow exit and walk or 1 = excitable; fast exit or jump or trot or run). Blood samples were collected from a sub-population of heifers (n = 86) at both synchronization initiation and the time of AI to determine the differences in serum progesterone, cortisol, prolactin and substance-P concentrations between temperament groups. Heifers were synchronized with 5-day CO-Synch+ controlled internal drug release (CIDR) protocol and were inseminated at 56 h after CIDR removal. Heifers were examined for pregnancy by ultrasound 70 days after AI to determine AI pregnancy. Controlling for synchronization treatment (p = 0.03), facility design (p = 0.05), and cattle handling facility design by temperament score interaction (p = 0.02), the AI pregnancy differed between heifers with excitable and calm temperament (51.9% vs 60.3%; p = 0.01). The alley-way with acute bends and turns, and long straight alley-way had lower AI pregnancy rate than did the semicircular alley-way (53.5%, 56.3% and 67.0% respectively; p = 0.05). The serum hormone concentrations differed significantly between different types of cattle handling facility (p < 0.05). The cattle handling facility design by temperament group interactions significantly influenced progesterone (p = 0.01), cortisol (p = 0.01), prolactin (p = 0.02) and substance-P (p = 0.04) both at the initiation of

78 FR 6227 - Importation of Fresh Apricots From Continental Spain

Science.gov (United States)

2013-01-30

.... APHIS-2011-0132] RIN 0579-AD62 Importation of Fresh Apricots From Continental Spain AGENCY: Animal and... continental Spain. As a condition of entry, fresh apricots from continental Spain would have to be produced in... organization of Spain certifying that the fruit is free from all quarantine pests and has been produced in...

INES in Spain

International Nuclear Information System (INIS)

Zarzuela, J.

1997-01-01

The presentation discusses the INES activities in Spain addressing the following issues: applicability; rating procedure; public information; activities in 1997; events above level 0 (October 1996 - September 1997); difficulties

AI/Simulation Fusion Project at Lawrence Livermore National Laboratory

International Nuclear Information System (INIS)

Erickson, S.A.

1984-01-01

This presentation first discusses the motivation for the AI Simulation Fusion project. After discussing very briefly what expert systems are in general, what object oriented languages are in general, and some observed features of typical combat simulations, it discusses why putting together artificial intelligence and combat simulation makes sense. We then talk about the first demonstration goal for this fusion project

AI/Simulation Fusion Project at Lawrence Livermore National Laboratory

Energy Technology Data Exchange (ETDEWEB)

Erickson, S.A.

1984-04-25

This presentation first discusses the motivation for the AI Simulation Fusion project. After discussing very briefly what expert systems are in general, what object oriented languages are in general, and some observed features of typical combat simulations, it discusses why putting together artificial intelligence and combat simulation makes sense. We then talk about the first demonstration goal for this fusion project.

Cancer incidence in Spain, 2015.

Science.gov (United States)

Galceran, J; Ameijide, A; Carulla, M; Mateos, A; Quirós, J R; Rojas, D; Alemán, A; Torrella, A; Chico, M; Vicente, M; Díaz, J M; Larrañaga, N; Marcos-Gragera, R; Sánchez, M J; Perucha, J; Franch, P; Navarro, C; Ardanaz, E; Bigorra, J; Rodrigo, P; Bonet, R Peris

2017-07-01

Periodic cancer incidence estimates of Spain from all existing population-based cancer registries at any given time are required. The objective of this study was to present the current situation of cancer incidence in Spain. The Spanish Network of Cancer Registries (REDECAN) estimated the numbers of new cancer cases occurred in Spain in 2015 by applying the incidence-mortality ratios method. In the calculus, incidence data from population-based cancer registries and mortality data of all Spain were used. In 2015, nearly a quarter of a million new invasive cancer cases were diagnosed in Spain, almost 149,000 in men (60.0%) and 99,000 in women. Globally, the five most common cancers were those of colon-rectum, prostate, lung, breast and urinary bladder. By gender, the four most common cancers in men were those of prostate (22.4%), colon-rectum (16.6%), lung (15.1%) and urinary bladder (11.7%). In women, the most common ones were those of breast (28.0%), colon-rectum (16.9%), corpus uteri (6.2%) and lung (6.0%). In recent years, cancer incidence in men seems to have stabilized due to the fact that the decrease in tobacco-related cancers compensates for the increase in other types of cancer like those of colon and prostate. In women, despite the stabilization of breast cancer incidence, increased incidence is due, above all, to the rise of colorectal and tobacco-related cancers. To reduce these incident cancer cases, improvement of smoking control policies and extension of colorectal cancer screening should be the two priorities in cancer prevention for the next years.

The effect of solid content on silylated-γ-AI2O3/PVDF-HFP-coated PE separators for lithium secondary battery

International Nuclear Information System (INIS)

Im, Jong Su; Sohn, Joon Yong; Shin, Jun Hwa; Nho, Young Chang; Kim, Jeong Soo

2009-01-01

Several PVDF-HFP/silylated γ-AI 2 O 3 -coated PE (polyethylene) separators with various solidities (various compositions of PVDF-HFP/silylated γ-AI 2 O 3 ) were prepared by a dip-coating of PE separators in PVDF-HFP/silylated γ-AI 2 O 3 /acetone mixtures. FT-IR spectroscopy was used to confirm the chemical reactions between silane coupling agent and γ-AI 2 O 3 . The SEM images of the coated separators showed that various morphologies could be produced by changing the composition of total contents of binder and solid contents. The effects of composition in inorganic material (silane coupling agent-treated γ-AI 2 O 3 ) and binder (PVDF-HFP) on the physio-chemical properties of the prepared separators such as liquid electrolyte uptake, and ion conductivity were investigated and reported in this paper

Teaching Gender and Geography in Spain

Science.gov (United States)

Garcia-Ramon, Maria-Dolors

2011-01-01

Since the introduction of gender themes into university teaching in geography in Spain in 1989, significant gains have been made but challenges remain in relation to placing gender into undergraduate curricula and developing teaching resources in local languages. Geographers in Spain have to meet those challenges in the near future in order to…

L’Institut français de recherche pour l’exploitation de la mer (IFREMER)

OpenAIRE

2014-01-01

Note portant sur l’auteur L’Institut français de recherche scientifique pour le développement en coopération (ORSTOM) et le Centre de coopération internationale en recherche agronomique pour le développement (CIRAD) sont deux organismes français de recherche qui œuvrent au Brésil depuis plus de vingt ans. Cette contribution permet de faire connaître l’éventail des recherches entreprises et leurs aspects originaux ainsi que les résultats obtenus, les apports et les profits mutuels, en deux mot...

Seated T'ai Chi in Older Taiwanese People Using Wheelchairs: A Randomized Controlled Trial Investigating Mood States and Self-Efficacy.

Science.gov (United States)

Hsu, Chen-Yuan; Moyle, Wendy; Cooke, Marie; Jones, Cindy

2016-12-01

There is growing interest in t'ai chi, but little research has addressed whether t'ai chi is effective in older people using wheelchairs for mobilization. The aim of this study was to compare the effects of seated t'ai chi exercise and usual standard activities on mood states and self-efficacy in older people living in a long-term care facility and using wheelchairs for mobilization. Randomized controlled trial (trial registration no. ACTRN12613000029796). One long-term-care facility in Taiwan. Sixty participants were randomly assigned by a computer-generated random sequence to a t'ai chi group (n = 30) or a usual exercise and entertainment activities group (n = 30). Seated t'ai chi exercise for 40 minutes three times a week for 26 weeks was provided. Mood states (Profile of Mood States Short Form [POMS-SF]) and self-efficacy (Self-Efficacy for Exercise [SEE]). At week 26, participants in the t'ai chi group reported significantly lower mood states on the fatigue-inertia dimension of the POMS-SF (mean score ± standard deviation, 3.56 ± 3.71) than did the control group (mean score, 7.16 ± 6.36) (F [1, 58] = 7.15; p self-efficacy for older people using wheelchairs.

75 FR 51113 - Chlorinated Isocyanurates From China and Spain

Science.gov (United States)

2010-08-18

... Isocyanurates From China and Spain AGENCY: United States International Trade Commission. ACTION: Scheduling of... and Spain. SUMMARY: The Commission hereby gives notice of the scheduling of expedited reviews pursuant... revocation of the antidumping duty orders on chlorinated isocyanurates from China and Spain would be likely...

Applying AI tools to operational space environmental analysis

Science.gov (United States)

Krajnak, Mike; Jesse, Lisa; Mucks, John

1995-01-01

The U.S. Air Force and National Oceanic Atmospheric Agency (NOAA) space environmental operations centers are facing increasingly complex challenges meeting the needs of their growing user community. These centers provide current space environmental information and short term forecasts of geomagnetic activity. Recent advances in modeling and data access have provided sophisticated tools for making accurate and timely forecasts, but have introduced new problems associated with handling and analyzing large quantities of complex data. AI (Artificial Intelligence) techniques have been considered as potential solutions to some of these problems. Fielding AI systems has proven more difficult than expected, in part because of operational constraints. Using systems which have been demonstrated successfully in the operational environment will provide a basis for a useful data fusion and analysis capability. Our approach uses a general purpose AI system already in operational use within the military intelligence community, called the Temporal Analysis System (TAS). TAS is an operational suite of tools supporting data processing, data visualization, historical analysis, situation assessment and predictive analysis. TAS includes expert system tools to analyze incoming events for indications of particular situations and predicts future activity. The expert system operates on a knowledge base of temporal patterns encoded using a knowledge representation called Temporal Transition Models (TTM's) and an event database maintained by the other TAS tools. The system also includes a robust knowledge acquisition and maintenance tool for creating TTM's using a graphical specification language. The ability to manipulate TTM's in a graphical format gives non-computer specialists an intuitive way of accessing and editing the knowledge base. To support space environmental analyses, we used TAS's ability to define domain specific event analysis abstractions. The prototype system defines

Development of X-ray diffractometers XD-D1 AI qualitative analysis system

International Nuclear Information System (INIS)

Arai, Hiroshi; Uota, Atsushi; Ishida, Hidenobu

1994-01-01

Qualitative X-ray diffraction is a very important analytical method, however, it is also very difficult to perform and needs some special skills. Also, the analysis accuracy depends on the operators' knowledge of qualitative analysis. In order that even a beginner analyst can obtain accurate results, we have developed the 'XD-D1 AI Qualitative Analysis System'. This system can support analytical operations with the experts' knowledge made available by AI techniques. Systematizing the experts' knowledge, we applied the system to our expert shell 'GENZO-I/PRO'. This system enabled a beginner analyst to get the same results as a specialist would get. In this paper, we will describe the process of system design, system construction and an example analysis. (author)

A photometric and spectroscopic study of the early-type binary AI Crucis

International Nuclear Information System (INIS)

Bell, S.A.; Kilkenny, D.; Malcolm, G.J.

1987-01-01

New Stroemgren photometry and medium-dispersion spectroscopy of the early-type eclipsing binary AI Cru are presented. The masses and radii of the two components are found to be (9.8 +-0.5) and (5.8 +-0.3) solar masses and (4.9 +- 0.1) and (4.4 +- 0.1) solar radii, respectively. The semi-detached nature of the system is confirmed and by comparison with stationary models by previous authors it is shown that AI Cru has probably passed through the rapid phase of Case A mass transfer. It is suggested that the original system may have had a period of about 1.3 day and that the roles of the current primary and secondary components were at that time reversed. (author)

General Video Game AI: Learning from Screen Capture

OpenAIRE

Kunanusont, Kamolwan; Lucas, Simon M.; Perez-Liebana, Diego

2017-01-01

General Video Game Artificial Intelligence is a general game playing framework for Artificial General Intelligence research in the video-games domain. In this paper, we propose for the first time a screen capture learning agent for General Video Game AI framework. A Deep Q-Network algorithm was applied and improved to develop an agent capable of learning to play different games in the framework. After testing this algorithm using various games of different categories and difficulty levels, th...

Conversational AI: The Science Behind the Alexa Prize

OpenAIRE

Ram, Ashwin; Prasad, Rohit; Khatri, Chandra; Venkatesh, Anu; Gabriel, Raefer; Liu, Qing; Nunn, Jeff; Hedayatnia, Behnam; Cheng, Ming; Nagar, Ashish; King, Eric; Bland, Kate; Wartick, Amanda; Pan, Yi; Song, Han

2018-01-01

Conversational agents are exploding in popularity. However, much work remains in the area of social conversation as well as free-form conversation over a broad range of domains and topics. To advance the state of the art in conversational AI, Amazon launched the Alexa Prize, a 2.5-million-dollar university competition where sixteen selected university teams were challenged to build conversational agents, known as socialbots, to converse coherently and engagingly with humans on popular topics ...

Effects of Ai Chi on balance, quality of life, functional mobility, and motor impairment in patients with Parkinson's disease.

Science.gov (United States)

Kurt, Emine Eda; Büyükturan, Buket; Büyükturan, Öznur; Erdem, Hatice Rana; Tuncay, Figen

2018-04-01

In this study, we aimed to investigate effects of Ai Chi on balance, functional mobility, health-related quality of life, and motor impairment in patients with Parkinson's disease. This study was conducted as an open-label randomized controlled trial (ISRCTN26292510) with repeated measures. Forty patients with Parkinson's disease stages 2 to 3 according to the Hoehn and Yahr Scale were randomly allocated to either an Ai Chi exercise group or a land-based exercise control group for 5 weeks. Balance was measured using the Biodex-3,1 and the Berg Balance Scale. Functional mobility was evaluated using the Timed Up and Go Test. Additionally, health-related quality of life and motor activity were assessed with the Parkinson's Disease Questionnaire-39 and the Unified Parkinson's Disease Rating Scale-III. Although patients in both groups showed significant improvement in all outcome variables, improvement of dynamic balance was significantly greater in the Ai Chi group (p Balance Scale (p balance, mobility, motor ability, and quality of life. In addition, Ai Chi exercise was more effective as an intervention than land-based exercise in patients with mild to moderate Parkinson's disease. Implications for rehabilitation Ai Chi exercises (aquatic exercises) may help improve balance, functional mobility, health-related quality of life, and motor ability in patients with mild to moderate Parkinson's disease more efficiently than similar land-based exercises. Ai Chi exercises should be considered as a rehabilitation option for treatment of patients with mild or moderate Parkinson's disease.

78 FR 32183 - Importation of Avocados From Continental Spain

Science.gov (United States)

2013-05-29

.... APHIS-2012-0002] RIN 0579-AD63 Importation of Avocados From Continental Spain AGENCY: Animal and Plant... continental Spain (excluding the Balearic Islands and Canary Islands) into the United States. This action will... avocados from continental Spain (excluding the Balearic Islands and Canary Islands) into the United States...

Oral immunization with recombinant Lactobacillus casei expressing OmpAI confers protection against Aeromonas veronii challenge in common carp, Cyprinus carpio.

Science.gov (United States)

Zhang, Dong-Xing; Kang, Yuan-Huan; Chen, Long; Siddiqui, Shahrood Ahmed; Wang, Chun-Feng; Qian, Ai-Dong; Shan, Xiao-Feng

2018-01-01

Aeromonas veronii is a gram-negative pathogen capable of infecting both fish and mammals, including humans, and natural infection in fish results in irreparable damage to the aquaculture industry. Lactic acid bacteria (LAB) have a number of properties that make them attractive candidates as delivery vehicles for presentation to the mucosa sites of compounds with pharmaceutical interest, in particular vaccines. In this study, we generated two recombinant Lactobacillus casei (surface-displayed or secretory) expressing the OmpAI of A.veronii and evaluated the effect on immune responses in fish model. A 1022 bp gene fragment of the 42 kDa OmpAI antigen of A.veronii was cloned into pPG-1 (surface-displayed) and pPG-2 (secretory) and electrotransformed into Lactobacillus casei CC16. The recombinant plasmid in L.casei could be stably inherited over 50 generations, and production of OmpAI protein had slight limited effects on cells growth. Treatment of common carp with the recombinant vaccine candidate stimulated high serum or skin mucus specific antibody titers and induced a higher lysozyme, ACP, SOD activity, while fish fed with Lc-pPG or PBS had no detectable immobilizing immune responses. Expression of IL-10, IL-β, IFN-γ, TNF-α genes in the group immunized with recombinant L.casei were significantly (P casei strains were directly delivered and survive throughout the intestinal tract, the recombinant OmpAI was also detected in intestine mucosal. The results showed that common carp received Lc-pPG1-OmpAI (66.7%) and Lc-pPG2-OmpAI (50.0%) had higher survival rates compared with the controls after challenge with A.veronii, indicating that Lc-pPG1-OmpAI and Lc-pPG2-OmpAI had beneficial effects on immune response and enhanced disease resistance of common carp against A.veronii infection. Our study here demonstrates, for the first time, the ability of recombinant L.casei as oral vaccine against A.veronii infection in carps. The combination of OmpAI delivery and LAB

Automated calculations for massive fermion production with ai-bar Talc

International Nuclear Information System (INIS)

Lorca, A.; Riemann, T.

2004-01-01

The package ai-bar Talc has been developed for the automated calculation of radiative corrections to two-fermion production at e + e - colliders. The package uses Diana, Qgraf, Form, Fortran, FF, LoopTools, and further unix/linux tools. Numerical results are presented for e + e - -> e + e - , μ + μ - , bs-bar , tc-bar

Future role of AI/Robotics in physical security

International Nuclear Information System (INIS)

Jacobs, J.

1986-06-01

Manpower requirements for physical security systems place a heavy burden on operating security budgets. Technology innovations which free personnel or which make security personnel more efficient in carrying out their tasks is an important means of dealing with budget and manpower constraints. It is believed that AI/Robotics will be important technologies to alleviate these problems in the future. There are three types of applications for AI and Robotics technology that may: (1) help security personnel perform their tasks more effectively or efficiently, (2) perform tasks that security personnel would otherwise perform (free up people), and (3) perform tasks that cannot be performed by security personnel at this time. This paper will discuss the various types of security applications that are presently being considered for the above areas and will briefly describe a few examples of the application of this technology. Examples will include ground mobile platforms carrying alarm assessment and/or surveillance sensors and operating either autonomously or with telepresence by a remote operator. An airborne platform performing similar functions will also be discussed. An application of a type of robot sentry that would be fixed and incorporate very simple portable displays will also be described. A third type of robot, an interior robot, that could be used in sensitive or hazardous areas to do detection and assessment functions will be reviewed

Lexique Pove–Français/Français– Pove, Mickala Manfoumbi ...

African Journals Online (AJOL)

rbr

Français/Français–. Pove (Mickala Manfoumbi 2004) fait par Mavoungou (2005). En dehors des réserves sur les ques- tions purement lexicographiques, l'ouvrage de Mickala Manfoumbi suscite des interrogations inté- ressantes qui dépassent le ...

Administration of a luteolytic dose of PGF2α at the time of AI

Directory of Open Access Journals (Sweden)

G. Neglia

2010-02-01

Full Text Available The aim of this study was to verify if the administration of a luteolytic dose of PGF2α at the time of AI is able to anticipate ovulation and, hence, to increase fertility rate. Furthermore, the presence of a “farm effect” was also evaluated. The trial was performed in two commercial farms (A and B located in Caserta on 584 buffaloes (Farm A: n=389; Farm B: n=195, synchronized by the Ovsynch-TAI Program. In each farm buffaloes were divided in two groups: treated group (n=181 and n=95, respectively in farms A and B received an intramuscular injection of 0.524 mg cloprostenol (Estrumate®, Schering-Plough Animal health, S.p.A., Milan, Italy at the time of AI while control group (n=208 and n=100 received an intramuscular injection of physiologic saline (0.9% NaCl. No differences were present with regard to the number of AI/subject, in terms of pregnancy rate and ovulation rate between treated and control groups. It is worth pointing out that the control group in farm A showed a higher (P<0.01 conception rate compared to the control group in farm B (46.15 vs. 30.00. Furthermore, within farm B buffaloes treated by cloprostenol on the day of AI showed higher (P<0.01 pregnancy rate vs. animals that received saline (51.58% vs. 30.00%. These results suggest that if fertility in control group is high, treatment by cloprostenol does not affect pregnancy rate and ovulation rate.

Past, present and prospect of an Artificial Intelligence (AI) based model for sediment transport prediction

Science.gov (United States)

Afan, Haitham Abdulmohsin; El-shafie, Ahmed; Mohtar, Wan Hanna Melini Wan; Yaseen, Zaher Mundher

2016-10-01

An accurate model for sediment prediction is a priority for all hydrological researchers. Many conventional methods have shown an inability to achieve an accurate prediction of suspended sediment. These methods are unable to understand the behaviour of sediment transport in rivers due to the complexity, noise, non-stationarity, and dynamism of the sediment pattern. In the past two decades, Artificial Intelligence (AI) and computational approaches have become a remarkable tool for developing an accurate model. These approaches are considered a powerful tool for solving any non-linear model, as they can deal easily with a large number of data and sophisticated models. This paper is a review of all AI approaches that have been applied in sediment modelling. The current research focuses on the development of AI application in sediment transport. In addition, the review identifies major challenges and opportunities for prospective research. Throughout the literature, complementary models superior to classical modelling.

AI-2 does not function as a quorum sensing molecule in Campylobacter jejuni during exponential growth in vitro

NARCIS (Netherlands)

Holmes, K.; Tavender, T.J.; Winzer, K.; Wells, J.; Hardie, K.

2009-01-01

Background - Campylobacter jejuni contains a homologue of the luxS gene shown to be responsible for the production of the signalling molecule autoinducer-2 (AI-2) in Vibrio harveyi and Vibrio cholerae. The aim of this study was to determine whether AI-2 acted as a diffusible quorum sensing signal

“Awake” intraoperative functional MRI (ai-fMRI) for mapping the eloquent cortex: Is it possible in awake craniotomy?☆

Science.gov (United States)

Lu, Jun-Feng; Zhang, Han; Wu, Jin-Song; Yao, Cheng-Jun; Zhuang, Dong-Xiao; Qiu, Tian-Ming; Jia, Wen-Bin; Mao, Ying; Zhou, Liang-Fu

2012-01-01

As a promising noninvasive imaging technique, functional MRI (fMRI) has been extensively adopted as a functional localization procedure for surgical planning. However, the information provided by preoperative fMRI (pre-fMRI) is hampered by the brain deformation that is secondary to surgical procedures. Therefore, intraoperative fMRI (i-fMRI) becomes a potential alternative that can compensate for brain shifts by updating the functional localization information during craniotomy. However, previous i-fMRI studies required that patients be under general anesthesia, preventing the wider application of such a technique as the patients cannot perform tasks unless they are awake. In this study, we propose a new technique that combines awake surgery and i-fMRI, named “awake” i-fMRI (ai-fMRI). We introduced ai-fMRI to the real-time localization of sensorimotor areas during awake craniotomy in seven patients. The results showed that ai-fMRI could successfully detect activations in the bilateral primary sensorimotor areas and supplementary motor areas for all patients, indicating the feasibility of this technique in eloquent area localization. The reliability of ai-fMRI was further validated using intraoperative stimulation mapping (ISM) in two of the seven patients. Comparisons between the pre-fMRI-derived localization result and the ai-fMRI derived result showed that the former was subject to a heavy brain shift and led to incorrect localization, while the latter solved that problem. Additionally, the approaches for the acquisition and processing of the ai-fMRI data were fully illustrated and described. Some practical issues on employing ai-fMRI in awake craniotomy were systemically discussed, and guidelines were provided. PMID:24179766

The (Dis)appearance of Ai Weiwei: Translations and (In)visibilities

DEFF Research Database (Denmark)

Glud, Louise Nørgaard; Stenbøg, Anne Sofie Christensen; Albrechtslund, Anders

This paper offers a study of surveillance themes relating to Ai Weiwei’s highly discussed disappearance and later reappearance in 2011. Our study is based on an Actor-Network Theory (ANT) approach and we focus on the manifold negotiations and (in)visibilities relating to the dramatic events as well...... as Ai’s artwork and life....

The (Dis)appearance of Ai Weiwei: Translations and (In)visibilities

DEFF Research Database (Denmark)

Stenbøg, Sofie; Nørgaard Glud, Louise; Albrechtslund, Anders

2013-01-01

This paper offers a study of surveillance themes relating to Ai Weiwei’s highly discussed disappearance and later reappearance in 2011. Our study is based on an Actor-Network Theory (ANT) approach and we focus on the manifold negotiations and (in)visibilities relating to the dramatic events as well...... as Ai’s artwork and life....

NASA space station automation: AI-based technology review. Executive summary

Science.gov (United States)

Firschein, O.; Georgeff, M. P.; Park, W.; Cheeseman, P. C.; Goldberg, J.; Neumann, P.; Kautz, W. H.; Levitt, K. N.; Rom, R. J.; Poggio, A. A.

1985-01-01

Research and Development projects in automation technology for the Space Station are described. Artificial Intelligence (AI) based technologies are planned to enhance crew safety through reduced need for EVA, increase crew productivity through the reduction of routine operations, increase space station autonomy, and augment space station capability through the use of teleoperation and robotics.

The assessment of the impact of socio-economic factors in accepting cancer using the Acceptance of Illness Scale (AIS).

Science.gov (United States)

Czerw, Aleksandra I; Bilińska, Magdalena; Deptała, Andrzej

2016-01-01

The paper presents the results of examining the level of acceptance of the illness in cancer patients using the Acceptance of Illness Scale (AIS). The study involved cancer patients treated at the Central Clinical Hospital of the Ministry the Interior in Warsaw in 2014. The questionnaire comprised basic demographic questions (socio-economic factors) and the AIS test estimating the level of illness acceptance in patients. For the group of patients in the research group, the arithmetic mean amounted to 27.56 points. The period of time that elapsed between the first cancer diagnosis and the start of the study did not influence the score of accepting illness. The acceptance of illness in patients diagnosed with metastases differed from the acceptance of illness by patients diagnosed with metastatic cancer. Females obtained the average of 29.59 in the AIS test, whereas the average in male patients was 26.17. The patients' age did not impact the AIS test. There were no differences in the AIS test results between a group of people with secondary education and a group of people with higher education. There were no differences in the AIS test results between employed individuals versus pensioners. The inhabitants of cities were characterized by the highest degree of acceptance of their health condition. The lowest degree of acceptance of illness was observed in the group with the lowest average incomes. In the group of married individuals the average degree of acceptance of illness amounted to 27.37 points. The average degree of acceptance of illness in patients that declared themselves as single amounted to 25.75. The average degree of acceptance of illness in the study group was 27.56 points, which is a relatively high level of acceptance of cancer. The main socio-economic factor, which influenced the AIS test results was whether metastases were diagnosed or not. There were no differences between patients in groups where the time that elapsed from the first diagnosis of

The assessment of the impact of socio-economic factors in accepting cancer using the Acceptance of Illness Scale (AIS

Directory of Open Access Journals (Sweden)

Aleksandra I. Czerw

2015-11-01

Full Text Available Aim of the study : The paper presents the results of examining the level of acceptance of the illness in cancer patients using the Acceptance of Illness Scale (AIS. Materials and methods: The study involved cancer patients treated at the Central Clinical Hospital of the Ministry the Interior in Warsaw in 2014. The questionnaire comprised basic demographic questions (socio-economic factors and the AIS test estimating the level of illness acceptance in patients. Results : For the group of patients in the research group, the arithmetic mean amounted to 27.56 points. The period of time that elapsed between the first cancer diagnosis and the start of the study did not influence the score of accepting illness. The acceptance of illness in patients diagnosed with metastases differed from the acceptance of illness by patients diagnosed with metastatic cancer. Females obtained the average of 29.59 in the AIS test, whereas the average in male patients was 26.17. The patients’ age did not impact the AIS test. There were no differences in the AIS test results between a group of people with secondary education and a group of people with higher education. There were no differences in the AIS test results between employed individuals versus pensioners. The inhabitants of cities were characterized by the highest degree of acceptance of their health condition. The lowest degree of acceptance of illness was observed in the group with the lowest average incomes. In the group of married individuals the average degree of acceptance of illness amounted to 27.37 points. The average degree of acceptance of illness in patients that declared themselves as single amounted to 25.75. Conclusions : The average degree of acceptance of illness in the study group was 27.56 points, which is a relatively high level of acceptance of cancer. The main socio-economic factor, which influenced the AIS test results was whether metastases were diagnosed or not. There were no

Taxi ! méthode de français : niveau 3

CERN Document Server

Johnson, Anne-Marie

2004-01-01

Taxi ! 3 est une méthode interactive, qui développe non seulement les connaissances, mais aussi les savoir-faire et les savoir-être de l'apprenant, à l'écrit comme à l'oral. La méthode est très simple à utiliser : une leçon = une double page. Taxi ! 3 couvre le niveau Bl du Cadre européen commun de référence pour l'apprentissage, l'enseignement et l'évaluation des langues. La méthode permet de se préparer aux épreuves A3 et A4 du DELF 1er degré. Une progression et des contenus fonctionnels et langagiers solides permettent à l'apprenant d'atteindre rapidement une autonomie en français dans des situations de la vie courante. Taxi ! 3 permet de mieux connaître la France d'aujourd'hui et les comportements des Français à travers une grande variété de documents authentiques (écrit et audio).

Vessel classification features using spatial Bayesian inference from historical AIS data

CSIR Research Space (South Africa)

Meyer, Rory GV

2017-07-01

Full Text Available Detections and classification of non-AIS-compliant vessels is an important ability for countries or institutions interested in MDA. SAR has been proven to be an effective method but there exists a trade-off between the area that can be imaged...

An Energy Dense-AI-NaBH4-PEMFC Based Power Generator for Unmanned Undersea Vehicles

Science.gov (United States)

2016-03-01

From- To) 03/01/2016 Final 01/28/2013-12/31/2015 4. TITLE AND SUBTITLE Sa. CONTRACT NUMBER An Energy-Dense AI-NaBH4- PEMFC Based Power Generator for...combination of polymer electrolyte membrane fuel cell ( PEMFC ) with a compact hydrogen generator util izing AI-NaBH4 composite fuel. The conditions...ANSI Std. Z39.18 FLORIDA SOLAR ENERGY CENTER. Crl’nrmg EnPrgy lnrll’pendrnr£’ An Energy-Dense Al-NaBH4- PEMFC Based Power Generator for Unmanned

Quality assurance in Spain

International Nuclear Information System (INIS)

Villate, J.

1980-01-01

The first part of this lecture is devoted to present the energy program in Spain and the three generations of nuclear plants. The evolution of QA is outlined pointing out how IAEA Codes of Practice on QA is now a requirement and also how USA regulations, codes and standards have constituted, up to now, the main framework to develop QA activities in Spain. A general idea is given of the Spanish program of courses to qualify the personnel to be involved in QA tasks in nuclear power plants. Finally a general scheme is given, emphasizing the three main aspects: design, procurement and fabrication; construction (QA on site). (orig./RW)

Download and multiply sharing robot minds and bodies over the Web could take AI to the next level

CERN Multimedia

Graham-Rowe, D

2002-01-01

Some AI researchers believe progress is being held back because the problems are too great for any individual group to solve alone. They have suggested that instead of just publishing results in journals, AI software and robots should be made available across the Internet and accessible even to complete novices (1 page).

An Internet of Things Approach for Extracting Featured Data Using AIS Database: An Application Based on the Viewpoint of Connected Ships

Directory of Open Access Journals (Sweden)

Wei He

2017-09-01

Full Text Available Automatic Identification System (AIS, as a major data source of navigational data, is widely used in the application of connected ships for the purpose of implementing maritime situation awareness and evaluating maritime transportation. Efficiently extracting featured data from AIS database is always a challenge and time-consuming work for maritime administrators and researchers. In this paper, a novel approach was proposed to extract massive featured data from the AIS database. An Evidential Reasoning rule based methodology was proposed to simulate the procedure of extracting routes from AIS database artificially. First, the frequency distributions of ship dynamic attributes, such as the mean and variance of Speed over Ground, Course over Ground, are obtained, respectively, according to the verified AIS data samples. Subsequently, the correlations between the attributes and belief degrees of the categories are established based on likelihood modeling. In this case, the attributes were characterized into several pieces of evidence, and the evidence can be combined with the Evidential Reasoning rule. In addition, the weight coefficients were trained in a nonlinear optimization model to extract the AIS data more accurately. A real life case study was conducted at an intersection waterway, Yangtze River, Wuhan, China. The results show that the proposed methodology is able to extract data very precisely.

La muerte del príncipe Don Juan. Exequias y duelo en Córdoba y Sevilla durante el otoño de 1497 = The Death of Prince Juan. Funeral Rites and Mourning in Cordoba and Seville during the Autumn of 1497

Directory of Open Access Journals (Sweden)

Margarita Cabrera Sánchez

2018-05-01

Full Text Available La finalidad de este trabajo es estudiar las circunstancias de la muerte del príncipe don Juan, los ritos post mortem y las ceremonias fúnebres que tuvieron lugar en Córdoba y Sevilla. Además, nos hemos detenido a analizar cómo pudieron transcurrir los primeros años de su vida y su adolescencia, ya que los testimonios consultados revelan una salud frágil, que, probablemente, pudo precipitar su temprano fallecimiento. Las numerosas fuentes a las que hemos tenido acceso nos han permitido obtener datos inéditos sobre el ceremonial funerario, las manifestaciones de duelo y el volumen de gastos al que tuvieron que hacer frente los concejos de Córdoba y Sevilla para despedir, como la ocasión merecía, al príncipe heredero.   The purpose of this paper is to study the circumstances of the death of prince Juan, the post mortem rites and the funeral ceremonies that took place in Cordoba and Seville. In addition, we have analysed how the first years of his life and adolescence may have taken place, since the testimonies consulted reveal a fragile health that probably could have determined his early death. The numerous sources to which we have had access allowed us to obtain unpublished information on the funerary ceremonial, the demonstrations of mourning and the level of expenditure that was assumed by the councils of Cordoba and Seville to pay their last respects to the heir prince.

ITER site selection studies in Spain

International Nuclear Information System (INIS)

Medrano, M.; Alejaldre, C.; Doncel, J.; Garcia, A.; Ibarra, A.; Jimenez, J.A.; Sanchez de Mora, M.A.; Alcala, F.; Diez, J.E.; Dominguez, M.; Albisu, F.

2003-01-01

The studies carried out to evaluate and select a candidate site for International Thermonuclear Experimental Reactor (ITER) construction in Spain are presented in this paper. The ITER design, completed in July 2001, considered a number of technical requirements that must be fulfilled by the selected site. Several assumptions concerning the ITER site were made in order to carry on the design before final site selection. In the studies undertaken for ITER site selection in Spain, the referred technical requirements and assumptions were applied across the whole of Spain and two areas were identified as being preferential. These areas are on the Mediterranean coast and are situated in the Catalan and Valencian regions. A comparative evaluation based on technical characteristics for the concrete plots, proposed within the preferential areas, has been done. The result of these studies was the selection of a site that was deemed to be the most competitive--Vandellos (Tarragona)--and it was proposed to the European Commission for detailed studies in order to be considered as a possible European site for ITER construction. Another key factor for hosting ITER in Spain, is the licensing process. The present status is summarised in this paper

A Note on the Lithuanian 2nd Sg. Ending "-ai."

Science.gov (United States)

Schmalstieg, William R.

1980-01-01

Discusses an attempt by Chr. S. Stang to establish a proto-Lithuanian present paradigm for the verb "megti" (to like), questioning the existence of the second singular form "-ai." Argues that the few examples of this form, all from a single Bible translation source, afford shaky support for its existence. (Executive Office of the AABS, 231 Miller…

Açai (Euterpe oleracea Mart. Upregulates Paraoxonase 1 Gene Expression and Activity with Concomitant Reduction of Hepatic Steatosis in High-Fat Diet-Fed Rats

Directory of Open Access Journals (Sweden)

Renata Rebeca Pereira

2016-01-01

Full Text Available Açai (Euterpe oleracea Mart., a fruit from the Amazon region, has emerged as a promising source of polyphenols. Açai consumption has been increasing owing to ascribed health benefits and antioxidant properties; however, its effects on hepatic injury are limited. In this study, we evaluated the antioxidant effect of filtered açai pulp on the expression of paraoxonase (PON isoforms and PON1 activity in rats with nonalcoholic fatty liver disease (NAFLD. The rats were fed a standard AIN-93M (control diet or a high-fat (HF diet containing 25% soy oil and 1% cholesterol with or without açai pulp (2 g/day for 6 weeks. Our results show that açai pulp prevented low-density lipoprotein (LDL oxidation, increased serum and hepatic PON1 activity, and upregulated the expression of PON1 and ApoA-I in the liver. In HF diet-fed rats, treatment with açai pulp attenuated liver damage, reducing fat infiltration and triglyceride (TG content. In rats receiving açai, increased serum PON1 activity was correlated with a reduction in hepatic steatosis and hepatic injury. These findings suggest the use of açai as a potential therapy for liver injuries, supporting the idea that dietary antioxidants are a promising approach to enhance the defensive systems against oxidative stress.

Spain succeeds on the PWR learning curve

International Nuclear Information System (INIS)

Varley, J.

1982-01-01

The development of nuclear power in Spain is described. Although the programme has been delayed and cut back, success has been achieved in carrying out technology transfer. Spain now has an industry capable of exporting nuclear components, equipment and expertise. An architect-engineering capability has also developed. (U.K.)

Transparency and Good Governance in Spain

Directory of Open Access Journals (Sweden)

Catalina Larach

2015-06-01

Full Text Available Nowadays, transparency and Governance are relevant for Spain. Especially, for the dissatisfied citizenship and the weakness in national and local institutions over the last few years, with results like not trusting, less guarantee on healthcare and education system, the corruption in public administration, politics-economic issues, and so on. Although, in the European Union, Spain has been one of the last countries to regulate this issue, whit Act 19/2013 there are new objectives relating to open government, citizenship, technology, accountability. Moreover in relation with the structure of administration because the “commission for transparency and good governance” was initiated on last 19th January. In general, its effectiveness in moderating this issue and applying measures in order to get administration systems cleaner in countries like Spain.

Regulation of Yersina pestis Virulence by AI-2 Mediated Quorum Sensing

Energy Technology Data Exchange (ETDEWEB)

Segelke, B; Hok, S; Lao, V; Corzett, M; Garcia, E

2010-03-29

The proposed research was motivated by an interest in understanding Y. pestis virulence mechanisms and bacteria cell-cell communication. It is expected that a greater understanding of virulence mechanisms will ultimately lead to biothreat countermeasures and novel therapeutics. Y. pestis is the etiological agent of plague, the most devastating disease in human history. Y. pestis infection has a high mortality rate and a short incubation before mortality. There is no widely available and effective vaccine for Y. pestis and multi-drug resistant strains are emerging. Y. pestis is a recognized biothreat agent based on the wide distribution of the bacteria in research laboratories around the world and on the knowledge that methods exist to produce and aerosolize large amounts of bacteria. We hypothesized that cell-cell communication via signaling molecules, or quorum sensing, by Y. pestis is important for the regulation of virulence factor gene expression during host invasion, though a causative link had never been established. Quorum sensing is a mode of intercellular communication which enables orchestration of gene expression for many bacteria as a function of population density and available evidence suggests there may be a link between quorum sensing and regulation of Y. pesits virulence. Several pathogenic bacteria have been shown to regulate expression of virulence factor genes, including genes encoding type III secretion, via quorum sensing. The Y. pestis genome encodes several cell-cell signaling pathways and the interaction of at least three of these are thought to be involved in one or more modes of host invasion. Furthermore, Y. pestis gene expression array studies carried out at LLNL have established a correlation between expression of known virulence factors and genes involved in processing of the AI-2 quorum sensing signal. This was a basic research project that was intended to provide new insights into bacterial intercellular communication and how it is

AI AND SAR APPROACHES FOR PREDICTING CHEMICAL CARCINOGENICITY: SURVEY AND STATUS REPORT

Science.gov (United States)

A wide variety of artificial intelligence (AI) and structure-activity relationship (SAR approaches have been applied to tackling the general problem of predicting rodent chemical carcinogenicity. Given the diversity of chemical structures and mechanisms relative to this endpoin...

New progress of FEM simulation and AI application in rolling at RAL

International Nuclear Information System (INIS)

Liu Xianghua; Wang Guodong; Zhao Kun

2000-01-01

New progresses on FEM simulation and AI application in rolling have been achieved at RAL recently. The existence and uniqueness of the extreme point of total functional for rolling problem has been proved. Different rolling processes, such as H-beam rolling, ribbing strip rolling, slab sizing, have been solved by our in-house FEM software package. The simulation results have been put into production use to improve the precision of math models. The Artificial Neural Network has been used to predict rolling force, coiling temperature, microstructure and properties of the rolled products. An expert system for deviation diagnoses of strip thickness has been developed for industry use. Synergetic Artificial Intelligence has also been applied to rolling scheduling. We are making continuous efforts to develop AI applications for rolling line co-operating in China steel industry. (author)

Light pollution in Spain 2010

Science.gov (United States)

Sánchez de Miguel, A.; Zamorano, J.; Pila-Díez, B.; Rubio, J.; Ruiz, R.; Rodríguez-Herranz, I.; González-Pérez, A.

2011-11-01

The most recent data on electricity consumption for public lighting inSpain is presented and compared with light pollution measurements asderived from night satellite imagery. NOAA-MSP images (low-resolution)and higher resolution images obtained with conventional DSLR cameras on board the International Space Station (ISS) have been used.We show that the data can be related to night sky brightness maps with a study conducted within the Comunidad Autónoma de Madrid. Weintend to extend our work to the rest of Spain through tight collaborationwith amateur astronomers.

S&T converging trends in dealing with disaster: A review on AI tools

International Nuclear Information System (INIS)

Hasan, Abu Bakar; Isa, Mohd Hafez Mohd.

2016-01-01

Science and Technology (S&T) has been able to help mankind to solve or minimize problems when arise. Different methodologies, techniques and tools were developed or used for specific cases by researchers, engineers, scientists throughout the world, and numerous papers and articles have been written by them. Nine selected cases such as flash flood, earthquakes, workplace accident, fault in aircraft industry, seismic vulnerability, disaster mitigation and management, and early fault detection in nuclear industry have been studied. This paper looked at those cases, and their results showed nearly 60% uses artificial intelligence (AI) as a tool. This paper also did some review that will help young researchers in deciding the types of AI tools to be selected; thus proving the future trends in S&T

S&T converging trends in dealing with disaster: A review on AI tools

Science.gov (United States)

Hasan, Abu Bakar; Isa, Mohd. Hafez Mohd.

2016-01-01

Science and Technology (S&T) has been able to help mankind to solve or minimize problems when arise. Different methodologies, techniques and tools were developed or used for specific cases by researchers, engineers, scientists throughout the world, and numerous papers and articles have been written by them. Nine selected cases such as flash flood, earthquakes, workplace accident, fault in aircraft industry, seismic vulnerability, disaster mitigation and management, and early fault detection in nuclear industry have been studied. This paper looked at those cases, and their results showed nearly 60% uses artificial intelligence (AI) as a tool. This paper also did some review that will help young researchers in deciding the types of AI tools to be selected; thus proving the future trends in S&T.

S&T converging trends in dealing with disaster: A review on AI tools

Energy Technology Data Exchange (ETDEWEB)

Hasan, Abu Bakar, E-mail: abakarh@usim.edu.my; Isa, Mohd Hafez Mohd. [Faculty of Science and Technology, Universiti Sains Islam Malaysia, 71800 Nilai, Negeri Sembilan (Malaysia)

2016-01-22

Science and Technology (S&T) has been able to help mankind to solve or minimize problems when arise. Different methodologies, techniques and tools were developed or used for specific cases by researchers, engineers, scientists throughout the world, and numerous papers and articles have been written by them. Nine selected cases such as flash flood, earthquakes, workplace accident, fault in aircraft industry, seismic vulnerability, disaster mitigation and management, and early fault detection in nuclear industry have been studied. This paper looked at those cases, and their results showed nearly 60% uses artificial intelligence (AI) as a tool. This paper also did some review that will help young researchers in deciding the types of AI tools to be selected; thus proving the future trends in S&T.

78 FR 32184 - Importation of Fresh Apricots From Continental Spain

Science.gov (United States)

2013-05-29

.... APHIS-2011-0132] RIN 0579-AD62 Importation of Fresh Apricots From Continental Spain AGENCY: Animal and... United States of fresh apricots from continental Spain. This action will allow interested persons... importation of fruits and vegetables to allow the importation of fresh apricots from continental Spain into...

142 Perspective Actionelle Visa-a-Vis L'enseignement du Français ...

African Journals Online (AJOL)

NGOZI

29 avr. 2010 ... Français Langue Entrangele au Nigeria : Problem et. Vision. Scholastica .... La langue est conçue comme un instrument de communication et ... langue est un outil fournissant une base commune pour l'enseignement et ...

Des résumés en français

Directory of Open Access Journals (Sweden)

Bogdan Patrut

2010-09-01

Full Text Available Des résumés en français
BRAIN. Broad Research in Artificial Intelligence and Neuroscience
CERVEAU. Recherche large en intelligence artificielle et neurosciences
Volume 1, Numéro 4
Juillet 2010: « Automne 2010»
www.brain.edusoft.ro
Sous la direction de: Bogdan Pătruţ

Les Pronoms Personnels de Troisième Personne en Français et en Italien

Directory of Open Access Journals (Sweden)

Samuel Bidaud

2015-01-01

Full Text Available Nous étudions dans cet article les pronoms personnels de troisième personne du français et de l'italien dans une perspective psychomécanique. Nous commencerons par voir que les pronoms personnels de troisième personne peuvent être sémiologiquement identiques à des déterminants et qu'ils viennent après ces derniers dans l'idéogénèse, puis nous situerons les pronoms personnels de troisième personne par rapport aux pronoms personnels de première et de deuxième personne, et nous verrons que les pronoms personnels de troisième personne peuvent appartenir au plan nominal ou au plan verbal. Nous étudierons ensuite de façon détaillée les pronoms personnels de troisième personne du français et de l'italien, et nous nous intéresserons plus particulièrement aux pronoms français y et italien ci dans une dernière partie.

Increased intra-abdominal fat may lower HDL levels by increasing the fractional catabolic rate of Lp A-I in postmenopausal women.

Science.gov (United States)

Vajo, Zoltan; Terry, James G; Brinton, Eliot A

2002-02-01

High-density lipoprotein (HDL) particles without apolipoprotein A-II (Lp A-I) may be more anti-atherogenic than HDL with apo A-II (Lp A-I/AII) and Lp A-I is reported selectively to be reduced in cases of intra-abdominal obesity. We explored the mechanisms of this reduction by studying the turnover of Lp A-I and Lp A-I/A-II in postmenopausal women well characterized for total body, regional and sub-regional adiposity by body mass index (BMI), truncal girth ratio, and abdominal magnetic resonance imaging (MRI), respectively. We tested for possible cause-effect relationships by measuring inter-correlations among these variables. Intra-abdominal fat area correlated strongly and positively with the fractional catabolic rate (FCR) of Lp A-I (r=0.98, P=0.003). Intra-abdominal fat only showed a non-significant trend toward correlation with the FCR of Lp A-I/A-II (r=0.84, P=0.07), and had no correlation with the production or transport rate (TR) of either Lp A-I or Lp A-I/A-II (r=0.48 and 0.02, respectively, P>0.1). Subjects were studied both with and without estrogen replacement, allowing exploration of a possible interaction of adiposity with estrogen effects on HDL turnover. Response of HDL turnover to estrogen did not correlate with adiposity, except for a parameter of waist to hip ratio (WHR), which predicted the increase in LP A-I TR with estrogen (r=0.84, P=0.04). We conclude that intra-abdominal fat may lower HDL levels by increasing the FCR of Lp A-I, suggesting a mechanism by which central adiposity may be proatherogenic.

How to improve aesthetics in patients with Adolescent Idiopathic Scoliosis (AIS: a SPoRT brace treatment according to SOSORT management criteria

Directory of Open Access Journals (Sweden)

Fusco Claudia

2009-09-01

Full Text Available Abstract Background Aesthetics is a main goal of both conservative and surgical treatments in adolescent idiopathic scoliosis (AIS. Previously, we developed and validated a clinical scale - the Aesthetic Index (AI--in order to measure aesthetic impairment and changes during treatment. Aim To verify the efficacy of bracing on aesthetics in AIS. Study Design Prospective Cohort Study. Population Thirty-four consecutive patients, age 13.2 ± 3.7, initial Cobb Angle 32 ± 12°, ATR 10 ± 4° Bunnel, 11 males. Methods Patients with AI scores of at least 5/6 were included. Each of them had a brace prescription (18 to 23 hours per day, according to the SPoRT concept. AI was measured again after six months and at the end of treatment, and then the pre- and post-treatment scores compared. The Wilcoxon test was performed. Results Twenty-nine patients out of the 34 included completed the treatment and had six-month and final results; four patients were lost during the treatment, and one was fused. At baseline, median AI was 6 (95% IC 5-6 but the score decreased to 3 (95% IC 0-5; p Conclusion Aesthetics can be improved in a clinically significant way when the brace treatment is performed according to the SPoRT concept and by following the SOSORT management criteria. This is a relevant result for patients and a major goal of scoliosis treatment, be it conservative or surgical. The use of a more sensitive tool like TRACE could more easily detect the clinical changes; nevertheless, AI proved sensible enough that its use in everyday clinical practice can be suggested.

STAR - A computer language for hybrid AI applications

Science.gov (United States)

Borchardt, G. C.

1986-01-01

Constructing Artificial Intelligence application systems which rely on both symbolic and non-symbolic processing places heavy demands on the communication of data between dissimilar languages. This paper describes STAR (Simple Tool for Automated Reasoning), a computer language for the development of AI application systems which supports the transfer of data structures between a symbolic level and a non-symbolic level defined in languages such as FORTRAN, C and PASCAL. The organization of STAR is presented, followed by the description of an application involving STAR in the interpretation of airborne imaging spectrometer data.

How AI turned the chess world upside down

KAUST Repository

Polgar, Susan

2018-01-22

Man vs. Machine! In 1977 an IBM supercomputer \\'Deep Blue\\' beat the reigning World Chess Champion Gary Kasparov in a 6 game chess match played under tournament conditions. This was the first time a machine beat a human at chess. It symbolized the emergence of Artificial Intelligence (AI) and the potential for great good (and great harm) from machines that have aspects of human intelligence. During this lecture Susan Polgar, a pioneer for Women in Chess, will share her remarkable story as well as how technology has changed the world of chess.

Beyond AI: Artificial Dreams Conference

CERN Document Server

Zackova, Eva; Kelemen, Jozef; Beyond Artificial Intelligence : The Disappearing Human-Machine Divide

2015-01-01

This book is an edited collection of chapters based on the papers presented at the conference “Beyond AI: Artificial Dreams” held in Pilsen in November 2012. The aim of the conference was to question deep-rooted ideas of artificial intelligence and cast critical reflection on methods standing at its foundations.  Artificial Dreams epitomize our controversial quest for non-biological intelligence, and therefore the contributors of this book tried to fully exploit such a controversy in their respective chapters, which resulted in an interdisciplinary dialogue between experts from engineering, natural sciences and humanities.   While pursuing the Artificial Dreams, it has become clear that it is still more and more difficult to draw a clear divide between human and machine. And therefore this book tries to portrait such an image of what lies beyond artificial intelligence: we can see the disappearing human-machine divide, a very important phenomenon of nowadays technological society, the phenomenon which i...

The Effect of T'ai Chi Exercise on Lipid Profiles: A Systematic Review and Meta-Analysis of Randomized Clinical Trials.

Science.gov (United States)

Alenazi, Aqeel M; Alshehri, Mohammed M; Hoover, Jeffrey C; Yabroudi, Mohammad A; Kachanathu, Shaji John; Liu, Wen

2018-03-01

Cardiovascular disease is a common health problem resulting from many factors, including dyslipidemia. T'ai chi is one of the interventions assigned to improve lipid profiles and other physical outcomes. However, conflicting results might be attributed to different study designs and interventional approaches. A systematic review and meta-analysis are needed to evaluate existing evidence. The aim of this systematic review and meta-analysis is to evaluate existing randomized clinical trials (RCTs) regarding the overall effect of t'ai chi exercise on lipid profiles. Electronic databases (MEDLINE and Cumulative Index to Nursing and Allied Health Literature) were searched. The authors included only English peer reviewed published RCTs that used a t'ai chi intervention and high-density lipoprotein cholesterol (HDL-C) as the primary outcome along with low-density lipoprotein cholesterol (LDL-C) and/or total cholesterol (TC) as secondary outcomes. The authors identified 37 potentially eligible studies. Only eight RCTs were eligible for their qualitative review, and seven studies were eligible for meta-analysis. The included studies were rated as having a low risk of bias. Despite the overall low risk of bias, all studies failed to blind participants to group assignment and were generally unclear about whether they were selectively reporting data. A fixed effect model (I 2  = 38.16%) demonstrated a small positive effect of t'ai chi on HDL-C (Cohen d = 0.12; standard error [SE] = 0.067; p = 0.037). A random effect model demonstrated a medium effect and small effect for LDL-C (Cohen d = 0.47; SE = 0.347; p = 0.089) and TC (Cohen d = 0.34; SE = 0.225; p = 0.066), respectively. T'ai chi may potentially be beneficial on lipid profiles across different age groups and populations. Although there were conflicting results regarding the effect of t'ai chi on lipid profiles, the majority of studies had at least a small positive effect indicating

Economic crisis and nursing in Spain.

Science.gov (United States)

Zabalegui, Adelaida; Cabrera, Esther

2010-07-01

The purpose of the present study is to describe the economic context in Spain and its impact on the health care sector and in nursing schools. The global economic crisis is affecting nursing in Spain. This study analyses and compares indicators related to health care and nursing schools among European countries. Some new strategies to cope with the challenges arising from the health care crisis are suggested. Health care costs are increasing as a result of the ageing of the Spanish population, immigration, chronicity of health problems and new medical technology. Nursing education has changed in 2010 from a 3-year diploma programme to a 4-year University degree in Nursing. This change requires new resources involving staff, facilities and equipment, all of which are lacking because of the economic crisis in Spain. The worldwide economic crisis has affected Spain more than it has other European Union (EU) countries. This global crisis has an impact on the health care sector as well on nursing schools. It is essential for nursing management to develop creative approaches to maintain cost effective patient care. New programmes and technology must be carefully evaluated in terms of cost effectiveness before being implemented. All health care professionals should be well informed and have a solid understanding of this situation.

Pathologies of AI: Responsible use of artificial intelligence in professional work

NARCIS (Netherlands)

Stamper, R.K.

1988-01-01

Although the AI paradigm is useful for building knowledge-based systems for the applied natural sciences, there are dangers when it is extended into the domains of business, law and other social systems. It is misleading to treat knowledge as a commodity that can be separated from the context in

ReACT!: An Interactive Educational Tool for AI Planning for Robotics

Science.gov (United States)

Dogmus, Zeynep; Erdem, Esra; Patogulu, Volkan

2015-01-01

This paper presents ReAct!, an interactive educational tool for artificial intelligence (AI) planning for robotics. ReAct! enables students to describe robots' actions and change in dynamic domains without first having to know about the syntactic and semantic details of the underlying formalism, and to solve planning problems using…

Studies on Anti-Hepatoma Effect of Gan-Ai-Xiao Decoction | Yuan ...

African Journals Online (AJOL)

Purpose: To explore the anti-hepatoma effect of Gan-Ai-Xiao Decoction (GAXD), a folk remedy. Methods: High performance liquid chromatography (HPLC) was used to identify the major chemical components of GAXD ethanol extract (EE). The cytotoxic effect of GAXD EE against HepG2 cells was measured by methyl ...

University Teacher’s Evaluation in Spain

Directory of Open Access Journals (Sweden)

Francisco Javier Tejedor Tejedor

2008-08-01

Full Text Available This article intends to make a brief overview about the performance evaluation for university teachers in democratic Spain. It contents: a considerations about teaching evaluation, in order to delimit the authors’ position in this matter, due to the fact that this position obviously conditions any revision; b a brief summary of the history of university teachers evaluation in Spain during the last years, since the Spanish Constitution of 1978 approval; c a typology of the evaluation plans, in order to define a map of the planning lines for evaluations applied in Spain; d the technical guidelines for teachers´ evaluation and presentation of the current model, exampled by its application in the university of Salamanca; and e as a conclusion, some considerations about the consequences of evaluation and its entailment with the professionalization of university teachers.

Comparing response options for the International Outcome Inventory for Hearing Aids (IOI-HA) and for Alternative Interventions (IOI-AI) daily-use items.

Science.gov (United States)

Laplante-Lévesque, Ariane; Hickson, Louise; Worrall, Linda

2012-10-01

This study investigated how clients quantify use of hearing rehabilitation. Comparisons focused on the daily-use item of the International Outcome Inventory for Hearing Aids (IOI-HA), and for Alternative Interventions (IOI-AI). Adults with hearing impairment completed the original versions of the IOI-HA and the IOI-AI daily-use item which has five numerical response options (e.g. 1-4 hours/day) and a modified version with five word response options (e.g. 'Sometimes'). Respondents completed both IOI versions immediately after intervention completion and three months later. In total, 64 people who had obtained hearing aids completed both IOI-HA versions and 27 people who had participated in communication programs completed both IOI-AI versions. Participants reported higher scores on the modified (word) daily-use item than on the original (number) daily-use item. Participants who completed the IOI-AI did so significantly more than participants who completed the IOI-HA. This was true both after intervention completion and three months later. This study showed that comparisons between IOI-HA and IOI-AI daily-use item scores should be made with caution. Word daily-use response options are recommended for the IOI-AI (i.e. Never; Rarely; Sometimes; Often; and Almost always).

[Nuclear medicine in Spain: high technology 2013].

Science.gov (United States)

Soriano Castrejón, A M; Prats Rivera, E; Alonso Farto, J C; Vallejo Casas, J A; Rodriguez Gasen, A; Setoain Perego, J; Arbizu Lostao, J

2014-01-01

This article details the high technology equipment in Spain obtained through a survey sent to the three main provider companies of equipment installed in Spain. The geographical distribution of high technology by Autonomous Communities and its antiquity have been analyzed. Copyright © 2014 Elsevier España, S.L.U. y SEMNIM. All rights reserved.

Construction industry accidents in Spain.

Science.gov (United States)

Camino López, Miguel A; Ritzel, Dale O; Fontaneda, Ignacio; González Alcantara, Oscar J

2008-01-01

This paper analyzed industrial accidents that take place on construction sites and their severity. Eighteen variables were studied. We analyzed the influence of each of these with respect to the severity and fatality of the accident. This descriptive analysis was grounded in 1,630,452 accidents, representing the total number of accidents suffered by workers in the construction sector in Spain over the period 1990-2000. It was shown that age, type of contract, time of accident, length of service in the company, company size, day of the week, and the remainder of the variables under analysis influenced the seriousness of the accident. IMPACT ON INJURY PREVENTION: The results obtained show that different training was needed, depending on the severity of accidents, for different age, length of service in the company, organization of work, and time when workers work. The research provides an insight to the likely causes of construction injuries in Spain. As a result of the analysis, industries and governmental agencies in Spain can start to provide appropriate strategies and training to the construction workers.

les causes de l'abandon de l'etude du français en form deux au kenya

African Journals Online (AJOL)

Frederick Iraki

réserver ou fixer un rendez vous qui n'est pas agréable et facile dans la culture kenyane. L'Ambassade de France au Kenya a aussi été mentionnée, pour souligner qu'elle a arrêté des bourses et des supports linguistiques surtout pour les professeurs de français et les étudiants de français à l'université. Ils pensent que ...

Implementation of the new maintenance rule in Spain

International Nuclear Information System (INIS)

Coello, A. L.; Gerez, L.

2000-01-01

The maintenance rule involving a change in philosophy both for the facilities and regulations has been implemented in Spain nuclear power plants as from April 1st this year. The authors describe this rule and detail its fulfillment in Spain. (Author)

Companion Cognitive Systems: A Step toward Human-Level AI

OpenAIRE

Forbus, Kenneth D.; Hinrichs, Thomas R.

2006-01-01

We are developing Companion Cognitive Systems, a new kind of software that can be effectively treated as a collaborator. Aside from their potential utility, we believe this effort is important because it focuses on three key problems that must be solved to achieve human-level AI: Robust reasoning and learning, interactivity, and longevity. We describe the ideas we are using to develop the first architecture for Companions: analogical processing, grounded in cognitive science for reasoning and...

Artificial intelligence (AI) systems for interpreting complex medical datasets.

Science.gov (United States)

Altman, R B

2017-05-01

Advances in machine intelligence have created powerful capabilities in algorithms that find hidden patterns in data, classify objects based on their measured characteristics, and associate similar patients/diseases/drugs based on common features. However, artificial intelligence (AI) applications in medical data have several technical challenges: complex and heterogeneous datasets, noisy medical datasets, and explaining their output to users. There are also social challenges related to intellectual property, data provenance, regulatory issues, economics, and liability. © 2017 ASCPT.

Naissance d’une notion. La première réception du film d’art français en Italie

OpenAIRE

Alovisio, Silvio

2011-01-01

L’auteur propose une première exploration des discours relatifs au film d’art français dans la presse cinématographique italienne entre 1908 et 1912. Non seulement la réception des premiers films d’art français en Italie influence le développement de nouvelles stratégies de promotion des produits de l’industrie cinématographique, mais elle contribue aussi à l’émergence d’un discours critique jusqu’alors superficiel, en plaçant au centre la question de l’acteur. Le film d’art français offre en...

Feeding Supplementation And Radioimmunoassay (RIA) Technique For The Improvement Of artificial Insemination (AI) Efficiency

International Nuclear Information System (INIS)

Tjiptosumirat, Totti; Supandi, Dadang; Firsoni

2002-01-01

Recent research activities have showed that RIA techniques may be use as a tool in the improvement of dairy cattle AI in . Cisurupan district, Garut. Although already indicate in the previous research, with a small number of dairy cattle tested, a more in depth study on the utilization of RIA for the improvement of AI efficiency is still required. It is indicated from the previous experiment results that administration of feeding supplementation might improved the efficiency of reproductive performance of dairy cattle. The current Study is a continuation from the previous study with a larger number of dairy cattle and wider area covered. The experiment is aimed to monitor the impact of feeding supplementation on the reproductive performance of dairy cattle using Artificial Insemination Database Application (AIDA) and RIA technique. Result from this study indicated that feeding supplementation improved conception rate between pre-supplemented and post-supplemented dairy cattle; 25% vs 40%, respectively, therefore improve ratio of Service per Conception of 4.0 vs 2.3, respectively for pre-supplemented and post-supplemented dairy cattle. Result of this experiment also showed that RIA might be use as an effective tool in monitoring the early failure of AI compared to if just relying on the conventional method, the rectal palpation. However, due to an increase in milk production as a result of feeding supplementation, tanners tend to lengthen the lactation period from 10.20 ± 0.5 months to 11.8 ± 0.6 months, respectively in dairy cattle pre-supplemented and post-supplemented. It can be conclude from this study that supplementation feeding improve reproductive performance. However, even AIDA and RIA may be of effective tool in monitoring the reproductive performance of dairy cattle, as an holistic approach for an improvement dairy farm management is still required due to other factors play important role for AI efficiency

Balzac peint les français: social satire and construction of ideal types in Les français peints par eux-mêmes.

Directory of Open Access Journals (Sweden)

Marilisa Moccia

2017-02-01

Full Text Available Tra il 1840 e il 1842, negli stessi anni in cui prendeva forma quella che sarà di lì a poco la Comédie Humaine, furono dati alle stampe nove volumi dell’opera Les Français peints par eux-mêmes, pubblicata da Léon Curmer. L’opera vide la collaborazione di disegnatori e scrittori fra i quali Honoré de Balzac che contribuì al progetto scrivendo due voci l’épicier e la femme comme il faut. Les Français peints par eux-mêmes, definito nel sottotitolo Encyclopédie morale du XIXe siècle, è uno dei maggiori esempi di «letteratura panoramica», come ebbe a definirla Walter Benjamin (Benjamin 1979, e vi si mescolano caricatura e determinismo fisiologico impiegati per ritrarre, e non semplicemente descrivere, i tipi umani e sociali che popolano Parigi e la Provincia. L’introduzione di Léon Curmer e Jules Janin colloca il progetto globale dell’opera sotto l’etichetta di «tableau», già utilizzata da Louis-Sébastien Mercier (Mercier 1782, della società contemporanea messa al servizio della storia dei costumi. Da un lato, il dispositivo umoristico dell’opera scatena dall’idea di classificare gli uomini, svuotati della loro soggettività e degradati a tipi sociali, al pari delle specie animali e vegetali, ricalcando e “scoronando”, dunque, l’intento normalizzante dell’Enciclopedia dei lumi. Per questo motivo, la mise en page (ogni voce dell’opera è strutturata in type, tête de page, cul de lampe, contribuisce a creare un transtesto (Genette 1997, che stringe l’occhio al lettore del tempo, nutrito dalle opere di Buffon e Cuvier.  Dall’altro, però, l’intento dichiaratamente “serio” dell’opera che deve occuparsi di spiegare, con intento pedagogico e attraverso l’escamotage dell’autoritratto, i francesi ai Francesi, suggerisce una seconda ipotesi: la società tutta è risibile perché ridicola è la borghesia del regno di Luigi Filippo. Il contributo si propone di indagare il tipo di satira che

Anthropometric Status and Nutritional Intake in Children (6-9 Years) in Valencia (Spain): The ANIVA Study.

Science.gov (United States)

Morales-Suárez-Varela, María; Rubio-López, Nuria; Ruso, Candelaria; Llopis-Gonzalez, Agustín; Ruiz-Rojo, Elías; Redondo, Maximino; Pico, Yolanda

2015-12-18

The aim of our study was to assess nutritional intake and anthropometric statuses in schoolchildren to subsequently determine nutritional adequacy with Spanish Dietary Reference Intake (DRIs). The ANIVA study, a descriptive cross-sectional study, was conducted in 710 schoolchildren (6-9 years) in 2013-2014 in Valencia (Spain). Children's dietary intake was measured using 3-day food records, completed by parents. Anthropometric measures (weight and height) were measured according to international standards, and BMI-for-age was calculated and converted into z-scores by WHO-Anthro for age and sex. Nutrient adequacy was assessed using DRI based on estimated average requirement (EAR) or adequate intake (AI). Pearson's chi-square and Student's t-test were employed. Of our study group (47.61% boys, 52.39% girls), 53.1% were normoweight and the weight of 46.9% was inadequate; of these, 38.6% had excess body weight (19.6% overweight and 19.0% obesity). We found intakes were lower for biotin, fiber, fluoride, vitamin D (p nutritional adequacy to Spanish recommendations in overweight children. Our findings suggest that nutritional intervention and educational strategies are needed to promote healthy eating in these children and nutritional adequacies.

Costs, outcomes and challenges for diabetes care in Spain

OpenAIRE

Lopez-Bastida, Julio; Boronat, Mauro; Moreno, Juan Oliva; Schurer, Willemien

2013-01-01

Background Diabetes is becoming of increasing concern in Spain due to rising incidence and prevalence, although little information is known with regards to costs and outcomes. The information on cost of diabetes in Spain is fragmented and outdated. Our objective is to update diabetes costs, and to identify outcomes and quality of care of diabetes in Spain. Methods We performed systematic searches from secondary sources, including scientific literature and government data and reports. Results ...

Faecal glucocorticoid metabolites and body temperature in Australian merino ewes (Ovis aries) during summer artificial insemination (AI) program

Science.gov (United States)

Sawyer, Gregory; Parisella, Simone

2018-01-01

Reproductive wastage is a key issue for sheep producers, both regionally and globally. The reproductive output of farm animals can be influenced by physiological and environmental factors. Rapid and reliable quantification of physiological stress can provide a useful tool for designing and testing on-farm management interventions to improve farm animal welfare and productivity. In this study, we quantified physiological stress non-invasively using faecal glucocorticoid metabolites-FGMs analysis and body temperature measurements of 15 superovulated donor merino ewes (Ovis aries) during participation in artificial insemination (AI) program conducted during 2015/2016 Australian summer. We hypothesized that low percentage transferable embryos in donor merino ewes will be associated positively with higher body temperature and/or higher FGMs in these ewes. Temperature humidity index (THI) was calculated and found within high thermal stress range during the two AI trials. Overall, results showed none of the factors (ewe ID, AI trial no., THI or FGMs) were significant for reduced percentage transferrable embryos, except ewe body temperature was highly significant (p = 0.014). Within AI trial comparisons showed significant positive associations between higher FGMs and body temperature with reduced transferrable embryos. These results suggest that Australian merino ewes participating in summer AI trials can experience physiological stress. Prolonged activation of the stress endocrine response and high body temperature (e.g. ensued from heat stress) could impact on ewe reproductive output. Therefore, future research should apply minimally invasive physiological tools to gather baseline information on physiological stress in merino sheep to enable the development of new farm-friendly methods of managing stress. PMID:29381759

AI-2 does not function as a quorum sensing molecule in Campylobacter jejuni during exponential growth in vitro

Directory of Open Access Journals (Sweden)

Winzer Klaus

2009-10-01

Full Text Available Abstract Background Campylobacter jejuni contains a homologue of the luxS gene shown to be responsible for the production of the signalling molecule autoinducer-2 (AI-2 in Vibrio harveyi and Vibrio cholerae. The aim of this study was to determine whether AI-2 acted as a diffusible quorum sensing signal controlling C. jejuni gene expression when it is produced at high levels during mid exponential growth phase. Results AI-2 activity was produced by the parental strain NCTC 11168 when grown in rich Mueller-Hinton broth (MHB as expected, but interestingly was not present in defined Modified Eagles Medium (MEM-α. Consistent with previous studies, the luxS mutant showed comparable growth rates to the parental strain and exhibited decreased motility halos in both MEM-α and MHB. Microarray analysis of genes differentially expressed in wild type and luxS mutant strains showed that many effects on mRNA transcript abundance were dependent on the growth medium and linked to metabolic functions including methionine metabolism. Addition of exogenously produced AI-2 to the wild type and the luxS mutant, growing exponentially in either MHB or MEM-α did not induce any transcriptional changes as analysed by microarray. Conclusion Taken together these results led us to conclude that there is no evidence for the role of AI-2 in cell-to-cell communication in C. jejuni strain NCTC 11168 under the growth conditions used, and that the effects of the luxS mutation on the transcriptome are related to the consequential loss of function in the activated methyl cycle.

AI-2 does not function as a quorum sensing molecule in Campylobacter jejuni during exponential growth in vitro.

Science.gov (United States)

Holmes, Kathryn; Tavender, Tim J; Winzer, Klaus; Wells, Jerry M; Hardie, Kim R

2009-10-08

Campylobacter jejuni contains a homologue of the luxS gene shown to be responsible for the production of the signalling molecule autoinducer-2 (AI-2) in Vibrio harveyi and Vibrio cholerae. The aim of this study was to determine whether AI-2 acted as a diffusible quorum sensing signal controlling C. jejuni gene expression when it is produced at high levels during mid exponential growth phase. AI-2 activity was produced by the parental strain NCTC 11168 when grown in rich Mueller-Hinton broth (MHB) as expected, but interestingly was not present in defined Modified Eagles Medium (MEM-alpha). Consistent with previous studies, the luxS mutant showed comparable growth rates to the parental strain and exhibited decreased motility halos in both MEM-alpha and MHB. Microarray analysis of genes differentially expressed in wild type and luxS mutant strains showed that many effects on mRNA transcript abundance were dependent on the growth medium and linked to metabolic functions including methionine metabolism. Addition of exogenously produced AI-2 to the wild type and the luxS mutant, growing exponentially in either MHB or MEM-alpha did not induce any transcriptional changes as analysed by microarray. Taken together these results led us to conclude that there is no evidence for the role of AI-2 in cell-to-cell communication in C. jejuni strain NCTC 11168 under the growth conditions used, and that the effects of the luxS mutation on the transcriptome are related to the consequential loss of function in the activated methyl cycle.

Sustainable energy communities: a study contrasting Spain and Germany

International Nuclear Information System (INIS)

Romero-Rubio, Carmen; Andrés Díaz, José Ramón de

2015-01-01

In recent years, several governments and organisations in the developed world have encouraged the creation of sustainable energy communities (SECs) as a strategy for achieving their energy and environmental targets. However, whereas in some of these countries (e.g., Germany), numerous SECs have been founded, there are other countries, such as Spain, where the creation and growth of SECs has been much slower. The purpose of this article is to analyse the case of Spain, to determine the causes of the lack of SECs in this country, and to propose actions adapted to the Spanish context aimed at accelerating the creation of SECs. To facilitate these tasks, we have taken the German case as a reference. The key finding is that, in contrast to Germany, in Spain, SECs have scarcely contributed to the development of RE (Renewable energy) infrastructures, despite having similar incentives for renewable electricity (until recently). Moreover, in Spain, these incentives have been drastically cut recently. Therefore, it has become even more difficult to finance a renewable electricity generation plant. That is why strategies in sectors other than renewable electricity have been suggested for the encouragement of SECs in Spain. -- Highlights: •Collective-ownership models for RE (Renewable energy) infrastructures are very widespread in Germany. •Approximately 22% of the installed renewable electricity capacity in Germany is owned by SECs. •In contrast, collective ownership of RE infrastructures is rare in Spain. •In Spain, incentives for renewable electricity have been drastically cut recently. •To encourage SECs, energy activities other than renewable electricity production are proposed

SMARTER THAN YOUR AVERAGE SENSOR: AIS SENSOR THAT INTELLIGENTLY RE-TRANSMITS MEANINGFUL INFORMATION DERIVED FROM RAWAIS DATA IN NETWORK LIMITED AREAS

Directory of Open Access Journals (Sweden)

R. G. V. Meyer

2017-11-01

Full Text Available AIS is a transponder based, anti-collision system used by the majority of ocean traffic. Ships regularly transmit their identity, position and speed. The information used to populate the AIS fields come from ship based sensors, such as GPS, and user populated fields, such as the vessels name and MMSI number. These fields are susceptible to spoofing and can be changed to hide the identity or location of a vessel. This is often done to disguise the vessel as a different class to avoid inspections or to enter a protected area without raising alarms. The AIS system has found great utility in monitoring global shipping trends and traffic but this was never intended when the protocol was designed. Docked vessels still transmit messages regularly that contain no new information. These, and other redundant messages, are still transmitted and stored. In situations where a sensor is remote and has limited access to the Internet this can become costly. The Smart-AIS sensor records all incoming messages locally and makes a decision on whether the message is of special interest or not. Messages of interest are re-transmitted to an external AIS database.

Blue Sky Ideas in Artificial Intelligence Education from the EAAI 2017 New and Future AI Educator Program

OpenAIRE

Eaton, Eric; Koenig, Sven; Schulz, Claudia; Maurelli, Francesco; Lee, John; Eckroth, Joshua; Crowley, Mark; Freedman, Richard G.; Cardona-Rivera, Rogelio E.; Machado, Tiago; Williams, Tom

2017-01-01

The 7th Symposium on Educational Advances in Artificial Intelligence (EAAI'17, co-chaired by Sven Koenig and Eric Eaton) launched the EAAI New and Future AI Educator Program to support the training of early-career university faculty, secondary school faculty, and future educators (PhD candidates or postdocs who intend a career in academia). As part of the program, awardees were asked to address one of the following "blue sky" questions: * How could/should Artificial Intelligence (AI) courses ...

Expression of scavenger receptor‐AI promotes alternative activation of murine macrophages to limit hepatic inflammation and fibrosis

Science.gov (United States)

Labonte, Adam C.; Sung, Sun‐Sang J.; Jennelle, Lucas T.; Dandekar, Aditya P.

2016-01-01

The liver maintains an immunologically tolerant environment as a result of continuous exposure to food and bacterial constituents from the digestive tract. Hepatotropic pathogens can take advantage of this niche and establish lifelong chronic infections causing hepatic fibrosis and hepatocellular carcinoma. Macrophages (Mϕ) play a critical role in regulation of immune responses to hepatic infection and regeneration of tissue. However, the factors crucial for Mϕ in limiting hepatic inflammation or resolving liver damage have not been fully understood. In this report, we demonstrate that expression of C‐type lectin receptor scavenger receptor‐AI (SR‐AI) is crucial for promoting M2‐like Mϕ activation and polarization during hepatic inflammation. Liver Mϕ uniquely up‐regulated SR‐AI during hepatotropic viral infection and displayed increased expression of alternative Mϕ activation markers, such as YM‐1, arginase‐1, and interleukin‐10 by activation of mer receptor tyrosine kinase associated with inhibition of mammalian target of rapamycin. Expression of these molecules was reduced on Mϕ obtained from livers of infected mice deficient for the gene encoding SR‐AI (msr1). Furthermore, in vitro studies using an SR‐AI‐deficient Mϕ cell line revealed impeded M2 polarization and decreased phagocytic capacity. Direct stimulation with virus was sufficient to activate M2 gene expression in the wild‐type (WT) cell line, but not in the knockdown cell line. Importantly, tissue damage and fibrosis were exacerbated in SR‐AI–/– mice following hepatic infection and adoptive transfer of WT bone‐marrow–derived Mϕ conferred protection against fibrosis in these mice. Conclusion: SR‐AI expression on liver Mϕ promotes recovery from infection‐induced tissue damage by mediating a switch to a proresolving Mϕ polarization state. (Hepatology 2017;65:32‐43). PMID:27770558

Effects of herd origin, AI stud and sire identification on genetic evaluation of Holstein Friesian bulls

OpenAIRE

Giovanni Bittante; Paolo Carnier; Luigi Gallo Gallo; Riccardo Dal Zotto; Martino Cassandro

2010-01-01

The purpose of this study was to estimate the effects of herd origin of bull, AI stud and sire identification number (ID)  on official estimated breeding values (EBV) for production traits of Holstein Friesian proven bulls. The data included 1,005  Italian Holstein-Friesian bulls, sons of 76 sires, born in 100 herds and progeny tested by 10 AI studs. Bulls were required  to have date of first proof between September 1992 and September 1997, to be born in a herd with at least on...

Gambling in Spain: update on experience, research and policy.

Science.gov (United States)

Jiménez-Murcia, Susana; Fernández-Aranda, Fernando; Granero, Roser; Menchón, Jose Manuel

2014-10-01

To describe the current situation of gambling in Spain, sketching its history and discussing the regulations and legislation currently in force within the framework of the European Union (EU), and to review the epidemiology of gambling in Spain, the self-help groups and professional treatments available, and their potential effectiveness. A systematic computerized search was performed in three databases (EMBASE, PubMed and PsychINFO, including articles and chapters) and the reference lists from previous reviews to obtain some of the most relevant studies published up to now on the topic of pathologic gambling in Spain. Similar to other EU countries, Spain has a high prevalence of pathologic gambling, focused on specific culturally bounded types of gambling. Expenditure in online gaming has risen significantly in the last few years, prompting the Spanish government to draft new legislation to regulate gaming. The gaming industry is expected to be one of the fastest growing sectors in Spain in the coming years owing to the rise of new technologies and the development of online gaming. © 2013 Society for the Study of Addiction.

Apolipoprotein A-I configuration and cell cholesterol efflux activity of discoidal lipoproteins depend on the reconstitution process.

Science.gov (United States)

Cuellar, Luz Ángela; Prieto, Eduardo Daniel; Cabaleiro, Laura Virginia; Garda, Horacio Alberto

2014-01-01

Discoidal high-density lipoproteins (D-HDL) are critical intermediates in reverse cholesterol transport. Most of the present knowledge of D-HDL is based on studies with reconstituted lipoprotein complexes of apolipoprotein A-I (apoA-I) obtained by cholate dialysis (CD). D-HDL can also be generated by the direct microsolubilization (DM) of phospholipid vesicles at the gel/fluid phase transition temperature, a process mechanistically similar to the "in vivo" apoAI lipidation via ABCA1. We compared the apoA-I configuration in D-HDL reconstituted with dimyristoylphosphatidylcholine by both procedures using fluorescence resonance energy transfer measurements with apoA-I tryptophan mutants and fluorescently labeled cysteine mutants. Results indicate that apoA-I configuration in D-HDL depends on the reconstitution process and are consistent with a "double belt" molecular arrangement with different helix registry. As reported by others, a configuration with juxtaposition of helices 5 of each apoAI monomer (5/5 registry) predominates in D-HDL obtained by CD. However, a configuration with helix 5 of one monomer juxtaposed with helix 2 of the other (5/2 registry) would predominate in D-HDL generated by DM. Moreover, we also show that the kinetics of cholesterol efflux from macrophage cultures depends on the reconstitution process, suggesting that apoAI configuration is important for this HDL function. Copyright © 2013 Elsevier B.V. All rights reserved.

Trimerization of apolipoprotein A-I retards plasma clearance and preserves antiatherosclerotic properties

DEFF Research Database (Denmark)

Graversen, Jonas Heilskov; Laurberg, Jacob Marsvin; Andersen, Mikkel Holmen

2008-01-01

An increased plasma level of the major high-density lipoprotein (HDL) component, apolipoprotein A-I (apoA-I) is the aim of several therapeutic strategies for combating atherosclerotic disease. HDL therapy by direct intravenous administration of apoA-I is a plausible way; however, a fast renal...

The Simulation of a Major Automated Information System (AIS) on a Microcomputer

Science.gov (United States)

1984-03-01

The AIS would be selected from a public zec cor application. Rationale for this choice are: a. Many public sector organizations have a far richer...19. Boehm, Barry W. and others, Characteristics of Software Quality, North-Holland, 1978. 20. Freeman, Peter and Wasserman, Anthony I., Tutorial on

Road accidents and business cycles in Spain.

Science.gov (United States)

Rodríguez-López, Jesús; Marrero, Gustavo A; González, Rosa Marina; Leal-Linares, Teresa

2016-11-01

This paper explores the causes behind the downturn in road accidents in Spain across the last decade. Possible causes are grouped into three categories: Institutional factors (a Penalty Point System, PPS, dating from 2006), technological factors (active safety and passive safety of vehicles), and macroeconomic factors (the Great recession starting in 2008, and an increase in fuel prices during the spring of 2008). The PPS has been blessed by incumbent authorities as responsible for the decline of road fatalities in Spain. Using cointegration techniques, the GDP growth rate, the fuel price, the PPS, and technological items embedded in motor vehicles appear to be statistically significantly related with accidents. Importantly, PPS is found to be significant in reducing fatal accidents. However, PPS is not significant for non-fatal accidents. In view of these results, we conclude that road accidents in Spain are very sensitive to the business cycle, and that the PPS influenced the severity (fatality) rather than the quantity of accidents in Spain. Importantly, technological items help explain a sizable fraction in accidents downturn, their effects dating back from the end of the nineties. Copyright © 2016 Elsevier Ltd. All rights reserved.

Xiao-Ai-Ping, a TCM Injection, Enhances the Antigrowth Effects of Cisplatin on Lewis Lung Cancer Cells through Promoting the Infiltration and Function of CD8+ T Lymphocytes

Directory of Open Access Journals (Sweden)

Wanshuai Li

2013-01-01

Full Text Available Objectives. To investigate how Xiao-Ai-Ping injection, a traditional Chinese medicine and an ancillary drug in tumor treatment, enhances the antitumor effects of cisplatin on Lewis lung cancer (LLC cells. Methods. LLC-bearing mice were daily intraperitoneally injected with various doses of cisplatin, Xiao-Ai-Ping, or cisplatin plus Xiao-Ai-Ping, respectively. Body weight and tumor volumes were measured every three days. Results. Combination of Xiao-Ai-Ping and cisplatin yielded significantly better antigrowth and proapoptotic effects on LLC xenografts than sole drug treatment did. In addition, we found that Xiao-Ai-Ping triggered the infiltration of CD8+ T cells, a group of cytotoxic T cells, to LLC xenografts. Furthermore, the mRNA levels of interferon-γ (ifn-γ, perforin-1 (prf-1, and granzyme B (gzmb in CD8+ T cells were significantly increased after combination treatment of Xiao-Ai-Ping and cisplatin. In vitro studies showed that Xiao-Ai-Ping markedly upregulated the mRNA levels of ifn-γ, prf-1, and gzmb in CD8+ T cells in a concentration-dependent manner, suggesting that Xiao-Ai-Ping augments the function of CD8+ T cells. Conclusions. Xiao-Ai-Ping promotes the infiltration and function of CD8+ T cells and thus enhances the antigrowth effects of cisplatin on LLC xenografts, which provides new evidence for the combination of Xiao-Ai-Ping and cisplatin in clinic in China.

Thought–shape fusion and body image in eating disorders

Directory of Open Access Journals (Sweden)

Jáuregui-Lobera I

2012-10-01

Full Text Available Ignacio Jáuregui-Lobera,1 Patricia Bolaños-Ríos,2 Inmaculada Ruiz-Prieto21Department of Nutrition and Bromatology, Pablo de Olavide University, Seville, Spain; 2Behavioral Sciences Institute, Seville, SpainPurpose: The aim of this study was to analyze the relationships among thought–shape fusion (TSF, specific instruments to assess body image disturbances, and body image quality of life in eating disorder patients in order to improve the understanding of the links between body image concerns and a specific bias consisting of beliefs about the consequences of thinking about forbidden foods.Patients and methods: The final sample included 76 eating disorder patients (mean age 20.13 ± 2.28 years; 59 women and seven men. After having obtained informed consent, the following questionnaires were administered: Body Appreciation Scale (BAS, Body Image Quality of Life Inventory (BIQLI-SP, Body Shape Questionnaire (BSQ, Eating Disorders Inventory-2 (EDI-2, State-Trait Anxiety Inventory (STAI, Symptom Checklist-90-Revised (SCL-90-R and Thought-Shape Fusion Questionnaire (TSF-Q.Results: Significant correlations were found between TSF-Q and body image-related variables. Those with higher scores in TSF showed higher scores in the BSQ (P < 0.0001, Eating Disorder Inventory – Drive for Thinness (EDI-DT (P < 0.0001, and Eating Disorder Inventory – Body Dissatisfaction (EDI-BD (P < 0.0001. The same patients showed lower scores in the BAS (P < 0.0001. With respect to the psychopathological variables, patients with high TSF obtained higher scores in all SCL-90-R subscales as well as in the STAI.Conclusion: The current study shows the interrelations among different body image-related variables, TSF, and body image quality of life.Keywords: cognitive distortions, quality of life, body appreciation, psychopathology, anorexia nervosa, bulimia nervosa

Formal Safety Assessment (FSA for Analysis of Ship Collision Using AIS Data

Directory of Open Access Journals (Sweden)

Muhammad Badrus Zaman

2015-03-01

Full Text Available Currently, Maritime safety is the best issue in the world. International Maritime organization (IMO have recommended FSA methodology to enhance maritime safety. In this paper, the research conducted in the Malacca Strait. Malacca Strait is an area that has a high risk for shipping navigation. Many accidents occur in the area are like collision, fire, grounding and so on. Therefore a study on improving safety in this area is very important. it is to produce an output that can be used to provide input to the master and multiple stakeholders to improve safety on board at the time of sailing. In this study, AIS is used as a data source. Sea condition data collected actual traffic through the Automatic Identification System (AIS equipment installed at Kobe University, Japan, and Universiti Teknologi Malaysia (UTM in Johor, Malaysia. The data is applied to define a method with the help of Geographic Information Systems (GIS.

Optimal synthesis of four-bar steering mechanism using AIS and genetic algorithms

Energy Technology Data Exchange (ETDEWEB)

Ettefagh, Mir Mohammad; Javash, Morteza Saeidi [University of Tabriz, Tabriz (Iran, Islamic Republic of)

2014-06-15

Synthesis of four-bar Ackermann steering mechanism was considered as an optimization problem for generating the best function between input and output links. The steering mechanism was designed through two heuristic optimization methods, namely, artificial immune system (AIS) algorithm and genetic algorithm (GA). The optimization was implemented using the two methods, length was selected as optimization parameter in the first method, whereas precision point distribution was considered in the second method. Two of the links in the first method had the same length to achieve a symmetric mechanism; one of these lengths was considered as optimization parameter. Five precision points were considered in the precision point distribution method, one of which was in the straight line condition, whereas the others were symmetric. The obtained results showed that the AIS algorithm can generate the closest function to the desired function in the first method. By contrast, GA can generate the closest function to the desired function with the least error in the second method.

Superhuman AI for heads-up no-limit poker: Libratus beats top professionals.

Science.gov (United States)

Brown, Noam; Sandholm, Tuomas

2018-01-26

No-limit Texas hold'em is the most popular form of poker. Despite artificial intelligence (AI) successes in perfect-information games, the private information and massive game tree have made no-limit poker difficult to tackle. We present Libratus, an AI that, in a 120,000-hand competition, defeated four top human specialist professionals in heads-up no-limit Texas hold'em, the leading benchmark and long-standing challenge problem in imperfect-information game solving. Our game-theoretic approach features application-independent techniques: an algorithm for computing a blueprint for the overall strategy, an algorithm that fleshes out the details of the strategy for subgames that are reached during play, and a self-improver algorithm that fixes potential weaknesses that opponents have identified in the blueprint strategy. Copyright © 2018, The Authors, some rights reserved; exclusive licensee American Association for the Advancement of Science. No claim to original U.S. Government Works.

Goldfish Leptin-AI and Leptin-AII: Function and Central Mechanism in Feeding Control

Directory of Open Access Journals (Sweden)

Ai-Fen Yan

2016-05-01

Full Text Available In mammals, leptin is a peripheral satiety factor that inhibits feeding by regulating a variety of appetite-related hormones in the brain. However, most of the previous studies examining leptin in fish feeding were performed with mammalian leptins, which share very low sequence homologies with fish leptins. To elucidate the function and mechanism of endogenous fish leptins in feeding regulation, recombinant goldfish leptin-AI and leptin-AII were expressed in methylotrophic yeast and purified by immobilized metal ion affinity chromatography (IMAC. By intraperitoneal (IP injection, both leptin-AI and leptin-AII were shown to inhibit the feeding behavior and to reduce the food consumption of goldfish in 2 h. In addition, co-treatment of leptin-AI or leptin-AII could block the feeding behavior and reduce the food consumption induced by neuropeptide Y (NPY injection. High levels of leptin receptor (lepR mRNA were detected in the hypothalamus, telencephalon, optic tectum and cerebellum of the goldfish brain. The appetite inhibitory effects of leptins were mediated by downregulating the mRNA levels of orexigenic NPY, agouti-related peptide (AgRP and orexin and upregulating the mRNA levels of anorexigenic cocaine-amphetamine-regulated transcript (CART, cholecystokinin (CCK, melanin-concentrating hormone (MCH and proopiomelanocortin (POMC in different areas of the goldfish brain. Our study, as a whole, provides new insights into the functions and mechanisms of leptins in appetite control in a fish model.

Nuclear energy in Spain

International Nuclear Information System (INIS)

Isla, M.

1984-01-01

The 'Plan Energetico Nacional de 1983' (1983 National Energy Program)(PEN-83) was approved recently by the Spanish Government and presented to the 'Cortes Espanolas' (Spanish Parliament) in May 1984. The PEN-83 is being discussed at present in the Parliament and it is possible that some modifications be introduced, but expectedly will be rather limited and minor. PEN-83 covers the period 1983-1992. It includes a comparative analysis of the evolution and situation in OECD countries and in Spain. In Spain the offer, supply and consumption of primary energy and of the interrelation with other economic indicators, such as the gross domestic product, inflation rate and unemployment compared with that of the industrialized OECD countries, has shown a much lower capability to adapt its structure to the energy price increases

Inspection of nuclear fuel transport in Spain

International Nuclear Information System (INIS)

Lobo Mendez, J.

1977-01-01

The experience acquired in inspecting nuclear fuel shipments carried out in Spain will serve as a basis for establishing the regulations wich must be adhered to for future transports, as the transport of nuclear fuels in Spain will increase considerably within the next years as a result of the Spanish nuclear program. The experience acquired in nuclear fuel transport inspection is described. (author) [es

Bioinformatic Analysis of Plasma Apolipoproteins A-I and A-II Revealed Unique Features of A-I/A-II HDL Particles in Human Plasma

Science.gov (United States)

Kido, Toshimi; Kurata, Hideaki; Kondo, Kazuo; Itakura, Hiroshige; Okazaki, Mitsuyo; Urata, Takeyoshi; Yokoyama, Shinji

2016-01-01

Plasma concentration of apoA-I, apoA-II and apoA-II-unassociated apoA-I was analyzed in 314 Japanese subjects (177 males and 137 females), including one (male) homozygote and 37 (20 males and 17 females) heterozygotes of genetic CETP deficiency. ApoA-I unassociated with apoA-II markedly and linearly increased with HDL-cholesterol, while apoA-II increased only very slightly and the ratio of apoA-II-associated apoA-I to apoA-II stayed constant at 2 in molar ratio throughout the increase of HDL-cholesterol, among the wild type and heterozygous CETP deficiency. Thus, overall HDL concentration almost exclusively depends on HDL with apoA-I without apoA-II (LpAI) while concentration of HDL containing apoA-I and apoA-II (LpAI:AII) is constant having a fixed molar ratio of 2 : 1 regardless of total HDL and apoA-I concentration. Distribution of apoA-I between LpAI and LpAI:AII is consistent with a model of statistical partitioning regardless of sex and CETP genotype. The analysis also indicated that LpA-I accommodates on average 4 apoA-I molecules and has a clearance rate indistinguishable from LpAI:AII. Independent evidence indicated LpAI:A-II has a diameter 20% smaller than LpAI, consistent with a model having two apoA-I and one apoA-II. The functional contribution of these particles is to be investigated. PMID:27526664

Pharmaceutical costs of assisted reproduction in Spain.

Science.gov (United States)

Lorente, Maria-Reyes; Hernández, Juana; Antoñanzas, Fernando

2013-11-01

Assisted reproduction is one of the health services currently being considered for possible limitation or exclusion from the public health services portfolio in Spain. One of the main reasons claimed for this is the impact on the budget for pharmaceutical expenditure. The objective of this study was to assess the significance of the pharmaceutical costs of assisted reproduction in Spain. This study focused on medical practice in Spain, and is based on the opinions of experts in assisted reproduction and the results provided by professional societies' publications. The reference year is 2012 and the setting was secondary care. We have included all existing pharmaceutical modalities for assisted reproduction, as well as the most common drug for each modality. We have considered the pharmaceutical cost per cycle for artificial insemination, in vitro fertilisation with or without intracytoplasmic sperm injection (IVF_ICSI), and cryotransfer and donated fresh oocytes reception. In Spain, artificial insemination has a pharmaceutical cost per cycle of between €69.36 and €873.79. This amounts to an average cycle cost of €364.87 for partner's sperm and €327.10 for donor sperm. The pharmaceutical cost of IVF_ICSI ranges between €278.16 and €1,902.66, giving an average cost per cycle of €1,139.65. In the case of cryotransfer and donated fresh oocytes reception, the pharmaceutical cost per cycle is between €22.61 and €58.73, yielding an average cost of €40.67. The budgetary impact of pharmaceutical expenditure for assisted reproduction in Spain for the year 2012 was estimated at €98.7 million. In Spain, the total pharmaceutical cost of assisted reproduction is substantial. According to our results, we can say that about 29% of the total pharmaceutical expenditure for assisted reproduction techniques is funded by the National Health System and the rest represents 2.4% of the total annual out-of-pocket family expenditure on drugs.

THE IMPROVEMENT AND APPLICATION OF EI-GUN (ELECTRICAL INSEMINATION GUN FOR ARTIFICIAL INSEMINATION (AI USING GOAT FRESH SEMEN

Directory of Open Access Journals (Sweden)

Mirsa Ita Dewi

2017-03-01

Full Text Available Electrical Insemination Gun (EI-GUN was a tool for Artificial Insemination (AI using fresh semen with an electric control system. The research objective was to produced EI-GUN for AI using fresh semen on small ruminants (goat. The research was conducted from March to June 2015. The process of EI-GUN creation implemented in Design and Prototype Laboratory and Aero Modeling Research Laboratory at Engineering Faculty, University of Brawijaya (UB. Testing tools EI-GUN on goat was conducted in the Sumber Sekar Laboratory, Animal Husbandry Faculty, UB.  The methods of research were literature study, tool specification determination, designing EI-GUN, running test, semen evaluation passed EI-GUN and application on Goat. EI-GUN has seven important parts, which supports each other in this operating system. Those parts consist of stylet, servo, system controlled, insemination pump, connecting rod, battery, and holder. EI-GUN work system sucked the semen into insemination pump as much as 5 ml, and release the semen 0.25 ml appropriate standard of AI. It was applicable for 20 times AI. The results showed that the cell motility of spermatozoa ≥ 70% were still in ranging of Indonesian National Standard (SNI.   Keywords: artificial insemination, EI-GUN, fresh semen.

LE RACCOMANDAZIONI SERVONO? MORAL SUASION SULLA GEO-LOCALIZZAZIONE PER SERVIZI AI CITTADINI

Directory of Open Access Journals (Sweden)

Mauro Salvemini

2014-12-01

Full Text Available Con modestia, ma con determinazione AMFM GIS Italia ha inteso esercitare la suafunzione di entità non governativa elaborando nell'anno in corso nove raccomandazioni circa LA GEO-LOCALIZZAZIONE COME ELEMENTO UNIFICANTE DELLE AZIONI E DELLE INFORMAZIONI PER I SERVIZI AI CITTADINI.

Cognitive Maps, AI Agents and Personalized Virtual Environments in Internet Learning Experiences.

Science.gov (United States)

Maule, R. William

1998-01-01

Develops frameworks to help Internet media designers address end-user information presentation preferences by advancing structures for assessing metadata design variables which are then linked to user cognitive styles. An underlying theme is that artificial intelligence (AI) methodologies may be used to help automate the Internet media design…

Nonlinear study of AI Velorum

International Nuclear Information System (INIS)

Cox, A.N.; Hodson, S.W.

1979-01-01

Using results from earlier studies of double-mode dwarf Cepheids by Cox, King, and Hodson, hydrodynamic calculations were undertaken for AI Vel. The earlier derived evolution theory mass of 1.8 M sub solar, a luminosity of of 23 L sub solar and a T/sub e/ of 7500 0 K give the observed period of 0.11 day and the observed period ratio PI 1 /PI 0 = 0.773. A cooler T/sub e/ than the observed one (7620 0 K) was used because 7620 0 K is beyond the fundamental pulsation mode blue edge. The composition used is X = 0.70 Z = 0.01. This lower than normal Z is necessary to make the period ratio as large as observed. The goal is to see if double-mode behavior, due to either mode switching or a permanent state, can be predicted for the model. Progress in converging the model to a periodic pulsation solution by the von Sengbusch--Stellingwerf relaxation method will be reported. 17 references

Human serum albumin nanoparticles modified with apolipoprotein A-I cross the blood-brain barrier and enter the rodent brain.

Science.gov (United States)

Zensi, Anja; Begley, David; Pontikis, Charles; Legros, Celine; Mihoreanu, Larisa; Büchel, Claudia; Kreuter, Jörg

2010-12-01

Nanoparticles made of human serum albumin (HSA) and modified with apolipoproteins have previously been shown to transport drugs, which normally do not enter the brain, across the blood-brain barrier (BBB). However the precise mechanism by which nanoparticles with different apolipoproteins on their surface can target to the brain, as yet, has not been totally elucidated. In the present study, HSA nanoparticles with covalently bound apolipoprotein A-I (Apo A-I) as a targetor for brain capillary endothelial cells were injected intravenously into SV 129 mice and Wistar rats. The rodents were sacrificed after 15 or 30 min, and their brains were examined by transmission electron microscopy. Apo A-I nanoparticles could be found inside the endothelial cells of brain capillaries as well as within parenchymal brain tissue of both, mice and rats, whereas control particles without Apo A-I on their surface did not cross the BBB during our experiments. The maintenance of tight junction integrity and barrier function during treatment with nanoparticles was demonstrated by perfusion with a fixative containing lanthanum nitrate as an electron dense marker for the permeability of tight junctions.

Fully automatic AI-based leak detection system

Energy Technology Data Exchange (ETDEWEB)

Tylman, Wojciech; Kolczynski, Jakub [Dept. of Microelectronics and Computer Science, Technical University of Lodz in Poland, ul. Wolczanska 221/223, Lodz (Poland); Anders, George J. [Kinectrics Inc., 800 Kipling Ave., Toronto, Ontario M8Z 6C4 (Canada)

2010-09-15

This paper presents a fully automatic system intended to detect leaks of dielectric fluid in underground high-pressure, fluid-filled (HPFF) cables. The system combines a number of artificial intelligence (AI) and data processing techniques to achieve high detection capabilities for various rates of leaks, including leaks as small as 15 l per hour. The system achieves this level of precision mainly thanks to a novel auto-tuning procedure, enabling learning of the Bayesian network - the decision-making component of the system - using simulated leaks of various rates. Significant new developments extending the capabilities of the original leak detection system described in and form the basis of this paper. Tests conducted on the real-life HPFF cable system in New York City are also discussed. (author)

[Heart failure mortality in Spain: is there an andalusian paradox?].

Science.gov (United States)

Jiménez-Navarro, M; Gómez-Doblas, J; Molero, E; Galván, E de Teresa

2006-06-01

Congestive heart failure has a high mortality, as reflected in different clinical trials and observational studies. Spain, as other countries around the Mediterranean basin, have a relatively low rate of coronary deaths, attributed to the so-called Mediterranean lifestyle. Andalusia, in the southern most part of Spain, constitutes the paradigm of Mediterranean lifestyle. However, different reports show that the prevalence of ischemic heart disease is higher in Andalusia than in other zones of Spain. Thus the mortality rate due to heart failure in Spain in the year 2000 per 100,000 inhabitants was 27.3 in men and 28.88 in women and each one of the eight Andalusia provinces had greater rates than the national mean in both men and woman. Even in countries with a relatively low prevalence of coronary heart disease as is the case in Spain, heart failure mortality seems to be parallel to local differences in IHD prevalence.

Wind power development in Spain, the model of Navarra

Energy Technology Data Exchange (ETDEWEB)

Miguel Ichaso, A. de [Energia Hidroelectrica de Navarra S.A. (EHN), Pamplona (Spain)

2000-08-01

Wind power implementation in Spain has undergone spectacular growth in recent years. From 834 Megawatts installed at the end of 1998, the figure of 1,500 MW was reached at the end of 1999 and forecasts expect well over 2,500 MW by the end of the year 2000. A favourable legislative framework and tariff structure have brought about this rate of development, which is mainly based on the implementation of large wind farms on high altitude sites in Spain. The region of Navarra (northern Spain) has played a special role in this development, and EHN, a company born in this region, has carried out major projects that have given it 30% of the Spanish wind power sector. The challenges for the sector in Spain over the next few years are: (1) Make its development compatible with the supply guarantees required by the national electricity supply operator, (2) ensure that the implementation of wind farms is done with respect for the environment, (3) harmonise the wind power development of the different Autonomous Communities of Spain, and (4) reduce the investment costs in order to obtain enough profitability with falling energy prices in the coming years. (orig.)

A Comparative Evaluation of Procedural Level Generators in the Mario AI Framework

DEFF Research Database (Denmark)

Horn, Britton; Dahlskog, Steve; Shaker, Noor

dierent from another in terms of its output. To remedy this, we have conducted a large-scale comparative evaluation of level generators for the Mario AI Benchmark, a research-friendly clone of the classic platform game Super Mario Bros. In all, we compare the output of seven dierent level generators from...

Taxation of nuclear waste in Spain

OpenAIRE

Rozas Valdés, José Andrés

2014-01-01

Law 15/2012 established in Spain four new environmental taxes and extended the scope objective excise duties on mineral oils to tax the use of natural gas and coal as sources of electricity. One of the newly created taxes falls on all electric power producers, and has as tax base the turnover. The second one tax hydropower production, and the other two fall on the nuclear industry. So, there are two new taxes in Spain on the production of electricity from nuclear sources. The first one is a t...

Lack of genomic evidence of AI-2 receptors suggests a non-quorum sensing role for luxS in most bacteria.

Science.gov (United States)

Rezzonico, Fabio; Duffy, Brion

2008-09-20

Great excitement accompanied discoveries over the last decade in several Gram-negative and Gram-positive bacteria of the LuxS protein, which catalyzes production of the AI-2 autoinducer molecule for a second quorum sensing system (QS-2). Since the luxS gene was found to be widespread among the most diverse bacterial taxa, it was hypothesized that AI-2 may constitute the basis of a universal microbial language, a kind of bacterial Esperanto. Many of the studies published in this field have drawn a direct correlation between the occurrence of the luxS gene in a given organism and the presence and functionality of a QS-2 therein. However, rarely hathe existence of potential AI-2 receptors been examined. This is important, since it is now well recognized that LuxS also holds a central role as a metabolic enzyme in the activated methyl cycle which is responsible for the generation of S-adenosyl-L-methionine, the major methyl donor in the cell. In order to assess whether the role of LuxS in these bacteria is indeed related to AI-2 mediated quorum sensing we analyzed genomic databases searching for established AI-2 receptors (i.e., LuxPQ-receptor of Vibrio harveyi and Lsr ABC-transporter of Salmonella typhimurium) and other presumed QS-related proteins and compared the outcome with published results about the role of QS-2 in these organisms. An unequivocal AI-2 related behavior was restricted primarily to organisms bearing known AI-2 receptor genes, while phenotypes of luxS mutant bacteria lacking these genes could often be explained simply by assuming deficiencies in sulfur metabolism. Genomic analysis shows that while LuxPQ is restricted to Vibrionales, the Lsr-receptor complex is mainly present in pathogenic bacteria associated with endotherms. This suggests that QS-2 may play an important role in interactions with animal hosts. In most other species, however, the role of LuxS appears to be limited to metabolism, although in a few cases the presence of yet unknown

Lack of genomic evidence of AI-2 receptors suggests a non-quorum sensing role for luxS in most bacteria

Directory of Open Access Journals (Sweden)

Duffy Brion

2008-09-01

Full Text Available Abstract Background Great excitement accompanied discoveries over the last decade in several Gram-negative and Gram-positive bacteria of the LuxS protein, which catalyzes production of the AI-2 autoinducer molecule for a second quorum sensing system (QS-2. Since the luxS gene was found to be widespread among the most diverse bacterial taxa, it was hypothesized that AI-2 may constitute the basis of a universal microbial language, a kind of bacterial Esperanto. Many of the studies published in this field have drawn a direct correlation between the occurrence of the luxS gene in a given organism and the presence and functionality of a QS-2 therein. However, rarely hathe existence of potential AI-2 receptors been examined. This is important, since it is now well recognized that LuxS also holds a central role as a metabolic enzyme in the activated methyl cycle which is responsible for the generation of S-adenosyl-L-methionine, the major methyl donor in the cell. Results In order to assess whether the role of LuxS in these bacteria is indeed related to AI-2 mediated quorum sensing we analyzed genomic databases searching for established AI-2 receptors (i.e., LuxPQ-receptor of Vibrio harveyi and Lsr ABC-transporter of Salmonella typhimurium and other presumed QS-related proteins and compared the outcome with published results about the role of QS-2 in these organisms. An unequivocal AI-2 related behavior was restricted primarily to organisms bearing known AI-2 receptor genes, while phenotypes of luxS mutant bacteria lacking these genes could often be explained simply by assuming deficiencies in sulfur metabolism. Conclusion Genomic analysis shows that while LuxPQ is restricted to Vibrionales, the Lsr-receptor complex is mainly present in pathogenic bacteria associated with endotherms. This suggests that QS-2 may play an important role in interactions with animal hosts. In most other species, however, the role of LuxS appears to be limited to metabolism

Relationship between the level of physical activity and sedentary, overweight and health-related quality of life in scholar-age asthmatic children: an explanatory study in Seville

Directory of Open Access Journals (Sweden)

Alfonso Rosa, Rosa María

2012-07-01

Full Text Available The aim of this study was: 1 To determine the differences between normal-weight asthmatic children and overweight asthmatic children in terms of HRQoL and amount of physical activity and sedentary and 2 To determine the relationship between amount of physical activity, sedentary and BMI and their influence on the HRQoL of this population in Seville. Method. We used a cohort design study that included 69 school-age children with controlled persistent asthma. The measures included in the study were: the questionnaire PAQL (S, to assess the HRQoL of children and the IPAQ-A questionnaire to assess the amount of physical activity and sedentary lifestyle of children. BMI was also calculated and determined if the participant was of normal-weight or overweight. Results. Overweight children scored worse on HRQoL and IPAQ-A values than their peers with normal-weight. Positive correlations were also observed between BMI and the amount of sedentary lifestyle. Negative correlations were observed between BMI and the amount of physical activity and also negative correlations were observed between BMI and HRQoL. Conclusion. BMI negatively affect HRQoL in school- age asthmatic children

Teaching Digital Libraries in Spain: Context and Experiences

Science.gov (United States)

Garcia-Marco, Francisco-Javier

2009-01-01

The situation of digital libraries teaching and learning in Spain up to 2008 is examined. A detailed analysis of the different curricula and subjects is provided both at undergraduate and postgraduate level. Digital libraries have been mostly a postgraduate topic in Spain, but they should become mainstream, with special subjects devoted to them,…

Sex Education in Spain: Teachers' Views of Obstacles

Science.gov (United States)

Martinez, Jose L.; Carcedo, Rodrigo J.; Fuertes, Antonio; Vicario-Molina, Isabel; Fernandez-Fuertes, Andres A.; Orgaz, Begona

2012-01-01

This paper offers an overview of the current state, difficulties, limitations and future possibilities for sex education in Spain. On the basis of a study involving 3760 teachers from all provinces in Spain, a detailed analysis of the obstacles at legislative, school and teacher levels was developed. Significant weaknesses were found at each of…

Daily variation patterns of airborne allergenic pollen in southwestern Spain.

Science.gov (United States)

González Minero, F J; Candau, P; Tomás, C; Morales, J

1998-01-01

The study was carried out using a Burkard sampler installed on the roof terrace of the School of Pharmacy, Seville, for two years (1995 and 1996). Eight pollen types described in the literature as having allergenic activity were chosen. They were Poaceae, Olea europaea, Chenopodiaceae/Amaranthaceae, Plantago, Rumex, Urticaceae (including Parietaria), Cupressaceae, and Platanus hispanica. The types were grouped according to the similarity of their pattern of intradiurnal variation in pollen concentration. The following associations were established by multivariate analysis: Urticaceae and Chenopodiaceae/Amaranthaceae (appearing mainly between 11:00 and 20:00), Olea europaea and Plantago (12:00 to 19:00), Poaceae and Rumex (appearing throughout the day), and Cupressaceae and Platanus hispanica (8:00 to 14:00). The patterns of intradiurnal variation were similar both years for each type, despite the fact that the two years were climatologically different (1995 was dry and 1996 wet). We conclude that these behavior patterns are endogenous to the plants, and are hardly affected by meteorological parameters.

Progesterone supplementation after ovulation: effects on corpus luteum function and on fertility of dairy cows subjected to AI or ET.

Science.gov (United States)

Monteiro, Pedro L J; Nascimento, Anibal B; Pontes, Guilherme C S; Fernandes, Gabriela O; Melo, Leonardo F; Wiltbank, Milo C; Sartori, Roberto

2015-10-15

Three experiments were done to evaluate the effects of progesterone (P4) supplementation starting during metestrus on formation of the CL and on fertility of lactating dairy cows subjected to fixed-time artificial insemination (FTAI) or embryo transfer (ET). In experiment 1, 42 Holstein cows were randomly allocated to untreated (Control) or to receive an intravaginal implant containing 1.9 g of P4 from Day 3 to 20 after FTAI (controlled internal drug release [CIDR]). Blood samples were collected on Days 3, 4, 7, 11, 14, 17, 20, and 21 after FTAI to evaluate the effect of CIDR supplementation on plasma concentration of P4 using radioimmunoassay. Ultrasound scans were performed at Days 4, 7, 11, 14, and 20 to evaluate CL volume. In experiment 2, the effect on CIDR supplementation on fertility was evaluated in 668 Holstein and crossbred dairy cows that were subjected to FTAI and allocated randomly to untreated (AI-Control) or to receive a CIDR from Day 3 to 17 (AI-CIDR) after FTAI. In experiment 3, 360 Holstein cows were treated with PGF and after heat detection (Day 0), they were allocated to untreated (ET-Control) or to receive a CIDR from Day 4 ± 1 to 8 ± 1 (ET-CIDR-4) or a CIDR from 4 ± 1 to 18 ± 1 (ET-CIDR-14). In vitro-produced embryos were transferred on Day 8 ± 1. Pregnancy diagnoses were performed by ultrasound. In experiment 1, there was interaction between treatment and day in relation to plasma P4 on Days 4 and 7 due to CIDR supplementation. Independent of treatment, pregnant cows had higher plasma P4 from Day 14 to 21 than nonpregnant cows (P ≤ 0.05). Supplementation with CIDR did not alter CL development. In experiment 2, there was no effect of supplementation of P4 on pregnancy per AI on Day 32 (32.0% vs. 31.8%, for AI-Control and AI-CIDR, respectively) or pregnancy loss (15.6% vs. 17.6%, for AI-Control and AI-CIDR, respectively). In experiment 3, P4 supplementation compromised pregnancy per ET (P/ET) on Day 32 in both supplemented groups (39

Catalonia and Spain at the crossroads: financial and economic aspects

OpenAIRE

Castells, Antoni (Castells Oliveres)

2014-01-01

In some large European countries, in recent decades, economic globalization has gone hand in hand with a powerful trend to political decentralization (this has been the case in the United Kingdom, France, Italy, and Spain). In Spain, and after years of apparent stability, the relations between Catalonia and Spain are experiencing troubled times. This paper examines particularly the main economic effects of both the staying together and the secession scenarios. Following the introduction, the ...

What's Going On? An Overview of Adult Education Policies in Spain

Science.gov (United States)

Lucio-Villegas, Emilio

2012-01-01

In this paper, I attempt to present the state of adult education in Spain. Adult education in Spain is not unlike that of other countries in Europe in that it focuses on the policies and practices of lifelong learning rather than on the perspectives of people and communities. However, Spain has two specific characteristics that are distinctive…

Google Earth Visualizations of the Marine Automatic Identification System (AIS): Monitoring Ship Traffic in National Marine Sanctuaries

Science.gov (United States)

Schwehr, K.; Hatch, L.; Thompson, M.; Wiley, D.

2007-12-01

The Automatic Identification System (AIS) is a new technology that provides ship position reports with location, time, and identity information without human intervention from ships carrying the transponders to any receiver listening to the broadcasts. In collaboration with the USCG's Research and Development Center, NOAA's Stellwagen Bank National Marine Sanctuary (SBNMS) has installed 3 AIS receivers around Massachusetts Bay to monitor ship traffic transiting the sanctuary and surrounding waters. The SBNMS and the USCG also worked together propose the shifting the shipping lanes (termed the traffic separation scheme; TSS) that transit the sanctuary slightly to the north to reduce the probability of ship strikes of whales that frequent the sanctuary. Following approval by the United Nation's International Maritime Organization, AIS provided a means for NOAA to assess changes in the distribution of shipping traffic caused by formal change in the TSS effective July 1, 2007. However, there was no easy way to visualize this type of time series data. We have created a software package called noaadata-py to process the AIS ship reports and produce KML files for viewing in Google Earth. Ship tracks can be shown changing over time to allow the viewer to feel the motion of traffic through the sanctuary. The ship tracks can also be gridded to create ship traffic density reports for specified periods of time. The density is displayed as map draped on the sea surface or as vertical histogram columns. Additional visualizations such as bathymetry images, S57 nautical charts, and USCG Marine Information for Safety and Law Enforcement (MISLE) can be combined with the ship traffic visualizations to give a more complete picture of the maritime environment. AIS traffic analyses have the potential to give managers throughout NOAA's National Marine Sanctuaries an improved ability to assess the impacts of ship traffic on the marine resources they seek to protect. Viewing ship traffic

Oil spills and AI: How to manage resources through simulation

International Nuclear Information System (INIS)

Giribone, P.; Bruzzone, A.G.; Caddeo, S.

1995-01-01

Today, in the Mediterranean theater of the Upper Tyrrhenian, the ecological risk involving oil installations is still quite high. This is due to the fact that valuable environmental and tourist areas exist together with large industrial and port structures; in particular, recent events have demonstrated the danger involving oil spills along the Ligurian coastline. This study proposes an approach to plan the operations that should be performed when accidents occur, based on the use of AI techniques

Advances and trends on earthquake-triggered landslide research in Spain

OpenAIRE

García Mayordomo, Julián; Rodríguez Peces, Martín Jesús; Azañón, J.M.; Insúa Arévalo, Juan Miguel

2009-01-01

This work reviews the current situation of earthquake‐triggered landslide studies in Spain both from the point of view of regional assessment and site‐specific cases. Regional assessments have been undertaken in areas of the Betic Cordillera (South and Southeast Spain): Alcoy Basin, Lorca Basin, Granada Basin and Sierra Nevada Range; and Central Pyrenees (North Spain and Andorra). Specific studies are very scarce, outstanding those related to the Güevéjar landslide (Granada) –triggered by 175...

Using Ontological Engineering to Overcome AI-ED Problems: Contribution, Impact and Perspectives

Science.gov (United States)

Mizoguchi, Riichiro; Bourdeau, Jacqueline

2016-01-01

This article reflects on the ontology engineering methodology discussed by the paper entitled "Using Ontological Engineering to Overcome AI-ED Problems" published in this journal in 2000. We discuss the achievements obtained in the last 10 years, the impact of our work as well as recent trends and perspectives in ontology engineering for…

Grammaire progressive du français avec 400 exercices : niveau avancé

CERN Document Server

Boularès, Michèle

1997-01-01

La Grammaire progressive du français, de niveau avancé, s'adresse à de grands adolescents et adultes ayant suivi environ 250 heures de cours.Par une méthode progressive, des exemples nombreux et pertinents pour renforcer les règles de grammaire, une langue authentique, cet ouvrage a pour objectif de rendre vivant et stimulant l'apprentissage de la grammaire.Elle présente et explique des points complexes (subjonctif, gérondif, adjectif verbal, participe présent...) et relie résolument la forme et le sens afin de ne pas dissocier grammaire et communication. La Grammaire progressive du français est une grammaire pédagogique: les explications grammaticales sont simples, le plus souvent de l'ordre de la phrase, elles utilisent un minimum de métalangage; des exemples clairs et nombreux illustrent chque explication grammaticale; la langue utilisée dans les exemples et les exercices est authentique. Quand l'exemple illustrant un point grammatical exige un niveau de langage soutenue, celui-ci est signalé...

Spain: From massive immigration to vast emigration?

OpenAIRE

Izquierdo, Mario; Jimeno, Juan F.; Lacuesta, Aitor

2016-01-01

Large immigration flows during the 1995-2007 period increased the weight of foreigners living in Spain to 12 % of the total population. The rapid increase in unemployment associated with the Great Recession and the subsequent European debt crisis, substantially changed migration flows, so that, from the beginning of the 2010s, Spain experienced positive net outflows. In this paper, we take on three tasks. First, we show that sensitivity of migration flows to unemployment is similar between Sp...

AI tools in computer based problem solving

Science.gov (United States)

Beane, Arthur J.

1988-01-01

The use of computers to solve value oriented, deterministic, algorithmic problems, has evolved a structured life cycle model of the software process. The symbolic processing techniques used, primarily in research, for solving nondeterministic problems, and those for which an algorithmic solution is unknown, have evolved a different model, much less structured. Traditionally, the two approaches have been used completely independently. With the advent of low cost, high performance 32 bit workstations executing identical software with large minicomputers and mainframes, it became possible to begin to merge both models into a single extended model of computer problem solving. The implementation of such an extended model on a VAX family of micro/mini/mainframe systems is described. Examples in both development and deployment of applications involving a blending of AI and traditional techniques are given.

Little AI: Playing a constructivist robot

Science.gov (United States)

Georgeon, Olivier L.

Little AI is a pedagogical game aimed at presenting the founding concepts of constructivist learning and developmental Artificial Intelligence. It primarily targets students in computer science and cognitive science but it can also interest the general public curious about these topics. It requires no particular scientific background; even children can find it entertaining. Professors can use it as a pedagogical resource in class or in online courses. The player presses buttons to control a simulated "baby robot". The player cannot see the robot and its environment, and initially ignores the effects of the commands. The only information received by the player is feedback from the player's commands. The player must learn, at the same time, the functioning of the robot's body and the structure of the environment from patterns in the stream of commands and feedback. We argue that this situation is analogous to how infants engage in early-stage developmental learning (e.g., Piaget (1937), [1]).

Little AI: Playing a constructivist robot

Directory of Open Access Journals (Sweden)

Olivier L. Georgeon

2017-01-01

Full Text Available Little AI is a pedagogical game aimed at presenting the founding concepts of constructivist learning and developmental Artificial Intelligence. It primarily targets students in computer science and cognitive science but it can also interest the general public curious about these topics. It requires no particular scientific background; even children can find it entertaining. Professors can use it as a pedagogical resource in class or in online courses. The player presses buttons to control a simulated “baby robot”. The player cannot see the robot and its environment, and initially ignores the effects of the commands. The only information received by the player is feedback from the player’s commands. The player must learn, at the same time, the functioning of the robot’s body and the structure of the environment from patterns in the stream of commands and feedback. We argue that this situation is analogous to how infants engage in early-stage developmental learning (e.g., Piaget (1937, [1].

Enamelin (Enam) is essential for amelogenesis: ENU-induced mouse mutants as models for different clinical subtypes of human amelogenesis imperfecta (AI).

Science.gov (United States)

Masuya, Hiroshi; Shimizu, Kunihiko; Sezutsu, Hideki; Sakuraba, Yoshiyuki; Nagano, Junko; Shimizu, Aya; Fujimoto, Naomi; Kawai, Akiko; Miura, Ikuo; Kaneda, Hideki; Kobayashi, Kimio; Ishijima, Junko; Maeda, Takahide; Gondo, Yoichi; Noda, Tetsuo; Wakana, Shigeharu; Shiroishi, Toshihiko

2005-03-01

Amelogenesis imperfecta (AI) is a group of commonly inherited defects of dental enamel formation, which exhibits marked genetic and clinical heterogeneity. The genetic basis of this heterogeneity is still poorly understood. Enamelin, the affected gene product in one form of AI (AIH2), is an extracellular matrix protein that is one of the components of enamel. We isolated three ENU-induced dominant mouse mutations, M100395, M100514 and M100521, which caused AI-like phenotypes in the incisors and molars of the affected individuals. Linkage analyses mapped each of the three mutations to a region of chromosome 5 that contained the genes encoding enamelin (Enam) and ameloblastin (Ambn). Sequence analysis revealed that each mutation was a single-base substitution in Enam. M100395 (Enam(Rgsc395)) and M100514 (Enam(Rgsc514)) were putative missense mutations that caused S to I and E to G substitutions at positions 55 and 57 of the translated protein, respectively. Enam(Rgsc395) and Enam(Rgsc514) heterozygotes showed severe breakage of the enamel surface, a phenotype that resembled local hypoplastic AI. The M100521 mutation (Enam(Rgsc521)) was a T to A substitution at the splicing donor site in intron 4. This mutation resulted in a frameshift that gave rise to a premature stop codon. The transcript of the Enam(Rgsc521) mutant allele was degraded, indicating that Enam(Rgsc521) is a loss-of-function mutation. Enam(Rgsc521) heterozygotes showed a hypomaturation-type AI phenotype in the incisors, possibly due to haploinsufficiency of Enam. Enam(Rgsc521) homozygotes showed complete loss of enamel on the incisors and the molars. Thus, we report here that the Enam gene is essential for amelogenesis, and that mice with different point mutations at Enam may provide good animal models to study the different clinical subtypes of AI.

Red Beads and Love Magic. Cross-Cultural Exchanges Between Spain and new Spain in Modern Era

Directory of Open Access Journals (Sweden)

Carla Andreia Martins Torres

2018-01-01

Full Text Available This paper is about the significance of particular red beads used in love magic during the 17th and 18th centuries, specifically on the construction of symbolic universe through perceptions based on «others» materiality. It aims to provide a connected studied between Spain and New Spain through the histories of the gipsy Generosa Vicente and mestiza Margarita Palacios recovered from the Inquisition authorities notes. This is the way to understand the extent to which cross-cultural contacts privilege the transmission of ideas associated with objects, and how they were used apparently with similar purposes but with a very different meaning.

Thermal solar energy in Spain. State of the art and objectives

International Nuclear Information System (INIS)

Glenn, Jaouen

2006-01-01

According the Kyoto protocol, Spain has to reduce its CO 2 emissions at 330 millions of tons (a decrease of 18 % from the level of 2003). From the european commission policy, the energy resources will be of 12 % of renewable energies. In this context, Spain developed an energy policy in favor of the solar energy. This document provides information on: the energy market in Spain, the thermal solar energy operating, the CO 2 emissions, the state of the art in the domain in spain, the 2010 objectives, the programs and the assistance, some data on the solar market in comparison with the Europe. (A.L.B.)

Prediction of shipboard electromagnetic interference (EMI) problems using artificial intelligence (AI) technology

Science.gov (United States)

Swanson, David J.

1990-08-01

The electromagnetic interference prediction problem is characteristically ill-defined and complicated. Severe EMI problems are prevalent throughout the U.S. Navy, causing both expected and unexpected impacts on the operational performance of electronic combat systems onboard ships. This paper focuses on applying artificial intelligence (AI) technology to the prediction of ship related electromagnetic interference (EMI) problems.

Notes on the inherently safe core design meeting with the DOE-RRT, AI, GE, W-ARD, EPRI, and ETEC (at AI, Canoga Park, California, November 7-8, 1978)

International Nuclear Information System (INIS)

Jackola, A.S.; Paschall, R.K.

1978-01-01

The primary purpose of the meeting was to familiarize large LMFBR design managers with the capabilities of the Inherent Secondary Shutdown Systems (articulated rod and absorber balls) and to obtain inputs from them. The other purpose of the meeting was for the ISSS designers (AI, GE, and WARD) to present current work status, future plans, and schedules for their respective ISSS tasks

Deep Learning Neural Networks in Cybersecurity - Managing Malware with AI

OpenAIRE

Rayle, Keith

2017-01-01

There’s a lot of talk about the benefits of deep learning (neural networks) and how it’s the new electricity that will power us into the future. Medical diagnosis, computer vision and speech recognition are all examples of use-cases where neural networks are being applied in our everyday business environment. This begs the question…what are the uses of neural-network applications for cyber security? How does the AI process work when applying neural networks to detect malicious software bombar...