WorldWideScience

Sample records for ai seville spain

  1. [Characteristics of Hospitalizations of Homeless Persons in Seville, Spain].

    Science.gov (United States)

    Tornero Patricio, Sebastián; Fernández Ajuria, Alberto; Charris Castro, Liliana

    2016-02-10

    The aim was to determine the characteristics of hospital admissions of homeless persons in Seville, Spain. Observational study of 103,802 hospital admissions of 71,756 patients admitted in the Hospitals "Virgen del Rocío" and "Virgen Macarena" (Seville), in 2013 and 2014. Bivariate analysis were performed using χ2 and t-Student tests and multivariate analysis using binomial logistic regression model. 0.16% (n=163) of admissions were homeless persons and 99.84% (n=103,639) were not. The mean age at admission in homeless patients was 48 years and 76.5% of them were men. Hospital deaths of homeless patients occurred being 23 years younger. 92% of hospital admissions came from emergency departments and 10.0% of their discharges were against medical advice. The average length of stay was 4.8 days longer in homeless persons and the most frequent diagnoses on admission were mental (27.0%), infectious (19.6%) and respiratory diseases (18.4%). Mental disorders were present on 83.7% of homeless patients as secondary diagnose and 77.6% referred drugs consumption. Hospital admissions characteristics of homeless persons were particularly different. Homeless patients were hospitalized and died at a younger age than non-homeless patients. The morbidity and mortality of homeless persons reflect their vulnerable health condition.

  2. Subsidence monitoring in Seville (S Spain) using multi-temporal InSAR

    NARCIS (Netherlands)

    Ruiz-Armenteros, A.M.; Ruiz-Constán, A.; Lamas-Fernández, F.; Galindo-Zaldívar, J.; Sousa, J.J.; De Galdeano, C.S.; Delgado, J.M.; Pedrera-Parias, A.; Martos-Rosillo, S.; Gil, A.J.; Caro-Cuenca, M.; Hanssen, R.F.

    2016-01-01

    Seville, with a metropolitan population of about 1.5 million, is the capital and largest city of Andalusia (S Spain). It is the 30th most populous municipality in the European Union and contains three UNESCO World Heritage Sites. The Seville harbour, located about 80 km from the Atlantic Ocean, is

  3. Subsidence Monitoring in Seville (S Spain) Using Multi-Temporal InSAR

    Science.gov (United States)

    Ruiz-Armenteros, Antonio M.; Ruiz-Constan, Ana; Lamas-Fernandez, Francisco; Galindo-Zaldivar, Jesus; Sousa, Joaquim J.; Sanz de Galdeano, Carlos; Delgado, Manuel J.; Pedrera-Parias, Antonio; Martos-Rosillo, Sergio; Gil, Antonio J.; Caro-Cuenca, Miguel; Hanssen, Ramon F.

    2016-08-01

    Seville, with a metropolitan population of about 1.5 million, is the capital and largest city of Andalusia (S Spain). It is the 30th most populous municipality in the European Union and contains three UNESCO World Heritage Sites. The Seville harbour, located about 80 km from the Atlantic Ocean, is the only river port in Spain. The city is located on the plain of the Guadalquivir River. Using Multi-Temporal InSAR with ERS-1/2 and Envisat data a subsidence behavior is detected in the period 1992-2010. The geometry of the subsiding areas suggests that it should be conditioned by the fluvial dynamics of the Guadalquivir River and its tributaries. Facies distribution along the fluvial system (paleochannels, flood plains...), with different grain size and matrix proportion, may explain the relative subsidence between the different sectors.

  4. Actuation and Promotion Mechanisms of Urban Tourism: The Case of Seville (Spain

    Directory of Open Access Journals (Sweden)

    Roberto Diez Pisonero

    2011-01-01

    Full Text Available Tourist activity in Seville right now constitutes one of the fundamental pillars of the economic, social and cultural progress of the city. Seville’s importance lies not only in its plentiful monumental and artistic heritage, but also in the rest of the characteristics of the city that come together to form the tourist product (infrastructure, accommodation, catering, shops, recreational areas.... Its diversified offerings in other areas such as business, shopping, gastronomy and golf, in addition to its excellent position in the world tourist system as well as its image as a tourist destination and its international projection, have turned Seville, the Andalusian capital, into one of the biggest tourist metropolis in the south of Europe. This paper attempts to provide a better understanding of the phenomenon and the complexity of urban tourism using a successful case as an example. To that effect, using a methodology based on the compilation, filtration and proper organization of information, it presents an analysis of the actions different administrations have taken to better the positioning of Seville in the global tourism industry. The analysis focuses on two aspects of the rise of Seville as a successful tourist attraction: the first, the different strategies employed to refine the tourist product, promotion, commercialization, planning, marketing, quality and sustainability; and second, the strengthening of the transport infrastructure that added dynamism to this Spanish city. Through this analysis, the paper complements existing literature on the topic by adding to our knowledge of the tourist industry.

  5. [Implementation of a health promotion programme for women in social exclusion in the city of Seville (Spain)].

    Science.gov (United States)

    Rodríguez Fernández-Viagas, Cristina; García Gil, Carmen; Bayo Barroso, Nora; Villalba Quesada, Cristina; Álvarez Girón, Manuela

    2018-01-09

    Health promotion can contribute towards reducing inequality and ensuring equal opportunities, providing the means to enable the entire population to develop its maximum health possibilities. Women living in areas with social transformation needs (ASTN) are an especially vulnerable group due to the situation of material deprivation and social exclusion in which they live. Health promotion programmes for this group can bring about an improvement in their health. This paper describes the health promotion programme Socio-educational Groups of Primary Care for Women (SEGPC-W), and evaluates its implementation in ASTN in the city of Seville (Spain), as well as the benefits and difficulties of its development through a documentary analysis and interviews with participating professionals. Copyright © 2017 SESPAS. Publicado por Elsevier España, S.L.U. All rights reserved.

  6. Impact on the psychotic vulnerability of the therapeutic approachin the Prison Psychiatric Hospital in Seville (Spain).

    Science.gov (United States)

    Massé-García, P; Lamas-Bosque, F J; Massé-Palomo, A

    2017-06-01

    to analyze changes in psychotic vulnerability following the implementation of a program of prison psychiatric treatment, recidivism after the release and various descriptive variables of criminological interest. review of a sample consisting of 50 patients diagnosed with schizophrenia admitted to the Prison Psychiatric Hospital of Seville. there was a statistically significant reduction of psychotic vulnerability according to an assessment using the Frankfurt psychopathological inventory (FBF-3), after conducting a complete psychiatric, psychological, social and rehabilitation approach in the prison environment. The core symptoms relating to complex perception and language also decreased significantly. The reduction is particularly noticeable in the number of patients categorized as medium-high and high severity. Recidivism in the follow-up of release of patients in the study sample is low (6%) and there were no cases of serious felony or grievous bodily harm. Recidivism, when it occurs, is not immediate. Although there is some criminal versatility, it is limited. The most frequent victims are parents with a previous relationship with the patient. Most of the patients in the sample, and all recidivists, have comorbid substance abuse (dual diagnosis). we need more comprehensive studies to establish causal relationships between the decrease in psychotic vulnerability and an integrated psychiatric, psychological, social and rehabilitation approach in prisons; or to attribute the low rate of recidivism to the decline of psychotic vulnerability.

  7. Impact on the psychotic vulnerability of the therapeutic approachin the Prison Psychiatric Hospital in Seville (Spain

    Directory of Open Access Journals (Sweden)

    P. Massé-García

    Full Text Available Objectives: to analyze changes in psychotic vulnerability following the implementation of a program of prison psychiatric treatment, recidivism after the release and various descriptive variables of criminological interest. Materials and methods: review of a sample consisting of 50 patients diagnosed with schizophrenia admitted to the Prison Psychiatric Hospital of Seville. Results: there was a statistically significant reduction of psychotic vulnerability according to an assessment using the Frankfurt psychopathological inventory (FBF-3, after conducting a complete psychiatric, psychological, social and rehabilitation approach in the prison environment. The core symptoms relating to complex perception and language also decreased significantly. The reduction is particularly noticeable in the number of patients categorized as medium-high and high severity. Recidivism in the follow-up of release of patients in the study sample is low (6% and there were no cases of serious felony or grievous bodily harm. Recidivism, when it occurs, is not immediate. Although there is some criminal versatility, it is limited. The most frequent victims are parents with a previous relationship with the patient. Most of the patients in the sample, and all recidivists, have comorbid substance abuse (dual diagnosis. Discussion: we need more comprehensive studies to establish causal relationships between the decrease in psychotic vulnerability and an integrated psychiatric, psychological, social and rehabilitation approach in prisons; or to attribute the low rate of recidivism to the decline of psychotic vulnerability.

  8. [Sexual and reproductive health in Roma women: the family planning programme of Polígono Sur in Seville (Spain)].

    Science.gov (United States)

    Escobar-Ballesta, Marta; García-Ramírez, Manuel; Albar-Marín, M ª Jesús; Paloma, Virginia

    2018-04-05

    To describe the challenges, resources and strategies of the staff of the family planning programme of the Polígono Sur Healthcare Centre in Seville (Spain) in their care of Roma women. This is a descriptive study in which in-depth interviews and discussion groups were held with all programme professionals, including a documentary review of the programme. The information was analyzed based on the Roma Health Integration Policy Index, a tool that evaluates the entitlement, accessibility, sensitivity and capacity for change of health programmes for the Roma population. The professionals encountered multiple challenges to implement the family planning programme with Roma women due to the characteristics of the users and the low sensitivity of the programme towards them. The absence of specific actions for Roma women within the family planning programme, agreed to by the healthcare district, obliges professionals to develop adaptations and strategies to ensure quality sexual and reproductive health services for their users. It is necessary to adapt sexual and reproductive health programmes targeted at Roma women by (a) detecting, evaluating, systematizing and disseminating good practices, (b) developing actions that address the multiple vulnerabilities of Roma women, (c) acknowledging professionals who advocate for the health of these women within their organizations, and (d) promoting reproductive justice as the goal of these programmes. Copyright © 2018 SESPAS. All rights reserved.

  9. Effects of extremely hot days on people older than 65 years in Seville (Spain) from 1986 to 1997

    Science.gov (United States)

    Díaz, J.; García, R.; Velázquez de Castro, F.; Hernández, E.; López, C.; Otero, A.

    2002-04-01

    The effects of heat waves on the population have been described by different authors and a consistent relationship between mortality and temperature has been found, especially in elderly subjects. The present paper studies this effect in Seville, a city in the south of Spain, known for its climate of mild winters and hot summers, when the temperature frequently exceeds 40 °C. This study focuses on the summer months (June to September) for the years from 1986 to 1997. The relationships between total daily mortality and different specific causes for persons older than 65 and 75 years, of each gender, were analysed. Maximum daily temperature and relative humidity at 7.00 a.m. were introduced as environmental variables. The possible confounding effect of different atmospheric pollutants, particularly ozone, were considered. The methodology employed was time series analysis using Box-Jenkins models with exogenous variables. On the basis of dispersion diagrams, we defined extremely hot days as those when the maximum daily temperature surpassed 41 °C. The ARIMA model clearly shows the relationship between temperature and mortality. Mortality for all causes increased up to 51% above the average in the group over 75 years for each degree Celsius beyond 41 °C. The effect is more noticeable for cardiovascular than for respiratory diseases, and more in women than in men. Among the atmospheric pollutants, a relation was found between mortality and concentrations of ozone, especially for men older than 75.

  10. Macroscopical morphology of deterioration of the stone in the Cathedral of Seville, Spain

    Directory of Open Access Journals (Sweden)

    Alcalde, M.

    1990-09-01

    Full Text Available The lithotype mainly used in the construction of the Cathedral of Seville is the calcarenite from Puerto de Santa f/laria followed by the limestone from Espera. The primordial extrinsecal factor of deterioration is the atmospherical contamination, mainly sulphur oxides and smoke, within a humid environment. From both factors, the porose stone of a carbonated nature and the acid environment, we can deduce that the principal mechanism of deterioration is the chemical attack; the most important indicators of deterioration that have been found are the deposits and arenizations. In a "grosso modo" valoration we can say that the stone of structural employment is well conserved in its majority while the ornamental stone is degraded at 80%. Half the cresting is in a state of ruin and 20% of the tips have been removed or will have to be in the near future.

    El litotipo mayoritariamente empleado en la construcción de la Catedral de Sevilla es la calcarenita del Puerto de Santa María seguida de la caliza de Espera. El factor extrínseco de alteración primordial es la contaminación atmosférica, principalmente óxidos de azufre y humos, en ambiente húmedo. De ambos factores, piedra porosa de naturaleza carbonatada y medio ambiente ácido, puede deducirse que el principal mecanismo de alteración es el ataque químico y se ha encontrado que los indicadores de alteración más importantes son los depósitos y las arenizaciones. En una valoración a grosso modo puede decirse que la piedra de uso estructural se encuentra bien conservada en su mayor parte, y la ornamental degradada en un 80%. La mitad de las cresterías se encuentran en estado de ruina y un 20% de los remates han sido retirados o habrán de serlo próximamente.

  11. Perceptions among university students in Seville (Spain of the rabbit as livestock and as a companion animal

    Directory of Open Access Journals (Sweden)

    Pedro González-Redondo

    2012-10-01

    Full Text Available The rabbit has various utilities and roles, mainly as a meat-producing animal, game species, companion animal, laboratory animal or pest. Among these roles, rabbit breeding for meat has traditionally prevailed in the Mediterranean countries. However, in recent decades the practice of keeping this species as a companion animal has been on the rise; a factor that could be changing public perception of the rabbit. A survey of 492 university students from Seville, Andalusia, Spain, was conducted to determine young people’s perceptions of the rabbit as livestock and as a companion species. The rabbit received the lowest score when regarded as livestock compared to the pig, cow, goat, sheep and hen. Regarding companion animals, young Spanish people preferred the dog and cat, respectively. The rabbit and the hamster were rated at the same level as a pet, while the budgerigar was rated lower than these two mammals by women and higher by men. The goldfish occupied the last position among the pet species in the women’s perceptions. With regard to the perception of various rabbit breeds and varieties when evaluated as pets, it was found that the pet Lop Dwarf, Netherland Dwarf, Angora and Lionhead breeds were rated higher than a typical meat breed (New Zealand White and than the wild rabbit. The gender of the young people surveyed influenced their perception of the rabbit. Women rated the rabbit lower as livestock while they rated it higher as a pet, also rating the pet rabbit breeds higher than men did. It is proposed that, in keeping with the rabbit’s attributes related to its cuteness, conceptually linked with pets, young Andalusian people’s perception of the rabbit is ambivalent and this perception might partly be shifting from perceiving it as livestock to regarding it as a pet.

  12. Time analysis of the containerized cargo flow in the logistic chain using simulation tools: the case of the Port of Seville (Spain)

    Energy Technology Data Exchange (ETDEWEB)

    Ruiz Aguilar, J.J.; Turias, J.I.; Cerban, M.; Gonzalez, M.J.; Pulido, A.

    2016-07-01

    The logistic chain that connects the capital of Spain (Madrid) with the Canary Islands has the Port of Seville as the port node. This port node makes possible to switch from one transport mode (railway) to another (maritime) at the container terminal of the port. Some constraints, such as the operational time window that restricts the freight train access into the port in a certain time-slot or the need of the reversal of the train before entering into port, lead to generate important time delays in the intermodal chain. A time analysis of the process is necessary in order to check the critical points. A simulation of the whole process from the goods departing the origin station by train until they leave the port of Seville by ship to the Canary Islands is performed. To this aim, a queuing model network was developed in order to simulate the travel time of the cargo. The database is composed of daily departures of goods train and daily departures of vessels (including times of docking, berthing or load/unload cargo). The final objective of this work is twofold: firstly, to provide a validated model of the containerized cargo flow and secondly, to demonstrate that this kind of queuing models can become a powerful supporting tool in making decisions about future investments. (Author)

  13. A forensic pathology approach to sudden death in children and young adults in Biscay and Seville (Spain

    Directory of Open Access Journals (Sweden)

    Benito Morentin

    2012-10-01

    Full Text Available Sudden death (SD in children and young adults is a complex multifactorial problem that entails medical forensic and socio-familial implications. Forensic pathology plays an important role in these cases due to the fact that they tend to occur unexpectedly, and therefore a postmortem examination is needed to determine cause and mechanism of death. Most of these deaths are of cardiovascular origin and many of them have a hereditary component. The autopsy may be the only way to establish the correct diagnosis of the underlying condition enabling the family to receive proper medical counseling, to identify asymptomatic relatives at risk, and to prevent subsequent deaths. A proper approach requires the collaboration of various medical specialties (coroners, pathologists, pediatricians, cardiologists, microbiologists, geneticians, who must work in coordination in accordance to international protocols. In this article, the epidemiologic and clinical-pathological features of the main conditions that may lead to SD in children and young adults are reviewed and a case series from Seville and Biscay provinces is presented. Finally, the importance of forensic pathology in the management and prevention of these cases is underlined.

  14. Ai

    African Journals Online (AJOL)

    :=g=~!Ai~~~~~g~~ ~~~~~~. Jim Taylor, Rob O'Donoghue and Alistair Clacherty. INTRODUCTION. The Department of Environment Affairs, in cooperation with ...

  15. Pictorial materials used in the polychrome decorations of the façade of the palace of King Pedro I (The Royal Alcazar of Seville, Spain

    Directory of Open Access Journals (Sweden)

    López-Cruz, O.

    2015-06-01

    Full Text Available This research has been conducted on the architectural decoration of the façade of the Palace of King Pedro I (The Royal Alcazar of Seville, Spain. The stratigraphic study of pictorial layers has revealed numerous interventions made on the polychrome decorations that have been related to those referenced in historical documents. Mineralogical and compositional studies of the natural and synthetic pigments and their alteration have provided an independent chronology for the polychrome decorations. Finally, this study has revealed the importance of colour of the decorative elements over the history of the palace.El estudio de la fachada del palacio de Pedro I ha puesto de manifiesto la existencia de un gran número de policromías realizadas con una amplia variedad de pigmentos de diferentes cronologías. Mediante diversas técnicas analíticas han sido diferenciadas y caracterizadas química y mineralógicamente. El estudio estratigráfico detallado de las diferentes policromías ha permitido relacionarlas con las sucesivas intervenciones documentadas, comprobando así la gran importancia que el color ha tenido en todas las épocas o momentos históricos del Palacio.

  16. A GEOMETRICAL SIMILARITY PATTERN AS AN EXPERIMENTAL MODEL FOR SHAPES IN ARCHITECTURAL HERITAGE: A CASE STUDY OF THE BASE OF THE PILLARS IN THE CATHEDRAL OF SEVILLE AND THE CHURCH OF SANTIAGO IN JEREZ, SPAIN

    Directory of Open Access Journals (Sweden)

    J. J. Moyano

    2017-02-01

    Full Text Available This paper proposes a procedure for the search of a geometrical similarity pattern in architectural heritage by means of calculating probability indexes to support hypotheses initially endorsed by documentary sources. The buildings analysed are the Cathedral of Seville and the Church of Santiago, in Jerez, Spain. The 3D models of their selected pillars are obtained by means of Terrestrial Laser Scanning (TLS, Optical Scanning (OS and photogrammetry through image-based modelling software (SFM-IBM. To this end, a procedure for the comparison of shapes is established. It is based on similarity statistics, the determination of homologous points and the agreement of characteristic sections. Here, two key aspects are considered: on the one hand, the metric standpoint; on the other hand, historical-graphical features of the 3D models: composition, techniques, styles, and historical-graphical documentary sources. Thus, putting aside the mere dimensional analysis, the sections are compared with graphical patterns and models of which the same authorship – stonemasons working in that age – is accurately known. As a result, the outcomes of this research reveal the geometrical similarity between the elements of the pillars of the Cathedral of Seville and the Church of Santiago.

  17. Experiences to substitute polyacrylamide in Carambolo DWTP (Seville, Spain); Experiencias para la sustitucion de las pliacrilamidas en la ETAP Carambolo de Sevilla

    Energy Technology Data Exchange (ETDEWEB)

    Diaz Garcia, J. M.; Gonzalez Quesada, R.

    2010-07-01

    The legal limitation of Spanish normative OM SCO/3719/2005 about polyacrylamide flocculants dosification produced the need to reduce this dosing or the substitution of flocculants by other alternative products. this work, realized in laboratory and in a decanter too, determines the performance obtained for final turbidity, wash and frequency of filters, economic costs and application technical problems. the study of these alternatives has been realized to apply in carambolo DWTP. This plant supplies drinking water to Seville city and great part of its metropolitan area. (Author) 10 refs.

  18. Artificial Intelligence (AI techniques to analyze the determinants attributes in housing prices

    Directory of Open Access Journals (Sweden)

    Julia M. Núñez Tabale

    2016-12-01

    Full Text Available The econometric approach to obtain the value of a property began with hedonic modelling, which were based on a set of property attributes, internal or external, associated to each particular dwelling. The final sale value can be estimated, and also the marginal prices of each exogenous explanatory variable. A good alternative to the hedonic approach is based on several Artificial Intelligence (AI techniques, such as artificial neural networks (ANN, these tend to be more precise. Both methodologies are compared, and a case study is developed using data from Seville, the larger town in the South of Spain.

  19. Isidore of Seville – Reader of Solinus

    Directory of Open Access Journals (Sweden)

    Anca Crivăţ

    2013-05-01

    Full Text Available This paper focuses on examining how in his Etymologiae sive Origines Isidore of Seville makes use of the lexis that describes marvellous phenomena. This lexis was borrowed to some extent from Solinus’ Collectanea rerum memorabilium. This research therefore aims at checking the results of some previous studies which demonstrate the rationality of Isidore’s approach by investigating the lexis in his work.

  20. Ethical Imagination in Peace Studies: Beyond the Seville Statement.

    Science.gov (United States)

    Rivage-Seul, M.

    1989-01-01

    Asks reader to look beyond Seville Statement, Social Darwinism, and utopian ideals and come to understand ethical imagination more fully as it relates to peace studies. Examines Seville Statement and its opposition to Social Darwinism. Explains how ethical imagination serves to provide radical alternative to biological determinism. (Author/NB)

  1. Spain

    International Nuclear Information System (INIS)

    Zoppo, C.E.

    1990-01-01

    This paper reports on nuclear export activities in Spain, as elsewhere, which occur in a political, economic, and technological context. The factors operating the process are not always explicitly related in the public and the private sectors, nor between these sectors, by the relevant decision makers. A redefinition of Spain's policies in the nuclear sector has been going on since at least 1984, when a new energy plan was legislated by the newly elected Socialist government. It would be accurate to suggest that this process remains dynamic and not fully completed for policy purposes. This condition has resulted from the fact that Spain underwent a crucial political regime change from dictatorship to parliamentary democracy about a decade ago, with the transition to democracy only recently consolidated. Moreover, no policy in regard to nuclear nonproliferation existed during the Franco regime. Instead, Spain's official position was to maintain the right to preserve a nuclear option for national defense. However, this option was not developed into a concerted program to develop a nuclear military capability

  2. AIS authentication

    CERN Multimedia

    2006-01-01

    Users are invited to use the NICE password for AIS authentication. As announced in CNL June-August 2006 (see http://www.cerncourier.com/articles/cnl/3/6/14/1) it is possible to use the NICE username and password to log on to AIS. The procedure is now fully operational and users can themselves reset the AIS password such that the NICE password will be used for authentication required by AIS applications. We strongly recommend CERN users who have a NICE account (this is the case of most users) to do this, with the objective to reduce the number of passwords they need to remember. This can be achieved very easily, directly from the Change Password option on the AIS login (https://aislogin.cern.ch/). Users should just select the '[Change Password]' option displayed at the bottom of the page, provide the 'Old Password' and then click on the button 'Use Nice password' followed by 'Submit'. Change Password option on the AIS login windowSetting the AIS password - Use Nice Password It should be noted that the proce...

  3. Spain.

    Science.gov (United States)

    1985-03-01

    Spain is a constitutional monarchy with a population of 38.3 million growing at .5%/year. The most striking topographical features are the high plateaus and internal compartmentalization by mountain and river barriers. Nearly 3/4 of the country is arid. The Iberian peninsula was the scene of successive invasions and warfare for centuries. Phoenicians, Greeks, Carthaginians, Moors, Celts, Romans, and Visigoths all invaded at some time. The present language, religion, and laws stem from the Roman Period. The Reconquest from the North African Moors lasted over 700 years until they were driven out in 1492. The unification of present day Spain was complete by 1512. A period of dictatorial rule from 1923-31 ended with establishment of the Second Republic which saw increasing political polarization culminating in the Spanish Civil War. Franco's victory in 1939 was followed by official neutrality but pro-Axis policies during World War II. Spain's economy began to recover during the 1950s, but large scale modernization and development did not occur until the 1960s. Prince Juan Carlos de Borbon y Borbon, Franco's personally designated heir, assumed the title of king and chief of state with Franco's death in 1975. Franco's last prime minister was replaced in July 1976 in order to speed the pace of post-Franco liberalization. Spain's 1st parliamentary elections since 1936 were held in 1977, and a new constitution protecting human and civil rights and granting due process was overwhelmingly approved in 1978. The constitution also authorized creation of regional autonomous governments. By the mid-1970s, Spain had developed a strong and diversified industrial sector and a thriving tourist industry. From 1975-83, there were 8 years of double-digit inflation, an average growth rate of 1.5% in real terms, and an increase in unemployment from about 4.7% to 18.4%. By 1984 there was substantial improvement in inflation and the balance of payments. Goals of current government economic

  4. Spain

    International Nuclear Information System (INIS)

    2001-01-01

    Spanish low and intermediate level radioactive wastes are disposed of at the El Cabril Disposal Facility, in the province of Cordoba (SPAIN). The fundamental safety objective of the facility consists of the immediate and longer term protection of people and the environment. This objective leads to the need to isolate the wastes from the human surroundings, such that any release of the radionuclides contained in them does not pose any radiological risk for either people or the environment over the necessary time period. Consequently, it is necessary to fully protect the wastes against external aggression, from both the climatic and biological point of view (infiltration of water, temperature variations, chemical action of water, attacks by living macro and microorganisms, plants, etc.). This waste isolation is achieved by means of a multi-barrier system separating the activity stored from the aforementioned actions

  5. Use of health services by adult Latin American immigrants residing in Seville

    Directory of Open Access Journals (Sweden)

    José Rafael González-López

    2014-07-01

    Full Text Available Objective. This work sought to describe the use of health services by adult Latin American immigrants from Seville. Methodology. This was a descriptive cohort study with the participation of 190 adult Latin American immigrants from 25 to 44 years of age, residing in the city of Seville (Spain in 2011. A self-report survey was applied. Results. Within the past year, 67% of the individuals have visited a physician and 23% have attended nursing consultation. A total of 14% of the immigrants who called on a healthcare center reported that their experience was worse than that of others. La annual prevalence by accidents was: 10% domestic, 4% traffic-related and 9% occupational; nearly half these accidents justified emergency care or hospitalization due to their severity. The logistic regression model revealed that health services were used mostly by: women, those in poor self-perceived health status, those with secondary level of education, the elderly, and those who were single. Conclusion. The population studied presents adequate use of health services, although it would be recommendable to implement prevention activities by nurses in the immigrant's work and family environment to reduce the accident incidence described by this group.

  6. Seville City Hall Chapter Room ceiling decoration

    Directory of Open Access Journals (Sweden)

    Robador, M. D.

    2010-02-01

    Full Text Available The present article describes a chemical and physical study of the colour, chemical composition and mineral phases of the decorative materials in the Seville City Hall Chapter House ceiling. The findings showed that the inner most layer of material, calcite, was covered with white lead, in turn concealed under a layer of gilded bole. The ceiling underwent re-gilding, also over bole, due in all likelihood to wear on the original gold leaf. In the nineteenth century, the entire ceiling with the exception of the inscriptions was whitewashed with calcite and white lead. Silver was employed on King John I’s sword (coffer 27. Gold leaf was used to adorn the royal attributes: crowns, belts, sceptres, swords and rosary beads. The high reliefs were likewise gilded. The pigments identified on the ceiling adornments included azurite, malachite, vermilion and gas black. A lime and ground dolomite mortar was used throughout.

    El objetivo de este trabajo es el estudio de diferentes aspectos, como el color, la composición química y las fases mineralógicas presentes en los diferentes materiales que forman la ornamentación del techo de la Sala Capitular del Ayuntamiento de Sevilla, mediante métodos físicos y químicos. Nuestros resultados muestran que el dorado fue realizado sobre una capa de bol previamente depositada sobre una lámina de blanco de plomo que cubría un estrato de calcita. Posteriormente, y probablemente debido a alteraciones en el dorado original, el techo fue de nuevo dorado usando una técnica similar. En el siglo XIX, casi todo el techo, excepto las zonas con inscripciones, fue blanqueado usando una mezcla de calcita y blanco de plomo. Se empleó plata para cubrir la espada del rey Juan I (casetón 27. Finísimas láminas de oro se usaron para decorar los atributos reales: coronas, cinturones, cetros, espadas y rosarios. En diferentes partes de la decoración fueron detectados pigmentos como azurita, malaquita, bermellón y

  7. The Chronica Maiora of Isidore of Seville

    Directory of Open Access Journals (Sweden)

    Sam KOON

    2008-12-01

    Full Text Available Isidore of Seville’s Chronica Maiora was written in two redactions in early seventh century and reveals a great deal about the political, religious and intellectual history of late antique and early medieval Spain. a comparative analysis of the different versions demonstrates the author in action, responding to a range of contemporary stimuli. On a series of levels, the changing form and contents of the chronicle can be mapped against a rapidly changing religious and political background to provide valuable historical data and insights into the working methods and intellectual world of the most important author of early medieval Spain. This article offers a brief introduction to the text and its context of production before presenting an English translation of the two redactions of the text.La Chronica Maiora de Isidoro de Sevilla fue redactada en dos versiones a principios del siglo VII y revela una gran variedad de datos acerca de la historia política, religiosa e intelectual de la España de la Antigüedad tardía y de la alta Edad Media. Un estudio comparativo de las versiones existentes revela un autor dinámico que responde a estímulos contemporáneos. Los cambios en la forma y el contenido de la crónica se pueden relacionar con rápidos cambios políticos y religiosos, y revelan valiosos datos históricos así como los métodos de trabajo y el panorama intelectual del autor más importante de la alta Edad Media en España. Este artículo presenta una breve introducción al texto y el contexto de su producción así como una traducción al inglés de las dos versiones.

  8. Tradition and modernity in Marques of Tarifa pilgrimage to Jerusalem: Influence on the cultural heritage of Seville

    Directory of Open Access Journals (Sweden)

    María Encarnación Cambil Henández

    2015-12-01

    Full Text Available

    Tradition and modernity that characterizes the transition from the Middle Ages to the Modern Age in Spain, will be reflected in the pilgrimage trips to the Holy Land. During the sixteenth century, Christians travelers who came on pilgrimage to Jerusalem did their tour with a fundamentally religious and devotional interest. But he was not alone, as he joined other interests as the search of adventure, knowledge and business. During the journey, the pilgrim, full of emotion and spirituality, visiting shrines and relics for indulgences necessary for the good die and attain eternal life. However, during the return trip, and become traveler, carrying out other planned objectives becoming an experience that would later reflected in their environment and heritage. In this paper we analyze the stay of the Marquis of Tarifa in Jerusalem and his return trip to Seville, for his experience during these sections of the trip will be captured forever in the cultural landscape of the city of Seville.

  9. [Influence of postcode on paediatric admissions in Seville].

    Science.gov (United States)

    Tornero Patricio, Sebastián; Charris-Castro, Liliana; Granero Asencio, Mercedes; Daponte Codina, Antonio

    2017-12-01

    The postcode (where the home is situated) is an indicator of socioeconomic status and is associated with morbidity, mortality, and the use of health services. The aim of this study was to analyse its effects on paediatric admissions and to determine the rates of the most common causes of paediatric admissions in Seville. An observational cross-sectional study with two analysis units: under 15 year-old "admissions" in public hospitals in Seville (n=2,660) and "city districts" of Seville (n=11). The independent variable analysed was whether the postcode of the admitted patients was within a Regional Government designated "area with social transformation needs". The analysis of the admissions was performed using X 2 -test, Fisher test and Student-t test, with the description of rates using the calculation of crude and specific rates, and by rate ratio. Children living in districts with a lower socioeconomic status were on average 7 months younger (P<.001), and they were significantly more likely to be admitted via the emergency department (P<.001). There was no statistical difference detected in either the length of hospital stay or mortality. The crude admission rate ratio was higher in districts with a lower socioeconomic status (1.8), with a higher specific rate ratio detected in admissions due to asthma, respiratory infections, inguinal hernia, and epilepsy/convulsions. Paediatric hospital admission rates of the main diagnoses were higher in districts with a lower socioeconomic status. Children living in these districts were more likely to be admitted younger and via the emergency department. Copyright © 2016 Asociación Española de Pediatría. Publicado por Elsevier España, S.L.U. All rights reserved.

  10. An analysis of the black crusts from the Seville Cathedral: A challenge to deepen the understanding of the relationships among microstructure, microchemical features and pollution sources

    International Nuclear Information System (INIS)

    Ruffolo, Silvestro A.; Comite, Valeria; La Russa, Mauro F.; Belfiore, Cristina M.; Barca, Donatella; Bonazza, Alessandra; Crisci, Gino M.; Pezzino, Antonino

    2015-01-01

    The Cathedral of Seville is one of the most important buildings in the whole of southern Spain. It suffers, like most of the historical buildings located in urban environments, from several degradation phenomena related to the high pollution level. Undoubtedly, the formation of black crusts plays a crucial role in the decay of the stone materials belonging to the church. Their formation occurs mainly on carbonate building materials, whose interaction with a sulfur oxide-enriched atmosphere leads to the transformation of calcium carbonate (calcite) into calcium sulfate dihydrate (gypsum) which, together with embedded carbonaceous particles, forms the black crusts on the stone surface. To better understand the composition and the formation dynamics of this degradation product and to identify the pollutant sources and evaluate their impact on the stone material, an analytical study was carried out on the black crust samples collected from different areas of the building. For a complete characterization of the black crusts, several techniques were used, including laser ablation inductively coupled plasma mass spectrometry, Fourier transform infrared spectroscopy, micro infrared spectroscopy, optical and scanning electron microscopy. This battery of tests provided information about the nature and distribution of the mineralogical phases and the elements within the crusts and the crust-substrate interface, contributing to the identification of the major pollution sources responsible for the deterioration of the monument over time. In addition, the results revealed a relation among the height of sampling, the surface exposure and the concentration of heavy metals. Finally, information has been provided about the origin of the concentration gradients of some metals. - Highlights: • Black crusts from the Cathedral of Seville have been studied. • The impact of the pollution on the Cathedral of Seville has been assessed. • A geochemical study has been performed on black

  11. An analysis of the black crusts from the Seville Cathedral: A challenge to deepen the understanding of the relationships among microstructure, microchemical features and pollution sources

    Energy Technology Data Exchange (ETDEWEB)

    Ruffolo, Silvestro A., E-mail: silvestro.ruffolo@unical.it [Università della Calabria, Dipartimento di Biologia, Ecologia e Scienze della Terra (DiBEST), Via Pietro Bucci 87036, Arcavacata di Rende, CS (Italy); Comite, Valeria [Università della Calabria, Dipartimento di Biologia, Ecologia e Scienze della Terra (DiBEST), Via Pietro Bucci 87036, Arcavacata di Rende, CS (Italy); Dipartimento di Scienze Biologiche, Geologiche e Ambientali–Sezione di Scienze della Terra, Università di Catania, Corso Italia 57, 95129 Catania (Italy); La Russa, Mauro F. [Università della Calabria, Dipartimento di Biologia, Ecologia e Scienze della Terra (DiBEST), Via Pietro Bucci 87036, Arcavacata di Rende, CS (Italy); Belfiore, Cristina M. [Università della Calabria, Dipartimento di Biologia, Ecologia e Scienze della Terra (DiBEST), Via Pietro Bucci 87036, Arcavacata di Rende, CS (Italy); Dipartimento di Scienze Biologiche, Geologiche e Ambientali–Sezione di Scienze della Terra, Università di Catania, Corso Italia 57, 95129 Catania (Italy); Barca, Donatella [Università della Calabria, Dipartimento di Biologia, Ecologia e Scienze della Terra (DiBEST), Via Pietro Bucci 87036, Arcavacata di Rende, CS (Italy); Bonazza, Alessandra [Istituto di Scienze dell' Atmosfera e del Clima, ISAC-CNR, Via Gobetti 101, 40129 Bologna (Italy); Crisci, Gino M. [Università della Calabria, Dipartimento di Biologia, Ecologia e Scienze della Terra (DiBEST), Via Pietro Bucci 87036, Arcavacata di Rende, CS (Italy); Pezzino, Antonino [Dipartimento di Scienze Biologiche, Geologiche e Ambientali–Sezione di Scienze della Terra, Università di Catania, Corso Italia 57, 95129 Catania (Italy); and others

    2015-01-01

    The Cathedral of Seville is one of the most important buildings in the whole of southern Spain. It suffers, like most of the historical buildings located in urban environments, from several degradation phenomena related to the high pollution level. Undoubtedly, the formation of black crusts plays a crucial role in the decay of the stone materials belonging to the church. Their formation occurs mainly on carbonate building materials, whose interaction with a sulfur oxide-enriched atmosphere leads to the transformation of calcium carbonate (calcite) into calcium sulfate dihydrate (gypsum) which, together with embedded carbonaceous particles, forms the black crusts on the stone surface. To better understand the composition and the formation dynamics of this degradation product and to identify the pollutant sources and evaluate their impact on the stone material, an analytical study was carried out on the black crust samples collected from different areas of the building. For a complete characterization of the black crusts, several techniques were used, including laser ablation inductively coupled plasma mass spectrometry, Fourier transform infrared spectroscopy, micro infrared spectroscopy, optical and scanning electron microscopy. This battery of tests provided information about the nature and distribution of the mineralogical phases and the elements within the crusts and the crust-substrate interface, contributing to the identification of the major pollution sources responsible for the deterioration of the monument over time. In addition, the results revealed a relation among the height of sampling, the surface exposure and the concentration of heavy metals. Finally, information has been provided about the origin of the concentration gradients of some metals. - Highlights: • Black crusts from the Cathedral of Seville have been studied. • The impact of the pollution on the Cathedral of Seville has been assessed. • A geochemical study has been performed on black

  12. First description of a tooth of the extinct giant shark "Carcharocles megalodon" (Agassiz, 1835) found in the province of Seville (SW Iberian Peninsula) (Otodontidae)

    OpenAIRE

    Medina Gavilán, José Luis; Toscano Grande, Antonio; Muñiz Guinea, Fernando; Delgado, Francisco Javier

    2015-01-01

    Fossil remains of the extinct giant shark Carcharocles megalodon (Agassiz, 1835) are rare in interior Andalusia (Southern Spain). For the first time, a fossil tooth belonging to this paleospecies is described from material found in the province of Seville (Burguillos). Los restos del extinto tiburón gigante Carcharocles megalodon (Agassiz, 1835) son raros en el interior de Andalucía (sur de España). Por primera vez, se describe un diente fósil de esta paleoespecie a partir de m...

  13. The Catalog of illustrious Men of Isidore of Seville (CPL 1206: content and dating

    Directory of Open Access Journals (Sweden)

    José Carlos MARTÍN

    2014-04-01

    Full Text Available This paper presents the authors and writings cited by Isidore of Seville in his De uiris illustribus and study the use of them made by the bishop of Seville in the rest of his works. The conclusion is that the catalog of illustrious men is one of the oldest works of Isidore or perhaps the oldest.

  14. The Securing of a Precarious Commerce: Exchanges between Seville and Yucatan (1590- 1600

    Directory of Open Access Journals (Sweden)

    Manuela Cristina García Bernal

    2000-10-01

    Full Text Available This work underlines the importance of Yucatan's commercial relations across the Atlantic Ocean, as opposed to the traditional belief  that  these exchanges were small and  infrequent. Due to the margination and poverty of the province, in 1590 the Span­ish Crown granted Yucatan a license  to send two small  ships each year, with the necessary products. This license  allowed the securing of a trade that until  then had  been quite  precarious. This is why the quantitative and qualitative analyses of the move­ments of ships and merchandise between 1590 and 1600 lets us understand why, despite being considered secondary, this re­gion's commerce occupied, as seen from Seville, a considerable position among the  great amount of Atlantic trade. These analy­ses also reveal  why  during the  seventeenth  century Yucatan would come  to be  the  most  favored of the smaller posts along the Spain-Indies trading route.

  15. Factores de riesgo y eventos cardiovasculares en inmigrantes latinoamericanos adultos en el Distrito Macarena, Sevilla, España: estudio piloto Fatores de risco e eventos cardiovasculares em imigrantes latino americanos adultos no Distrito Macarena, Sevilla, Espanha: estudo piloto Risk factors and cardiovascular events in adult Latin American immigrants in the Macarena District, Seville, Spain: a pilot study

    Directory of Open Access Journals (Sweden)

    José Rafael González-López

    2013-04-01

    úde, este conhecimento deve ser considerada pelas enfermeiras para desenvolver planos de cuidados culturalmente apropriado do contexto dos imigrantes.In order to estimate the prevalence of self-reported risk factors and cardiovascular events in an adult immigrant Latin American population of District 2 (Macarena in Seville, we conducted a pilot study using cross-sectional descriptive research. We used an anonymous questionnaire with self-reported risk factors and cardiovascular events. 34 people participated (18% of the sample; mean age: 31.8 years, mean residence: 6.5 years, women: 52.9%. Prevalence of risk factors: diabetes 8.8%, high cholesterol 14.7% and high blood pressure 23.5%. Prevalence of coronary events was 8.8%; angina pectoris, myocardial infarction and stroke, 2.9% each. The conclusion is that self-reported prevalence of cardiovascular events was higher than in the literature, this issue deserving the attention of health agencies. This knowledge should be considered by nurses to develop culturally appropriate care plans of the context of immigrants.

  16. Financial Feasibility of Public Bike Rental Systems in Spain

    Energy Technology Data Exchange (ETDEWEB)

    Hernandez-Diaz, A.G.; Sastre, J.; Lopez-Sanchez, A.D.; Cuello, M.; Molina, J.

    2016-07-01

    In recent years, many public bike rental systems have proliferated in Spain. Unfortunately, many have had to close because of their poor financial feasibility. The aim of this paper is twofold. On the one hand, a benchmarking of the main public bicycle systems in Spain is conducted, analysing the growth in the last decades, with special emphasis on successful systems and on the recently failed. In addition, the financial feasibility of some successful systems in Spain is analysed: Seville, Valencia and Barcelona. Thus, major factors directly related to the viability of such systems are discussed. A proper and correct knowledge of these factors is essential when making decisions in mobility policies. The main factors on which the management company may decide are: pricing policy (annual and weekly rate), advertising rates, and system dimensions (number of docking stations, anchors and bicycles). There are other external factors not directly controlled by the company (subscribers, occupancy rate of advertising space and system maintenance cost) but which are crucial to their feasibility. To achieve the aforementioned objectives, mobility studies in Seville (1400 surveys) and Barcelona (1000 surveys) were conducted in order to achieve more accurate parameter values (time cycling, distances, used rate, frequencies, etc.). Despite the similarities between the systems in Valencia and Seville, they have shown very different profitability. The high profitability in Valencia and Barcelona is highlighted in contrast to the case of the Seville system. (Author)

  17. Artificial Intelligence Study (AIS).

    Science.gov (United States)

    1987-02-01

    ARTIFICIAL INTELLIGNECE HARDWARE ....... 2-50 AI Architecture ................................... 2-49 AI Hardware ....................................... 2...ftf1 829 ARTIFICIAL INTELLIGENCE STUDY (RIS)(U) MAY CONCEPTS 1/3 A~NLYSIS AGENCY BETHESA RD R B NOJESKI FED 6? CM-RP-97-1 NCASIFIED /01/6 M |K 1.0...p/ - - ., e -- CAA- RP- 87-1 SAOFŔ)11 I ARTIFICIAL INTELLIGENCE STUDY (AIS) tNo DTICFEBRUARY 1987 LECT 00 I PREPARED BY RESEARCH AND ANALYSIS

  18. T'ai Chi

    Science.gov (United States)

    ... are different styles of t'ai chi, including: Chen style Hao (or Wu Shi) style Hu Lei ... medical advice, diagnoses, and treatment, consult your doctor. © 1995- The Nemours Foundation. All rights reserved. Images provided ...

  19. Modeling Progress in AI

    OpenAIRE

    Brundage, Miles

    2015-01-01

    Participants in recent discussions of AI-related issues ranging from intelligence explosion to technological unemployment have made diverse claims about the nature, pace, and drivers of progress in AI. However, these theories are rarely specified in enough detail to enable systematic evaluation of their assumptions or to extrapolate progress quantitatively, as is often done with some success in other technological domains. After reviewing relevant literatures and justifying the need for more ...

  20. Areal Informations Systemet - AIS

    DEFF Research Database (Denmark)

    Nielsen, K.; Stjernholm, M.; Olsen, B. Ø.

    Forord: Denne rapport giver en kort beskrivelse af Areal Informations Systemet (AIS), som er et databasesystem med natur- og miljødata, som kan stedfæstes geografisk. Projektet er gennemført i perioden 1996-2000 som et samarbejdsprojekt mellem Danmarks Miljøundersøgelser (DMU), Danmarks og...... og enkeltpersoner med interesse for natur- og miljøforhold i Danmark. Yderligere oplysninger om Areal Informations Systemet, herunder adgangsforhold, kan fås på DMU's hjemmeside med følgende adresse: http://ais.dmu.dk/ Projektet er finansieret af Miljø- og Energiministeriet, mens en række...... (planlægning, beskyttelse), geologi (overfladegeologi og marin geologi), samt marin dybdemodel. # Etablering af dataadgang for Miljø- og Energiministeriets institutioner til AIS-data. # Afprøvning af systemet i forhold til konkrete projekter. # Formidling af produkterne til brugerkredsen....

  1. MassAI

    DEFF Research Database (Denmark)

    2011-01-01

    A software tool for general analysis and data-mining of mass-spectrometric datasets. The program features a strong emphasis on scan-by-scan identification and results-transparency. MassAI also accommodates residue level analysis of labelled runs, e.g. HDX.......A software tool for general analysis and data-mining of mass-spectrometric datasets. The program features a strong emphasis on scan-by-scan identification and results-transparency. MassAI also accommodates residue level analysis of labelled runs, e.g. HDX....

  2. Tweeting AI: Perceptions of AI-Tweeters (AIT) vs Expert AI-Tweeters (EAIT)

    OpenAIRE

    Manikonda, Lydia; Dudley, Cameron; Kambhampati, Subbarao

    2017-01-01

    With the recent advancements in Artificial Intelligence (AI), various organizations and individuals started debating about the progress of AI as a blessing or a curse for the future of the society. This paper conducts an investigation on how the public perceives the progress of AI by utilizing the data shared on Twitter. Specifically, this paper performs a comparative analysis on the understanding of users from two categories -- general AI-Tweeters (AIT) and the expert AI-Tweeters (EAIT) who ...

  3. AIS ASM Operational Integration Plan

    Science.gov (United States)

    2013-08-01

    Rack mount computer AIS Radio Interface Ethernet Switch 192.168.0.x Firewall Cable Modem 192.168.0.1 VTS Accred. Boundary AIS ASM Operational... AIS ASM Operational Integration Plan Distribution Statement A: Approved for public release; distribution is unlimited. August 2013 Report No...CD-D-07-15 AIS ASM Operational Integration Plan ii UNCLAS//Public | CG-926 R&DC | I. Gonin, et al. | Public August 2013 N O T I C

  4. General general game AI

    OpenAIRE

    Togelius, Julian; Yannakakis, Georgios N.; 2016 IEEE Conference on Computational Intelligence and Games (CIG)

    2016-01-01

    Arguably the grand goal of artificial intelligence research is to produce machines with general intelligence: the capacity to solve multiple problems, not just one. Artificial intelligence (AI) has investigated the general intelligence capacity of machines within the domain of games more than any other domain given the ideal properties of games for that purpose: controlled yet interesting and computationally hard problems. This line of research, however, has so far focuse...

  5. AI and health

    OpenAIRE

    Martin Anderson

    2018-01-01

    ntelligence refers to the ability of an individual to learn or understand something, or to deal with a new situation. When a machine or software exhibits such characteristics, it is referred to as artificial intelligence (AI). Artificial Intelligence is therefore defined as the theory and development of computer systems able to perform tasks that normally require human intelligence, such as visual perception, speech recognition, decision-making, and translation between languages.

  6. AI and Mathematical Education

    Directory of Open Access Journals (Sweden)

    Angel Garrido

    2012-01-01

    Full Text Available From ancient times, the history of human beings has developed by a succession of steps and sometimes jumps, until reaching the relative sophistication of the modern brain and culture. Researchers are attempting to create systems that mimic human thinking, understand speech, or beat the best human chess player. Understanding the mechanisms of intelligence, and creating intelligent artifacts are the twin goals of Artificial Intelligence (AI. Great mathematical minds have played a key role in AI in recent years; to name only a few: Janos Neumann (also known as John von Neumann, Konrad Zuse, Norbert Wiener, Claude E. Shannon, Alan M. Turing, Grigore Moisil, Lofti A. Zadeh, Ronald R. Yager, Michio Sugeno, Solomon Marcus, or Lászlo A. Barabási. Introducing the study of AI is not merely useful because of its capability for solving difficult problems, but also because of its mathematical nature. It prepares us to understand the current world, enabling us to act on the challenges of the future.

  7. The Heritage of Medieval Errors in the Latin Manuscripts of Johannes Hispalensis (John of Seville

    Directory of Open Access Journals (Sweden)

    Robinson, Maureen

    2007-06-01

    Full Text Available After the Christian reconquest of Islamic-held territory, many Arabic texts had to be translated into Latin in twelfth century Spain. Johannes Hispalensis (John of Seville knew both Arabic and Latin and worked alone, whereas others needed collaborators to complete the process. The duplication of Latin texts became popular and quickly spread. Over the following centuries, the medieval scribes involved made multiple copies of the manuscripts and during the reproduction process, many errors occurred. These contributed to confusion between the correct version of the translator's name and his identity. Consequently, Hispalensis appeared in later copies of his work with various titles such as “Master” or “Bishop”, or was coupled with a collaborator. Modern-day historians added to the complexities by creating one personality out of two diverse translators. At times, the ownership of some of the manuscripts rested solely on the names appearing in them, when only scribal errors had contributed them. An attempt is made to clarify the translations accredited to Johannes Hispalensis, working alone, and those working with collaborators.

    Después de la Reconquista, se tuvieron que traducir al latín muchos textos árabes en la España del siglo XII. La mayoría de los copistas necesitaban colaboradores para concluir el proceso, sin embargo, Johannes Hispalensis (Juan de Sevilla conocía tanto la lengua árabe como el latín, por lo que podía trabajar solo. La duplicación de textos latinos se popularizó y divulgó rápidamente. Durante los siglos siguientes, los copistas medievales hicieron múltiples copias, y durante el proceso de reproducción cometieron muchos errores que contribuyeron a la confusión entre la versión correcta del nombre del traductor y su identidad.  Por consiguiente, Hispalensis apareció en copias

  8. AI 3D Cybug Gaming

    OpenAIRE

    Ahmed, Zeeshan

    2010-01-01

    In this short paper I briefly discuss 3D war Game based on artificial intelligence concepts called AI WAR. Going in to the details, I present the importance of CAICL language and how this language is used in AI WAR. Moreover I also present a designed and implemented 3D War Cybug for AI WAR using CAICL and discus the implemented strategy to defeat its enemies during the game life.

  9. AI its nature and future

    CERN Document Server

    Boden, Margaret A

    2016-01-01

    least - on the Internet. Margaret Boden considers the realistic and unrealistic expectations we have placed on AI, analyses its progress, and considers the value of its byproducts. ations we have placed on AI, analyses its progress, and considers the value of its byproducts.

  10. Spain. Women in the world.

    Science.gov (United States)

    Galindo, E; Serrano, N

    1994-08-01

    Spanish women live almost 2 times longer today than did their great grandmothers (60-65 years vs. 35). Contraception is more accessible, resulting in fewer pregnancies and their complications. The National Health Service of Spain provides women and their families medical care. Yet, women's health risks continue. Class, race, and geography result in women having uneven access to medical care. Primary health care services are not a priority as are high- technology hospitals. Women, who already lead a busy life, still care for older people or people with disabilities. Many households have a very limited or no income and depend on welfare benefits or family. There are more women than men who are poor because women, many of whom are single, are raising large families and many live alone. Women are often the victims of violence and of domestic abuse (1993, 86 violent deaths and 200,000 cases of abuse by a partner). Spain has laws that protect women facing divorce and that allow abortion, but men have created the world order. Women suffer daily in a world which does not recognize rape and sexual harassment as war crimes (e.g., former Yugoslavia). In Seville, the Solidarity Network of Women in Black is a pacifist group working to stop violence. They plan on setting up links to publicly denounce and act against all aggression and to institutionalize women's right to full freedom. War is destroying women's lives.

  11. Code AI Personal Web Pages

    Science.gov (United States)

    Garcia, Joseph A.; Smith, Charles A. (Technical Monitor)

    1998-01-01

    The document consists of a publicly available web site (george.arc.nasa.gov) for Joseph A. Garcia's personal web pages in the AI division. Only general information will be posted and no technical material. All the information is unclassified.

  12. Analytical investigation of Mudéjar polychrome on the carpentry in the Casa de Pilatos palace in Seville using non-destructive XRF and complementary techniques

    Science.gov (United States)

    Garrote, M. A.; Robador, M. D.; Perez-Rodriguez, J. L.

    2017-02-01

    The pigments, execution technique and repainting used on the polychrome wood ceilings and doors in the Casa de Pilatos (Seville, Spain) were studied using portable X-ray fluorescence equipment. Cross-sections of small samples were also analysed by optical microscopy, SEM with EDX analysis, micro-Raman and micro-infrared spectroscopy and X-ray diffraction. These carpentry works are magnificent examples of the Mudéjar art made in Spain in the early 16th century. Portable X-ray fluorescence gave good information on the different components of the polychrome. The SEM-EDX study of the surfaces of small samples gave information on their components and also characterized the compounds that had been deposited or formed by environmental contamination or by the alteration of some pigments. The SEM-EDX study of cross-sections facilitated the characterization of all layers and pigments from the support to the most external layer. The following pigments were characterized: red (cinnabar/vermillion, lead oxide, iron oxides and orpiment/realgar), black (carbon black), white (white lead and titanium barium white), yellow-orange-red-brown (orpiment/realgar and iron oxides), green (chromium oxide), blue (indigo blue and ultramarine blue), and gilding (gold leaf on bole). False gold, bronze and brass were also found. The pigments were applied with the oil painting technique over a support layer that had been primed with animal glue. This support layer was gypsum in some cases and white lead in others. This study is essential to the polychrome conservation of the studied artwork, and it will help clarify uncertainties in the history and painting of Mudéjar art.

  13. Analytical investigation of Mudéjar polychrome on the carpentry in the Casa de Pilatos palace in Seville using non-destructive XRF and complementary techniques.

    Science.gov (United States)

    Garrote, M A; Robador, M D; Perez-Rodriguez, J L

    2017-02-15

    The pigments, execution technique and repainting used on the polychrome wood ceilings and doors in the Casa de Pilatos (Seville, Spain) were studied using portable X-ray fluorescence equipment. Cross-sections of small samples were also analysed by optical microscopy, SEM with EDX analysis, micro-Raman and micro-infrared spectroscopy and X-ray diffraction. These carpentry works are magnificent examples of the Mudéjar art made in Spain in the early 16th century. Portable X-ray fluorescence gave good information on the different components of the polychrome. The SEM-EDX study of the surfaces of small samples gave information on their components and also characterized the compounds that had been deposited or formed by environmental contamination or by the alteration of some pigments. The SEM-EDX study of cross-sections facilitated the characterization of all layers and pigments from the support to the most external layer. The following pigments were characterized: red (cinnabar/vermillion, lead oxide, iron oxides and orpiment/realgar), black (carbon black), white (white lead and titanium barium white), yellow-orange-red-brown (orpiment/realgar and iron oxides), green (chromium oxide), blue (indigo blue and ultramarine blue), and gilding (gold leaf on bole). False gold, bronze and brass were also found. The pigments were applied with the oil painting technique over a support layer that had been primed with animal glue. This support layer was gypsum in some cases and white lead in others. This study is essential to the polychrome conservation of the studied artwork, and it will help clarify uncertainties in the history and painting of Mudéjar art. Copyright © 2016 Elsevier B.V. All rights reserved.

  14. Spain's greatest and most recent mine disaster.

    Science.gov (United States)

    Guerrero, Flor Ma; Lozano, Macarena; Rueda-Cantuche, José M

    2008-03-01

    On 25 April 1998, the mineral waste retaining wall at the Swedish-owned pyrite mine at Aznalcóllar (Seville, Spain) burst, causing the most harmful environmental and socio-economic disaster in the history of the River Guadiamar basin. The damage was so great that the regional government decided in May 1998 to finance a comprehensive, multidisciplinary research initiative with the objective of eradicating or at least minimising all of the negative social, economic and environmental impacts. This paper utilises a Strengths, Weaknesses, Opportunities and Threats (SWOT) analysis to identify eight strategic measures aimed at providing policymakers with key guidelines on implementing a sustainable development model, in a broad sense. Empirical evidence, though, reveals that, to date, major efforts to tackle the negative impacts have centred on environmental concerns and that the socio-economic consequences have not been completely mitigated.

  15. The former school of San Buenaventura in Seville: new graphic documents

    Directory of Open Access Journals (Sweden)

    Alberto Fernández González

    2018-05-01

    Full Text Available Built in the first decades of the 17th century, the San Buenaventura Convent-School was an important architectural ensemble in the historic centre of Seville, which was demolished, almost entirely, in the mid-19th century due to roadwork carried out in the area around the present Plaza Nueva. In this article, the result of research carried out in the General Military Archive of Madrid, the author analyses and divulges the floor plan and section of the building. These graphic documents, drawn by the academic architect Juan Manuel Caballero in 1847, are extremely interesting because they reproduce the exact organization of the architecture of this Franciscan school. To complete this study, an anonymous 1687 description of the building has been recovered.

  16. Brick durability and conservation treatment (Santa María de Jesús chapel portal, Seville, Spain

    Directory of Open Access Journals (Sweden)

    Villegas, R.

    2009-03-01

    Full Text Available Durability differences of 2 types of brick from Santa María de Jesús Chapel (Sevilla and 2 treatments for its restoration have been studied. They have been characterizad using XRD and SEM, as well as their physical, hydric and mechanical properties. Samples prepared with bricks from the chapel have been submitted to salt crystallization test, to identify decay causes and mechanisms.The red brick present the lowest firing temperature, lower porosity and a great proportion of micropores. Physical and mechanical properties don’t change significantly with the treatments, only hygric properties vary with the water repellent. The accelerated aging test revealed significant improvement in the behaviour of yellow brick, but no change in the decay mechanism of red brick (Typical of microporous materials or its durability is observed.Se ha estudiado la alteración diferencial de los 2 tipos de ladrillo de la iglesia de Santa María de Jesús (Sevilla y 2 tratamientos para su restauración. Se han caracterizado por DRX y SEM, así como sus propiedades físicas, hídricas y mecánicas. Probetas preparadas de ladrillos de la iglesia se han sometido a ensayo de cristalización de sales para determinar las causas y los mecanismos de alteración.El ladrillo rojo es el que presenta menor temperatura de cocción, menor porosidad y mayor proporción de microporos. Las propiedades físicas y mecánicas de ambos ladrillos no varían significativamente con los tratamientos, sólo las propiedades hídricas cambian con el hidrófugo. En el ensayo de alteración mejora mucho el comportamiento del ladrillo amarillo, mientras que en el rojo no varía la morfología de alteración (características de materiales con microporos ni la durabilidad.

  17. Colorimetric study of the tiles in Patio de las Doncellas of the Real Alcazar of Seville (Spain)

    International Nuclear Information System (INIS)

    Melgosa, M.; Collado-Montero, F. J.; Fernandez, E.; Medina, V. J.

    2015-01-01

    Colorimetric and goniocolorimetric measurements of 187 tiles in the lower gallery of Patio de las Doncellas (14 t h Century) have been performed. They can be grouped around 5 main colors: white, black, blue, green and orange. Conventional color measurements proved to be insufficient for most of the samples whose goniochromatic nature requires the use of goniocolorimeters for proper characterization. The main color changes appeared from -15 degree (close to the specular direction) to +45 degree centigrade (direction perpendicular to the sample) and consisted of a lightness (L*) decrease and a chroma (C* a b) increase. For the black samples, there was also a pronounced decrease of hue-angle (hab), as well as a high value of 16.0 for the lightness-flop index. The black and orange samples had a metallic appearance, as indicated by average metallic index values greater than 5.0. Considering a displacement between the two extreme angles of -15 degree centigrade and +110 degree centigrade, the average CIELAB color differences were considerably high, ranging from 4.1 (white group) to 31.2 (orange group). Current methods and results for the tiles in Patio de las Doncellas may be useful for future work of conservators. (Author)

  18. EIAMUO methodology for environmental assessment of the post-war housing estates renovation: Practical application in Seville (Spain)

    International Nuclear Information System (INIS)

    Garrido-Piñero, Julia; Mercader-Moyano, Pilar

    2017-01-01

    This paper reports on the environmental impact assessment of a specific urban fabric: the housing estate. This urban-growth typology arose in the second half of the twentieth century to supply the existing needs of the time. It involved short-term processes, reduced costs, and lower comfort standards, which are far from present European guidelines. Currently, they represent situations of unsustainability in cities worldwide that are undergoing improvement. Here, the environmental impact assessment and minimization for urban organisms (EIAMUO) methodology is presented. This consists of a system of eco-indicators created specifically for estimating the impacts associated with these fabrics. Through its practical application, a snapshot of the current situation is achieved and the targets designed to minimize the environmental impact are proposed. - Highlights: • An environmental-impact minimization methodology for housing estates is proposed. • The paper presents a new definition for city analysis: urban organism. • The areas for the assessment are energy, water, materials and waste and atmosphere. • Energy and water areas determine most of the housing estate environmental behavior. • The building character prevails in the urban organism's environmental assessment.

  19. Nominal Address and Rapport Management in Informal Interactions among University Students in Quito (Ecuador), Santiago (Chile) and Seville (Spain)

    Science.gov (United States)

    Placencia, María Elena; Fuentes Rodríguez, Catalina; Palma-Fahey, María

    2015-01-01

    Nominal and pronominal address forms, which play a central role in the construction of interpersonal relations (cf. Bargiela et al. 2002; Clyne et al. 2009), have been the focus of attention in different linguistics subfields for several decades now. Less attention, however, has been paid to these forms from a variational pragmatics (Schneider and…

  20. harnessing_ai_20180319.pptx

    OpenAIRE

    Johnson, Matthew

    2018-01-01

    There have been great strides made in Artificial Intelligence in recent years, but it is often not clear how to apply these recent advances to new problems. In this talk I propose one method of thinking about problems in the sciences and how to find the right AI techniques to aid in research.

  1. Organisational intelligence and distributed AI

    OpenAIRE

    Kirn, Stefan

    1995-01-01

    The analysis of this chapter starts from organisational theory, and from this it draws conclusions for the design, and possible organisational applications, of Distributed AI systems. We first review how the concept of organisations has emerged from non-organised black-box entities to so-called computerised organisations. Within this context, organisational researchers have started to redesign their models of intelligent organisations with respect to the availability of advanced computing tec...

  2. Optimizing Limousine Service with AI

    OpenAIRE

    Chun, Andy Hon Wai

    2011-01-01

    A common problem for companies with strong business growth is that it is hard to find enough experienced staff to support expansion needs. This problem is particular pronounced for operations planners and controllers who must be very highly knowledgeable and experienced with the business domain. This article is a case study of how one of the largest travel agencies in Hong Kong alleviated this problem by using AI to support decision-making and problem-solving so that their planners and contro...

  3. Physical activity practice´s characteristics of students of Faculty of Education (University of Seville

    Directory of Open Access Journals (Sweden)

    Carolina Castañeda Vázquez

    2012-02-01

    Full Text Available The aim of this research is to know about students´ physical activity from Faculty of Education of University of Seville, and its characteristics.The sample (N=409 is constituted for students from the different degrees of this Faculty (±4.8%; 95%CI. A specific questionnaire, built to that effect, was used to obtain dates. This instrument was validated by different experts on this area of studies, and statistic tests was done to check its reliability (Alpha Cronbach: .78 using SPSS V.15. The main results showed that 62.19% of students do physical activity regularly. Students prefer recreational activities or exercise aimed at being fit or watching health instead competitive games. Activities done by students inside University are very similar to activities done out of this. They also do exercise during all academic year, preferably along the all week or from Monday to Friday, and especially in the afternoon. This group usually practice with friends, classmates or workmates, but lonely too, and they prefer public areas and public or private sport facilities for their sport practice.Key Words: University students, physical activity practice, leisure time.

  4. Study of the Wall Paintings of the Cenador Del Leon in the Real Alcazar of Seville

    Science.gov (United States)

    Robador, Maria Dolores; Mancera, Inmaculada; Perez-Maqueda, Rafael; Albardonedo, Antonio

    2017-10-01

    The paintings on the walls of the Cenador del Leon located in the gardens of the Real Alcazar in Seville next to the Pabellon de Carlos V in the Jardin Ingles area have been studied. The components of the wall paintings cross-sections, which were prepared using small samples taken from the walls of Cenador del Leon, were characterized using infrared spectroscopy (FTIR), X-ray diffraction (XRD) and scanning electron microscopy (SEM) with energy dispersive X-ray (EDX) analysis. The cross-sections of the collected samples indicated that the paint layer is well adhered to the preparation layer without any discontinuity, and only one carbonation layer exists at the top of the sequence of layers. These data suggest that the paint was applied on a fresco surface, and therefore, the adopted technique was fresco. Based on the different elements detected by EDX analysis of the cross-sections, the detected pigments included iron oxides accompanied by clay minerals (or earths) in the red pink, golden yellow and yellow colours, blue smelt for the blue colour and basic copper chloride (atacamite) for the green colour. In one sample, the particles were composed of Ba and S from barium sulphate and Ti and O from rutile titanium oxide due to a modern pigment.

  5. Focus: Spain

    International Nuclear Information System (INIS)

    Ferguson, M.P.

    1992-01-01

    Historically, Spain's nuclear program has had its share of successes and challenges. The country currently operates nine nuclear reactors totalling over 7,100 MWe of capacity and accounting for more than a third of Spain's electricity generation. Yet four reactors at advanced stages of construction remain mothballed due to a government-imposed moratorium, and a fire at one reactor in 1989 led to its premature closure and to a revival of anti-nuclear sentiment in the country. In the new national energy plan, Spain opted to continue the moratorium and rely upon conservation measures, additional natural gas imports, and electricity imports to meet expected demand. The current nuclear facilities will continue to operate, and the government will continue to pursue advanced reactor research, and expansion of the country's domestic uranium industry. Spain's integration into the European Community also is affecting the country's energy plans, prompting consolidation within the Spanish electricity sector in order to be more competitive in Europe

  6. An SDR based AIS receiver for satellites

    DEFF Research Database (Denmark)

    Larsen, Jesper Abildgaard; Mortensen, Hans Peter; Nielsen, Jens Frederik Dalsgaard

    2011-01-01

    For a few years now, there has been a high interest in monitoring the global ship traffic from space. A few satellite, capable of listening for ship borne AIS transponders have already been launched, and soon the AAUSAT3, carrying two different types of AIS receivers will also be launched. One...... of the AIS receivers onboard AAUSAT3 is an SDR based AIS receiver. This paper serves to describe the background of the AIS system, and how the SDR based receiver has been integrated into the AAUSAT3 satellite. Amongst some of the benefits of using an SDR based receiver is, that due to its versatility, new...... detection algorithms are easily deployed, and it is easily adapted the new proposed AIS transmission channels....

  7. USACE AIS Transmit Technical Support Summary Report

    Science.gov (United States)

    2014-09-01

    the TAG block for the correct transmitters, and then send to the USACE AIS network. B. Outbound openings in the USCG firewall for the USCG Message...USACE AIS Transmit Technical Support Summary Report Distribution Statement A: Approved for public release; distribution is unlimited...September 2014 Report No. CD-D-09-15 USACE AIS Transmit Technical Support Summary Report ii UNCLAS//Public | CG-926 RDC | I. Gonin et al. Public

  8. Adaptive Motion Gaming AI for Health Promotion

    OpenAIRE

    Paliyawan, Pujana; Kusano, Takahiro; Nakagawa, Yuto; Harada, Tomohiro; Thawonmas, Ruck

    2017-01-01

    This paper presents a design of a non-player character (AI) for promoting balancedness in use of body segments when engaging in full-body motion gaming. In our experiment, we settle a battle between the proposed AI and a player by using FightingICE, a fighting game platform for AI development. A middleware called UKI is used to allow the player to control the game by using body motion instead of the keyboard and mouse. During gameplay, the proposed AI analyze health states of the player; it d...

  9. Beyond AI: Artificial Dreams Conference

    CERN Document Server

    Zackova, Eva; Kelemen, Jozef; Beyond Artificial Intelligence : The Disappearing Human-Machine Divide

    2015-01-01

    This book is an edited collection of chapters based on the papers presented at the conference “Beyond AI: Artificial Dreams” held in Pilsen in November 2012. The aim of the conference was to question deep-rooted ideas of artificial intelligence and cast critical reflection on methods standing at its foundations.  Artificial Dreams epitomize our controversial quest for non-biological intelligence, and therefore the contributors of this book tried to fully exploit such a controversy in their respective chapters, which resulted in an interdisciplinary dialogue between experts from engineering, natural sciences and humanities.   While pursuing the Artificial Dreams, it has become clear that it is still more and more difficult to draw a clear divide between human and machine. And therefore this book tries to portrait such an image of what lies beyond artificial intelligence: we can see the disappearing human-machine divide, a very important phenomenon of nowadays technological society, the phenomenon which i...

  10. The London Charter and the Seville Principles as sources of requirements for e-archaeology systems development purposes

    Directory of Open Access Journals (Sweden)

    Juan M. Carrillo Gea

    2013-11-01

    Full Text Available Requirements engineering (RE is a discipline of critical importance in software development. This paper provides a process and a set of software artefacts to help in the production of e-archaeology systems with emphasis on requirements reuse and standards. In particular, two important guidelines in the field of earchaeology, the London Charter and the Principles of Seville, have been shown as two sources of requirements to be considered as a starting point for developing this type of systems.

  11. JGOMAS: New Approach to AI Teaching

    Science.gov (United States)

    Barella, A.; Valero, S.; Carrascosa, C.

    2009-01-01

    This paper presents a new environment for teaching practical work in AI subjects. The main purpose of this environment is to make AI techniques more appealing to students and to facilitate the use of the toolkits which are currently widely used in research and development. This new environment has a toolkit for developing and executing agents,…

  12. Adaptive game AI with dynamic scripting

    NARCIS (Netherlands)

    Spronck, P.; Ponsen, M.J.V.; Sprinkhuizen-Kuyper, I.G.; Postma, E.O.

    2006-01-01

    Online learning in commercial computer games allows computer-controlled opponents to adapt to the way the game is being played. As such it provides a mechanism to deal with weaknesses in the game AI, and to respond to changes in human player tactics.We argue that online learning of game AI should

  13. The Relevance of AI Research to CAI.

    Science.gov (United States)

    Kearsley, Greg P.

    This article provides a tutorial introduction to Artificial Intelligence (AI) research for those involved in Computer Assisted Instruction (CAI). The general theme is that much of the current work in AI, particularly in the areas of natural language understanding systems, rule induction, programming languages, and socratic systems, has important…

  14. Nonlinear study of AI Velorum

    International Nuclear Information System (INIS)

    Cox, A.N.; Hodson, S.W.

    1979-01-01

    Using results from earlier studies of double-mode dwarf Cepheids by Cox, King, and Hodson, hydrodynamic calculations were undertaken for AI Vel. The earlier derived evolution theory mass of 1.8 M sub solar, a luminosity of of 23 L sub solar and a T/sub e/ of 7500 0 K give the observed period of 0.11 day and the observed period ratio PI 1 /PI 0 = 0.773. A cooler T/sub e/ than the observed one (7620 0 K) was used because 7620 0 K is beyond the fundamental pulsation mode blue edge. The composition used is X = 0.70 Z = 0.01. This lower than normal Z is necessary to make the period ratio as large as observed. The goal is to see if double-mode behavior, due to either mode switching or a permanent state, can be predicted for the model. Progress in converging the model to a periodic pulsation solution by the von Sengbusch--Stellingwerf relaxation method will be reported. 17 references

  15. Artificial intelligence. Fears of an AI pioneer.

    Science.gov (United States)

    Russell, Stuart; Bohannon, John

    2015-07-17

    From the enraged robots in the 1920 play R.U.R. to the homicidal computer H.A.L. in 2001: A Space Odyssey, science fiction writers have embraced the dark side of artificial intelligence (AI) ever since the concept entered our collective imagination. Sluggish progress in AI research, especially during the “AI winter” of the 1970s and 1980s, made such worries seem far-fetched. But recent breakthroughs in machine learning and vast improvements in computational power have brought a flood of research funding— and fresh concerns about where AI may lead us. One researcher now speaking up is Stuart Russell, a computer scientist at the University of California, Berkeley, who with Peter Norvig, director of research at Google, wrote the premier AI textbook, Artificial Intelligence: A Modern Approach, now in its third edition. Last year, Russell joined the Centre for the Study of Existential Risk at Cambridge University in the United Kingdom as an AI expert focusing on “risks that could lead to human extinction.” Among his chief concerns, which he aired at an April meeting in Geneva, Switzerland, run by the United Nations, is the danger of putting military drones and weaponry under the full control of AI systems. This interview has been edited for clarity and brevity.

  16. "All-In-One Test" (AI1)

    DEFF Research Database (Denmark)

    Giacalone, Davide; Bredie, Wender Laurentius Petrus; Frøst, Michael Bom

    2013-01-01

    by the Check-All-That-Apply (CATA) technique is reported. In this exploratory "All-In-One Test"(AI1), subjects (N = 160) filled out a questionnaire with demographic and psychographic variables, and appropriateness ratings for specific sensory descriptors of beer. Subsequently, subjects gave hedonic ratings...... between appropriateness and actual hedonic response. Overall, the AI1 test provided interpretable results concerning consumer perception (sensory/hedonic) of the beers, and revealed relations with consumers' background information. Initial results with AI1 test show that it is an efficient and versatile...

  17. Health Information in French (français)

    Science.gov (United States)

    ... Biopsy - français (French) Bilingual PDF Health Information Translations Breast Biopsy - français (French) Bilingual PDF Health Information Translations Colposcopy - français (French) Bilingual PDF ...

  18. AIS Ship Traffic: Hawaii: 2011-2012

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Ship position data from a satellite-based Automatic Identification System (AIS) were obtained jointly by PacIOOS (J. Potemra), SOEST/ORE of the University of Hawaii...

  19. Cracks appear in the AI gravy train

    Energy Technology Data Exchange (ETDEWEB)

    Mill, J.

    1983-10-01

    This article highlights some of the problems facing the Alvey committee and outlines some reasons for believing that the optimistically founded Alvey and Esprit funding programmes are no guarantee Britain will win the AI race.

  20. National AIS at 1 Minute Intervals

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — OCM plans to contract for AIS data per the following description. The United States Automatic Identification System Database contains vessel traffic data for...

  1. AI applications in sheet metal forming

    CERN Document Server

    Hussein, Hussein

    2017-01-01

    This book comprises chapters on research work done around the globe in the area of artificial intelligence (AI) applications in sheet metal forming. The first chapter offers an introduction to various AI techniques and sheet metal forming, while subsequent chapters describe traditional procedures/methods used in various sheet metal forming processes, and focus on the automation of those processes by means of AI techniques, such as KBS, ANN, GA, CBR, etc. Feature recognition and the manufacturability assessment of sheet metal parts, process planning, strip-layout design, selecting the type and size of die components, die modeling, and predicting die life are some of the most important aspects of sheet metal work. Traditionally, these activities are highly experience-based, tedious and time consuming. In response, researchers in several countries have applied various AI techniques to automate these activities, which are covered in this book. This book will be useful for engineers working in sheet metal industri...

  2. Learning game AI programming with Lua

    CERN Document Server

    Young, David

    2014-01-01

    If you are a game developer or a general programmer who wishes to focus on programming systems and techniques to build your game AI without creating low-level interfaces in a game engine, then this book is for you. Knowledge of C++ will come in handy to debug the entirety of the AI sandbox and expand on the features present within the book, but it is not required.

  3. Adaptive game AI with dynamic scripting

    OpenAIRE

    Spronck, P.; Ponsen, M.J.V.; Sprinkhuizen-Kuyper, I.G.; Postma, E.O.

    2006-01-01

    Online learning in commercial computer games allows computer-controlled opponents to adapt to the way the game is being played. As such it provides a mechanism to deal with weaknesses in the game AI, and to respond to changes in human player tactics.We argue that online learning of game AI should meet four computational and four functional requirements. The computational requirements are speed, effectiveness, robustness and ef- ficiency. The functional requirements are clarity, variety, consi...

  4. Research Directions for AI in Computer Games

    OpenAIRE

    Fairclough, Chris; Fagan, Michael; Cunningham, Padraig; Mac Namee, Brian

    2001-01-01

    The computer games industry is now bigger than the film industry. Until recently, technology in games was driven by a desire to achieve real-time, photo-realistic graphics. To a large extent, this has now been achieved. As game developers look for new and innovative technologies to drive games development, AI is coming to the fore. This paper will examine how sophisticated AI techniques, such as those being used in mainstream academic research, can be applied to computer games ...

  5. Characterization and recovery proposal of polymer mortar coating plates of the parish of San Pablo in Seville

    Directory of Open Access Journals (Sweden)

    V. Flores-Alés

    2017-06-01

    Full Text Available This paper deals with the study of the facade elements of the parish of San Pablo in Seville (1961. They are made with polymer mortar. A characterization of the coating plates was carried out and possible solutions for recovering the altered material were analyzed in order to facilitate a future intervention. The resins used as a binder were identified as aliphatic polyester. The resin study was carried out to assure the compatibility of restoration products. Materials characterization provides information about the structural capacity of the plates and the properties achieved. The plates’ colorimetric control is an inexcusable necessity, since any action on the surface of the pieces leads to a color change. All the analyses and testing carried out have led to the creation of an appropriate treatment system for recovery of the plates that provides sufficient information to the intervention project managers to justify decision-making.

  6. El deporte en la ciudad de Sevilla durante el siglo XV=Sports in Seville during the XVth century

    Directory of Open Access Journals (Sweden)

    Gonzalo Ramírez Macías

    2013-03-01

    Full Text Available Esta investigación tiene como finalidad fundamental conocer y caracterizar los deportes que eran practicados durante el siglo XV en la ciudad de Sevilla, una de las capitales castellanas que más prosperidad experimentó en esa centuria. La primera parte de este estudio está dedicada a justificar y fundamentar la investigación, en la segunda parte se expone la metodología de investigación propuesta, la cual tiene un carácter novedoso dentro de la historia del deporte. En tercer lugar se presentan y analizan los resultados obtenidos en el estudio, que indican que los deportes practicados durante el siglo XV en la ciudad de Sevilla eran: juego de cañas, correr la sortija, correr monte, justas, torneos, carreras pedestres, carreras a caballo y correr toros. Finalmente se exponen las conclusiones de la investigación las cuales se fundamentan en los resultados de la misma y en las aportaciones de otros estudios anteriores.--------------------------------------------------------------------------The main purpose of this research is to know and characterize the sports practised during the XVth century in Seville, one of the most prosperous Castilian capitals at that time. The first part of this research is devoted to its justification and basis, whereas the second part puts forward the research methodology suggested, which has a new nature within the history of Sports. Thirdly, the results obtained in the research are presented and analysed, what points out that the sports practised during the XVth Century in Seville were: cane games,*correr la sortija, **correr monte, jousts, tournaments, races, horse races and bull races. Finally, the research conclusions are expounded, which are based on its results and on other contributions from previous researches.*Correr la sortija: A game in which two players riding horses had to catch a ring with a spear.**Correr monte: to hunt

  7. Beyond AI: Interdisciplinary Aspects of Artificial Intelligence

    CERN Document Server

    Romportl, Jan; Zackova, Eva; Beyond Artificial Intelligence : Contemplations, Expectations, Applications

    2013-01-01

    Products of modern artificial intelligence (AI) have mostly been formed by the views, opinions and goals of the “insiders”, i.e. people usually with engineering background who are driven by the force that can be metaphorically described as the pursuit of the craft of Hephaestus. However, since the present-day technology allows for tighter and tighter mergence of the “natural” everyday human life with machines of immense complexity, the responsible reaction of the scientific community should be based on cautious reflection of what really lies beyond AI, i.e. on the frontiers where the tumultuous ever-growing and ever-changing cloud of AI touches the rest of the world.   The chapters of this boo are based on the selected subset of the presentations that were delivered by their respective authors at the conference “Beyond AI: Interdisciplinary Aspects of Artificial Intelligence” held in Pilsen in December 2011.   From its very definition, the reflection of the phenomena that lie beyond AI must be i...

  8. Two new Oxalis species (Oxalidaceae) from the Ai-Ais / Richtersveld Transfrontier Park, South Africa

    NARCIS (Netherlands)

    Roets, F.; Oberlander, K.C.; Dreyer, L.L.

    2012-01-01

    South Africa has a rich, but scantily surveyed, desert flora. Documenting annual and geophytic species in this biome is challenging, as they usually only flower after adequate precipitation, which is characteristically erratic and infrequent. Recent floristic surveys in the Ai-Ais / Richtersveld

  9. Use of AI-1024 and AI-4096 analyzers in multiple regimes

    International Nuclear Information System (INIS)

    Zaika, N.D.; Kovtunenko, I.S.; Savchuk, O.G.

    1975-01-01

    The operation of pulse multichannel analyzers in the following multidimensional modes: AI-1024-4 - amplitude mode from several transducers; amplitude mode from several transducers at different time intervals; AI-4096-3M - amplitude mode at different time intervals in each of four groups with unit BVI-1

  10. Artificial Intelligence Safety and Cybersecurity: a Timeline of AI Failures

    OpenAIRE

    Yampolskiy, Roman V.; Spellchecker, M. S.

    2016-01-01

    In this work, we present and analyze reported failures of artificially intelligent systems and extrapolate our analysis to future AIs. We suggest that both the frequency and the seriousness of future AI failures will steadily increase. AI Safety can be improved based on ideas developed by cybersecurity experts. For narrow AIs safety failures are at the same, moderate, level of criticality as in cybersecurity, however for general AI, failures have a fundamentally different impact. A single fai...

  11. Tweeting AI: Perceptions of Lay vs Expert Twitterati

    OpenAIRE

    Manikonda, Lydia; Kambhampati, Subbarao

    2017-01-01

    With the recent advancements in Artificial Intelligence (AI), various organizations and individuals are debating about the progress of AI as a blessing or a curse for the future of the society. This paper conducts an investigation on how the public perceives the progress of AI by utilizing the data shared on Twitter. Specifically, this paper performs a comparative analysis on the understanding of users belonging to two categories -- general AI-Tweeters (AIT) and expert AI-Tweeters (EAIT) who ...

  12. Strategic Team AI Path Plans: Probabilistic Pathfinding

    Directory of Open Access Journals (Sweden)

    Tng C. H. John

    2008-01-01

    Full Text Available This paper proposes a novel method to generate strategic team AI pathfinding plans for computer games and simulations using probabilistic pathfinding. This method is inspired by genetic algorithms (Russell and Norvig, 2002, in that, a fitness function is used to test the quality of the path plans. The method generates high-quality path plans by eliminating the low-quality ones. The path plans are generated by probabilistic pathfinding, and the elimination is done by a fitness test of the path plans. This path plan generation method has the ability to generate variation or different high-quality paths, which is desired for games to increase replay values. This work is an extension of our earlier work on team AI: probabilistic pathfinding (John et al., 2006. We explore ways to combine probabilistic pathfinding and genetic algorithm to create a new method to generate strategic team AI pathfinding plans.

  13. AI Researchers, Video Games Are Your Friends!

    OpenAIRE

    Togelius, Julian

    2016-01-01

    If you are an artificial intelligence researcher, you should look to video games as ideal testbeds for the work you do. If you are a video game developer, you should look to AI for the technology that makes completely new types of games possible. This chapter lays out the case for both of these propositions. It asks the question "what can video games do for AI", and discusses how in particular general video game playing is the ideal testbed for artificial general intelligence research. It the...

  14. AI, automation and the Flight Telerobotic Servicer

    Science.gov (United States)

    Goforth, Andre; Dominy, Robert

    1988-01-01

    A NASA study for the preliminary definition of a teleoperated robotic device has been recently completed. The Fligt Telerobotic Servicer (FTS) will be used to assist astronauts in many of the on-board tasks of assembly, maintenance, servicing, and inspection of the Space Station. The role of artificial intelligence (AI) in furthering the FTS automation capabilities and, hence, extending its capacity for growth and evolution is discussed. Relevant system engineering issues are identified, and an approach for insertion of AI technology is presented in terms of the NASA/NBS Standard Reference Model control architecture NASREM.

  15. Inicios del Hockey patines en Sevilla. El Patín Claret en la década de los 70 del siglo XX = Beginnings of Roller Hockey in Seville. Claret Skate in the Decade of the Twenthieh Century 70

    Directory of Open Access Journals (Sweden)

    Jaime Segundo Cuesta Pérez

    2013-10-01

    Full Text Available En el siguiente artículo, se trata de presentar una de las páginas más importantes de la historia del Hockey Patines en Andalucía y más concretamente en la ciudad de Sevilla. Un deporte prácticamente copado desde sus inicios por equipos catalanes y cuya implantación en el resto del país ha sido muy complicada, siendo aún hoy en día muy escasa por toda España, salvo en regiones muy localizadas como Cataluña, Madrid, o Galicia. Estos que ahora presentamos son parte de los orígenes de este deporte en la capital andaluza, de los cuales nacería, para sorpresa de muchos, un equipo que alcanzaría importantes hitos en la División de Honor Nacional de este deporte.---------------------------------------------------------------------In the next article, we try to present one of the most important papers of the roller hockey history in Andalucía, concretely in Seville. This sport has been surrounded from its beginning by teams from Cataluña, while the establishment in the rest of the country has been very difficult, being still today quite scarce all over Spain, except in some regions such as Cataluña, Madrid or Galicia. We will try to show you the origin of this sport in the capital of Andalucía, from where was born, surprising everybody, a team wich achieved great landmark in the Pride National Division of this sport.

  16. SNAP and AI Fuel Summary Report

    International Nuclear Information System (INIS)

    Lords, R.E.

    1994-08-01

    The SNAP and AI Fuel Summary Report provides a detailed overview of treatment and storage of these fuels from fabrication through current storage including design parameters and reactor history. Chemical and physical characteristics are described, and potential indicators of as-stored fuel conditions are emphasized

  17. Represión en Sevilla: el tribunal de responsabilidades políticas. Fondo del Archivo Histórico Provincial de Sevilla (Repression in Seville: the court of political responsibilities. Fund of the Historical Provincial Archive of Seville

    Directory of Open Access Journals (Sweden)

    Antonio Rosa Félix

    2013-12-01

    Full Text Available Resumen: El Archivo Histórico Provincial de Sevilla guarda un fondo de expedientes de Responsabilidades Políticas, procedentes del Juzgado de Primera Instancia e Instrucción de Sanlúcar la Mayor. La Ley de Responsabilidades Políticas de 1939 aglutina la normativa que los generales golpistas aplicaron desde el verano de 1936. Había que arruinar al vencido y para ello se creó esta jurisdicción especial, una inversión en la represión para crear y mantener un régimen lleno de adeptos. En el mundo rural se quería recuperar la hegemonía de la oligarquía agraria y mantener la situación anterior a la reforma agraria.Abstract: The Historical Provincial Archive of Seville keeps a collection of files record of Political Responsibilities, proceeding from the Court of The First Instance and Sanlúcar's Instruction. The Law of Political Responsibilities of 1939 agglutinates the regulation that the general rebels applied from the summer of 1936. It was necessary to ruin the defeated one and for it this special jurisdiction, an investment was created in the repression to create and to support a regime full followers'. In the rural world one wanted to recover the hegemony of the agrarian oligarchy and to support the situation previous to the agrarian reform.

  18. Physical self-concept in adolescents from Seville in relation with gender and the evolution of sport career

    Directory of Open Access Journals (Sweden)

    Francis Ries

    2011-01-01

    Full Text Available The aim of this study was to examine the physical capacities and the physical attractiveness of Seville adolescent athletes and whether these perceptions vary by gender and sport career development. 90 adolescents from 12 to 18 years (50 girls and 40 boys completed a Spanish adaptation of the Physical Self Description Questionnaire (Marsh, Richards, Johnson, Roche y Tremaye, 1994; Tomás, 1998 and a scale to collect physical attractiveness perceived (Alfermann, Saborowski y Würth, 1997. The results show that males have a more positive physical self-concept than females. There were no relationships of the variables with the level of sports performance. The follow-up survey, one year later, noted an increase in some subdomains of self-concept in terms of positive developments in the sport career. In this study the physical changes associated with maturation in adolescence seem to have fewer influences on the perception of the body as it has been reported in other studies

  19. The BSM-AI project: SUSY-AI-generalizing LHC limits on supersymmetry with machine learning

    Energy Technology Data Exchange (ETDEWEB)

    Caron, Sascha [Radboud Universiteit, Institute for Mathematics, Astro- and Particle Physics IMAPP, Nijmegen (Netherlands); Nikhef, Amsterdam (Netherlands); Kim, Jong Soo [UAM/CSIC, Instituto de Fisica Teorica, Madrid (Spain); Rolbiecki, Krzysztof [UAM/CSIC, Instituto de Fisica Teorica, Madrid (Spain); University of Warsaw, Faculty of Physics, Warsaw (Poland); Ruiz de Austri, Roberto [IFIC-UV/CSIC, Instituto de Fisica Corpuscular, Valencia (Spain); Stienen, Bob [Radboud Universiteit, Institute for Mathematics, Astro- and Particle Physics IMAPP, Nijmegen (Netherlands)

    2017-04-15

    A key research question at the Large Hadron Collider is the test of models of new physics. Testing if a particular parameter set of such a model is excluded by LHC data is a challenge: it requires time consuming generation of scattering events, simulation of the detector response, event reconstruction, cross section calculations and analysis code to test against several hundred signal regions defined by the ATLAS and CMS experiments. In the BSM-AI project we approach this challenge with a new idea. A machine learning tool is devised to predict within a fraction of a millisecond if a model is excluded or not directly from the model parameters. A first example is SUSY-AI, trained on the phenomenological supersymmetric standard model (pMSSM). About 300, 000 pMSSM model sets - each tested against 200 signal regions by ATLAS - have been used to train and validate SUSY-AI. The code is currently able to reproduce the ATLAS exclusion regions in 19 dimensions with an accuracy of at least 93%. It has been validated further within the constrained MSSM and the minimal natural supersymmetric model, again showing high accuracy. SUSY-AI and its future BSM derivatives will help to solve the problem of recasting LHC results for any model of new physics. SUSY-AI can be downloaded from http://susyai.hepforge.org/. An on-line interface to the program for quick testing purposes can be found at http://www.susy-ai.org/. (orig.)

  20. The BSM-AI project: SUSY-AI-generalizing LHC limits on supersymmetry with machine learning

    International Nuclear Information System (INIS)

    Caron, Sascha; Kim, Jong Soo; Rolbiecki, Krzysztof; Ruiz de Austri, Roberto; Stienen, Bob

    2017-01-01

    A key research question at the Large Hadron Collider is the test of models of new physics. Testing if a particular parameter set of such a model is excluded by LHC data is a challenge: it requires time consuming generation of scattering events, simulation of the detector response, event reconstruction, cross section calculations and analysis code to test against several hundred signal regions defined by the ATLAS and CMS experiments. In the BSM-AI project we approach this challenge with a new idea. A machine learning tool is devised to predict within a fraction of a millisecond if a model is excluded or not directly from the model parameters. A first example is SUSY-AI, trained on the phenomenological supersymmetric standard model (pMSSM). About 300, 000 pMSSM model sets - each tested against 200 signal regions by ATLAS - have been used to train and validate SUSY-AI. The code is currently able to reproduce the ATLAS exclusion regions in 19 dimensions with an accuracy of at least 93%. It has been validated further within the constrained MSSM and the minimal natural supersymmetric model, again showing high accuracy. SUSY-AI and its future BSM derivatives will help to solve the problem of recasting LHC results for any model of new physics. SUSY-AI can be downloaded from http://susyai.hepforge.org/. An on-line interface to the program for quick testing purposes can be found at http://www.susy-ai.org/. (orig.)

  1. Launching AI in NASA ground systems

    Science.gov (United States)

    Perkins, Dorothy C.; Truszkowski, Walter F.

    1990-01-01

    This paper will discuss recent operational successes in implementing expert systems to support the complex functions of NASA mission control systems at the Goddard Space Flight Center, including fault detection and diagnosis for real time and engineering analysis functions in the Cosmic Background Explorer and Gamma Ray Observatory missions and automation of resource planning and scheduling functions for various missions. It will also discuss ongoing developments and prototypes that will lead to increasingly sophisticated applications of artificial intelligence. These include the use of neural networks to perform telemetry monitoring functions, the implementation of generic expert system shells that can be customized to telemetry handling functions specific to NASA control centers, the applications of AI in training and user support, the long-term potential of implementing systems based around distributed, cooperative problem solving, and the use of AI to control and assist system development activities.

  2. AI systems approach in particle accelerators

    International Nuclear Information System (INIS)

    Kataria, S.K.; Bhagwat, P.V.; Kori, S.A.

    1992-01-01

    The large particle accelerators machines like pelletron accelerator at Tata Institute of Fundamental Research (T.I.F.R) have several levels of controls with operators responsible for overall global control decisions and closed loop feedback controllers for relatively small subsystems of the machines. As the accelerator machines are becoming more complicated and the requirements more stringent, there is a need to provide the operators with an artificial intelligence (AI) system to aid in the tuning the machine and in failure diagnosis. There are few major areas in the pelletron operation, which can be done more efficiently using AI systems approach so that useful beam is available for much more time: 1) Accelerator Conditioning, 2) Accelerator Tuning, and 3) Maintaining the Tune beams. The feasibility study for using expert system for above areas and also for safety evaluation of the various subsystems is carried out. (author). 10 refs., 4 figs

  3. Deploying Embodied AI into Virtual Worlds

    Science.gov (United States)

    Burden, David J. H.

    The last two years have seen the start of commercial activity within virtual worlds. Unlike computer games where Non-Player-Character avatars are common, in most virtual worlds they are the exception — and until recently in Second Life they were non-existent. However there is real commercial scope for Als in these worlds — in roles from virtual sales staff and tutors to personal assistants. Deploying an embodied AI into a virtual world offers a unique opportunity to evaluate embodied Als, and to develop them within an environment where human and computer are on almost equal terms. This paper presents an architecture being used for the deployment of chatbot driven avatars within the Second Life virtual world, looks at the challenges of deploying an AI within such a virtual world, the possible implications for the Turing Test, and identifies research directions for the future.

  4. Managing bioengineering complexity with AI techniques.

    Science.gov (United States)

    Beal, Jacob; Adler, Aaron; Yaman, Fusun

    2016-10-01

    Our capabilities for systematic design and engineering of biological systems are rapidly increasing. Effectively engineering such systems, however, requires the synthesis of a rapidly expanding and changing complex body of knowledge, protocols, and methodologies. Many of the problems in managing this complexity, however, appear susceptible to being addressed by artificial intelligence (AI) techniques, i.e., methods enabling computers to represent, acquire, and employ knowledge. Such methods can be employed to automate physical and informational "routine" work and thus better allow humans to focus their attention on the deeper scientific and engineering issues. This paper examines the potential impact of AI on the engineering of biological organisms through the lens of a typical organism engineering workflow. We identify a number of key opportunities for significant impact, as well as challenges that must be overcome. Copyright © 2015 Elsevier Ireland Ltd. All rights reserved.

  5. The Potential of AI Techniques for Remote Sensing

    Science.gov (United States)

    Estes, J. E.; Sailer, C. T. (Principal Investigator); Tinney, L. R.

    1984-01-01

    The current status of artificial intelligence AI technology is discussed along with imagery data management, database interrogation, and decision making. Techniques adapted from the field of artificial intelligence (AI) have significant, wide ranging impacts upon computer-assisted remote sensing analysis. AI based techniques offer a powerful and fundamentally different approach to many remote sensing tasks. In addition to computer assisted analysis, AI techniques can also aid onboard spacecraft data processing and analysis and database access and query.

  6. AI in space: Past, present, and possible futures

    Science.gov (United States)

    Rose, Donald D.; Post, Jonathan V.

    1992-01-01

    While artificial intelligence (AI) has become increasingly present in recent space applications, new missions being planned will require even more incorporation of AI techniques. In this paper, we survey some of the progress made to date in implementing such programs, some current directions and issues, and speculate about the future of AI in space scenarios. We also provide examples of how thinkers from the realm of science fiction have envisioned AI's role in various aspects of space exploration.

  7. Study by micro-Raman spectroscopy of wall paints (external parts and cross-sections) from reales alcazares of Seville (Spain)

    Science.gov (United States)

    Perez-Rodriguez, José Luis; Centeno, Miguel Angel; Robador, María Dolores; Siguenza, Belinda; Durán, Adrián

    2013-04-01

    The Reales Alcazares of Sevilla was originally builded by the Arabic in the year 913. The Mudejar Palace was built by Christian King Pedro I between 1364 and 1366. At the end of XV century the Catholic Kings, Isabel and Fernando made important transformations especially in the Mudejar Palace. Recently, wall paints from Catholic Kings periods were found during works of conservations in the first floor of the Palace. The study of these paints by non-destructive techniques was considered of great interest in order to determine the technology of manufacture and the originality of the artwork. The main objective of this work was to apply the Raman spectroscopy technique on the surface of the wall and on the different layers of the cross-sections prepared in order to characterize the pigments and the plaster present in these wall paints. Little information was obtained using a portable Raman spectrometer. In this case the dispersive integrated Horiba Jobin-Yvon LabRaman HR800 system was employed. Small samples of black, red, yellow, white and green colour were taken from the artwork. The surface of the samples were directly studed by the Raman spectroscopy instrument using red (785 nm) and green (522 nm) lasers, similarly to non-invasive experimental technique. This technique showed the presence of gypsum (SO4Ca.2H2O) and calcite (CaCO3) in all the studied samples However, the pigments responsible of different colours were not detected. The surface of these wall paints was covered with gypsum and calcite due to contamination. These mineras were also characterized by XRD and SEM-EDX. The presence of these compounds and the heterogeneous surface did not permit the characterization of the pigments responsible of the colour. In order to better characterization of the pigments and plaster used the study was carried out on cross-sections. The black colour was performed using carbon black. Two different red layers were detected one constituted by cinnabar and lead carbonate and the other one by iron oxides. The green and white colours were constituted by atacamite and calcite, respectively. In addition lead white was detected in green colour. The white layers (plaster) located under the colour layers were constituted by calcite, quartz and feldspars. These data confirm the use of fresco technique. The study of the surface (external part) by micro-Raman spectroscopy limited the characterization of the pigments present in these wall pains, due to the presence of a layer of gypsum deposited on the surface. By other hand, the study by Raman spectroscopy of the cross-sections allowed the characterization of different pigments and support used in the manufacture of these wall paints.

  8. Electric vehicles for the urban solid wastes collection in Seville (Spain); Vehiculos electricos para la recogida de residuos en el caso historico de Sevilla

    Energy Technology Data Exchange (ETDEWEB)

    Rodriguez Garcia, A.

    1998-07-01

    New technologies and systems are incorporated the design of public cleansing and collection of Municipal Solid Waste vehicles. Now types of vehicles propelled by electric power exist in the market: the electric pure traction vehicles and the electric combined traction vehicles, that we to their time could classify hybrid series in vehicles hybrid ``bimodal`` and hybrid parallel or tri modal. For their configuration and their characteristics, the system bimodal is the most adequate for their current application to public cleansing vehicles. (Author)

  9. SDI satellite autonomy using AI and Ada

    Science.gov (United States)

    Fiala, Harvey E.

    1990-01-01

    The use of Artificial Intelligence (AI) and the programming language Ada to help a satellite recover from selected failures that could lead to mission failure are described. An unmanned satellite will have a separate AI subsystem running in parallel with the normal satellite subsystems. A satellite monitoring subsystem (SMS), under the control of a blackboard system, will continuously monitor selected satellite subsystems to become alert to any actual or potential problems. In the case of loss of communications with the earth or the home base, the satellite will go into a survival mode to reestablish communications with the earth. The use of an AI subsystem in this manner would have avoided the tragic loss of the two recent Soviet probes that were sent to investigate the planet Mars and its moons. The blackboard system works in conjunction with an SMS and a reconfiguration control subsystem (RCS). It can be shown to be an effective way for one central control subsystem to monitor and coordinate the activities and loads of many interacting subsystems that may or may not contain redundant and/or fault-tolerant elements. The blackboard system will be coded in Ada using tools such as the ABLE development system and the Ada Production system.

  10. Monitoring severe accidents using AI techniques

    International Nuclear Information System (INIS)

    No, Young Gyu; Ahn, Kwang Il; Kim, Ju Hyun; Na, Man Gyun; Lim, Dong Hyuk

    2012-01-01

    After the Fukushima nuclear accident in 2011, there has been increasing concern regarding severe accidents in nuclear facilities. Severe accident scenarios are difficult for operators to monitor and identify. Therefore, accurate prediction of a severe accident is important in order to manage it appropriately in the unfavorable conditions. In this study, artificial intelligence (AI) techniques, such as support vector classification (SVC), probabilistic neural network (PNN), group method of data handling (GMDH), and fuzzy neural network (FNN), were used to monitor the major transient scenarios of a severe accident caused by three different initiating events, the hot-leg loss of coolant accident (LOCA), the cold-leg LOCA, and the steam generator tube rupture in pressurized water reactors (PWRs). The SVC and PNN models were used for the event classification. The GMDH and FNN models were employed to accurately predict the important timing representing severe accident scenarios. In addition, in order to verify the proposed algorithm, data from a number of numerical simulations were required in order to train the AI techniques due to the shortage of real LOCA data. The data was acquired by performing simulations using the MAAP4 code. The prediction accuracy of the three types of initiating events was sufficiently high to predict severe accident scenarios. Therefore, the AI techniques can be applied successfully in the identification and monitoring of severe accident scenarios in real PWRs.

  11. Monitoring severe accidents using AI techniques

    Energy Technology Data Exchange (ETDEWEB)

    No, Young Gyu; Ahn, Kwang Il [Korea Atomic Energy Research Institute, Daejeon (Korea, Republic of); Kim, Ju Hyun; Na, Man Gyun [Dept. of Nuclear Engineering, Chosun University, Gwangju (Korea, Republic of); Lim, Dong Hyuk [Korea Institute of Nuclear Nonproliferation and Control, Daejon (Korea, Republic of)

    2012-05-15

    After the Fukushima nuclear accident in 2011, there has been increasing concern regarding severe accidents in nuclear facilities. Severe accident scenarios are difficult for operators to monitor and identify. Therefore, accurate prediction of a severe accident is important in order to manage it appropriately in the unfavorable conditions. In this study, artificial intelligence (AI) techniques, such as support vector classification (SVC), probabilistic neural network (PNN), group method of data handling (GMDH), and fuzzy neural network (FNN), were used to monitor the major transient scenarios of a severe accident caused by three different initiating events, the hot-leg loss of coolant accident (LOCA), the cold-leg LOCA, and the steam generator tube rupture in pressurized water reactors (PWRs). The SVC and PNN models were used for the event classification. The GMDH and FNN models were employed to accurately predict the important timing representing severe accident scenarios. In addition, in order to verify the proposed algorithm, data from a number of numerical simulations were required in order to train the AI techniques due to the shortage of real LOCA data. The data was acquired by performing simulations using the MAAP4 code. The prediction accuracy of the three types of initiating events was sufficiently high to predict severe accident scenarios. Therefore, the AI techniques can be applied successfully in the identification and monitoring of severe accident scenarios in real PWRs.

  12. Why Don't Accounting Students like AIS?

    Science.gov (United States)

    Vatanasakdakul, Savanid; Aoun, Chadi

    2011-01-01

    Purpose: The demand for Accounting Information Systems (AIS) knowledge has increased exponentially over the past two decades, but studying AIS has not proved easy for many accounting students. The aim of the study is to understand the challenges accounting students face in studying AIS through investigation of the factors which may be contributing…

  13. Dicty_cDB: FC-AI04 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AI04 (Link to dictyBase) - - - Contig-U15121-1 FC-AI04E (Li...nk to Original site) - - - - - - FC-AI04E 772 Show FC-AI04 Library FC (Link to library) Clone ID FC-AI04 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AI/FC-AI04Q.Seq.d/ Representative seq. ID FC-AI...04E (Link to Original site) Representative DNA sequence >FC-AI04 (FC-AI04Q) /CSM/FC/FC-AI/FC-AI04Q.Seq....qvnkhqqvvtktvsd vlvphqvhnqvfphipqqmtlvnkhqpvvtktvsdvlvphqvhnqvfphtpqlkiqvylq vfqvvvvtiisai

  14. Dicty_cDB: FC-AI10 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AI10 (Link to dictyBase) - - - Contig-U16270-1 FC-AI10F (Li...nk to Original site) FC-AI10F 405 - - - - - - Show FC-AI10 Library FC (Link to library) Clone ID FC-AI10 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AI/FC-AI10Q.Seq.d/ Representative seq. ID FC-AI...10F (Link to Original site) Representative DNA sequence >FC-AI10 (FC-AI10Q) /CSM/FC/FC-AI/FC-AI10Q.Seq.... sequence RKKRKSDYTSFSTYIHKLLKQITPPTNAKSNEKGDRKFTISSKAMSVMNSFVHDIFDRIA TEASGLAKKKKRQTLHSRDIQVAVRIILTGELAXHAI

  15. Dicty_cDB: FC-AI23 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AI23 (Link to dictyBase) - - - Contig-U15308-1 FC-AI23Z (Li...nk to Original site) - - FC-AI23Z 603 - - - - Show FC-AI23 Library FC (Link to library) Clone ID FC-AI23 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AI/FC-AI23Q.Seq.d/ Representative seq. ID FC-AI...23Z (Link to Original site) Representative DNA sequence >FC-AI23 (FC-AI23Q) /CSM/FC/FC-AI/FC-AI23Q.Seq....LNTLAKKNEQVVEGEILAKQLTGVTAEELSEFKACFSHFDKDN DNKLNRLEFSSCLKSIGDELTEEQLNQVISKIDTDGNGTISFEEFIDYMVSSRKGTDSVE STKAAFKVMAEDKDFITEAQIRAAI

  16. Dicty_cDB: FC-AI05 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AI05 (Link to dictyBase) - - - Contig-U15516-1 FC-AI05E (Li...nk to Original site) - - - - - - FC-AI05E 1189 Show FC-AI05 Library FC (Link to library) Clone ID FC-AI05 (L...//dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AI/FC-AI05Q.Seq.d/ Representative seq. ID FC-AI...05E (Link to Original site) Representative DNA sequence >FC-AI05 (FC-AI05Q) /CSM/FC/FC-AI/FC-AI05Q.Seq...KIVGEASLKNKGKMSRVLAAKAALSARFD ALCEVSDTSYGIAYKGAVDRRAAAIEGREVRKSLNAVKPEKSGNVAKYDHTKSATTNTTR DVATKSSKESSIKQEKQ

  17. Dicty_cDB: FC-AI21 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AI21 (Link to dictyBase) - - - Contig-U16254-1 FC-AI21Z (Li...nk to Original site) - - FC-AI21Z 696 - - - - Show FC-AI21 Library FC (Link to library) Clone ID FC-AI21 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AI/FC-AI21Q.Seq.d/ Representative seq. ID FC-AI...21Z (Link to Original site) Representative DNA sequence >FC-AI21 (FC-AI21Q) /CSM/FC/FC-AI/FC-AI21Q.Seq....YPGYMYTDLSTIYERAGRIQGRNGSITQI PILTMPNDDITHPIPDLTGYITEGQIFIDRQINNRQIYPPINVLPSLSRLMKSAI

  18. Dicty_cDB: FC-AI01 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AI01 (Link to dictyBase) - - - Contig-U15592-1 FC-AI01E (Li...nk to Original site) - - - - - - FC-AI01E 307 Show FC-AI01 Library FC (Link to library) Clone ID FC-AI01 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AI/FC-AI01Q.Seq.d/ Representative seq. ID FC-AI...01E (Link to Original site) Representative DNA sequence >FC-AI01 (FC-AI01Q) /CSM/FC/FC-AI/FC-AI01Q.Seq....uences producing significant alignments: (bits) Value FC-AI01 (FC-AI01Q) /CSM/FC/FC-AI/FC-AI01Q.Seq.d/ 68 8e

  19. Dicty_cDB: FC-AI13 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AI13 (Link to dictyBase) - - - Contig-U16263-1 FC-AI13F (Li...nk to Original site) FC-AI13F 507 - - - - - - Show FC-AI13 Library FC (Link to library) Clone ID FC-AI13 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AI/FC-AI13Q.Seq.d/ Representative seq. ID FC-AI...13F (Link to Original site) Representative DNA sequence >FC-AI13 (FC-AI13Q) /CSM/FC/FC-AI/FC-AI13Q.Seq....nificant alignments: (bits) Value FC-AI13 (FC-AI13Q) /CSM/FC/FC-AI/FC-AI13Q.Seq.d/ 963 0.0 VSA730 (VSA730Q)

  20. Developing Pokemon AI For Finding Comfortable Settings

    OpenAIRE

    Panumate, Chetprayoon; Iida, Hiroyuki

    2016-01-01

    This paper explores an innovative way to find a comfortable setting of video games. Pokemon is chosen as benchmark and game refinement measure is employed for the assessment. The number of Pokemon that one trainer can carry (i.e., setting with n=6) has never been changed after the first episode of Pokemon was released in 1996. Pokemon battle is simulated and various AIs are developed for the experiments. The results show that the original setting is the best for many players of various levels.

  1. AI techniques in geomagnetic storm forecasting

    Science.gov (United States)

    Lundstedt, Henrik

    This review deals with how geomagnetic storms can be predicted with the use of Artificial Intelligence (AI) techniques. Today many different Al techniques have been developed, such as symbolic systems (expert and fuzzy systems) and connectionism systems (neural networks). Even integrations of AI techniques exist, so called Intelligent Hybrid Systems (IHS). These systems are capable of learning the mathematical functions underlying the operation of non-linear dynamic systems and also to explain the knowledge they have learned. Very few such powerful systems exist at present. Two such examples are the Magnetospheric Specification Forecast Model of Rice University and the Lund Space Weather Model of Lund University. Various attempts to predict geomagnetic storms on long to short-term are reviewed in this article. Predictions of a month to days ahead most often use solar data as input. The first SOHO data are now available. Due to the high temporal and spatial resolution new solar physics have been revealed. These SOHO data might lead to a breakthrough in these predictions. Predictions hours ahead and shorter rely on real-time solar wind data. WIND gives us real-time data for only part of the day. However, with the launch of the ACE spacecraft in 1997, real-time data during 24 hours will be available. That might lead to the second breakthrough for predictions of geomagnetic storms.

  2. Dissecting phenotypic variation among AIS patients

    International Nuclear Information System (INIS)

    Wang Minghua; Wang Jiucun; Zhang Zhen; Zhao Zhimin; Zhang Rongmei; Hu Xiaohua; Tan Tao; Luo Shijing; Luo Zewei

    2005-01-01

    We have created genital skin fibroblast cell lines directly from three patients in a Chinese family affected by androgen insensitivity syndrome (AIS). All patients in the family share an identical AR Arg 840 Cys mutant but show different disease phenotypes. By using the cell lines, we find that the mutation has not influenced a normal androgen-binding capacity at 37 deg C but has reduced the affinity for androgens and may cause thermolability of the androgen-receptor complex. The impaired nuclear trafficking of the androgen receptor in the cell lines is highly correlated with the severity of donors' disease phenotype. The transactivity of the mutant is substantially weakened and the extent of the reduced transactivity reflects severity of the donors' disease symptom. Our data reveal that although etiology of AIS is monogenic and the mutant may alter the major biological functions of its wild allele, the function of the mutant AR can also be influenced by the different genetic backgrounds and thus explains the divergent disease phenotypes

  3. Monitoring Severe Accidents Using AI Techniques

    International Nuclear Information System (INIS)

    No, Young Gyu; Kim, Ju Hyun; Na, Man Gyun; Ahn, Kwang Il

    2011-01-01

    It is very difficult for nuclear power plant operators to monitor and identify the major severe accident scenarios following an initiating event by staring at temporal trends of important parameters. The objective of this study is to develop and verify the monitoring for severe accidents using artificial intelligence (AI) techniques such as support vector classification (SVC), probabilistic neural network (PNN), group method of data handling (GMDH) and fuzzy neural network (FNN). The SVC and PNN are used for event classification among the severe accidents. Also, GMDH and FNN are used to monitor for severe accidents. The inputs to AI techniques are initial time-integrated values obtained by integrating measurement signals during a short time interval after reactor scram. In this study, 3 types of initiating events such as the hot-leg LOCA, the cold-leg LOCA and SGTR are considered and it is verified how well the proposed scenario identification algorithm using the GMDH and FNN models identifies the timings when the reactor core will be uncovered, when CET will exceed 1200 .deg. F and when the reactor vessel will fail. In cases that an initiating event develops into a severe accident, the proposed algorithm showed accurate classification of initiating events. Also, it well predicted timings for important occurrences during severe accident progression scenarios, which is very helpful for operators to perform severe accident management

  4. AI model for computer games based on case based reasoning and AI planning

    NARCIS (Netherlands)

    Menkovski, V.; Metafas, D.

    2008-01-01

    Making efficient AI models for games with imperfect information can be a particular challenge. Considering the large number of possible moves and the incorporated uncertainties building game trees for these games becomes very difficult due to the exponential growth of the number of nodes at each

  5. AI Based Personal Learning Environments: Directions for Long Term Research. AI Memo 384.

    Science.gov (United States)

    Goldstein, Ira P.; Miller, Mark L.

    The application of artificial intelligence (AI) techniques to the design of personal learning environments is an enterprise of both theoretical and practical interest. In the short term, the process of developing and testing intelligent tutoring programs serves as a new experimental vehicle for exploring alternative cognitive and pedagogical…

  6. Risk Reducing Effect of AIS Implementation on Collision Risk

    DEFF Research Database (Denmark)

    Lützen, Marie; Friis-Hansen, Peter

    2003-01-01

    AIS (Automatic Identification System) is a transponder system developed for sea traffic purposes. The system sends and receives important ship information and other safety-related information between other ships and shore-based AIS stations. The implementation of AIS has now been initiated and......, as a result, the community will undoubtedly observe an increase in navigational safety. However, to the authors? knowledge, no study has so far rigorously quantified the risk reducing effect of using AIS as an integrated part of the navigational system. The objective of this study is to fill this gap....... The risk reducing effect of AIS is quantified by building a Bayesian network facilitating an evaluation of the effect of AIS on the navigational officer?s reaction ability in a potential, critical collision situation. The time-dependent change in the risk reducing effect on ship collisions is analysed...

  7. GC/MS in the study of deterioration process of historical monuments: characterization of the black crust formed in the Cathedral of Seville

    International Nuclear Information System (INIS)

    Reyes, J.; Hermosin, B.; Saiz J, C.

    2006-01-01

    Here, we present an interesting application of Gas Chromatography/Mass Spectrometry (GC/MS) technique which permitted to differentiate successfully between natural and anthropogenic compounds present in the black crust formed in the Cathedral of Seville. This building, considered as one of the most important historic and cultural European monuments suffers from intense blackening of its outside walls and sculptures due to the interaction with the urban environment. Fragment of black crusts were removed from the Cathedral walls and extraction process with organic solvents was carried out. The aliphatic, aromatic and polar fractions were separated and analyzed using GC/MS. A complex organic composition of the black crusts indicated the accumulative character of the deposition process of atmospheric particles as a function of the time. The presence of high molecular weight n-alkanes, n-fatty acids and natural molecular markers identified during the study were indicative of current biogenic contributions. It was also found an important group of petrogenic molecular markers related with diesel soot emissions from motor engines. The diesel soot and molecular markers were entrapped within the black crust mineral matrix and contribute to the observed blackening of the Seville Cathedral. (Author)

  8. Towards a science of integrated AI and Robotics

    OpenAIRE

    Rajan, Kanna; Saffiotti, Alessandro

    2017-01-01

    The early promise of the impact of machine intelligence did not involve the partitioning of the nascent field of Artificial Intelligence. The founders of AI envisioned the notion of embedded intelligence as being conjoined between perception, reasoning and actuation. Yet over the years the fields of AI and Robotics drifted apart. Practitioners of AI focused on problems and algorithms abstracted from the real world. Roboticists, generally with a background in mechanical and electrical engineer...

  9. Discussion on AI Technology in Information Library Design

    OpenAIRE

    日比野, 省三; Shozo, HIBINO; 中京大学社会学部

    1987-01-01

    This paper deals with the discussion on the importance of AI (Artificial Intelligence) Technology in planning and designing a library information system in the near future. First of all, the history of Library and Information Science is reviewed and it is identified that the key technology in the future library will be AI as a mega-trend. After reviewing the concepts of AI technology, a model of a Knowledge-Base system is discussed as a case study, using micro-PROLOG.

  10. Humans and Machines in the Evolution of AI in Korea

    OpenAIRE

    Zhang, Byoung-Tak

    2016-01-01

    Artificial intelligence in Korea is currently prospering. The media is regularly reporting AI-enabled products such as smart advisors, personal robots, autonomous cars, and human-level intelligence machines. The IT industry is investing in deep learning and AI to maintain the global competitive edge in their services and products. The Ministry of Science, ICT, and Future Planning (MSIP) has launched new funding programs in AI and cognitive science to implement the government’s newly adopted e...

  11. Automatic Identification System (AIS) Transmit Testing in Louisville Phase 2

    Science.gov (United States)

    2014-08-01

    Firewall Louisville QM 65.206.28.x NAIS Site Controller PC RS232 Serial cable TV32 Computer Cmd Center Serial splitter SAAB R40 AIS Base Station...172.17.14.6 Rack mount computer AIS Radio Interface Ethernet Switch 192.168.0.x Firewall Cable Modem 192.168.0.1 VTS Accred. Boundary serial connection...Automatic Identification System ( AIS ) Transmit Testing in Louisville Phase 2 Distribution Statement A: Approved for public release

  12. The implementation of AI technologies in computer wargames

    Science.gov (United States)

    Tiller, John A.

    2004-08-01

    Computer wargames involve the most in-depth analysis of general game theory. The enumerated turns of a game like chess are dwarfed by the exponentially larger possibilities of even a simple computer wargame. Implementing challenging AI is computer wargames is an important goal in both the commercial and military environments. In the commercial marketplace, customers demand a challenging AI opponent when they play a computer wargame and are frustrated by a lack of competence on the part of the AI. In the military environment, challenging AI opponents are important for several reasons. A challenging AI opponent will force the military professional to avoid routine or set-piece approaches to situations and cause them to think much deeper about military situations before taking action. A good AI opponent would also include national characteristics of the opponent being simulated, thus providing the military professional with even more of a challenge in planning and approach. Implementing current AI technologies in computer wargames is a technological challenge. The goal is to join the needs of AI in computer wargames with the solutions of current AI technologies. This talk will address several of those issues, possible solutions, and currently unsolved problems.

  13. Little AI: Playing a constructivist robot

    Science.gov (United States)

    Georgeon, Olivier L.

    Little AI is a pedagogical game aimed at presenting the founding concepts of constructivist learning and developmental Artificial Intelligence. It primarily targets students in computer science and cognitive science but it can also interest the general public curious about these topics. It requires no particular scientific background; even children can find it entertaining. Professors can use it as a pedagogical resource in class or in online courses. The player presses buttons to control a simulated "baby robot". The player cannot see the robot and its environment, and initially ignores the effects of the commands. The only information received by the player is feedback from the player's commands. The player must learn, at the same time, the functioning of the robot's body and the structure of the environment from patterns in the stream of commands and feedback. We argue that this situation is analogous to how infants engage in early-stage developmental learning (e.g., Piaget (1937), [1]).

  14. AI tools in computer based problem solving

    Science.gov (United States)

    Beane, Arthur J.

    1988-01-01

    The use of computers to solve value oriented, deterministic, algorithmic problems, has evolved a structured life cycle model of the software process. The symbolic processing techniques used, primarily in research, for solving nondeterministic problems, and those for which an algorithmic solution is unknown, have evolved a different model, much less structured. Traditionally, the two approaches have been used completely independently. With the advent of low cost, high performance 32 bit workstations executing identical software with large minicomputers and mainframes, it became possible to begin to merge both models into a single extended model of computer problem solving. The implementation of such an extended model on a VAX family of micro/mini/mainframe systems is described. Examples in both development and deployment of applications involving a blending of AI and traditional techniques are given.

  15. Spain: Europe's California.

    Science.gov (United States)

    Wilvert, Calvin

    1994-01-01

    Contends that, as Spain integrates into the European Economic Community, it is considered to be Europe's California. Asserts that making regional comparisons between California and Spain can be an effective teaching method. Provides comparisons in such areas as agriculture and tourism. (CFR)

  16. Energy Made in Spain

    International Nuclear Information System (INIS)

    Ruiz del Arbol, M.

    2011-01-01

    Spain is the first country in Europe and the second worldwide in installed thermoelectric solar power, the second place in Europe and fourth worldwide in wind energy. Moreover, Spain is the second country in photovoltaic energy so in Europe as in the World.

  17. Dicty_cDB: FC-AI17 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AI17 (Link to dictyBase) - - - Contig-U15690-1 FC-AI17P (Li...nk to Original site) FC-AI17F 587 FC-AI17Z 626 FC-AI17P 1212 - - Show FC-AI17 Library FC (Link to library) Clone ID FC-AI...nal site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AI/FC-AI17Q.Seq.d/ Representative seq. ID FC-AI...17P (Link to Original site) Representative DNA sequence >FC-AI17 (FC-AI17Q) /CSM/FC/FC-AI/FC-AI...slated Amino Acid sequence ANIATVGDFLKADTVVPKMIITYNKRKQGTDYLKAVIGPILSNVIKQELNLELKPNLVYA AIISEQEIRTGEKSTLDRNV

  18. Dicty_cDB: FC-AI18 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AI18 (Link to dictyBase) - - - Contig-U15590-1 FC-AI18P (Li...nk to Original site) FC-AI18F 621 FC-AI18Z 703 FC-AI18P 1324 - - Show FC-AI18 Library FC (Link to library) Clone ID FC-AI...nal site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AI/FC-AI18Q.Seq.d/ Representative seq. ID FC-AI...18P (Link to Original site) Representative DNA sequence >FC-AI18 (FC-AI18Q) /CSM/FC/FC-AI/FC-AI...AVWPLIPGYERA DGEKQYPVAAMLCNFTKPTPTTPSLLTHDEVVTFFHEFGHVMHNMSTKVHYSMFSGTSVE RDFVECPSQLFEFWCWNKDVLVNKLSGHXKDHSKKLPTDLVERMIAAKNLNVAI

  19. Dicty_cDB: FC-AI03 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AI03 (Link to dictyBase) - - - Contig-U15833-1 FC-AI03P (Li...nk to Original site) FC-AI03F 690 FC-AI03Z 651 FC-AI03P 1341 - - Show FC-AI03 Library FC (Link to library) Clone ID FC-AI...nal site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AI/FC-AI03Q.Seq.d/ Representative seq. ID FC-AI...03P (Link to Original site) Representative DNA sequence >FC-AI03 (FC-AI03Q) /CSM/FC/FC-AI/FC-AI...li*l*ivtlskv*qswyqvfcslmrftcwi*nv fht*ivhwsqhwhql*flqpivaiv*skapitifnlhmaslwif*ivl*sfvpfhiitmk sfkfspfvpqlki

  20. AI technology and automobile. ; Toward vehicle autonomy. AI gijutsu to jidosha. ; Sharyo no jiritsuka ni mukatte

    Energy Technology Data Exchange (ETDEWEB)

    Okuno, A. (Mazda Motor Corp., Hiroshima (Japan))

    1991-01-01

    This report describes the vehicle autonomy by using artificial intelligence (AI) technology. Owing to a remarkable progress of AI technology, it is forecasted that driving support system will be introduced into the market till 2000, and higher autonomous navigation system will be introduced since about 2010. Autonomous vehicles have capacities of recognizing the outside world and of navigating roads by themselves, and with their enfanced environment adaptability the road transportation in the future is expected to be much more safer than in the present. The autonomous vehicle can warn its driver of potential dangers and correct operational errors of the driver. In order to realize such autonomous vehicles, extensive researches on perception systems, decision making systems and driving support systems are needed. 9 refs., 10 figs., 1 tab.

  1. Ada in AI or AI in Ada. On developing a rationale for integration

    Science.gov (United States)

    Collard, Philippe E.; Goforth, Andre

    1988-01-01

    The use of Ada as an Artificial Intelligence (AI) language is gaining interest in the NASA Community, i.e., by parties who have a need to deploy Knowledge Based-Systems (KBS) compatible with the use of Ada as the software standard for the Space Station. A fair number of KBS and pseudo-KBS implementations in Ada exist today. Currently, no widely used guidelines exist to compare and evaluate these with one another. The lack of guidelines illustrates a fundamental problem inherent in trying to compare and evaluate implementations of any sort in languages that are procedural or imperative in style, such as Ada, with those in languages that are functional in style, such as Lisp. Discussed are the strengths and weakness of using Ada as an AI language and a preliminary analysis provided of factors needed for the development of criteria for the integration of these two families of languages and the environments in which they are implemented. The intent for developing such criteria is to have a logical rationale that may be used to guide the development of Ada tools and methodology to support KBS requirements, and to identify those AI technology components that may most readily and effectively be deployed in Ada.

  2. Ai Weiwei - 21. sajandi märter? / Tanel Veenre

    Index Scriptorium Estoniae

    Veenre, Tanel, 1977-

    2011-01-01

    Hiina kunstniku, inimõiguslase ja teisitimõtleja Ai Weiwei elust, õpingutest, loomingust ja tegevusest. Hiinas kunstniku tagakiusamisest, arreteerimisest, maksupettuses süüdistamisest jm. Kunstniku toetajatest. Inglise kunstileht Art Review valis Ai Weiwei 2011. a. kõige mõjuvõimsamaks kunstitegelaseks

  3. Integrating the Wall Street Journal into AIS Courses

    Science.gov (United States)

    Kohlmeyer, James M., III

    2008-01-01

    While it is important for accounting information systems (AIS) students to understand computer technology, internal controls and business processes, such knowledge is of little use without reference to appropriate contexts. Integrating Wall Street Journal (WSJ) readings and discussions into AIS classes can enrich learning by stimulating…

  4. Brosimacutins A-I, nine new flavonoids from Brosimum acutifolium.

    Science.gov (United States)

    Takashima, Junko; Ohsaki, Ayumi

    2002-12-01

    Nine new flavonoids, brosimacutins A-I (1-9), and four known flavonoids were isolated from the bark of Brosimum acutifolium, a Brazilian folk medicine ("Mururé"). Their structures were elucidated by spectroscopic methods, including 2D NMR. Brosimacutins A-I possess differentially functionalized isoprene units at C-8.

  5. An Immune Agent for Web-Based AI Course

    Science.gov (United States)

    Gong, Tao; Cai, Zixing

    2006-01-01

    To overcome weakness and faults of a web-based e-learning course such as Artificial Intelligence (AI), an immune agent was proposed, simulating a natural immune mechanism against a virus. The immune agent was built on the multi-dimension education agent model and immune algorithm. The web-based AI course was comprised of many files, such as HTML…

  6. the Lexique kikongo–français by

    African Journals Online (AJOL)

    Gilles-Maurice de Schryver

    français by the Jesuit missionary Charles Polis, is analysed in great detail. Section 1 expounds on the goal and ... dictionary manuscript for Kikongo: the Lexique kikongo–français by Charles Polis. s.j. (1885–†1943). .... Inkisi River, and all but one (Leverville, the present Lusanga) are close to that river, which thus strongly ...

  7. Radioimmunoassay of apolipoprotein A-I of rat serum

    International Nuclear Information System (INIS)

    Fainaru, M.; Havel, R.J.; Felker, T.E.

    1976-01-01

    A double antibody radioimmunoassay technique was developed for quantification of apolipoprotein A-I, the major apoprotein of rat high density lipoprotein. Apo A-I was labelled with 125 I by the chloramine-T method. 125 I-labeled apo A-I had the same electrophoretic mobility as unlabeled apo A-I and more than 80% of the 125 I was precipitated by rabbit anti apo A-I antibodies. The assay is sensitive at the level of 0.5-5 ng, and has intraassay and interassay coefficients of variation of 4.5 and 6.5% respectively. The specificity of the assay was established by competitive displacement of 125 I-labeled apo A-I from its antibody by apo A-I and lipoproteins containing apo A-I, but not by rat albumin and other apoproteins. Immunoreactivity of high density lipoprotein and serum was only about 35% of that of their delipidated forms when Veronal buffer was used as a diluent. Inclusion of 5 mM sodium decyl sulfate in the incubation mixture brought out reactivity equivalent to that found after delipidation. Completeness of the reaction was verified by comparison with the amount of apo A-I in chromatographic fractions of the total apoprotein of high density lipoprotein. Content (weight %, mean values +- S.D.) of immunoassayable apo A-I was: 62.3 +- 5.9 in high density lipoprotein; 1.7 +- 0.3 in low density lipoprotein; 0.09 +- 0.03 in very low density lipoprotein and 25.0 +- 5.0 in lymph chylomicrons. Concentration in whole serum was 51.4 +- 8.9 mg/dl and 33.6 +- 4.1 mg/dl for female and male rats, respectively (p 1.21 g/ml and <1% in lipoproteins of d<1.063 g/ml

  8. Spain: NATO or Neutrality,

    Science.gov (United States)

    1980-04-01

    having Spain as a member. Spain is a traditional country in many ways. Religion is still a strongly-felt part of national life and atheism is looked at... Siglo XXI, 30 April 1979. Pedro J. Ramirez, "Diez Razones a favor de la OTAN," ABC, 17 September 1978, p. 7. 8 Ibid. Il 167 - SPAIN - WHAT’S IN IT...Cordoba and Granada. All three of the country’s major religions lived in relative harmony primarily in Moorish kingdoms, where the arts, commerce, and the

  9. Little AI: Playing a constructivist robot

    Directory of Open Access Journals (Sweden)

    Olivier L. Georgeon

    2017-01-01

    Full Text Available Little AI is a pedagogical game aimed at presenting the founding concepts of constructivist learning and developmental Artificial Intelligence. It primarily targets students in computer science and cognitive science but it can also interest the general public curious about these topics. It requires no particular scientific background; even children can find it entertaining. Professors can use it as a pedagogical resource in class or in online courses. The player presses buttons to control a simulated “baby robot”. The player cannot see the robot and its environment, and initially ignores the effects of the commands. The only information received by the player is feedback from the player’s commands. The player must learn, at the same time, the functioning of the robot’s body and the structure of the environment from patterns in the stream of commands and feedback. We argue that this situation is analogous to how infants engage in early-stage developmental learning (e.g., Piaget (1937, [1].

  10. [Artificial intelligence] AI for protection systems

    Energy Technology Data Exchange (ETDEWEB)

    Aggarwal, R.; Johns, A.

    1997-12-31

    The reliable operation of large power systems with small stability margins is highly dependent on control systems and protection devices. Progress in the field of microprocessor systems and demanding requirements in respect of the performance of protective relays are the reasons for digital device applications to power system protection. The superiority of numeric protection over its analogue alternatives is attributed to such factors as accurate extraction of the fundamental voltage and current components through filtering, functional benefits resulting from multi-processor design and extensive self-monitoring, etc. However, all these reasons have not led to a major impact on speed, sensitivity and selectivity of primary protective relays, and the gains are only marginal; this is so because conventional digital relays still rely on deterministic signal models and a heuristic approach for decision making, so that only a fraction of the information contained within voltage and current signals as well as knowledge about the plant to be protected is used. The performance of digital relays may be substantially improved if the decision making is based on elements of artificial intelligence (AI). (Author)

  11. Data of evolutionary structure change: 1AIFB-2AI0K [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available ignment> 0 n> 1AIF n>B 1AI... CA 272 n> 2AI0 n>K ...n>2AI0Kn> VAHPASSTKVD EEE EEEE...1AIFB-2AI0K 1AIF 2AI0 B K EVKLQESGGGLVQPGGSMKLSCVASGFTFNNYWMSWVRQ...SCAASGFTFRNYGMSWVRQTPEKRLEWVAAIS--GNSLYTSYPDSVKGRFTISRDNAKNNLYLQMSSLRSEDTALYFCARH

  12. Airborne grass (Poaceae) pollen in southern Spain. Results of a 10-year study (1987-96).

    Science.gov (United States)

    González Minero, F J; Candau, P; Tomás, C; Morales, J

    1998-03-01

    This work reports an exhaustive study of the aerobiology of the Gramineae in Seville, Spain, which is typical of coastal Mediterranean areas. Sampling was done with a Cour trap installed on the roof terrace of the School of Pharmacy, Seville, from 1987 to 1996, both inclusive. The climatic pattern of that period was characterized by two exceptionally wet years (1989 and 1996), between which were 5 consecutive years of drought (1990-5). This typically Mediterranean climate affects grass aerobiology. The annual amounts of total grass pollen are low, never exceeding 2500 grains/m3. The start, length, and intensity of the pollen season are significantly correlated with preseasonal meteorologic factors (precipitation and temperature), but intraseasonal meteorologic conditions have no effect on the three variables. The relationships are stated by three equations that, while further years of observations are anticipated, can be considered models to forecast the characteristics of the pollen season: the starting date depends on the mean temperatures of January and February, and the length and intensity of the season depend on the rainfall between the beginning of January and the starting date of the season. For the study period, the weekly concentrations (pollen curves) throughout the year showed no typical pattern of variation over the years, so that it was impossible to make mid- and long-term forecasts of the variation in weekly concentration. The most noteworthy aspects of grass pollen curves are a long pollen season, which starts in February or March and lasts until September or October; peaks of higher concentration (> 100 grains/m3) in May and June, associated with increases in temperature and absence of precipitation; and other peaks in the summer months that may be as high as the spring peaks.

  13. Digital models applied to the intervention of the architectural heritage: Restoration Southeast closing of the door of San Cristobal Cathedral of Seville

    Directory of Open Access Journals (Sweden)

    Francisco Pinto Puerto

    2015-10-01

    Full Text Available Interventions in historical heritage present an opportunity to gain a deeper knowledge of the element in question. The use of an appropriate methodology and the rational application of the technologies now available allow researchers from different disciplines to obtain valuable information that must be recorded and placed at the disposal of society in general. The recent consolidation works carried out on the finial of the spiral staircase of the San Cristóbal Door of Seville Cathedral is a case in point. In addition to creating an elevation of this architectural element, a virtual model was generated, incorporating all the data obtained during the course of the works. The theoretical bases were explored prior to creating the model, highlighting the importance of a profound preliminary analysis as well as the dissemination possibilities.

  14. INES in Spain

    International Nuclear Information System (INIS)

    Zarzuela, J.

    1997-01-01

    The presentation discusses the INES activities in Spain addressing the following issues: applicability; rating procedure; public information; activities in 1997; events above level 0 (October 1996 - September 1997); difficulties

  15. Molecular Gastronomy in Spain

    OpenAIRE

    García-Segovia, Purificación; Garrido, María Dolores; Vercet Tormo, Antonio; Arboleya, Juan Carlos; FISZMAN DAL SANTO, SUSANA; Martínez Monzó, Javier; Laguarda, Sergio; Palacios, Victor; Ruiz Carrascal, Jorge

    2014-01-01

    [EN] Beyond the overwhelming international success of Ferrán Adria, Spain has been one of the countries with a more active implication in molecular gastronomy as a scientific discipline but also in the use of ingredients, technologies, and equipment from the scientificand technological universe in the culinary area. Nowadays, this is a well-established discipline in Spain, with a number of research groups covering related topics, several companies commercializing appliances and additives worl...

  16. Radionuclides in the environment in the south of Spain, anthropogenic enhancements due to industry

    Energy Technology Data Exchange (ETDEWEB)

    Manjon, G. [Depto. de Fisica Aplicada 2, E.T.S. Arquitectura, Universidad de Sevilla, Av. Reina Mercedes 2, 41012 - Sevilla (Spain)

    2007-07-01

    Levels of natural radionuclides in the environment are affected by human activities in the South of Spain. Industry wastes, such as phospho-gypsum, have been released to an estuary since sixties until 1997. Nowadays the wastes management is careful with environment protection, which can be clearly observed today in the radionuclides pattern. Different sources of radionuclides (industry wastes, tidal action and mining) can be distinguished in the estuary. Uranium isotopes, {sup 226}Ra, {sup 210}Pb and {sup 210}Po were determined in water and sediment samples for this study. An iron recycling factory is working close to Seville (South of Spain). A {sup 137}Cs source was accidentally burnt in a furnace of this factory in 2001. The environmental impact of this accident was immediately denatured. Monitoring procedure and results are sho vn in this contribution. Radionuclides measurement involves difficult techniques. In this communication a procedure to determine the activity concentration of {sup 210}Pb by liquid scintillation counting is presented. Two quality tests, using gamma- and alpha-spectrometry were applied to the {sup 210} Pb results. (Author)

  17. Radionuclides in the environment in the south of Spain, anthropogenic enhancements due to industry

    International Nuclear Information System (INIS)

    Manjon, G.

    2007-01-01

    Levels of natural radionuclides in the environment are affected by human activities in the South of Spain. Industry wastes, such as phospho-gypsum, have been released to an estuary since sixties until 1997. Nowadays the wastes management is careful with environment protection, which can be clearly observed today in the radionuclides pattern. Different sources of radionuclides (industry wastes, tidal action and mining) can be distinguished in the estuary. Uranium isotopes, 226 Ra, 210 Pb and 210 Po were determined in water and sediment samples for this study. An iron recycling factory is working close to Seville (South of Spain). A 137 Cs source was accidentally burnt in a furnace of this factory in 2001. The environmental impact of this accident was immediately denatured. Monitoring procedure and results are sho vn in this contribution. Radionuclides measurement involves difficult techniques. In this communication a procedure to determine the activity concentration of 210 Pb by liquid scintillation counting is presented. Two quality tests, using gamma- and alpha-spectrometry were applied to the 210 Pb results. (Author)

  18. Dicty_cDB: FC-AI12 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AI12 (Link to dictyBase) - - - Contig-U15484-1 FC-AI12Z (Li...nk to Original site) - - FC-AI12Z 614 - - - - Show FC-AI12 Library FC (Link to library) Clone ID FC-AI12 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AI/FC-AI12Q.Seq.d/ Representative seq. ID FC-AI...12Z (Link to Original site) Representative DNA sequence >FC-AI12 (FC-AI12Q) /CSM/FC/FC-AI/FC-AI12Q.Seq....EKIVRRI ELLDGITCYRNEKAKDEIVLTGNSLELLSQSCATIQLRSAIKYKDVRKFLDGIYVSERNV LESN*in*riys

  19. Dicty_cDB: FC-AI07 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AI07 (Link to dictyBase) - - - Contig-U15296-1 | Contig-U15756-1 FC-AI...07P (Link to Original site) FC-AI07F 580 FC-AI07Z 723 FC-AI07P 1303 - - Show FC-AI07 Library FC (...Link to library) Clone ID FC-AI07 (Link to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Con...tig-U15296-1 | Contig-U15756-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AI/FC-AI...07Q.Seq.d/ Representative seq. ID FC-AI07P (Link to Original site) Representative DNA sequence >FC-AI07 (FC-AI

  20. Dicty_cDB: FC-AI19 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AI19 (Link to dictyBase) - - - Contig-U15115-1 FC-AI19Z (Li...nk to Original site) - - FC-AI19Z 661 - - - - Show FC-AI19 Library FC (Link to library) Clone ID FC-AI19 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AI/FC-AI19Q.Seq.d/ Representative seq. ID FC-AI...19Z (Link to Original site) Representative DNA sequence >FC-AI19 (FC-AI19Q) /CSM/FC/FC-AI/FC-AI19Q.Seq....lmrqswvkkiesi*lvl krrkkkknnkkkkkkkkkkklfn*lvnkkn*ik*kkllcnqkk Frame B: ---*ekaieilsklfsin*kfn**ysiiigkkstkyq

  1. Dicty_cDB: FC-AI14 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AI14 (Link to dictyBase) - - - Contig-U16280-1 FC-AI14Z (Li...nk to Original site) - - FC-AI14Z 671 - - - - Show FC-AI14 Library FC (Link to library) Clone ID FC-AI14 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AI/FC-AI14Q.Seq.d/ Representative seq. ID FC-AI...14Z (Link to Original site) Representative DNA sequence >FC-AI14 (FC-AI14Q) /CSM/FC/FC-AI/FC-AI14Q.Seq....nqrllv*lvvlskklqllnsnqsfkfkkvq rmkknsvkntkn*rfvllt*nlkslkrmpksknsptkliifilkly Frame B: ---lkdl*krtphl*stcfhhptlcssrrfclwslnai

  2. Dicty_cDB: FC-AI15 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AI15 (Link to dictyBase) - G01730 DDB0214993 Contig-U15123-1 FC-AI...15E (Link to Original site) - - - - - - FC-AI15E 856 Show FC-AI15 Library FC (Link to library) Clone ID FC-AI...3-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AI/FC-AI15Q.Se...q.d/ Representative seq. ID FC-AI15E (Link to Original site) Representative DNA sequence >FC-AI15 (FC-AI15Q) /CSM/FC/FC-AI/FC-AI...AAAAAAAATA sequence update 1996.12.24 Translated Amino Acid sequence kt*riyi*KMMIKYITIAILFIASLVKADLQFSLCPTCV

  3. Dicty_cDB: FC-AI24 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AI24 (Link to dictyBase) - - - - FC-AI24Z (Link to Original site) - - FC-AI...24Z 693 - - - - Show FC-AI24 Library FC (Link to library) Clone ID FC-AI24 (Link to dictyBas...e) Atlas ID - NBRP ID - dictyBase ID - Link to Contig - Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AI/FC-AI...24Q.Seq.d/ Representative seq. ID FC-AI24Z (Link to Original s...ite) Representative DNA sequence >FC-AI24 (FC-AI24Q) /CSM/FC/FC-AI/FC-AI24Q.Seq.d/ XXXXXXXXXXAAATTAGAAAACAAA

  4. Dicty_cDB: FC-AI06 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AI06 (Link to dictyBase) - - - Contig-U16465-1 FC-AI06E (Li...nk to Original site) - - - - - - FC-AI06E 1138 Show FC-AI06 Library FC (Link to library) Clone ID FC-AI06 (L...//dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AI/FC-AI06Q.Seq.d/ Representative seq. ID FC-AI...06E (Link to Original site) Representative DNA sequence >FC-AI06 (FC-AI06Q) /CSM/FC/FC-AI/FC-AI06Q.Seq...FGRGIDIERVNVVINYDMAESADTYLHRVGRAGRFGTK GLAISFVPSKEDPVLEQVQSKFVVSIKELVATPDPSTYMSG*kkkkkkkknlfvlksikk k*kkk*in

  5. Dicty_cDB: FC-AI09 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AI09 (Link to dictyBase) - - - Contig-U16149-1 FC-AI09Z (Li...nk to Original site) - - FC-AI09Z 591 - - - - Show FC-AI09 Library FC (Link to library) Clone ID FC-AI09 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AI/FC-AI09Q.Seq.d/ Representative seq. ID FC-AI...09Z (Link to Original site) Representative DNA sequence >FC-AI09 (FC-AI09Q) /CSM/FC/FC-AI/FC-AI09Q.Seq....*tkl ik*ilifykiknnkkkkkk Frame B: ---gt*kvpeflailfkrmasrsvlwy*rcltkakkglkapqtltik

  6. Dicty_cDB: FC-AI22 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AI22 (Link to dictyBase) - - - Contig-U15369-1 | Contig-U15732-1 FC-AI...22P (Link to Original site) FC-AI22F 583 FC-AI22Z 683 FC-AI22P 1266 - - Show FC-AI22 Library FC (...Link to library) Clone ID FC-AI22 (Link to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Con...tig-U15369-1 | Contig-U15732-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AI/FC-AI...22Q.Seq.d/ Representative seq. ID FC-AI22P (Link to Original site) Representative DNA sequence >FC-AI22 (FC-AI

  7. Dicty_cDB: FC-AI08 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AI08 (Link to dictyBase) - G01729 DDB0233148 Contig-U14939-1 FC-AI...08P (Link to Original site) FC-AI08F 654 FC-AI08Z 563 FC-AI08P 1217 - - Show FC-AI08 Library FC (Link... to library) Clone ID FC-AI08 (Link to dictyBase) Atlas ID - NBRP ID G01729 dictyBase ID DDB0233148 Link to ...Contig Contig-U14939-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AI/FC-AI...08Q.Seq.d/ Representative seq. ID FC-AI08P (Link to Original site) Representative DNA sequence >FC-AI08 (FC-AI

  8. Social movements and access to assets and services. Proposal of an analytical framework based on a comparative analysis of cases: political confrontation of unemployed persons (Argentina and occupancy of housing (Spain

    Directory of Open Access Journals (Sweden)

    Maria-Rosa Herrera-Gutierrez

    2017-06-01

    Full Text Available This work is the result of collaboration between researchers from two Academic Units of Social Work located in Spain and Argentina. The overall objective is to explore the analytical frameworks and empirical objects of research projects linked to social movements developed in both countries. Specifically, two phenomena that lead to social mobilization, unemployment through the territorial expressions of the unemployed (Córdoba, Argentina and housing through the occupation of buildings by people who are evicted (Seville, Spain are compared. The work includes the description of the cases in each country, and the nuclear concepts of analysis, community social innovation in the Spanish case of occupation of housing and political confrontation in the case of Argentina. Finally, we discuss some conclusions that present the proposed dimensions for an analytical framework that responds to the relationship between social movements and access to assets and services.

  9. Recent progresses on AI-2 bacterial quorum sensing inhibitors.

    Science.gov (United States)

    Zhu, Peng; Li, Minyong

    2012-01-01

    Quorum sensing (QS) is a communication procedure that predominates gene expression in response to cell density and fluctuations in the neighboring environment as a result of discerning molecules termed autoinducers (AIs). It has been embroiled that QS can govern bacterial behaviors such as the secretion of virulence factors, biofilm formation, bioluminescence production, conjugation, sporulation and swarming motility. Autoinducer 2 (AI-2), a QS signaling molecule brought up to be involved in interspecies communication, exists in both gram-negative and -positive bacteria. Therefore, novel approaches to interrupt AI-2 quorum sensing are being recognized as next generation antimicrobials. In the present review article, we summarized recent progresses on AI-2 bacterial quorum sensing inhibitors and discussed their potential as the antibacterial agents.

  10. Expanding the Possibilities of AIS Data with Heuristics

    Directory of Open Access Journals (Sweden)

    Bjørnar Brende Smestad

    2017-06-01

    Full Text Available Automatic Identification System (AIS is primarily used as a tracking system for ships, but with the launch of satellites to collect these data, new and previously untested possibilities are emerging. This paper presents the development of heuristics for establishing the specific ship type using information retrieved from AIS data alone. These heuristics expand the possibilities of AIS data, as the specific ship type is vital for several transportation research cases, such as emission analyses of ship traffic and studies on slow steaming. The presented method for developing heuristics can be used for a wider range of vessels. These heuristics may form the basis of large-scale studies on ship traffic using AIS data when it is not feasible or desirable to use commercial ship data registers.

  11. Creating an AI modeling application for designers and developers

    Science.gov (United States)

    Houlette, Ryan; Fu, Daniel; Jensen, Randy

    2003-09-01

    Simulation developers often realize an entity's AI by writing a program that exhibits the intended behavior. These behaviors are often the product of design documents written by designers. These individuals, while possessing a vast knowledge of the subject matter, might not have any programming knowledge whatsoever. To address this disconnect between design and subsequent development, we have created an AI application whereby a designer or developer sketches an entity's AI using a graphical "drag and drop" interface to quickly articulate behavior using a UML-like representation of state charts. Aside from the design-level benefits, the application also features a runtime engine that takes the application's data as input along with a simulation or game interface, and makes the AI operational. We discuss our experience in creating such an application for both designer and developer.

  12. 4th June: AIS and NICE/MAIL unique authentication

    CERN Multimedia

    AIS and NICE teams

    2007-01-01

    Over the past few years, the IT department has been in the process of streamlining CERN users' access to all central computing services. The long term goal is to converge on a unique computer account, which will increase computer security and simplify account maintenance. The next step of this process will occur on 4th June 2007, as of when authenticating on the AIS applications (EDH, HRT, CET, APT, ERT, CRA, Foundation, ...) and on NICE (Windows) and MAIL will be done using the same username and password. As a reminder, this account can also be used on EDMS, INDICO, CDS and SIMBA. So starting on 4th June 2007, authentication on the AIS applications must be done using your AIS username and your MAIL/NICE password. Thanks for your understanding, The AIS and NICE teams

  13. 4th June: AIS and NICE/MAIL unique authentication

    CERN Multimedia

    The AIS and NICE teams

    2007-01-01

    Over the past few years, the IT department has been in the process of streamlining CERN users' access to all central computing services. The long term goal is to converge on a unique computer account, which will increase computer security and simplify account maintenance. The next step of this process will occur on the 4th June 2007, as of when authenticating on the AIS applications (EDH, HRT, CET, APT, ERT, CRA, Foundation, ...) and on NICE (Windows) and MAIL will be done using the same username and password. As a reminder, this account can also be used on EDMS, INDICO, CDS and SIMBA. Thus starting on the 4th June 2007, authentication on the AIS applications must be done using your AIS username and your MAIL/NICE password. Thanks for your understanding, The AIS and NICE teams

  14. Quality measures and assurance for AI (Artificial Intelligence) software

    Science.gov (United States)

    Rushby, John

    1988-01-01

    This report is concerned with the application of software quality and evaluation measures to AI software and, more broadly, with the question of quality assurance for AI software. Considered are not only the metrics that attempt to measure some aspect of software quality, but also the methodologies and techniques (such as systematic testing) that attempt to improve some dimension of quality, without necessarily quantifying the extent of the improvement. The report is divided into three parts Part 1 reviews existing software quality measures, i.e., those that have been developed for, and applied to, conventional software. Part 2 considers the characteristics of AI software, the applicability and potential utility of measures and techniques identified in the first part, and reviews those few methods developed specifically for AI software. Part 3 presents an assessment and recommendations for the further exploration of this important area.

  15. Liquid Robotics Wave Glider, Honey Badger (G3), 2015, AIS

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Liquid Robotics Wave Glider, Honey Badger (G3), 2015, AIS. The MAGI mission is to use the Wave Glider to sample the late summer chlorophyll bloom that develops near...

  16. NASA space station automation: AI-based technology review

    Science.gov (United States)

    Firschein, O.; Georgeff, M. P.; Park, W.; Neumann, P.; Kautz, W. H.; Levitt, K. N.; Rom, R. J.; Poggio, A. A.

    1985-01-01

    Research and Development projects in automation for the Space Station are discussed. Artificial Intelligence (AI) based automation technologies are planned to enhance crew safety through reduced need for EVA, increase crew productivity through the reduction of routine operations, increase space station autonomy, and augment space station capability through the use of teleoperation and robotics. AI technology will also be developed for the servicing of satellites at the Space Station, system monitoring and diagnosis, space manufacturing, and the assembly of large space structures.

  17. Human-Assisted AI: an Intelligence Augmentation Approach

    OpenAIRE

    Alicea, Bradly

    2018-01-01

    As a flavor of Human-Computer Interaction (HCI), Human-Assisted AI can serve to both augment both human performance and artificial systems. This talk will feature a discussion of Human-assisted AI as an instance of Intelligence Augmentation (IA). We will discuss instances of weak and strong IA, in addition to contemporary examples of and paths forward for such systems. In the variety of models presented, data plays a critical role in the structure of interactions between human and artificial ...

  18. Emotion Oriented Programming: Computational Abstractions for AI Problem Solving

    OpenAIRE

    Darty , Kevin; Sabouret , Nicolas

    2012-01-01

    International audience; In this paper, we present a programming paradigm for AI problem solving based on computational concepts drawn from Affective Computing. It is believed that emotions participate in human adaptability and reactivity, in behaviour selection and in complex and dynamic environments. We propose to define a mechanism inspired from this observation for general AI problem solving. To this purpose, we synthesize emotions as programming abstractions that represent the perception ...

  19. It Takes Two to Tango: Towards Theory of AI's Mind

    OpenAIRE

    Chandrasekaran, Arjun; Yadav, Deshraj; Chattopadhyay, Prithvijit; Prabhu, Viraj; Parikh, Devi

    2017-01-01

    Theory of Mind is the ability to attribute mental states (beliefs, intents, knowledge, perspectives, etc.) to others and recognize that these mental states may differ from one's own. Theory of Mind is critical to effective communication and to teams demonstrating higher collective performance. To effectively leverage the progress in Artificial Intelligence (AI) to make our lives more productive, it is important for humans and AI to work well together in a team. Traditionally, there has been m...

  20. AI, Native Supercomputing and The Revival of Moore's Law

    OpenAIRE

    Lu, Chien-Ping

    2017-01-01

    Based on Alan Turing's proposition on AI and computing machinery, which shaped Computing as we know it today, the new AI computing machinery should comprise a universal computer and a universal learning machine. The later should understand linear algebra natively to overcome the slowdown of Moore's law. In such a universal learnig machine, a computing unit does not need to keep the legacy of a universal computing core. The data can be distributed to the computing units, and the results can be...

  1. AI-2 of Aggregatibacter actinomycetemcomitans Inhibits Candida albicans Biofilm Formation

    Directory of Open Access Journals (Sweden)

    Endang W. Bachtiar

    2014-07-01

    Full Text Available Aggregatibacter actinomycetemcomitans, a Gram-negative bacterium, and Candida albicans, a polymorphic fungus, are both commensals of the oral cavity but both are opportunistic pathogens that can cause oral diseases. A. actinomycetemcomitans produces a quorum-sensing molecule called autoinducer-2 (AI-2, synthesized by LuxS, that plays an important role in expression of virulence factors, in intra- but also in interspecies communication. The aim of this study was to investigate the role of AI-2 based signaling in the interactions between C. albicans and A. actinomycetemcomitans. A. actinomycetemcomitans adhered to C. albicans and inhibited biofilm formation by means of a molecule that was secreted during growth. C. albicans biofilm formation increased significantly when co-cultured with A. actinomycetemcomitans luxS, lacking AI-2 production. Addition of wild-type-derived spent medium or synthetic AI-2 to spent medium of the luxS strain, restored inhibition of C. albicans biofilm formation to wild-type levels. Addition of synthetic AI-2 significantly inhibited hypha formation of C. albicans possibly explaining the inhibition of biofilm formation. AI-2 of A. actinomycetemcomitans is synthesized by LuxS, accumulates during growth and inhibits C. albicans hypha- and biofilm formation. Identifying the molecular mechanisms underlying the interaction between bacteria and fungi may provide important insight into the balance within complex oral microbial communities.

  2. Highlights on artificial insemination (AI technology in the pig

    Directory of Open Access Journals (Sweden)

    Tarek Khalifa

    2014-03-01

    Full Text Available Over the past decade, there has been a tremendous increase in the development of field AI services in the majority of countries concerned with pig production. The objective of this paper is to review: (a the current status of swine AI in the world, (b significance and limitation of AI with liquid and frozen semen, (c the biological traits of porcine semen in relation to in-vitro sperm storage, (d the criteria used for selection of a boar stud as a semen supplier, (e how to process boar semen for liquid and frozen storage in the commercial settings and (f how to improve fertility and prolificacy of boar semen. More than 99% of the inseminations conducted worldwide are made with liquid-stored semen. AI with frozen semen is used only for upgrading the genetic base in a particular country or herd. Determining the initial quality of semen ejaculates along with the selection of the optimum storage extender has a profound effect on the quality and fertility of AI doses. Different procedures have been used for improving the fertility of preserved spermatozoa including colloidal centrifugation of the semen, intrauterine insemination and modulation of the uterine defense mechanism after AI. Development of an efficient protocol for synchronizing the time of ovulation in sows and gilts coupled with improving uterine horn insemination technique will make a breakthrough in the commercial use of frozen boar semen.

  3. Calibrating AIS images using the surface as a reference

    Science.gov (United States)

    Smith, M. O.; Roberts, D. A.; Shipman, H. M.; Adams, J. B.; Willis, S. C.; Gillespie, A. R.

    1987-01-01

    A method of evaluating the initial assumptions and uncertainties of the physical connection between Airborne Imaging Spectrometer (AIS) image data and laboratory/field spectrometer data was tested. The Tuscon AIS-2 image connects to lab reference spectra by an alignment to the image spectral endmembers through a system gain and offset for each band. Images were calibrated to reflectance so as to transform the image into a measure that is independent of the solar radiant flux. This transformation also makes the image spectra directly comparable to data from lab and field spectrometers. A method was tested for calibrating AIS images using the surface as a reference. The surface heterogeneity is defined by lab/field spectral measurements. It was found that the Tuscon AIS-2 image is consistent with each of the initial hypotheses: (1) that the AIS-2 instrument calibration is nearly linear; (2) the spectral variance is caused by sub-pixel mixtures of spectrally distinct materials and shade, and (3) that sub-pixel mixtures can be treated as linear mixtures of pure endmembers. It was also found that the image can be characterized by relatively few endmembers using the AIS-2 spectra.

  4. Application of AI methods to aircraft guidance and control

    Science.gov (United States)

    Hueschen, Richard M.; Mcmanus, John W.

    1988-01-01

    A research program for integrating artificial intelligence (AI) techniques with tools and methods used for aircraft flight control system design, development, and implementation is discussed. The application of the AI methods for the development and implementation of the logic software which operates with the control mode panel (CMP) of an aircraft is presented. The CMP is the pilot control panel for the automatic flight control system of a commercial-type research aircraft of Langley Research Center's Advanced Transport Operating Systems (ATOPS) program. A mouse-driven color-display emulation of the CMP, which was developed with AI methods and used to test the AI software logic implementation, is discussed. The operation of the CMP was enhanced with the addition of a display which was quickly developed with AI methods. The display advises the pilot of conditions not satisfied when a mode does not arm or engage. The implementation of the CMP software logic has shown that the time required to develop, implement, and modify software systems can be significantly reduced with the use of the AI methods.

  5. Spain's uranium industry

    International Nuclear Information System (INIS)

    Ferguson, M.P.

    1992-01-01

    Spain currently operates nine nuclear reactors totalling over 7,100 MWe of capacity, contributing about one-third of all electricity generated in Spain. Four reactors at advanced stages of construction remain mothballed as the result of a government-imposed moratorium, and a fire at Vandellos 1 in 1989 led to its premature closure and to a revival of anti-nuclear sentiment in the country. In the new national energy plan, which was sent to the Spanish Parliament on July 25, 1991, Spain opted to continue the nuclear moratorium that began in 1984 and rely upon conservation measures, additional natural gas imports, and electricity imports to meet expected demand. Under the new plan, nuclear power's share of Spain's total installed electrical generating capacity will fall from about 17 percent in 1990, to approximately 14 percent by the end of the century, as only the current nuclear facilities will continue to operate and no new nuclear plants will be built. Spain's integration into the European Community also is affecting the country's energy plans, prompting consolidation within the Spanish electricity sector in order to be more competitive in Europe. To supply the existing reactors, the government is supporting a major expansion of the country's domestic uranium industry

  6. Quality assurance in Spain

    International Nuclear Information System (INIS)

    Villate, J.

    1980-01-01

    The first part of this lecture is devoted to present the energy program in Spain and the three generations of nuclear plants. The evolution of QA is outlined pointing out how IAEA Codes of Practice on QA is now a requirement and also how USA regulations, codes and standards have constituted, up to now, the main framework to develop QA activities in Spain. A general idea is given of the Spanish program of courses to qualify the personnel to be involved in QA tasks in nuclear power plants. Finally a general scheme is given, emphasizing the three main aspects: design, procurement and fabrication; construction (QA on site). (orig./RW)

  7. Spain investigates PLEX options

    International Nuclear Information System (INIS)

    Hevia, F.

    1990-01-01

    Spain's nuclear generation capacity will be reduced by some 6000MWe by the year 2015 if decommissioning of the units currently in operation takes place at the end of their 40-year design life. Bearing this in mind, in 1988 the Santa Maria de Garona BWR and the Jose Cabrera PWR were chosen by their respective owners as reference units for plant life extension (PLEX) activities. These plants are the oldest of their types operating in Spain and PLEX programmes were already under way. (author)

  8. The "El Alamo" project (1990-1997): two consecutive hospital-based studies of breast cancer outcomes in Spain.

    Science.gov (United States)

    Martín, M; Mahillo, E; Llombart-Cussac, A; Lluch, A; Munarriz, B; Pastor, M; Alba, E; Ruiz, A; Antón, A; Bermejo, B

    2006-07-01

    The "Alamo" project is a retrospective analysis of 14,854 patients diagnosed of breast cancer between 1990 and 1997 in 50 Spanish hospitals. Alamo I (AI) consisted of 4,532 patients diagnosed with breast cancer between 1990 and 1993. Data were collected in 2000. Alamo II (AII) consisted of 10,322 patients diagnosed between 1994 and 1997. Data were collected in 2003. At presentation, there were (AI vs. AII) 17.6% vs. 24.3% at stage I; 55.5% vs. 53.1% at stage II; 18.7% vs. 15% at stage III; 7.2% vs. 5.9 at stage IV. Median age was 57 (AI) vs. 58 years (AII) and 65.9% vs. 67.2% (AI vs. AII) were post-menopausal. Firstline treatment for disease stages I, II and III was surgery in 91% of patients in both studies. Breast conserving surgery rate increased from 20.2% (AI) to 32.7% (AII). Adjuvant systemic treatments were administered to 87.6% (AI) and 92.8% (AII) of patients. Recurrence rate diminished from 36.6% (AI) to 22.5% (AII) and the 9-year survival rate increased from 63.2% (95% CI: 61.5-64.9) to 70.1% (95% CI: 68.5-71.8). Breast cancer outcomes in Spain have improved from 1990-1993 to 1994-1997, likely because of breast cancer screening program implementation and new therapies.

  9. Uptake of heavy metals and As by Brassica juncea grown in a contaminated soil in Aznalcollar (Spain): The effect of soil amendments

    International Nuclear Information System (INIS)

    Clemente, Rafael; Walker, David J.; Bernal, M. Pilar

    2005-01-01

    Two crops of Brassica juncea (L.) Czern. were grown in a field experiment, at the site affected by the toxic spillage of acidic, metal-rich waste in Aznalcollar (Seville, Spain), to study its metal accumulation and the feasibility of its use for metal phytoextraction. The effects of organic soil amendments (cow manure and mature compost) and lime on biomass production and plant survival were also assessed; plots without organic amendment and without lime were used as controls. Plots, with or without organic amendment, having pH -1 , respectively). The total uptake of heavy metals in the plants was relatively low, emphasising the problems faced when attempting to employ phytoextraction for clean-up of pluri-contaminated sites. - Although organic amendments improved soil conditions and plant growth, the phytoextraction capacity of Brassica juncea (cv. Z1) is too low for efficient soil remediation

  10. 77 FR 68150 - Meeting of the SANE/SART AI/AN Initiative Committee

    Science.gov (United States)

    2012-11-15

    .../SART AI/AN Initiative Committee AGENCY: Office for Victims of Crime, Justice. ACTION: Notice of meeting... Response Team (SART) American Indian/Alaskan Native (AI/AN) Initiative (``SANE/SART AI/AN Initiative... violence within AI/AN communities. Dates and Locations: The meeting will be held on the reservation of the...

  11. Data of evolutionary structure change: 1AIFL-2AI0L [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available /ss_2> 0 n> 1AIF L...n> 1AIFLn> VSSSI----SSSNL 2AI0 Ln> 2AI0L...1AIFL-2AI0L 1AIF 2AI0 L L DIQLTQSPAFMAASPGEKVTITCSVSSSI----SSSNLH...line> SER CA 273 SER CA 260 ASN CA 337 LEU CA 408

  12. Data of evolutionary structure change: 1AIFA-2AI0O [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available s_2> 0 n> 1AIF A...n> 1AIFAn> VSSSI----SSSNL n> 2AI0 n>O 2AI...1AIFA-2AI0O 1AIF 2AI0 A O DIQLTQSPAFMAASPGEKVTITCSVSSSI----SSSNLH...e>SER CA 251 SER CA 276 SER CA 258 ASN CA 337 LEU CA 410

  13. Data of evolutionary structure change: 1AIFH-2AI0K [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available > 0 n> 1AIF n>H ...n>1AIFHn> VAHPA-SSTKV n> 2AI0 n>K 2AI...1AIFH-2AI0K 1AIF 2AI0 H K EVKLQESGGGLVQPGGSMKLSCVASGFTFNNYWMSWVRQ...SCAASGFTFRNYGMSWVRQTPEKRLEWVAAIS--GNSLYTSYPDSVKGRFTISRDNAKNNLYLQMSSLRSEDTALYFCARH

  14. Data of evolutionary structure change: 1AIFA-2AI0L [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 2> 0 n> 1AIF n>A ...n>1AIFAn> VSSSI----SSSNL...n> 2AI0 n>L 2AI...1AIFA-2AI0L 1AIF 2AI0 A L DIQLTQSPAFMAASPGEKVTITCSVSSSI----SSSNLH...SER CA 251 SER CA 276 SER CA 258 ASN CA 337 LEU CA 410

  15. Municipal distribution of bladder cancer mortality in Spain: Possible role of mining and industry

    Directory of Open Access Journals (Sweden)

    Escolar-Pujolar Antonio

    2006-01-01

    Full Text Available Abstract Background Spain shows the highest bladder cancer incidence rates in men among European countries. The most important risk factors are tobacco smoking and occupational exposure to a range of different chemical substances, such as aromatic amines. Methods This paper describes the municipal distribution of bladder cancer mortality and attempts to "adjust" this spatial pattern for the prevalence of smokers, using the autoregressive spatial model proposed by Besag, York and Molliè, with relative risk of lung cancer mortality as a surrogate. Results It has been possible to compile and ascertain the posterior distribution of relative risk for bladder cancer adjusted for lung cancer mortality, on the basis of a single Bayesian spatial model covering all of Spain's 8077 towns. Maps were plotted depicting smoothed relative risk (RR estimates, and the distribution of the posterior probability of RR>1 by sex. Towns that registered the highest relative risks for both sexes were mostly located in the Provinces of Cadiz, Seville, Huelva, Barcelona and Almería. The highest-risk area in Barcelona Province corresponded to very specific municipal areas in the Bages district, e.g., Suría, Sallent, Balsareny, Manresa and Cardona. Conclusion Mining/industrial pollution and the risk entailed in certain occupational exposures could in part be dictating the pattern of municipal bladder cancer mortality in Spain. Population exposure to arsenic is a matter that calls for attention. It would be of great interest if the relationship between the chemical quality of drinking water and the frequency of bladder cancer could be studied.

  16. Molecular gastronomy in Spain

    DEFF Research Database (Denmark)

    García-Segovia, P.; Garrido, M. D.; Vercet, A.

    2014-01-01

    Beyond the overwhelming international success of Ferrán Adria, Spain has been one of the countries with a more active implication in molecular gastronomy as a scientific discipline but also in the use of ingredients, technologies, and equipment from the scientific and technological universe...... with scientists for facing the future of Spanish gastronomy....

  17. Proceedings of conference on AI applications in physical sciences

    International Nuclear Information System (INIS)

    1993-01-01

    A Conference cum workshop on AI applications in Physical Sciences was organised by the Indian Physics Association at Bhabha Atomic Research Centre, Bombay during January 15-17, 1992. It was held in memory of Late Shri S.N. Seshadri, who was the moving spirit behind self reliance in instrumentation development for research and industry. The two day conference which was followed by one day workshop covered the following broad spectrum of topics in Artificial Intelligence: AI Tools and Techniques, Neural Networks, Robotics and Machine Vision, Fuzzy Control and Applications, Natural Language and Speech Processing, Knowledge based Systems, and AI and Allied applications. The conference dealt with recent advances and achievements in AI. It provided a forum for the exchange of valuable information and expertise in this fast emerging field. Over 200 scientists, engineers and computer professionals from various universities, R and D institutes and industries actively participated. 45 contributed papers and 8 invited talks were presented in the symposium. The volume contains selected papers which were contributed by the participants. Some of them dealt with AI applications in nuclear science and technology. (original)

  18. Present status of application of AI in nuclear industry

    International Nuclear Information System (INIS)

    Kitamura, Masaharu

    1989-01-01

    Artificial intelligence (AL) techniques have been introduced actively in the nuclear industry in pursuit of increased safety and efficiency. The present report outlines some AI techniques currently used in nuclear facilities. This type of techniques have increasingly been introduced to such areas as design, construction, operation, maintenance, quality control and analysis. Most of them use knowledge engineering techniques including expert systems. Positive efforts at research and application of various more advance AI techniaues have started recently. For application of AI techniques, activities in nuclear power plants can be divided into two groups. One includes 'analytical' activities such as operation, maintenance and analysis, while the other includes 'synthetic' activities such as design, construction and fuel control. The most important AI technology for the analytical activities is diagnosis. Thus the report outlines major processes to which diagnostic techniques are applicable, and knowledge description and inference methods used for diagnosis. For AI techniques for synthetic activities, some problems and possible solutions are addressed. Development efforts in and outside Japan are also outlined. (Nogami, K.)

  19. Discovering Knowledge from AIS Database for Application in VTS

    Science.gov (United States)

    Tsou, Ming-Cheng

    The widespread use of the Automatic Identification System (AIS) has had a significant impact on maritime technology. AIS enables the Vessel Traffic Service (VTS) not only to offer commonly known functions such as identification, tracking and monitoring of vessels, but also to provide rich real-time information that is useful for marine traffic investigation, statistical analysis and theoretical research. However, due to the rapid accumulation of AIS observation data, the VTS platform is often unable quickly and effectively to absorb and analyze it. Traditional observation and analysis methods are becoming less suitable for the modern AIS generation of VTS. In view of this, we applied the same data mining technique used for business intelligence discovery (in Customer Relation Management (CRM) business marketing) to the analysis of AIS observation data. This recasts the marine traffic problem as a business-marketing problem and integrates technologies such as Geographic Information Systems (GIS), database management systems, data warehousing and data mining to facilitate the discovery of hidden and valuable information in a huge amount of observation data. Consequently, this provides the marine traffic managers with a useful strategic planning resource.

  20. A framework for AI-based nuclear design support system

    International Nuclear Information System (INIS)

    Furuta, Kazuo; Kondo, Shunsuke

    1991-01-01

    Nowadays many computer programs are being developed and used for the analytic tasks in nuclear reactor design, but experienced designers are still responsible for most of the synthetic tasks which are not amenable to algorithmic computer processes. Artificial intelligence (AI) is a promising technology to deal with these intractable tasks in design. In development of AI-based design support systems, it is desirable to choose a comprehensive framework based on the scientific theory of design. In this work a framework for AI-based design support systems for nuclear reactor design will be proposed based on an exploration model of design. The fundamental architectures of this framework will be described especially on knowledge representation, context management and design planning. (author)

  1. Analysis of raw AIS spectrum recordings from a LEO satellite

    DEFF Research Database (Denmark)

    Larsen, Jesper Abildgaard; Mortensen, Hans Peter

    2014-01-01

    The AAUSAT3 satellite is a 1U cubesat, which has been developed by students at Aalborg University, Denmark in collaboration with the Danish Maritime Authority. The satellite was launched in February 2013 on a mission to monitor ships from space using their AIS broadcast signals as an indication...... of position. The SDR receiver developed to listen for these AIS signals also allows for sampling and storing of the raw intermediate frequency spectrum, which has been used in order to map channel utilization over the areas of interest for the mission, which is mainly the arctic regions. The SDR based...... receiver used onboard the satellite is using a single chip front-end solution, which down converts the AIS signal located around 162 MHz into an intermediate frequency, with a up to 200 kHz bandwidth. This I/F signal is sampled with a 750 kSPS A/D converter and further processed by an Analog Devices DSP...

  2. Framework for AI-based nuclear reactor design support system

    International Nuclear Information System (INIS)

    Furuta, Kazuo; Kondo, Shunsuke

    1992-01-01

    Nowadays many computer programs are being developed and used for the analytic tasks in nuclear reactor design, but experienced designers are still responsible for most of the synthetic tasks which are not amenable to algorithmic computer processes. Artificial intelligence (AI) is a promising technology to deal with these intractable tasks in design. In development of AI-based design support systems, it is desirable to choose a comprehensive framework based on the scientific theory of design. In this work a framework for AI-based design support systems for nuclear reactor design will be proposed based on an explorative abduction model of design. The fundamental architectures of this framework will be described especially on knowledge representation, context management and design planning. (author)

  3. Towards AI-powered personalization in MOOC learning

    Science.gov (United States)

    Yu, Han; Miao, Chunyan; Leung, Cyril; White, Timothy John

    2017-12-01

    Massive Open Online Courses (MOOCs) represent a form of large-scale learning that is changing the landscape of higher education. In this paper, we offer a perspective on how advances in artificial intelligence (AI) may enhance learning and research on MOOCs. We focus on emerging AI techniques including how knowledge representation tools can enable students to adjust the sequence of learning to fit their own needs; how optimization techniques can efficiently match community teaching assistants to MOOC mediation tasks to offer personal attention to learners; and how virtual learning companions with human traits such as curiosity and emotions can enhance learning experience on a large scale. These new capabilities will also bring opportunities for educational researchers to analyse students' learning skills and uncover points along learning paths where students with different backgrounds may require different help. Ethical considerations related to the application of AI in MOOC education research are also discussed.

  4. AI-guided parameter optimization in inverse treatment planning

    International Nuclear Information System (INIS)

    Yan Hui; Yin Fangfang; Guan Huaiqun; Kim, Jae Ho

    2003-01-01

    An artificial intelligence (AI)-guided inverse planning system was developed to optimize the combination of parameters in the objective function for intensity-modulated radiation therapy (IMRT). In this system, the empirical knowledge of inverse planning was formulated with fuzzy if-then rules, which then guide the parameter modification based on the on-line calculated dose. Three kinds of parameters (weighting factor, dose specification, and dose prescription) were automatically modified using the fuzzy inference system (FIS). The performance of the AI-guided inverse planning system (AIGIPS) was examined using the simulated and clinical examples. Preliminary results indicate that the expected dose distribution was automatically achieved using the AI-guided inverse planning system, with the complicated compromising between different parameters accomplished by the fuzzy inference technique. The AIGIPS provides a highly promising method to replace the current trial-and-error approach

  5. Procedure for Marine Traffic Simulation with AIS Data

    Directory of Open Access Journals (Sweden)

    Rina Miyake

    2015-03-01

    Full Text Available It is essential to evaluate safety of marine traffic for the improvement of efficiency and safety of marine traffic. Spread of AIS makes observation of actual marine traffic more easily and faster than before. Besides, description of collision avoidance behaviours of ships are indispensable to simulate a realistic marine traffic. It is important to develop and implement an algorithm of collision avoidance corresponding to a target traffic or target area into the marine traffic simulation because actual actions for collision avoidance depend on circumstances where ships are sailing. The authors developed an automated marine traffic simulation system with AIS data. And in this paper, we proposed a series of systematic procedures for marine traffic simulation including analysing for collision avoidance behaviours using AIS data.

  6. The artisans of ‘Plus Ultra’: Pilots, cartographers and cosmographers in the House of Trade in Seville during the sixteenth century

    Directory of Open Access Journals (Sweden)

    Antonio Sánchez Martínez

    2010-12-01

    Full Text Available This article demonstrates how the institutionalization of cosmography and navigation ended with the slogan Non Terrae Plus Ultra, and led to the emergence of imperial heading Plus Ultra helped by the navigation of a Mare Tenebrosum (the Atlantic Ocean, and the delineation of the contours of a new world that began beyond the Columns of Hercules. This process was made possible by the establishment in Seville of the House of Trade in 1503 and the creation of scientific offices such as Pilot Major, master of making nautical charts or cosmographer. The ship appears on the cover of the Regimiento de navegación (1606 by Andres García de Céspedes across the pillars of the hero of Greek mythology highlights the Baconian premise of man's dominion over nature, the knowledge gained through the conquest of the West Indies, and also the wishes of the Spanish monarchy by taking advantage of the usefulness of scientific knowledge by joining the nautical experience and cosmographical theory.

  7. Relationship between the level of physical activity and sedentary, overweight and health-related quality of life in scholar-age asthmatic children: an explanatory study in Seville

    Directory of Open Access Journals (Sweden)

    Alfonso Rosa, Rosa María

    2012-07-01

    Full Text Available The aim of this study was: 1 To determine the differences between normal-weight asthmatic children and overweight asthmatic children in terms of HRQoL and amount of physical activity and sedentary and 2 To determine the relationship between amount of physical activity, sedentary and BMI and their influence on the HRQoL of this population in Seville. Method. We used a cohort design study that included 69 school-age children with controlled persistent asthma. The measures included in the study were: the questionnaire PAQL (S, to assess the HRQoL of children and the IPAQ-A questionnaire to assess the amount of physical activity and sedentary lifestyle of children. BMI was also calculated and determined if the participant was of normal-weight or overweight. Results. Overweight children scored worse on HRQoL and IPAQ-A values than their peers with normal-weight. Positive correlations were also observed between BMI and the amount of sedentary lifestyle. Negative correlations were observed between BMI and the amount of physical activity and also negative correlations were observed between BMI and HRQoL. Conclusion. BMI negatively affect HRQoL in school- age asthmatic children

  8. Application of AI technology to nuclear plant operations

    International Nuclear Information System (INIS)

    Sackett, J.I.

    1988-01-01

    In this paper, applications of Artificial Intelligence (AI) Technology to nuclear-power plant operation are reviewed. AI Technology is advancing rapidly and in the next five years is expected to enjoy widespread application to operation, maintenance, management and safety. Near term emphasis on a sensor validation, scheduling, alarm handling, and expert systems for procedural assistance. Ultimate applications are envisioned to culminate in autonomous control such as would be necessary for a power system in space, where automatic control actions are taken based upon reasoned conclusions regarding plant conditions, capability and control objectives

  9. AiGERM: A logic programming front end for GERM

    Science.gov (United States)

    Hashim, Safaa H.

    1990-01-01

    AiGerm (Artificially Intelligent Graphical Entity Relation Modeler) is a relational data base query and programming language front end for MCC (Mission Control Center)/STP's (Space Test Program) Germ (Graphical Entity Relational Modeling) system. It is intended as an add-on component of the Germ system to be used for navigating very large networks of information. It can also function as an expert system shell for prototyping knowledge-based systems. AiGerm provides an interface between the programming language and Germ.

  10. Tarasca: ritual monster of Spain.

    Science.gov (United States)

    Gilmore, David D

    2008-09-01

    misogynist theme that is so marked in the Spanish festival. Many anthroooloeists have noted the theme of the treacherous siren in Spanish folklore, a theme that corresponds to the female models carried aloft on the Tarasca's spine in Granada, Toledo, and other places. One observer, Stanley Brandes, was impressed with the pervasiveness of this specific male anxiety in the Andalusian town of Monteros. In his book on male folklore, Metaphors of Masculinity (1980), Brandes records a number of popular aphorisms that warn men to protect their fragile manhood from duplicitous females or suffer emasculation (one urges men literally to keep their penises in their pants or be castrated). In my own fieldwork in Seville Province, I found the eating/castration theme paramount in male folklore and I have recorded numerous Carnival ditties warning men and boys against the vagina dentata and other forms of female sexual aggression (Gilmore 1987; 1998). Literary scholar Louise Vasvari (1991, 3) refers to the "gastro-genital equivalence" symbolism of Spanish versification, which she identifies in writings dating back to the Middle Ages. Given all this evidence, we may conclude that with its defining misogynist theme and its female/monster imagery, the Spanish Tarasca embodies a dread of feminine sexuality that colors the Spanish male subculture. In particular, in the Hacinas case, the misogynist element combines a devouring theme along with the castration threat in the attack on the boys' genitals and in the liquid thrown onto the crotch, symbolizing, one may conjecture, semen and blood. While these themes are probably universal, their annual apotheosis in visual tropes, public rites, monster effigies, and masques may be specific to Spain. Both appalling in its ferocity and ennobling in its ultimate function as sacrificial object, the Tarasca is one of countless projections of universal human mental shadows as an embodiment, a visual metaphor, as James Fernandez has shown in his classic paper

  11. Nuclear energy in Spain

    International Nuclear Information System (INIS)

    Isla, M.

    1984-01-01

    The 'Plan Energetico Nacional de 1983' (1983 National Energy Program)(PEN-83) was approved recently by the Spanish Government and presented to the 'Cortes Espanolas' (Spanish Parliament) in May 1984. The PEN-83 is being discussed at present in the Parliament and it is possible that some modifications be introduced, but expectedly will be rather limited and minor. PEN-83 covers the period 1983-1992. It includes a comparative analysis of the evolution and situation in OECD countries and in Spain. In Spain the offer, supply and consumption of primary energy and of the interrelation with other economic indicators, such as the gross domestic product, inflation rate and unemployment compared with that of the industrialized OECD countries, has shown a much lower capability to adapt its structure to the energy price increases

  12. Nuclear power in Spain

    International Nuclear Information System (INIS)

    1979-01-01

    the plans of the Spanish Government to reduce their dependence on oil over the next ten years by a considerable increase in nuclear generating capacity are outlined. Data on the type, generating power, location and commissioning data of a number of nuclear power stations in Spain are tabulated. The use of foreign companies for the design and construction of the nuclear stations and the national organisations responsible for different aspects of the programme are considered. (UK)

  13. Snakebite poisoning in Spain.

    Science.gov (United States)

    Martín-Sierra, Cristina; Nogué-Xarau, Santiago; Pinillos Echeverría, Miguel Ángel; Rey Pecharromán, José Miguel

    2018-01-01

    Emergencies due to snakebites, although unusual in Spain, are potentially serious. Of the 13 species native to the Iberian peninsula, only 5 are poisonous: 2 belong to the Colubridae family and 3 to the Viperidae family. Bites from these venemous snakes can be life-threatening, but the venomous species can be easily identified by attending to certain physical traits. Signs denoting poisoning from vipers, and the appropriate treatment to follow, have changed in recent years.

  14. A Note on the Lithuanian 2nd Sg. Ending "-ai."

    Science.gov (United States)

    Schmalstieg, William R.

    1980-01-01

    Discusses an attempt by Chr. S. Stang to establish a proto-Lithuanian present paradigm for the verb "megti" (to like), questioning the existence of the second singular form "-ai." Argues that the few examples of this form, all from a single Bible translation source, afford shaky support for its existence. (Executive Office of the AABS, 231 Miller…

  15. Exploring AI Language Assistants with Primary EFL Students

    Science.gov (United States)

    Underwood, Joshua

    2017-01-01

    The main objective of this study was to identify ways to incorporate voice-driven Artificial Intelligence (AI) effectively in classroom language learning. This nine month teacher-led design research study employed technology probes (Amazon's Alexa, Apple's Siri, Google voice search) and co-design methods with a class of primary age English as a…

  16. Archiving AIS messages in a Geo-DBMS

    NARCIS (Netherlands)

    Meijers, B.M.; Quak, C.W.; van Oosterom, P.J.M.; Bregt, Arnold; Sarjakoski, Tapani; Lammeren, Ron van; Rip, Frans

    2017-01-01

    This paper reports on the result of two studies for using a geographical database management system for archiving Automated Identification System (AIS) message data. In this paper, we analyse the storage (using MongoDB and PostgreSQL) and we give a more in-depth description of a possible data model

  17. PASTURE ffPROVEMENT POSSIBILTTIES IN EFFECTIVE AI{IMAL ...

    African Journals Online (AJOL)

    PASTURE ffPROVEMENT POSSIBILTTIES IN EFFECTIVE AI{IMAL PRODUCTION SYSTEMS. P. de V. Booysen. University of Natal, King George V Avenue, Durban. (Key words: .... inherent in biotic simplification is the danger of increased susceptibility of the abiotic component to degradation. So as the agriculturalist ...

  18. The hidden dangers of experimenting in distributed AI

    NARCIS (Netherlands)

    Meyer, A.P.; Smit, A.; Kempen, M.; Wijngaards, N.

    2006-01-01

    Research on multi-agent systems often involves experiments, also in situations where humans interact with agents. Consequently, the field of experimental (human) sciences becomes more and more relevant. This paper clarifies how things can and often do go wrong in distributed AI experiments. We show

  19. The 2010 Mario AI Championship: Level Generation Track

    DEFF Research Database (Denmark)

    Shaker, Noor; Togelius, Julian; Yannakakis, Georgios N.

    2011-01-01

    The Level Generation Competition, part of the IEEE CIS-sponsored 2010 Mario AI Championship, was to our knowledge the world’s first procedural content generation competition. Competitors participated by submitting level generators — software that generates new levels for a version of Super Mario...

  20. AIS reception from a CubeSat in LEO

    DEFF Research Database (Denmark)

    Larsen, Jesper Abildgaard; Mortensen, Hans Peter; Nielsen, Jens Frederik Dalsgaard

    2013-01-01

    The primary payloads on board the AAUSAT3 satellite are two different AIS receivers, one is a traditional hardware-based receiver, the other one is a software-defined radio receiver. The hardware-based receiver has been developed around an ADF-7020 transceiver, with an appropriate LNA in front...... into a low-Earth orbit with a semi-major axis of 7156 km, i.e. 800 km altitude, near circular, dusk-dawn Sun-synchronous orbit. From this orbit the AIS antenna system, which consists of a dipole antenna, has a foot print diameter of approximately 6000 km. During the first pass over the primary ground station...... at Aalborg University, basic telemetry and the first few AIS messages were downloaded. During the first 14 days of the mission, the two receivers managed to detect more than 100,000 different AIS messages from ships all around the world, and more than 35,000 of these messages have been successfully...

  1. AI/Simulation Fusion Project at Lawrence Livermore National Laboratory

    Energy Technology Data Exchange (ETDEWEB)

    Erickson, S.A.

    1984-04-25

    This presentation first discusses the motivation for the AI Simulation Fusion project. After discussing very briefly what expert systems are in general, what object oriented languages are in general, and some observed features of typical combat simulations, it discusses why putting together artificial intelligence and combat simulation makes sense. We then talk about the first demonstration goal for this fusion project.

  2. AI/Simulation Fusion Project at Lawrence Livermore National Laboratory

    International Nuclear Information System (INIS)

    Erickson, S.A.

    1984-01-01

    This presentation first discusses the motivation for the AI Simulation Fusion project. After discussing very briefly what expert systems are in general, what object oriented languages are in general, and some observed features of typical combat simulations, it discusses why putting together artificial intelligence and combat simulation makes sense. We then talk about the first demonstration goal for this fusion project

  3. Measuring the Value of AI in Space Science and Exploration

    Science.gov (United States)

    Blair, B.; Parr, J.; Diamond, B.; Pittman, B.; Rasky, D.

    2017-10-01

    FDL is tackling knowledge gaps useful to the space program by forming small teams of industrial partners, cutting-edge AI researchers and space science domain experts, and tasking them to solve problems that are important to NASA as well as humanity's future.

  4. On the homotopy equivalence of simple AI-algebras

    International Nuclear Information System (INIS)

    Aristov, O Yu

    1999-01-01

    Let A and B be simple unital AI-algebras (an AI-algebra is an inductive limit of C*-algebras of the form BigOplus i k C([0,1],M N i ). It is proved that two arbitrary unital homomorphisms from A into B such that the corresponding maps K 0 A→K 0 B coincide are homotopic. Necessary and sufficient conditions on the Elliott invariant for A and B to be homotopy equivalent are indicated. Moreover, two algebras in the above class having the same K-theory but not homotopy equivalent are constructed. A theorem on the homotopy of approximately unitarily equivalent homomorphisms between AI-algebras is used in the proof, which is deduced in its turn from a generalization to the case of AI-algebras of a theorem of Manuilov stating that a unitary matrix almost commuting with a self-adjoint matrix h can be joined to 1 by a continuous path consisting of unitary matrices almost commuting with h

  5. Artificial Intelligence: Is the Future Now for A.I.?

    Science.gov (United States)

    Ramaswami, Rama

    2009-01-01

    In education, artificial intelligence (AI) has not made much headway. In the one area where it would seem poised to lend the most benefit--assessment--the reliance on standardized tests, intensified by the demands of the No Child Left Behind Act of 2001, which holds schools accountable for whether students pass statewide exams, precludes its use.…

  6. Predicting Vessel Trajectories from Ais Data Using R

    Science.gov (United States)

    2017-06-01

    Source: Hampton (2009). A vessel operator with AIS is able to get useful information about the other vessels in the area by selecting a vessel icon ...random forest model on our computer. All calculations are done on a MacBook-Pro with 2.7GHz quad-core Intel Core i7, and 16GB of memory . H2O allows us

  7. Long-term fiscal implications of funding assisted reproduction: a generational accounting model for Spain

    Directory of Open Access Journals (Sweden)

    R. Matorras

    2015-12-01

    Full Text Available The aim of this study was to assess the lifetime economic benefits of assisted reproduction in Spain by calculating the return on this investment. We developed a generational accounting model that simulates the flow of taxes paid by the individual, minus direct government transfers received over the individual’s lifetime. The difference between discounted transfers and taxes minus the cost of either IVF or artificial insemination (AI equals the net fiscal contribution (NFC of a child conceived through assisted reproduction. We conducted sensitivity analysis to test the robustness of our results under various macroeconomic scenarios. A child conceived through assisted reproduction would contribute €370,482 in net taxes to the Spanish Treasury and would receive €275,972 in transfers over their lifetime. Taking into account that only 75% of assisted reproduction pregnancies are successful, the NFC was estimated at €66,709 for IVF-conceived children and €67,253 for AI-conceived children. The return on investment for each euro invested was €15.98 for IVF and €18.53 for AI. The long-term NFC of a child conceived through assisted reproduction could range from €466,379 to €-9,529 (IVF and from €466,923 to €-8,985 (AI. The return on investment would vary between €-2.28 and €111.75 (IVF, and €-2.48 and €128.66 (AI for each euro invested. The break-even point at which the financial position would begin to favour the Spanish Treasury ranges between 29 and 41 years of age. Investment in assisted reproductive techniques may lead to positive discounted future fiscal revenue, notwithstanding its beneficial psychological effect for infertile couples in Spain.

  8. Training courses on radiation protection organized by the radioisotopes service of the University of Sevilla (Spain)

    International Nuclear Information System (INIS)

    Mateos, J. C.; Avalos, J.; Garcia-Leon, M.; Garcia-Tenorio, R.; Gomez-Puerto, A.; Gomez, M.; Herrador, M-; Lejeune, J.; Luis-simon, J.; Marquez, A.; Maranon, J.; Respaldiza, M. A.; Sanchez-Angulo, C.; Sanchez-Doblado, F.; Sarmiento, J. M.

    2003-01-01

    The University of Sevilla (Spain) through its Radioisotope Service has been organizing bi annually since 1995 Training courses for Supervisors and Operators of Radioactive Installations for university investigators that use radioactive sources or radiation equipment. The courses are imparted by professors from the university radioactive installations, hospital physicist specialists from medical physics services and medical doctors from prevention labour health service. The students are postgraduate students or professors that need operate, with ionising radiation in their research laboratories. Up to date, it has been organized 4 courses series with an average of 30 students per course. The courses are homologated by the Nuclear Security Council and let the student obtain the license for Supervisors or Operators of Radioactive Installations in each of the following applications fields. a) Laboratories with Non-Encapsulated Sources. This application includes research activities in Biology, Chemistry, Physics, Medicine and Pharmacy. b) Radiation Generator Equipment. This last one includes equipment such as X-Ray apparatus for diffraction studies in physics chemistry and art sciences, or Particle Accelerator for atomic physics research in the National Accelerator Centre. The practical sessions of the courses are imparted in the radioactive installations of the Seville university. In this study it is described the details of the organization of the courses. (Author) 4 refs

  9. Newspapers as early meteorological data sources in Andalusia (southern Spain), 1796-1830.

    Science.gov (United States)

    Fernández-Montes, S.; Rodrigo, F. S.

    2010-09-01

    The growing evidence of an anthropogenically induced climatic change and the need to compare present-day climate with that of the past centuries, has boosted the search of early meteorological data from all kind of historical archives. Among the documentary data sources, early newspapers deserve special attention. Anonymous observers began to send their data to local newspapers to ensure that people were informed of them. Hardly anything is known of the conditions in which these recording were made, and press collections conserved from late 18th century to mid-19th century are fragmentary. However, it is interesting to analyze the potential of these newspapers as climatic data sources in a period prior to the existence of an official meteorological service. In this work, some examples of Andalusian cities (southern Spain) are analyzed and their utility as data sources is studied: El Mensagero (1796-1797), El Publicista (1812-1813), Diario Constitucional (1820) of Granada, Diario del Gobierno de Sevilla (1812-1813), Diario de Sevilla (1826-1831), Diario de Sevilla de Comercio, Artes y Literatura (1829-1830) of Seville, and Diario Mercantil de Cádiz (1802-1803, 1816-1830) of Cádiz. Future research is outlined.

  10. Adult Prevalence of Epilepsy in Spain: EPIBERIA, a Population-Based Study

    Directory of Open Access Journals (Sweden)

    Pedro J. Serrano-Castro

    2015-01-01

    Full Text Available Background. This study assesses the lifetime and active prevalence of epilepsy in Spain in people older than 18 years. Methods. EPIBERIA is a population-based epidemiological study of epilepsy prevalence using data from three representative Spanish regions (health districts in Zaragoza, Almería, and Seville between 2012 and 2013. The study consisted of two phases: screening and confirmation. Participants completed a previously validated questionnaire (EPIBERIA questionnaire over the telephone. Results. A total of 1741 valid questionnaires were obtained, including 261 (14.99% raising a suspicion of epilepsy. Of these suspected cases, 216 (82.75% agreed to participate in phase 2. Of the phase 2 participants, 22 met the International League Against Epilepsy’s diagnostic criteria for epilepsy. The estimated lifetime prevalence, adjusted by age and sex per 1,000 people, was 14.87 (95% CI: 9.8–21.9. Active prevalence was 5.79 (95% CI: 2.8–10.6. No significant age, sex, or regional differences in prevalence were detected. Conclusions. EPIBERIA provides the most accurate estimate of epilepsy prevalence in the Mediterranean region based on its original methodology and its adherence to ILAE recommendations. We highlight that the lifetime prevalence and inactive epilepsy prevalence figures observed here were compared to other epidemiological studies.

  11. Adult Prevalence of Epilepsy in Spain: EPIBERIA, a Population-Based Study

    Science.gov (United States)

    Serrano-Castro, Pedro J.; Mauri-Llerda, Jose Angel; Hernández-Ramos, Francisco José; Sánchez-Alvarez, Juan Carlos; Parejo-Carbonell, Beatriz; Quiroga-Subirana, Pablo; Vázquez-Gutierrez, Fernando; Santos-Lasaosa, Sonia; Mendez-Lucena, Carolina; Redondo-Verge, Luis; Tejero-Juste, Carlos; Morandeira-Rivas, Clara; Sancho-Rieger, Jerónimo; Matías-Guiu, Jorge

    2015-01-01

    Background. This study assesses the lifetime and active prevalence of epilepsy in Spain in people older than 18 years. Methods. EPIBERIA is a population-based epidemiological study of epilepsy prevalence using data from three representative Spanish regions (health districts in Zaragoza, Almería, and Seville) between 2012 and 2013. The study consisted of two phases: screening and confirmation. Participants completed a previously validated questionnaire (EPIBERIA questionnaire) over the telephone. Results. A total of 1741 valid questionnaires were obtained, including 261 (14.99%) raising a suspicion of epilepsy. Of these suspected cases, 216 (82.75%) agreed to participate in phase 2. Of the phase 2 participants, 22 met the International League Against Epilepsy's diagnostic criteria for epilepsy. The estimated lifetime prevalence, adjusted by age and sex per 1,000 people, was 14.87 (95% CI: 9.8–21.9). Active prevalence was 5.79 (95% CI: 2.8–10.6). No significant age, sex, or regional differences in prevalence were detected. Conclusions. EPIBERIA provides the most accurate estimate of epilepsy prevalence in the Mediterranean region based on its original methodology and its adherence to ILAE recommendations. We highlight that the lifetime prevalence and inactive epilepsy prevalence figures observed here were compared to other epidemiological studies. PMID:26783554

  12. “De pugna virtutum adversus vitia”: os pecados capitais na obra de Isidoro de Sevilha = The cardinal sins in the work of Isidore of Seville

    Directory of Open Access Journals (Sweden)

    Sergio Alberto Feldman

    2010-07-01

    Full Text Available A proposta deste artigo é analisar a concepção dos pecados capitais na produção de Isidoro de Sevilha, a partir de sua obra magna o “Livro das Sentenças”, na qual descreve sua visão de mundo, sob a ótica da Cristandade e da teleologia agostiniana. O foco central éa construção de uma sociedade cristã que almeja combater o mal encarnado no diabo e em seus aliados, pela extirpação do pecado e pela construção de uma vanguarda de fiéis que se engajariam na luta das virtudes contra os vícios. O eixo da saúde pública permeia esseprojeto que visa a atingir a redenção e a segunda vinda de Cristo sob o Milênio redentor. The purpose of this paper is to analyze the conception of the cardinal sins in the work of Isidore of Seville, from his magnum opus "The Book of Sentences," which describes his world’s vision from theperspective of Christianity and Augustinian teleology. The main focus is the building of a Christian society that aims to combat evil in the devil incarnate and its allies through the removal of sin and the construction of a vanguard of believers who would engage in thestruggle of virtue against vices. The axis of this public health project aims to achieve the redemption and the second coming of Christ in the redeemer Millennium.

  13. [Suicide in Spain today].

    Science.gov (United States)

    Ruiz-Pérez, Isabel; Olry de Labry-Lima, Antonio

    2006-03-01

    Spain presents one of the lowest suicide rates (8.7 per 100,000) but, as well as Ireland, it has also experienced one of the highest rate increases both within Europe and within the world. In our country, it can be observed an increase in the suicide rates from 1975 to 1994, being this increase greater in men than in women. It can also be noted that there was a stabilisation in the following years. Social factors, specially those which have to deal with gender roles and changes in these roles, are the most common explanations. Another possible explanation for the observed increase in mortality due to suicide among young men could be the AIDS epidemic and intravenous drug addiction, that was observed in Spain during the eighties and nineties. Furthermore, we are witnessing an epidemic related to violence against children and women. Literature strongly suggests that child abuse (psychological and sexual) is associated with increased suicide risk in adolescent or adult life. Women experience violence from their intimate partners and have a greater risk of suffering from chronic pain, diverse somatisations, greater substance use like drugs and alcohol, depression and suicide attempt. The association between work precariousness and suicide seems to be due to economic and social and family support factors, which can lead to greater vulnerability to mental health problems. These factors are of great relevance, since Spain presents one of the highest unemployment and temporary employment rates in the European Union. It seems reasonable that, due to the individualism that characterises the contemporary society, its demands and the new role of women in the work market that cause, among others, a greater difficulty in combining work and family life, are factors that could explain the lack of decrease in suicide rates.

  14. Energy planning in Spain

    International Nuclear Information System (INIS)

    Cortina Garcia, J.

    1995-01-01

    This report aims to describe energy planning in Spain. It briefly analyses the three completed national energy plans (Plan Energetico Nacional, PEN). The fourth PEN 1991-2000 is analysed in detail, by reference to its objectives and characteristics and to developments during its first five years in operation. The Ministry of Industry and Energy has updated PEN en 1995, almost halfway through its period, and this is also summarised. Finally, there are some reflections on the future of energy planning. (Author) 46 refs

  15. Elasticidad precio de la demanda y perfil de los usuarios de la parada “Pablo de Olavide" de Metro de Sevilla || Price Elasticity of Demand and Profile of “Pablo de Olavide" Metro Stop's Users of Seville Metro

    Directory of Open Access Journals (Sweden)

    Hernández-Díaz, Alfredo G.

    2014-06-01

    Full Text Available En el presente trabajo mostramos los resultados más relevantes obtenidos en un proceso de encuestación a 300 usuarios de la estación “Pablo de Olavide" del metro de Sevilla. El objetivo del trabajo es doble: por un lado, analizar el perfil del usuario (motivaciones por las que usan el metro, intermodalidad y flujos; mientras que, por otro lado, a partir de las disposiciones a pagar con respecto a posibles incrementos en el precio del servicio, estimamos parcialmente la elasticidad precio de la demanda para esta población objetivo tan concreta. El perfil tan específico de los usuarios de dicha parada así como las características propias del metro de Sevilla explican algunos de los resultados obtenidos esperando ayuden a los gestores y administradores de Metro de Sevilla en la toma de decisiones. || In this paper the most relevant results obtained in a survey conducted by 300 users of the “Pablo de Olavide" Seville metro stop are presented. The aim of the paper is twofold. On the one hand, the user profile is analysed: motivations for using the subway, intermodality and ows, whereas, on the other hand, the price elasticity of demand is partially computed by means of the willingness to pay for that specic user profile. In fact, both the particular user profile and Seville metro's characteristics explain some of the obtained results that hopefully will help managers of Seville Metro in making decisions.

  16. Artemisiae Argyi Folium and its geo-authentic crude drug qi ai

    Directory of Open Access Journals (Sweden)

    Diangang Liu

    2017-01-01

    Conclusion: The superior quality of qi ai compared with general AAF may be due to relatively higher contents of bioactive components. This study provides basic information for further study and utilization of AAF and qi ai.

  17. Nuclear material control in Spain

    International Nuclear Information System (INIS)

    Velilla, A.

    1988-01-01

    A general view about the safeguards activities in Spain is presented. The national system of accounting for and control of nuclear materials is described. The safeguards agreements signed by Spain are presented and the facilities and nuclear materials under these agreements are listed. (E.G.) [pt

  18. Early Childhood Inclusion in Spain

    Science.gov (United States)

    Giné, Climent; Balcells-Balcells, Anna; Cañadas, Margarita; Paniagua, Gema

    2016-01-01

    This article describes early childhood inclusion in educational settings in Spain. First, we address the legislative framework of preschool education in Spain and offer a brief analysis of some relevant issues, including the current situation of early childhood education and inclusion at this stage. Second, current policies and practices relating…

  19. Future role of AI/Robotics in physical security

    International Nuclear Information System (INIS)

    Jacobs, J.

    1986-01-01

    Manpower requirements for physical security systems place a heavy burden on operating security budgets. Technology innovations which free personnel or which make security personnel more efficient in carrying out their tasks is an important means of dealing with budget and manpower constraints. It is believed that AI/Robotics will be important technologies to alleviate these problems in the future. There are three types of applications for AI and Robotics technology that may: (l) help security personnel perform their tasks more effectively or efficiently, (2) perform tasks that security personnel would otherwise perform (free up people), and (3) perform tasks that cannot be performed by security personnel at this time. This paper discusses the various types of security applications that are presently being considered for the above areas and briefly describes a few examples of the application of this technology

  20. AI mass spectrometers for space shuttle health monitoring

    Science.gov (United States)

    Adams, F. W.

    1991-01-01

    The facility Hazardous Gas Detection System (HGDS) at Kennedy Space Center (KSC) is a mass spectrometer based gas analyzer. Two instruments make up the HGDS, which is installed in a prime/backup arrangement, with the option of using both analyzers on the same sample line, or on two different lines simultaneously. It is used for monitoring the Shuttle during fuel loading, countdown, and drainback, if necessary. The use of complex instruments, operated over many shifts, has caused problems in tracking the status of the ground support equipment (GSE) and the vehicle. A requirement for overall system reliability has been a major force in the development of Shuttle GSE, and is the ultimate driver in the choice to pursue artificial intelligence (AI) techniques for Shuttle and Advanced Launch System (ALS) mass spectrometer systems. Shuttle applications of AI are detailed.

  1. Oil spills and AI: How to manage resources through simulation

    International Nuclear Information System (INIS)

    Giribone, P.; Bruzzone, A.G.; Caddeo, S.

    1995-01-01

    Today, in the Mediterranean theater of the Upper Tyrrhenian, the ecological risk involving oil installations is still quite high. This is due to the fact that valuable environmental and tourist areas exist together with large industrial and port structures; in particular, recent events have demonstrated the danger involving oil spills along the Ligurian coastline. This study proposes an approach to plan the operations that should be performed when accidents occur, based on the use of AI techniques

  2. Companion Cognitive Systems: A Step toward Human-Level AI

    OpenAIRE

    Forbus, Kenneth D.; Hinrichs, Thomas R.

    2006-01-01

    We are developing Companion Cognitive Systems, a new kind of software that can be effectively treated as a collaborator. Aside from their potential utility, we believe this effort is important because it focuses on three key problems that must be solved to achieve human-level AI: Robust reasoning and learning, interactivity, and longevity. We describe the ideas we are using to develop the first architecture for Companions: analogical processing, grounded in cognitive science for reasoning and...

  3. Conversational AI: The Science Behind the Alexa Prize

    OpenAIRE

    Ram, Ashwin; Prasad, Rohit; Khatri, Chandra; Venkatesh, Anu; Gabriel, Raefer; Liu, Qing; Nunn, Jeff; Hedayatnia, Behnam; Cheng, Ming; Nagar, Ashish; King, Eric; Bland, Kate; Wartick, Amanda; Pan, Yi; Song, Han

    2018-01-01

    Conversational agents are exploding in popularity. However, much work remains in the area of social conversation as well as free-form conversation over a broad range of domains and topics. To advance the state of the art in conversational AI, Amazon launched the Alexa Prize, a 2.5-million-dollar university competition where sixteen selected university teams were challenged to build conversational agents, known as socialbots, to converse coherently and engagingly with humans on popular topics ...

  4. General Video Game AI: Learning from Screen Capture

    OpenAIRE

    Kunanusont, Kamolwan; Lucas, Simon M.; Perez-Liebana, Diego

    2017-01-01

    General Video Game Artificial Intelligence is a general game playing framework for Artificial General Intelligence research in the video-games domain. In this paper, we propose for the first time a screen capture learning agent for General Video Game AI framework. A Deep Q-Network algorithm was applied and improved to develop an agent capable of learning to play different games in the framework. After testing this algorithm using various games of different categories and difficulty levels, th...

  5. Artificial intelligence (AI) systems for interpreting complex medical datasets.

    Science.gov (United States)

    Altman, R B

    2017-05-01

    Advances in machine intelligence have created powerful capabilities in algorithms that find hidden patterns in data, classify objects based on their measured characteristics, and associate similar patients/diseases/drugs based on common features. However, artificial intelligence (AI) applications in medical data have several technical challenges: complex and heterogeneous datasets, noisy medical datasets, and explaining their output to users. There are also social challenges related to intellectual property, data provenance, regulatory issues, economics, and liability. © 2017 ASCPT.

  6. Environmental performance reviews: Spain

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2004-10-01

    The second OECD Review of Spain's environmental performance reviews Spain's progress in the context of OECD environmental strategy for the first decade of the 21st century in relation to its own policy objectives. It praises a number of achievements such as in commitments to climate change policies and developments of cogeneration and renewable energy sources. Although emissions of sulphur dioxide from the energy sector have fallen since 1990 they are still high when measured per capita and per unit of GDP. The OECD recommends further control of emissions of SOx, NOx, VOCs and NH{sub 3}. Subsidies such as compulsory purchase of domestic coal by electricity producers are set to increase. The report recommends the phasing out of environmental subsidies (which has begun) and making use of economic instruments to encourage efficient resource management and reduction of pollutants. Greenhouse gas emissions increased by 38% between 1990 and 2002 and the outlook for the next few years is pessimistic. 39 figs., 31 tabs.

  7. Nuclear energy in Spain

    International Nuclear Information System (INIS)

    Villota, C. de

    2007-01-01

    Carlos Villota. Director of Nuclear Energy of UNESA gave an overview of the Spanish nuclear industry, the utility companies and the relevant institutions. Companies of the nuclear industry include firms that produce heavy components or equipment (ENSA), manufacturers of nuclear fuel (ENUSA), engineering companies, the National Company for Radioactive Waste Management (ENRESA), and nuclear power plants (nine units at seven sites). Nuclear energy is a significant component of the energy mix in Spain: 11% of all energy produced in Spain is of nuclear origin, whilst the share of nuclear energy in the total electricity generation is approximately 23%. The five main players of the energy sector that provide for the vast majority of electricity production, distribution, and supply have formed the Spanish Electricity Industry Association (UNESA). The latter carries out co-ordination, representation, management and promotion tasks for its members, as well as the protection of their business and professional interests. In the nuclear field, UNESA through its Nuclear Energy Committee co-ordinates aspects related to nuclear safety and radiological protection, regulation, NPP operation and R and D. Regarding the institutional framework of the nuclear industry, ENSA, ENUSA and ENRESA are controlled by the national government through the Ministry of Economy and Finance and the Ministry of Science and Technology. All companies of the nuclear industry are licensed by the Ministry of Industry, Tourism and Trade (MITYC), while the regulatory body is the Nuclear Safety Council (CSN). It is noteworthy that CSN is independent of the government, as it reports directly to Parliament. (author)

  8. Annealing Induced Softening in Deformed AI-4043 Alloy

    International Nuclear Information System (INIS)

    Saad, G.; Fawzy, A.; Soliman, H.N.; Mohammed, Gh.; Fayek, S.A.

    2011-01-01

    The present paper is devoted to study the effect of annealing temperature for different annealing periods of time on the structure and consequently on the tensile properties of Al-4043 alloy. The obtained results showed that the microstructure of AI-4043 alloy is characterized by the presence of spherically shaped Si-particles, which were found to be uniformly distributed within the AI-matrix. Stress-strain characterizations of AI-4043 samples annealed at different temperatures (T a = 573, 673 and 773 K) for different periods of time (t a = 0.5, 1,2.5,5 and 10 h), showed that the tensile parameters; yield stress ε y 0.2 and fracture stress ε f were decreased with increasing Ta and/or ta while the total strain ε T was increased. This was interpreted in terms of growth of Si-particles with increasing T a and/or t a . Attention has been also paid to the role of the minor elements Fe, Cu and Ti on the structure and tensile response behavior of the alloy under investigation

  9. The deep learning AI playbook strategy for disruptive artificial intelligence

    CERN Document Server

    Perez, Carlos E

    2017-01-01

    Deep Learning Artificial Intelligence involves the interplay of Computer Science, Physics, Biology, Linguistics and Psychology. In addition to that, it is technology that can be extremely disruptive. The ramifications to society and even our own humanity will be profound. There are few subjects that are as captivating and as consequential as this. Surprisingly, there is very little that is written about this new technology in a more comprehensive and cohesive way. This book is an opinionated take on the developments of Deep Learning AI. One question many have will be "how to apply Deep Learning AI in a business context?" Technology that is disruptive does not automatically imply that its application to valuable use cases will be apparent. For years, many people could not figure out how to monetize the World Wide Web. We are in a similar situation with Deep Learning AI. The developments may be mind-boggling but its monetization is far from being obvious. This book presents a framework to address this shortcomi...

  10. Artificial Intelligence (AI) Based Tactical Guidance for Fighter Aircraft

    Science.gov (United States)

    McManus, John W.; Goodrich, Kenneth H.

    1990-01-01

    A research program investigating the use of Artificial Intelligence (AI) techniques to aid in the development of a Tactical Decision Generator (TDG) for Within Visual Range (WVR) air combat engagements is discussed. The application of AI programming and problem solving methods in the development and implementation of the Computerized Logic For Air-to-Air Warfare Simulations (CLAWS), a second generation TDG, is presented. The Knowledge-Based Systems used by CLAWS to aid in the tactical decision-making process are outlined in detail, and the results of tests to evaluate the performance of CLAWS versus a baseline TDG developed in FORTRAN to run in real-time in the Langley Differential Maneuvering Simulator (DMS), are presented. To date, these test results have shown significant performance gains with respect to the TDG baseline in one-versus-one air combat engagements, and the AI-based TDG software has proven to be much easier to modify and maintain than the baseline FORTRAN TDG programs. Alternate computing environments and programming approaches, including the use of parallel algorithms and heterogeneous computer networks are discussed, and the design and performance of a prototype concurrent TDG system are presented.

  11. Accretion in Radiative Equipartition (AiRE) Disks

    Energy Technology Data Exchange (ETDEWEB)

    Yazdi, Yasaman K.; Afshordi, Niayesh, E-mail: yyazdi@pitp.ca, E-mail: nafshordi@pitp.ca [Perimeter Institute for Theoretical Physics, 31 Caroline Street N, Waterloo, ON N2L 2Y5 (Canada)

    2017-07-01

    Standard accretion disk theory predicts that the total pressure in disks at typical (sub-)Eddington accretion rates becomes radiation pressure dominated. However, radiation pressure dominated disks are thermally unstable. Since these disks are observed in approximate steady state over the instability timescale, our accretion models in the radiation-pressure-dominated regime (i.e., inner disk) need to be modified. Here, we present a modification to the Shakura and Sunyaev model, where the radiation pressure is in equipartition with the gas pressure in the inner region. We call these flows accretion in radiative equipartition (AiRE) disks. We introduce the basic features of AiRE disks and show how they modify disk properties such as the Toomre parameter and the central temperature. We then show that the accretion rate of AiRE disks is limited from above and below, by Toomre and nodal sonic point instabilities, respectively. The former leads to a strict upper limit on the mass of supermassive black holes as a function of cosmic time (and spin), while the latter could explain the transition between hard and soft states of X-ray binaries.

  12. AIS Algorithm for Smart Antenna Application in WLAN

    Directory of Open Access Journals (Sweden)

    Evizal Abdul Kadir

    2015-07-01

    Full Text Available Increasing numbers of wireless local area networks (WLAN replacing wired networks have an impact on wireless network systems, causing issues such as interference. The smart antenna system is a method to overcome interference issues in WLANs. This paper proposes an artificial immune system (AIS for a switch beam smart antenna system. A directional antenna is introduced to aim the beam at the desired user. The antenna consists of 8 directional antennas, each of which covers 45 degrees, thus creating an omnidirectional configuration of which the beams cover 360 degrees. To control the beam switching, an inexpensive PIC 16F877 microchip was used. An AIS algorithm was implemented in the microcontroller, which uses the received radio signal strength of the mobile device as reference. This is compared for each of the eight beams, after which the AIS algorithm selects the strongest signal received by the system and the microcontroller will then lock to the desired beam. In the experiment a frequency of 2.4 GHz (ISM band was used for transmitting and receiving. A test of the system was conducted in an outdoor environment. The results show that the switch beam smart antenna worked fine based on locating the mobile device.

  13. Functional subdivisions in low-frequency primary auditory cortex (AI).

    Science.gov (United States)

    Wallace, M N; Palmer, A R

    2009-04-01

    We wished to test the hypothesis that there are modules in low-frequency AI that can be identified by their responsiveness to communication calls or particular regions of space. Units were recorded in anaesthetised guinea pig AI and stimulated with conspecific vocalizations and a virtual motion stimulus (binaural beats) presented via a closed sound system. Recording tracks were mainly oriented orthogonally to the cortical surface. Some of these contained units that were all time-locked to the structure of the chutter call (14/22 tracks) and/or the purr call (12/22 tracks) and/or that had a preference for stimuli from a particular region of space (8/20 tracks with four contralateral, two ipsilateral and two midline), or where there was a strong asymmetry in the response to beats of different direction (two tracks). We conclude that about half of low-frequency AI is organized into modules that are consistent with separate "what" and "where" pathways.

  14. 76 FR 44045 - Establishment of the SANE/SART AI/AN Initiative Committee

    Science.gov (United States)

    2011-07-22

    ... SANE/SART AI/AN Initiative Committee AGENCY: Office for Victims of Crime, Justice. ACTION: Notice of... Nurse Examiner (SANE) Sexual Assault Response Team (SART) American Indian/Alaskan Native (AI/AN) Initiative (``SANE/SART AI/AN Initiative Committee'' or ``Committee'') is being established in accordance...

  15. 78 FR 17232 - Meeting of the SANE/SART AI/AN Initiative Committee

    Science.gov (United States)

    2013-03-20

    .../SART AI/AN Initiative Committee AGENCY: Office for Victims of Crime, Justice. ACTION: Notice of meeting. SUMMARY: The National Coordination Committee on the American Indian/ Alaska Native (AI/AN) Sexual Assault... violence within AI/AN communities. DATES AND LOCATIONS: The meeting will be held via webinar on Wednesday...

  16. 10 CFR 1017.28 - Processing on Automated Information Systems (AIS).

    Science.gov (United States)

    2010-01-01

    ... 10 Energy 4 2010-01-01 2010-01-01 false Processing on Automated Information Systems (AIS). 1017.28... UNCLASSIFIED CONTROLLED NUCLEAR INFORMATION Physical Protection Requirements § 1017.28 Processing on Automated Information Systems (AIS). UCNI may be processed or produced on any AIS that complies with the guidance in OMB...

  17. Burnup credit in Spain

    International Nuclear Information System (INIS)

    Conde, J.M.; Recio, M.

    2001-01-01

    The status of development of burnup credit for criticality safety analyses in Spain is described in this paper. Ongoing activities in the country in this field, both national and international, are resumed. Burnup credit is currently being applied to wet storage of PWR fuel, and credit to integral burnable absorbers is given for BWR fuel storage. It is envisaged to apply burnup credit techniques to the new generation of transport casks now in the design phase. The analysis methodologies submitted for the analyses of PWR and BWR fuel wet storage are outlined. Analytical activities in the country are described, as well as international collaborations in this field. Perspectives for future research and development of new applications are finally resumed. (author)

  18. QML-AiNet: An immune network approach to learning qualitative differential equation models.

    Science.gov (United States)

    Pang, Wei; Coghill, George M

    2015-02-01

    In this paper, we explore the application of Opt-AiNet, an immune network approach for search and optimisation problems, to learning qualitative models in the form of qualitative differential equations. The Opt-AiNet algorithm is adapted to qualitative model learning problems, resulting in the proposed system QML-AiNet. The potential of QML-AiNet to address the scalability and multimodal search space issues of qualitative model learning has been investigated. More importantly, to further improve the efficiency of QML-AiNet, we also modify the mutation operator according to the features of discrete qualitative model space. Experimental results show that the performance of QML-AiNet is comparable to QML-CLONALG, a QML system using the clonal selection algorithm (CLONALG). More importantly, QML-AiNet with the modified mutation operator can significantly improve the scalability of QML and is much more efficient than QML-CLONALG.

  19. Beyond AI: Multi-Intelligence (MI Combining Natural and Artificial Intelligences in Hybrid Beings and Systems

    Directory of Open Access Journals (Sweden)

    Stephen Fox

    2017-06-01

    Full Text Available Framing strongly influences actions among technology proponents and end-users. Underlying much debate about artificial intelligence (AI are several fundamental shortcomings in its framing. First, discussion of AI is atheoretical, and therefore has limited potential for addressing the complexity of causation. Second, intelligence is considered from an anthropocentric perspective that sees human intelligence, and intelligence developed by humans, as superior to all other intelligences. Thus, the extensive post-anthropocentric research into intelligence is not given sufficient consideration. Third, AI is discussed often in reductionist mechanistic terms. Rather than in organicist emergentist terms as a contributor to multi-intelligence (MI hybrid beings and/or systems. Thus, current framing of AI can be a self-validating reduction within which AI development is focused upon AI becoming the single-variable mechanism causing future effects. In this paper, AI is reframed as a contributor to MI.

  20. Spent fuel management in Spain

    International Nuclear Information System (INIS)

    Gonzalez, J.L.

    2002-01-01

    The spent fuel management strategy in Spain is presented. The strategy includes temporary solutions and plans for final disposal. The need for R and D including partitioning and transmutation, as well as the financial constraints are also addressed. (author)

  1. STAR - A computer language for hybrid AI applications

    Science.gov (United States)

    Borchardt, G. C.

    1986-01-01

    Constructing Artificial Intelligence application systems which rely on both symbolic and non-symbolic processing places heavy demands on the communication of data between dissimilar languages. This paper describes STAR (Simple Tool for Automated Reasoning), a computer language for the development of AI application systems which supports the transfer of data structures between a symbolic level and a non-symbolic level defined in languages such as FORTRAN, C and PASCAL. The organization of STAR is presented, followed by the description of an application involving STAR in the interpretation of airborne imaging spectrometer data.

  2. Pavlovian, Skinner, and Other Behaviourists' Contributions to AI. Chapter 9

    Science.gov (United States)

    Kosinski, Withold; Zaczek-Chrzanowska, Dominika

    2007-01-01

    A version of the definition of intelligent behaviour will be supplied in the context of real and artificial systems. Short presentation of principles of learning, starting with Pavlovian s classical conditioning through reinforced response and operant conditioning of Thorndike and Skinner and finishing with cognitive learning of Tolman and Bandura will be given. The most important figures within behaviourism, especially those with contribution to AI, will be described. Some tools of artificial intelligence that act according to those principles will be presented. An attempt will be made to show when some simple rules for behaviour modifications can lead to a complex intelligent behaviour.

  3. Alarm processing system using AI techniques for nuclear power plant

    International Nuclear Information System (INIS)

    Yang, Joon On; Chang, Soon Heung

    1990-01-01

    An alarm processing system (APS) has been developed using artificial intelligence (AI) techniques. The alarms of nuclear power plants (NPP's) are classified into the generalized and special alarms. The generalized alarms are also classified into the global and local alarms. For each type of alarms, the specific processing rules are applied to filter and suppress unnecessary and potentially misleading alarms. The local processing are based on 'model-based reasoning.' The global and special alarms are processed by using the general cause-consequence check rules. The priorities of alarms are determined according to the plant state and the consistencies between them

  4. Deep Learning Neural Networks in Cybersecurity - Managing Malware with AI

    OpenAIRE

    Rayle, Keith

    2017-01-01

    There’s a lot of talk about the benefits of deep learning (neural networks) and how it’s the new electricity that will power us into the future. Medical diagnosis, computer vision and speech recognition are all examples of use-cases where neural networks are being applied in our everyday business environment. This begs the question…what are the uses of neural-network applications for cyber security? How does the AI process work when applying neural networks to detect malicious software bombar...

  5. How AI turned the chess world upside down

    KAUST Repository

    Polgar, Susan

    2018-01-22

    Man vs. Machine! In 1977 an IBM supercomputer \\'Deep Blue\\' beat the reigning World Chess Champion Gary Kasparov in a 6 game chess match played under tournament conditions. This was the first time a machine beat a human at chess. It symbolized the emergence of Artificial Intelligence (AI) and the potential for great good (and great harm) from machines that have aspects of human intelligence. During this lecture Susan Polgar, a pioneer for Women in Chess, will share her remarkable story as well as how technology has changed the world of chess.

  6. Association of the Shared Epitope, Smoking and the Interaction Between the Two With the Presence of Autoantibodies (Anti-CCP and FR) in Patients With Rheumatoid Arthritis in a Hospital in Seville, Spain.

    Science.gov (United States)

    García de Veas Silva, José Luis; González Rodríguez, Concepción; Hernández Cruz, Blanca

    2017-11-01

    To evaluate the association of shared epitope, smoking and their interaction on the presence of autoantibodies (anti-cyclic citrullinated peptide [CCP] antibodies and rheumatoid factor) in patients with rheumatoid arthritis in our geographical area. A descriptive and cross-sectional study was carried out in a cohort of 106 patients diagnosed with RA. Odds ratios (OR) for antibody development were calculated for shared epitope, tobacco exposure and smoking dose. Statistical analysis was performed with univariate and multivariate statistics using ordinal logistic regression. Odds ratios were calculated with 95% confidence interval (95% CI) and a value of P20 packs/year) (OR=8.93; 95% CI: 1.95-40.82) were associated with the presence of anti-CCP antibodies. For rheumatoid factor, the association was only significant for tobacco exposure (OR=3.89; 95% CI: 1.06-14.28) and smoking dose (OR=8.33; 95% CI: 1.05-66.22). By ordinal logistic regression analysis, an association with high titers of anti-CCP (>200U/mL) was identified with South American mestizos, patients with homozygous shared epitope, positive FR and heavy smokers. Being a South American mestizo, having a shared epitope, rheumatoid factor positivity and a smoking dose>20 packs/year are independent risk factors for the development of rheumatoid arthritis with a high titer of anti-CCP (>200U/mL). In shared epitope-positive rheumatoid arthritis patients, the intensity of smoking is more strongly associated than tobacco exposure with an increased risk of positive anti-CCP. Copyright © 2017 Elsevier España, S.L.U. and Sociedad Española de Reumatología y Colegio Mexicano de Reumatología. All rights reserved.

  7. Colorimetric study of the tiles in Patio de las Doncellas of the Real Alcazar of Seville (Spain); Estudio colorimetrico de los azulejos del Patio de las Doncellas del Real Alcazar de Sevilla (Espana)

    Energy Technology Data Exchange (ETDEWEB)

    Melgosa, M.; Collado-Montero, F. J.; Fernandez, E.; Medina, V. J.

    2015-10-01

    Colorimetric and goniocolorimetric measurements of 187 tiles in the lower gallery of Patio de las Doncellas (14{sup t}h Century) have been performed. They can be grouped around 5 main colors: white, black, blue, green and orange. Conventional color measurements proved to be insufficient for most of the samples whose goniochromatic nature requires the use of goniocolorimeters for proper characterization. The main color changes appeared from -15 degree (close to the specular direction) to +45 degree centigrade (direction perpendicular to the sample) and consisted of a lightness (L*) decrease and a chroma (C*{sub a}b) increase. For the black samples, there was also a pronounced decrease of hue-angle (hab), as well as a high value of 16.0 for the lightness-flop index. The black and orange samples had a metallic appearance, as indicated by average metallic index values greater than 5.0. Considering a displacement between the two extreme angles of -15 degree centigrade and +110 degree centigrade, the average CIELAB color differences were considerably high, ranging from 4.1 (white group) to 31.2 (orange group). Current methods and results for the tiles in Patio de las Doncellas may be useful for future work of conservators. (Author)

  8. The flooded pit at Aznalcollar (Seville, Spain) and its use as a dumping site for mine waste; La corta inundada de Aznalcollar y su uso como vertedero de residuos mineros (Sevilla, Espana)

    Energy Technology Data Exchange (ETDEWEB)

    Santofimia Pastor, E.; Lopez Pamo, E.; Montero Gonzalez, E.

    2011-07-01

    Since its closure in 1995 and the subsequent failure of the slurry deposit dam in 1998, the Aznalcollar pit has been used as a disposal site for diverse metal-rich materials, such as the polluted soils removed during the cleaning-up of areas along the Guadiamar river together with waste rock, pyrite sludge and ashes deriving from pyrite roasting. At present the pit is partly flooded with a highly acidic (pH 2.7) lake holding some 6 Mm{sup 3} of metal- and sulphate-rich water. Detailed research undertaken in the area during recent years has proved that the dumping of wastes and the inflow of acidic mine waters are having a dramatic effect on the quality of the water in the lake. The greatest effect upon the Aznalcollar lake water was due to the dumping of 1.4 Mm{sup 3} of pyritic wastes during 2005 and 2006. The oxidative dissolution of this mineral has resulted firstly in the total consumption of dissolved oxygen, secondly, a notable increase in electric conductivity (from 8.6 to 12 mS/cm), thirdly, considerable acidification (from pH 4.2 to 2.7) and finally, heating due to the exothermic character of pyrite oxidation. Despite the almost total lack of oxidizing agents such as O{sub 2} and Fe(III) (Fe(III)<5% Fetotal) in the pit lake, pyrite continues to oxidize, producing a concomitant increase in SO{sub 4}{sup 2}- and Fe. (Author) 32 refs.

  9. Future role of AI/Robotics in physical security

    International Nuclear Information System (INIS)

    Jacobs, J.

    1986-06-01

    Manpower requirements for physical security systems place a heavy burden on operating security budgets. Technology innovations which free personnel or which make security personnel more efficient in carrying out their tasks is an important means of dealing with budget and manpower constraints. It is believed that AI/Robotics will be important technologies to alleviate these problems in the future. There are three types of applications for AI and Robotics technology that may: (1) help security personnel perform their tasks more effectively or efficiently, (2) perform tasks that security personnel would otherwise perform (free up people), and (3) perform tasks that cannot be performed by security personnel at this time. This paper will discuss the various types of security applications that are presently being considered for the above areas and will briefly describe a few examples of the application of this technology. Examples will include ground mobile platforms carrying alarm assessment and/or surveillance sensors and operating either autonomously or with telepresence by a remote operator. An airborne platform performing similar functions will also be discussed. An application of a type of robot sentry that would be fixed and incorporate very simple portable displays will also be described. A third type of robot, an interior robot, that could be used in sensitive or hazardous areas to do detection and assessment functions will be reviewed

  10. Sensor assignment to mission in AI-TECD

    Science.gov (United States)

    Ganger, Robert; de Mel, Geeth; Pham, Tien; Rudnicki, Ronald; Schreiber, Yonatan

    2016-05-01

    Sensor-mission assignment involves the allocation of sensors and other information-providing resources to missions in order to cover the information needs of the individual tasks within each mission. The importance of efficient and effective means to find appropriate resources for tasks is exacerbated in the coalition context where the operational environment is dynamic and a multitude of critically important tasks need to achieve their collective goals to meet the objectives of the coalition. The Sensor Assignment to Mission (SAM) framework—a research product of the International Technology Alliance in Network and Information Sciences (NIS-ITA) program—provided the first knowledge intensive resource selection approach for the sensor network domain so that contextual information could be used to effectively select resources for tasks in coalition environments. Recently, CUBRC, Inc. was tasked with operationalizing the SAM framework through the use of the I2WD Common Core Ontologies for the Communications-Electronics Research, Development and Engineering Center (CERDEC) sponsored Actionable Intelligence Technology Enabled Capabilities Demonstration (AI-TECD). The demonstration event took place at Fort Dix, New Jersey during July 2015, and this paper discusses the integration and the successful demonstration of the SAM framework within the AI-TECD, lessons learned, and its potential impact in future operations.

  11. Nuclear power in Spain

    International Nuclear Information System (INIS)

    Koryakin, Yu.I.

    1977-01-01

    The present states of nuclear power in Spain is shortly surveyed. Data are provided on NPPs currently in operation, under construction, designed and planned. In line with the 10-year ''National programme of electricity supply'' a major and all increasing part of the electricity generation growth is to be ensured by NPPs and to account for more than 50% by the end of the period (1987). Out of the 7 units of NPPs now under construction, 6 units utilize PWR reactors and only 1 unit- a BWR reactor. The roles of private and public sectors are noted. Main characteristics of the ''ENSA'' plant now under construction are provided where components of NPPs with PWR and BWR reactors will be fabricated. Major developments in the fields of mining, milling and extraction of U from lignites, U enrichment, fuel fabrication and spent fuel reprocessing are considered. Measures now taken to improve the licensing procedure, surveillance of NPPs and personnel training are to advance the nuclear power development programme in the country

  12. In-situ volatile organic compounds measurements with GC-MSD during the DOMINO campaign in Spain, December 2008

    Science.gov (United States)

    Song, W.; Yassaa, N.; Williams, J.

    2009-04-01

    This study presents a new volatile organic compounds (VOC) dataset measured during the DOMINO field campaign in December 2008. The measurements were made from a 10m tower located in a nature reserve on the south west coast of Spain. For the analysis, the VOCs were collected and concentrated on a thermal desorber unit, separated on a gas chromotagraph equipped with an enantiomerically selective column, and detected by mass spectrometry. This experimental set-up allowed the measurement of anthropogenic VOCs such as ethyl benzene, and all xylene isomers, and biogenic species such as isoprene and monoterpenes. Here we examine the VOC mixing ratio variations as a function of air mass origin to characterize the measurement site in terms of biogenic and anthropogenic influences. Mixing ratios of biogenic species were generally low, consistent with the low winter season growth rates. The ratio of (-)-alpha-pinene to (+)-alpha-pinene was variable but showed a clear dominance of the (-)-enantiomer, similar to previous results obtained with the same system in the Tropical rainforest. High mixing ratios of benzene and toluene were related to transport events from Seville (to the northeast) and Huelva (to the west). The ratio of two short lived anthropogenic species ethylbenzene and meta-xylene was found to peak at midday and indicative of the levels of oxidant levels.

  13. Applying AI tools to operational space environmental analysis

    Science.gov (United States)

    Krajnak, Mike; Jesse, Lisa; Mucks, John

    1995-01-01

    The U.S. Air Force and National Oceanic Atmospheric Agency (NOAA) space environmental operations centers are facing increasingly complex challenges meeting the needs of their growing user community. These centers provide current space environmental information and short term forecasts of geomagnetic activity. Recent advances in modeling and data access have provided sophisticated tools for making accurate and timely forecasts, but have introduced new problems associated with handling and analyzing large quantities of complex data. AI (Artificial Intelligence) techniques have been considered as potential solutions to some of these problems. Fielding AI systems has proven more difficult than expected, in part because of operational constraints. Using systems which have been demonstrated successfully in the operational environment will provide a basis for a useful data fusion and analysis capability. Our approach uses a general purpose AI system already in operational use within the military intelligence community, called the Temporal Analysis System (TAS). TAS is an operational suite of tools supporting data processing, data visualization, historical analysis, situation assessment and predictive analysis. TAS includes expert system tools to analyze incoming events for indications of particular situations and predicts future activity. The expert system operates on a knowledge base of temporal patterns encoded using a knowledge representation called Temporal Transition Models (TTM's) and an event database maintained by the other TAS tools. The system also includes a robust knowledge acquisition and maintenance tool for creating TTM's using a graphical specification language. The ability to manipulate TTM's in a graphical format gives non-computer specialists an intuitive way of accessing and editing the knowledge base. To support space environmental analyses, we used TAS's ability to define domain specific event analysis abstractions. The prototype system defines

  14. Computing Facilities for AI: A Survey of Present and Near-Future Options

    OpenAIRE

    Fahlman, Scott

    1981-01-01

    At the recent AAAI conference at Stanford, it became apparent that many new AI research centers are being established around the country in industrial and governmental settings and in universities that have not paid much attention to AI in the past. At the same time, many of the established AI centers are in the process of converting from older facilities, primarily based on Decsystem-10 and Decsystem-20 machines, to a variety of newer options. At present, unfortunately, there is no simple an...

  15. A Review of Future and Ethical Perspectives of Robotics and AI

    OpenAIRE

    Jim Torresen

    2018-01-01

    In recent years, there has been increased attention on the possible impact of future robotics and AI systems. Prominent thinkers have publicly warned about the risk of a dystopian future when the complexity of these systems progresses further. These warnings stand in contrast to the current state-of-the-art of the robotics and AI technology. This article reviews work considering both the future potential of robotics and AI systems, and ethical considerations that need to be taken in order to ...

  16. Demand for radiotherapy in Spain.

    Science.gov (United States)

    Rodríguez, A; Borrás, J M; López-Torrecilla, J; Algara, M; Palacios-Eito, A; Gómez-Caamaño, A; Olay, L; Lara, P C

    2017-02-01

    Assessing the demand for radiotherapy in Spain based on existing evidence to estimate the human resources and equipment needed so that every person in Spain has access to high-quality radiotherapy when they need it. We used data from the European Cancer Observatory on the estimated incidence of cancer in Spain in 2012, along with the evidence-based indications for radiotherapy developed by the Australian CCORE project, to obtain an optimal radiotherapy utilisation proportion (OUP) for each tumour. About 50.5 % of new cancers in Spain require radiotherapy at least once over the course of the disease. Additional demand for these services comes from reradiation therapy and non-melanoma skin cancer. Approximately, 25-30 % of cancer patients with an indication for radiotherapy do not receive it due to factors that include access, patient preference, familiarity with the treatment among physicians, and especially resource shortages, all of which contribute to its underutilisation. Radiotherapy is underused in Spain. The increasing incidence of cancer expected over the next decade and the greater frequency of reradiations necessitate the incorporation of radiotherapy demand into need-based calculations for cancer services planning.

  17. Forum on stakeholder confidence: Spain

    International Nuclear Information System (INIS)

    Vari, A.; Pescatore, C.

    2006-01-01

    The FSC workshop in Spain provided an important opportunity to carry out an in-depth examination of decision-making processes undertaken in an NEA member country, and to reflect on the evolution that has taken place over time. It offered a well-rounded perspective on the inclusion of stakeholders in decision making, and the atmosphere of the meetings was conducive to an honest and open exchange of ideas. The workshop started with the introduction of two case studies: the earlier attempt in Spain to locate a potential site for a high-level waste (HLW) disposal facility, and the dismantling of the Vandellos-I nuclear power plant. This was followed by two days of presentations and round-table discussions based on the recent COWAM Spain initiative (stemming from the EU-wide project on Community Waste Management), which aims at developing recommendations for institutional arrangements and decision-making processes concerning the siting of waste management facilities in Spain. This article provides a brief summary of the case studies and the COWAM Spain initiative, followed by some of the lessons learnt from an international perspective. (authors)

  18. Off The Beaten Lane: AI Challenges In MOBAs Beyond Player Control

    OpenAIRE

    Cook, Michael; Summerville, Adam; Colton, Simon

    2017-01-01

    MOBAs represent a huge segment of online gaming and are growing as both an eSport and a casual genre. The natural starting point for AI researchers interested in MOBAs is to develop an AI to play the game better than a human - but MOBAs have many more challenges besides adversarial AI. In this paper we introduce the reader to the wider context of MOBA culture, propose a range of challenges faced by the community today, and posit concrete AI projects that can be undertaken to begin solving them.

  19. Validation of the Avoidance and Inflexibility Scale (AIS) among Treatment-Seeking Smoker

    OpenAIRE

    Farris, Samantha G.; Zvolensky, Michael J.; DiBello, Angelo M.; Schmidt, Norman B.

    2015-01-01

    The Avoidance and Inflexibility Scale (AIS; Gifford et al., 2004) was derived as smoking-specific measure of experiential avoidance. However, there has been little investigation of the psychometric proprieties of the AIS and no published work on the topic. The current study aimed to test the reliability and validity of the AIS among a sample of adult treatment-seeking daily smokers (n = 465; 48.1% female, 17.8 [SD = 9.60] cigarettes per day). The AIS was administered at three time points (Bas...

  20. Fully automatic AI-based leak detection system

    Energy Technology Data Exchange (ETDEWEB)

    Tylman, Wojciech; Kolczynski, Jakub [Dept. of Microelectronics and Computer Science, Technical University of Lodz in Poland, ul. Wolczanska 221/223, Lodz (Poland); Anders, George J. [Kinectrics Inc., 800 Kipling Ave., Toronto, Ontario M8Z 6C4 (Canada)

    2010-09-15

    This paper presents a fully automatic system intended to detect leaks of dielectric fluid in underground high-pressure, fluid-filled (HPFF) cables. The system combines a number of artificial intelligence (AI) and data processing techniques to achieve high detection capabilities for various rates of leaks, including leaks as small as 15 l per hour. The system achieves this level of precision mainly thanks to a novel auto-tuning procedure, enabling learning of the Bayesian network - the decision-making component of the system - using simulated leaks of various rates. Significant new developments extending the capabilities of the original leak detection system described in and form the basis of this paper. Tests conducted on the real-life HPFF cable system in New York City are also discussed. (author)

  1. Planning chemical syntheses with deep neural networks and symbolic AI

    Science.gov (United States)

    Segler, Marwin H. S.; Preuss, Mike; Waller, Mark P.

    2018-03-01

    To plan the syntheses of small organic molecules, chemists use retrosynthesis, a problem-solving technique in which target molecules are recursively transformed into increasingly simpler precursors. Computer-aided retrosynthesis would be a valuable tool but at present it is slow and provides results of unsatisfactory quality. Here we use Monte Carlo tree search and symbolic artificial intelligence (AI) to discover retrosynthetic routes. We combined Monte Carlo tree search with an expansion policy network that guides the search, and a filter network to pre-select the most promising retrosynthetic steps. These deep neural networks were trained on essentially all reactions ever published in organic chemistry. Our system solves for almost twice as many molecules, thirty times faster than the traditional computer-aided search method, which is based on extracted rules and hand-designed heuristics. In a double-blind AB test, chemists on average considered our computer-generated routes to be equivalent to reported literature routes.

  2. Le français de la communication professionnelle

    CERN Document Server

    Danilo, Michel; Lincoln, M

    A partir de 150 heures de français. - Pour acquérir une bonne maîtrise des pratiques professionnelles. - Pour améliorer ses connaissances de la langue tout en se familiarisant avec les pratiques langagières spécifiques du monde du travail. - Pour préparer les examens de la Chambre de Commerce et d'Industrie de Paris. Dix dossiers : - La communication dans les affaires - Le travail administratif - Le téléphone - La communication interne - Le courrier de l'entreprise - L'offre et la commande - Livraison, transport, assurance - La facturation et le règlement - La communication avec les partenaires - Les nouveaux outils de communication Une cassette audio ainsi que des corrigés accompagnent ce livre.

  3. Age and helium content of the eclipsing binary AI Phoenicis

    International Nuclear Information System (INIS)

    VandenBerg, D.A.; Hrivnak, B.J.

    1985-01-01

    Comparisons of new theoretical isochrones for heavy-element abundances Z = 0.0169 (solar) and Z = 0.04 with recently published parameters of AI Phoenicis suggest that this system has an age of approximately (3.6 +- 0.7) x 10 9 yr and a helium content of Y = 0.38 +- 0.05. The indicated uncertainty is largely due to the lack of precise knowledge about the metallicity of the binary, since the fits to the data by both sets of isochrones are exceedingly good. The high helium content, which is required in order to reproduce the observed mass-luminosity relation, is suggested to be comparable with the values generally derived for binaries if the latter are adjusted to take into account the effect of the new Los Alamos opacities

  4. Conjugaison progressive du français avec 400 exercices

    CERN Document Server

    Boularès, Michèle

    1999-01-01

    La Conjugaison progressive du français s'adresse aux grands adolescents et aux adultes de tous niveaux. C'est un ouvrage d'apprentissage des formes verbales. On trouve sur la page de gauche : - la règle de formation de chaque temps ; - les verbes types présentés en tableaux et accompagnés d'une liste de verbes conjugués sur le même modèle ; - des remarques phonétiques ou orthographiques ; - des explications sur les difficultés particulières. La page de droite propose des exercices et des activités de difficulté progressive. C'est également un ouvrage de référence grâce aux nombreux tableaux de conjugaison qu'il contient.

  5. Applying AI techniques to improve alarm display effectiveness

    International Nuclear Information System (INIS)

    Gross, J.M.; Birrer, S.A.; Crosberg, D.R.

    1987-01-01

    The Alarm Filtering System (AFS) addresses the problem of information overload in a control room during abnormal operations. Since operators can miss vital information during these periods, systems which emphasize important messages are beneficial. AFS uses the artificial intelligence (AI) technique of object-oriented programming to filter and dynamically prioritize alarm messages. When an alarm's status changes, AFS determines the relative importance of that change according to the current process state. AFS bases that relative importance on relationships the newly changed alarm has with other activated alarms. Evaluations of a alarm importance take place without regard to the activation sequence of alarm signals. The United States Department of Energy has applied for a patent on the approach used in this software. The approach was originally developed by EG and G Idaho for a nuclear reactor control room

  6. Development of an advanced educational system using AI techniques

    International Nuclear Information System (INIS)

    Yoshimura, Seiichi

    1990-01-01

    This paper describes an advanced educational system that realizes effective education using AI techniques. The system is composed of three devices. One is a knowledge-processing computer that evaluates the operator's knowledge level and presents educational materials. Another is a computer for displaying transients. The other is a computer for voice input and output. The educational materials utilize cause-and-effect relationships. The relationships enable to perform effective education by pointing out the parts the operator failed to understand. An evaluation test was performed by actually operating the system. As a result, the system's fundamental characteristics, such as the ease of understanding the relationships, and the usefulness of the advanced evaluation of the operator's knowledge level, were evaluated highly. (author)

  7. Orthogonally Evolved AI to Improve Difficulty Adjustment in Video Games

    DEFF Research Database (Denmark)

    Hintze, Arend; Olson, Randal; Lehman, Joel Anthony

    2016-01-01

    Computer games are most engaging when their difficulty is well matched to the player's ability, thereby providing an experience in which the player is neither overwhelmed nor bored. In games where the player interacts with computer-controlled opponents, the difficulty of the game can be adjusted...... not only by changing the distribution of opponents or game resources, but also through modifying the skill of the opponents. Applying evolutionary algorithms to evolve the artificial intelligence that controls opponent agents is one established method for adjusting opponent difficulty. Less-evolved agents...... (i.e. agents subject to fewer generations of evolution) make for easier opponents, while highly-evolved agents are more challenging to overcome. In this publication we test a new approach for difficulty adjustment in games: orthogonally evolved AI, where the player receives support from collaborating...

  8. GPU: the biggest key processor for AI and parallel processing

    Science.gov (United States)

    Baji, Toru

    2017-07-01

    Two types of processors exist in the market. One is the conventional CPU and the other is Graphic Processor Unit (GPU). Typical CPU is composed of 1 to 8 cores while GPU has thousands of cores. CPU is good for sequential processing, while GPU is good to accelerate software with heavy parallel executions. GPU was initially dedicated for 3D graphics. However from 2006, when GPU started to apply general-purpose cores, it was noticed that this architecture can be used as a general purpose massive-parallel processor. NVIDIA developed a software framework Compute Unified Device Architecture (CUDA) that make it possible to easily program the GPU for these application. With CUDA, GPU started to be used in workstations and supercomputers widely. Recently two key technologies are highlighted in the industry. The Artificial Intelligence (AI) and Autonomous Driving Cars. AI requires a massive parallel operation to train many-layers of neural networks. With CPU alone, it was impossible to finish the training in a practical time. The latest multi-GPU system with P100 makes it possible to finish the training in a few hours. For the autonomous driving cars, TOPS class of performance is required to implement perception, localization, path planning processing and again SoC with integrated GPU will play a key role there. In this paper, the evolution of the GPU which is one of the biggest commercial devices requiring state-of-the-art fabrication technology will be introduced. Also overview of the GPU demanding key application like the ones described above will be introduced.

  9. Spain: Success story in space

    Science.gov (United States)

    Longdon, Norman

    From the early 1960's, European governments were aware that they had to take part in the exploration, and potential exploitation, of space, or be left behind in a field of high-technology that had far-reaching possibilities. It was also realized that financial and manpower constraints would limit the extent to which individual nations could carry out their own national programs. They, therefor, joined forces in two organizations: the European Space Research Organization (ESRO) and the European Launcher Development Organization (ELDO). By 1975, when the potential of space development had been more fully appreciated, the two organizations were merged into the Europeans Space Agency (ESA) of which Spain was a founding member. ESA looks after the interest of 13 member states, one associated member state (Finland), and one cooperating state (Canada) in the peaceful uses of space. Its programs center around a mandatory core of technological research and space science to which member states contribute on the basis of their Gross National Product. Spain in 1992 contributes 6.46% to this mandatory program budget. The member states then have the chance to join optional programs that include telecommunications, observation of the earth and its environment, space transportation systems, microgravity research, and participation in the European contribution to the International Space Station Freedom. Each government decides whether it is in its interest to join a particular optional program, and the percentage that it wishes to contribute to the budget. Although in the early days of ESA, Spain participated in only a few optional programs, today Spain makes a significant contribution to nearly all of ESA's optional programs. This document presents Spain's contributions to particular ESA Programs and discusses Spain's future involvement in ESA.

  10. Light pollution in Spain 2010

    Science.gov (United States)

    Sánchez de Miguel, A.; Zamorano, J.; Pila-Díez, B.; Rubio, J.; Ruiz, R.; Rodríguez-Herranz, I.; González-Pérez, A.

    2011-11-01

    The most recent data on electricity consumption for public lighting inSpain is presented and compared with light pollution measurements asderived from night satellite imagery. NOAA-MSP images (low-resolution)and higher resolution images obtained with conventional DSLR cameras on board the International Space Station (ISS) have been used.We show that the data can be related to night sky brightness maps with a study conducted within the Comunidad Autónoma de Madrid. Weintend to extend our work to the rest of Spain through tight collaborationwith amateur astronomers.

  11. [Intensive medicine in Spain].

    Science.gov (United States)

    2011-03-01

    the future of intensive care medicine in Spain and in Europe, recommendations are made towards specialization in intensive care medicine incorporating in the training program those competences (knowledge, skills and attitudes) that should be present an intensivist in Europe and that are extensively fulfilled by the current Spanish training program. The trajectory followed by intensive care medicine in Europe and recently in China, shows the increasing need of intensive care and the progressive recognition of the specialty in economically growing countries, and emphasizes the need of homogenization in the training of future specialists in intensive care medicine globally. Copyright © 2010 Elsevier España, S.L. y SEMICYUC. All rights reserved.

  12. PSA results and trends for Spain's NPPs

    International Nuclear Information System (INIS)

    Carretero, J.A.

    1993-01-01

    The Spain regulatory authority CSN demanded performance of PSA for all Spain nuclear power plants. The specific data analysis carried out as a part of the PSA has contributed to the realistic view on the results which could be achieved by the PSA. The main characteristics of the PSA in Spain and PSA trends in the development are presented in the paper

  13. 210Po content in human urine of people living in south of Spain

    International Nuclear Information System (INIS)

    Díaz-Francés, I.; García-Tenorio, R.; Mantero, J.; Manjón, G.

    2013-01-01

    The death of the former secret service agent Alexander Livitnenko in 2006 due to a lethal intake of 210 Po, presumably via ingestion, sparked renewed interest in the field of 210 Po toxicity to humans. 210 Po occurs widely in nature and is an important component of man' s natural radiation background. The main route of 210 Po intake by the human body is the ingestion with foodstuffs, although ingestion with drinking water especially of underground origin represents another route of 210 Po intakes. Inhalation of 222 Rn released from the soil also contributes in 210 Po body burden. However, the body burden of 210 Po in normal human body may differ from one person to another depending upon the mode life including diet habits, origin of drinking water, residence place (radon exposure rate) and also smoking habits. Therefore, many factors may affect the 210 Po intake and lead to variations in the body burden in different individuals, and consequently in their urine. To see the influence of the diet habits in the amount of 210 Po excreted by urine, some volunteers in Seville (south of Spain) follow defined diets during approximately one month, with daily urine collection followed by 210 Po determination by alpha-particle spectrometry. Depending on the type of diet ingested by the different volunteers, it was observed differences approaching even an order of magnitude in their levels of 210 Po in urine. This fact difficult enormously the adoption of a predefined value of this nuclide in urine with natural origin with the consequence difficulties for screening through urine the possible anthropogenic intake of this element. (author)

  14. Apolipoprotein A-I metabolism in cynomolgus monkey. Identification and characterization of beta-migrating pools

    International Nuclear Information System (INIS)

    Melchior, G.W.; Castle, C.K.

    1989-01-01

    Fresh plasma from control (C) and hypercholesterolemic (HC) cynomolgus monkeys was analyzed by agarose electrophoresis-immunoblotting with antibody to cynomolgus monkey apolipoprotein (apo) A-I. Two bands were evident on the autoradiogram: an alpha-migrating band (high density lipoprotein) and a beta-migrating band that comigrated exactly with cynomolgus monkey low density lipoprotein (LDL). The presence of beta-migrating apo A-I in the plasma of these monkeys was confirmed by Geon-Pevikon preparative electrophoresis, crossed immunoelectrophoresis, and isotope dilution studies in which radiolabeled apo A-I was found to equilibrate also with alpha- and beta-migrating pools of apo A-I in the plasma. Subfractionation of C and HC plasma by agarose column chromatography (Bio-Gel A-0.5M and A-15M) followed by agarose electrophoresis-immunoblotting indicated that the beta-migrating apo A-I in C was relatively homogeneous and eluted with proteins of Mr approximately 50 kD [apo A-I(50 kD)], whereas two beta-migrating fractions were identified in HC, one that eluted with the 50-kD proteins, and the other that eluted in the LDL Mr range [apo A-I(LDL)]. The apo A-I(LDL) was precipitated by antibody to cynomolgus monkey apo B. The apo A-I(50 kD) accounted for 5 +/- 1% (mean +/- SD) of the plasma apo A-I in C plasma, and 15 +/- 7% in HC plasma. No apo A-I(LDL) was detected in C plasma, but that fraction accounted for 9 +/- 7% of the apo A-I in HC plasma. These data establish the presence of multiple pools of apo A-I in the cynomolgus monkey, which must be taken into consideration in any comprehensive model of apo A-I metabolism in this species

  15. The environmental research programme of the Centro Nacional de Aceleradores, Sevilla (Spain)

    International Nuclear Information System (INIS)

    Ager, F.J.; Martin, J.E.; Ynsa, M.D.; Ontalba, M.A.; Ruiz-Lara, J.R.; Respaldiza, M.A.

    2001-01-01

    Full text: The Centro Nacional de Aceleradores (National Accelerator Center, CNA), the first and for the moment the only Spanish ion beam analysis (IBA) laboratory, was set up in 1998 in the University of Seville (Spain). This laboratory was created with the aim to fulfill the increasing demand for IBA techniques existing in Spain. This facility is based on a 3 MB pelletron tandem accelerator, which is being used for interdisciplinary studies concerning Material Science, Art, Archaeology, Biology, Medicine, Environmental Science, etc. In addition, the works for a cyclotron laboratory are commencing now. This paper reports on the most recent applications in the field of Environmental Science carried out in our laboratory. Remediation of metal-contaminated soils and waters poses a challenging problem due to its implications in the environment and the human health. A possible solution to this problem is the phytoremediation, i.e. the process of using plants for environmental restoration taking advantage of the ability of certain terrestrial plants to absorb and accumulate metals, removing them from soils and aqueous streams. These plants are called metal hyper accumulators if they accumulate for instance more than 0.01% of Cd, 0.1% of Ni or 1% of Zn per dry weight in their shoots. For example, Cd is readily transported and accumulated in the shoots of several plant species, being a favourable target metal for this technology. In recent works making use of nuclear microscopy techniques, we investigated the sites of metal localization within the leaves of metal hyper accumulator Arabidopsis thaliana, when plants are grown in a cadmium-rich environment, and we proved that cadmium is sequestered within the trichomes on the leaf surface. The Donana Natural Park is an internationally important wetland area of 280,000 ha in the Huelva-Seville-Cadiz triangle in Southern Spain, which includes natural beaches, dunes, pine forests and marshlands as the most relevant habitats. On

  16. Assessment of different surveillance systems for avian influenza in commercial poultry in Catalonia (North-Eastern Spain).

    Science.gov (United States)

    Alba, A; Casal, J; Napp, S; Martin, P A J

    2010-11-01

    Compulsory surveillance programmes for avian influenza (AI) have been implemented in domestic poultry and wild birds in all the European Member States since 2005. The implementation of these programmes is complex and requires a close evaluation. A good indicator to assess their efficacy is the sensitivity (Se) of the surveillance system. In this study, the sensitivities for different sampling designs proposed by the Spanish authorities for the commercial poultry population of Catalonia were assessed, using the scenario tree model methodology. These samplings were stratified throughout the territory of Spain and took into account the species, the types of production and their specific risks. The probabilities of detecting infection at different prevalences at both individual and holding level were estimated. Furthermore, those subpopulations that contributed more to the Se of the system were identified. The model estimated that all the designs met the requirements of the European Commission. The probability of detecting AI circulating in Catalonian poultry did not change significantly when the within-holding design prevalence varied from 30% to 10%. In contrast, when the among-holding design prevalence decreased from 5% to 1%, the probability of detecting AI was drastically reduced. The sampling of duck and goose holdings, and to a lesser extent the sampling of turkey and game bird holdings, increased the Se substantially. The Se of passive surveillance in chickens for highly pathogenic avian influenza (HPAI) and low pathogenicity avian influenza (LPAI) were also assessed. The probability of the infected birds manifesting apparent clinical signs and the awareness of veterinarians and farmers had great influence on the probability of detecting AI. In order to increase the probability of an early detection of HPAI in chicken, the probability of performing AI specific tests when AI is suspected would need to be increased. Copyright © 2010 Elsevier B.V. All rights

  17. Squeeze Casting Method Of AI-Si Alloy For Piston Material

    International Nuclear Information System (INIS)

    Wagiyo, H.; Dani, Muhammad; Sulistioso, G.S.; Pardede, Elman; Handayani, Ari; Teguh, Yulius S.P.P.

    2001-01-01

    The AI-Si alloy is an alloy used as piston material. This alloys could be as AI-Si hypereutectic alloy (Si content more than 12.5 % wt.), as AI-Si eutectic alloy (Si cuntent 12.5 % wt, and as AI-Si hypoeutectic alloy (Si content less than 12.5 % wt.). The synthesize of AI-Si alloy piston generally using the technique of gravity casting in a dies. This method is causing high porousity. By using the squeeze technique, amount ofporousity in AI-Si alloy is possibly reduced and the density of this alloy should be higher. The other factors such as alloying elements of AI-Si alloy (Mg. Cu, Zn) would increase the mechanical properties especially the hardness. The focuses of this research are the microstructure and the maximum hardness during the heat treatment of AI-Si alloy which was added by alloying elments. The result of hardness at test shows the maximum hardness at 94.7 kg/mm 2 obtained at aging temperature of 210 o C for hours with homogenous dendritic microstructure

  18. Activity of autoinducer two (AI-2) in bacteria isolated from surface ripened cheeses

    DEFF Research Database (Denmark)

    Gori, Klaus; Jespersen, Lene

    2007-01-01

    ). Corynebacterium casei, Microbacterium barkeri, Microbacterium gubbeenense and S. equorum subsp. linens (all isolated from the smear of surface ripened cheeses) using the AI-2 bioluminescence assay. This indicates that AI-2 signaling could take place between bacteria found in the smear of surface ripened cheeses....

  19. Explanation and trust: what to tell the user in security and AI?

    NARCIS (Netherlands)

    Pieters, Wolter

    2010-01-01

    There is a common problem in artificial intelligence (AI) and information security. In AI, an expert system needs to be able to justify and explain a decision to the user. In information security, experts need to be able to explain to the public why a system is secure. In both cases, the goal of

  20. Explanation and trust: what to tell the user in security and AI?

    NARCIS (Netherlands)

    Pieters, Wolter

    There is a common problem in artificial intelligence (AI) and information security. In AI, an expert system needs to be able to justify and explain a decision to the user. In information security, experts need to be able to explain to the public why a system is secure. In both cases, an important

  1. On how AI & Law can help autonomous systems obey the law: a position paper

    NARCIS (Netherlands)

    Prakken, Hendrik

    2016-01-01

    In this position paper I discuss to what extent current and past AI & law research is relevant for research on autonomous intelligent systems that exhibit legally relevant behaviour. After a brief review of the history of AI & law, I will compare the problems faced by autonomous intelligent systems

  2. In Orbit Validation of the AAUSAT3 SDR based AIS receiver

    DEFF Research Database (Denmark)

    Larsen, Jesper Abildgaard; Mortensen, Hans Peter

    2013-01-01

    During the past years, there has been a high interest in monitoring the global ship traffic from space. The recently launched AAUSAT3 satellite carries an SDR based AIS receiver, which during the past months have been transmitting space based AIS data down to the Aalborg University Ground Station...

  3. Development and application of AI technology to plant operation and support

    International Nuclear Information System (INIS)

    Sackett, J.I.; Mott, J.E.

    1989-01-01

    This paper discusses a framework for the development and application of artificial intelligence (AI) technology in existing nuclear facilities and reviews the status of development. We consider those areas best addressed by AI technology, e.g., equipment diagnostics, sensor validation, and expert systems for procedural response or planning. A brief discussion of work in computer displays is also given. (orig./GL)

  4. Teaching AI Search Algorithms in a Web-Based Educational System

    Science.gov (United States)

    Grivokostopoulou, Foteini; Hatzilygeroudis, Ioannis

    2013-01-01

    In this paper, we present a way of teaching AI search algorithms in a web-based adaptive educational system. Teaching is based on interactive examples and exercises. Interactive examples, which use visualized animations to present AI search algorithms in a step-by-step way with explanations, are used to make learning more attractive. Practice…

  5. Novel lyssavirus in bat, Spain.

    Science.gov (United States)

    Aréchiga Ceballos, Nidia; Vázquez Morón, Sonia; Berciano, José M; Nicolás, Olga; Aznar López, Carolina; Juste, Javier; Rodríguez Nevado, Cristina; Aguilar Setién, Alvaro; Echevarría, Juan E

    2013-05-01

    A new tentative lyssavirus, Lleida bat lyssavirus, was found in a bent-winged bat (Miniopterus schreibersii) in Spain. It does not belong to phylogroups I or II, and it seems to be more closely related to the West Causasian bat virus, and especially to the Ikoma lyssavirus.

  6. Novel Lyssavirus in Bat, Spain

    OpenAIRE

    Ceballos, Nidia Ar?chiga; Mor?n, Sonia V?zquez; Berciano, Jos? M.; Nicol?s, Olga; L?pez, Carolina Aznar; Juste, Javier; Nevado, Cristina Rodr?guez; Seti?n, ?lvaro Aguilar; Echevarr?a, Juan E.

    2013-01-01

    A new tentative lyssavirus, Lleida bat lyssavirus, was found in a bent-winged bat (Miniopterus schreibersii) in Spain. It does not belong to phylogroups I or II, and it seems to be more closely related to the West Causasian bat virus, and especially to the Ikoma lyssavirus.

  7. The gas industry in Spain

    International Nuclear Information System (INIS)

    Jego, H.

    1999-01-01

    This short presentation of the Spanish gas industry looks at the industry's different players including Gas Natural, which controls almost all of the gas distribution in Spain. Natural gas, almost all of which is imported, accounts for an ever-growing share in the country's energy balance and has undergone great developments, particularly in industry and in thermal generating plants. (author)

  8. Study on AI-2 signaling molecules activity and the effect of matrine on AI-2 in Staphylococcus epidermidis LuxS/AI-2 quorum sensing%产膜表皮葡萄球菌LuxS/AI-2型密度感应系统AI-2的活性及苦参碱对其的影响

    Institute of Scientific and Technical Information of China (English)

    李雪; 何芳; 卢金霞; 管翠萍; 周学章

    2017-01-01

    [Objective] This study investigated the activity of AI-2 signaling molecules in Staphylococcus epidermidis planktonic bacteria and biofilm bacteria and the effect of matrine.[Method] The growth curve of Staphylococcus epidermidis planktonic bacteria and biofilm bacteria was drawn and AI-2 concentration was measured using the V.harveyi bioluminescence assay.The transcription level of luxS gene was analyzed using real-time PCR.The AI-2 signaling molecules of Staphylococcus epidermidis ATCC35984 were treated with matrine and the changes of AI-2 signaling molecules activity were determined.[Result] In Staphylococcus epidermidis planktonic bacteria growth process,AI-2 signaling molecule activity and the relative expression quantity of luxS gene reached the maximum in the logarithmic phase before decreasing gradually.Their change curves were similar with planktonic growth curve.However,in the growth process of Staphylococcus epidermidis biofilm bacteria,the activity trend was similar with the biofilm growth.The relative expression quantity of luxS gene had an opposite trend to biofilm growth.Matrine had inhibitory effect on AI-2 signaling molecule activity in planktonic and biofilm bacteria,and the inhibitory effect was stronger to planktonic bacteria.[Conclusion] AI-2 signaling molecule activity and relative expression quantity of luxS gene highly correlated with the growth of Staphylococcus epidermidis and its biofilm formation.Matrine significantly reduced the AI-2 signaling molecule activity of Staphylococcus epidermidis.%[目的]研究产膜表皮葡萄球菌生物被膜菌和液相浮游菌LuxS/AI-2型密度感应系统中AI-2信号分子的活性及苦参碱对其的影响.[方法]绘制产膜表皮葡萄球菌ATCC35984液相浮游菌及生物被膜菌的生长曲线;利用哈维氏弧菌BB170(Vibrio harveyi BB170)作为报告菌株检测表皮葡萄球菌AI-2信号分子的活性;用荧光定量PCR法检测luxS基因的转录水平;用苦参碱

  9. Artificial Intelligence (AI), Operations Research (OR), and Decision Support Systems (DSS): A conceptual framework

    Science.gov (United States)

    Parnell, Gregory S.; Rowell, William F.; Valusek, John R.

    1987-01-01

    In recent years there has been increasing interest in applying the computer based problem solving techniques of Artificial Intelligence (AI), Operations Research (OR), and Decision Support Systems (DSS) to analyze extremely complex problems. A conceptual framework is developed for successfully integrating these three techniques. First, the fields of AI, OR, and DSS are defined and the relationships among the three fields are explored. Next, a comprehensive adaptive design methodology for AI and OR modeling within the context of a DSS is described. These observations are made: (1) the solution of extremely complex knowledge problems with ill-defined, changing requirements can benefit greatly from the use of the adaptive design process, (2) the field of DSS provides the focus on the decision making process essential for tailoring solutions to these complex problems, (3) the characteristics of AI, OR, and DSS tools appears to be converging rapidly, and (4) there is a growing need for an interdisciplinary AI/OR/DSS education.

  10. Enabling technologies and methods for the retro-fitting of AI software into NPPS

    International Nuclear Information System (INIS)

    Pymm, P.

    1994-01-01

    Scottish Nuclear have a number of plant monitoring and training applications at their operational nuclear power plant which could benefit from the introduction of artificial intelligence (AI) software. An outline of early work on two current AI developments in the areas of advanced operator aids and intelligent training is given. A generic workstation based engineering simulator (WES) which provides a prototyping environment for AI product application development and evaluation and development of human-computer interface (HCI) designs for plant installation is described. It is concluded that the WES architecture facilitates both migration of the prototype AI application to the plant and collaboration in the AI field between Scottish Nuclear and other organizations. (author). 1 ref., 6 figs

  11. Cancer incidence in Spain, 2015.

    Science.gov (United States)

    Galceran, J; Ameijide, A; Carulla, M; Mateos, A; Quirós, J R; Rojas, D; Alemán, A; Torrella, A; Chico, M; Vicente, M; Díaz, J M; Larrañaga, N; Marcos-Gragera, R; Sánchez, M J; Perucha, J; Franch, P; Navarro, C; Ardanaz, E; Bigorra, J; Rodrigo, P; Bonet, R Peris

    2017-07-01

    Periodic cancer incidence estimates of Spain from all existing population-based cancer registries at any given time are required. The objective of this study was to present the current situation of cancer incidence in Spain. The Spanish Network of Cancer Registries (REDECAN) estimated the numbers of new cancer cases occurred in Spain in 2015 by applying the incidence-mortality ratios method. In the calculus, incidence data from population-based cancer registries and mortality data of all Spain were used. In 2015, nearly a quarter of a million new invasive cancer cases were diagnosed in Spain, almost 149,000 in men (60.0%) and 99,000 in women. Globally, the five most common cancers were those of colon-rectum, prostate, lung, breast and urinary bladder. By gender, the four most common cancers in men were those of prostate (22.4%), colon-rectum (16.6%), lung (15.1%) and urinary bladder (11.7%). In women, the most common ones were those of breast (28.0%), colon-rectum (16.9%), corpus uteri (6.2%) and lung (6.0%). In recent years, cancer incidence in men seems to have stabilized due to the fact that the decrease in tobacco-related cancers compensates for the increase in other types of cancer like those of colon and prostate. In women, despite the stabilization of breast cancer incidence, increased incidence is due, above all, to the rise of colorectal and tobacco-related cancers. To reduce these incident cancer cases, improvement of smoking control policies and extension of colorectal cancer screening should be the two priorities in cancer prevention for the next years.

  12. LuxS-independent formation of AI-2 from ribulose-5-phosphate

    Directory of Open Access Journals (Sweden)

    Hardie Kim R

    2008-06-01

    Full Text Available Abstract Background In many bacteria, the signal molecule AI-2 is generated from its precursor S-ribosyl-L-homocysteine in a reaction catalysed by the enzyme LuxS. However, generation of AI-2-like activity has also been reported for organisms lacking the luxS gene and the existence of alternative pathways for AI-2 formation in Escherichia coli has recently been predicted by stochastic modelling. Here, we investigate the possibility that spontaneous conversion of ribulose-5-phosphate could be responsible for AI-2 generation in the absence of luxS. Results Buffered solutions of ribulose-5-phosphate, but not ribose-5-phosphate, were found to contain high levels of AI-2 activity following incubation at concentrations similar to those reported in vivo. To test whether this process contributes to AI-2 formation by bacterial cells in vivo, an improved Vibrio harveyi bioassay was used. In agreement with previous studies, culture supernatants of E. coli and Staphylococcus aureus luxS mutants were found not to contain detectable levels of AI-2 activity. However, low activities were detected in an E. coli pgi-eda-edd-luxS mutant, a strain which degrades glucose entirely via the oxidative pentose phosphate pathway, with ribulose-5-phosphate as an obligatory intermediate. Conclusion Our results suggest that LuxS-independent formation of AI-2, via spontaneous conversion of ribulose-5-phosphate, may indeed occur in vivo. It does not contribute to AI-2 formation in wildtype E. coli and S. aureus under the conditions tested, but may be responsible for the AI-2-like activities reported for other organisms lacking the luxS gene.

  13. The AI&M procedure for learning from incomplete data

    DEFF Research Database (Denmark)

    Jaeger, Manfred

    2006-01-01

    We investigate methods for parameter learning from incomplete data that is not missing at random. Likelihood-based methods then require the optimization of a profile likelihood that takes all possible missingness mechanisms into account. Optimizing this profile likelihood poses two main difficult......We investigate methods for parameter learning from incomplete data that is not missing at random. Likelihood-based methods then require the optimization of a profile likelihood that takes all possible missingness mechanisms into account. Optimizing this profile likelihood poses two main...... by operations in the space of data completions, rather than directly in the parameter space of the profile likelihood. We apply the AI\\&M method to learning parameters for Bayesian networks. The method is compared against conservative inference, which takes into account each possible data completion......, and against EM. The results indicate that likelihood-based inference is still feasible in the case of unknown missingness mechanisms, and that conservative inference is unnecessarily weak. On the other hand, our results also provide evidence that the EM algorithm is still quite effective when the data...

  14. Building regional early flood warning systems by AI techniques

    Science.gov (United States)

    Chang, F. J.; Chang, L. C.; Amin, M. Z. B. M.

    2017-12-01

    Building early flood warning system is essential for the protection of the residents against flood hazards and make actions to mitigate the losses. This study implements AI technology for forecasting multi-step-ahead regional flood inundation maps during storm events. The methodology includes three major schemes: (1) configuring the self-organizing map (SOM) to categorize a large number of regional inundation maps into a meaningful topology; (2) building dynamic neural networks to forecast multi-step-ahead average inundated depths (AID); and (3) adjusting the weights of the selected neuron in the constructed SOM based on the forecasted AID to obtain real-time regional inundation maps. The proposed models are trained, and tested based on a large number of inundation data sets collected in regions with the most frequent and serious flooding in the river basin. The results appear that the SOM topological relationships between individual neurons and their neighbouring neurons are visible and clearly distinguishable, and the hybrid model can continuously provide multistep-ahead visible regional inundation maps with high resolution during storm events, which have relatively small RMSE values and high R2 as compared with numerical simulation data sets. The computing time is only few seconds, and thereby leads to real-time regional flood inundation forecasting and make early flood inundation warning system. We demonstrate that the proposed hybrid ANN-based model has a robust and reliable predictive ability and can be used for early warning to mitigate flood disasters.

  15. Computational intelligence from AI to BI to NI

    Science.gov (United States)

    Werbos, Paul J.

    2015-05-01

    This paper gives highlights of the history of the neural network field, stressing the fundamental ideas which have been in play. Early neural network research was motivated mainly by the goals of artificial intelligence (AI) and of functional neuroscience (biological intelligence, BI), but the field almost died due to frustrations articulated in the famous book Perceptrons by Minsky and Papert. When I found a way to overcome the difficulties by 1974, the community mindset was very resistant to change; it was not until 1987/1988 that the field was reborn in a spectacular way, leading to the organized communities now in place. Even then, it took many more years to establish crossdisciplinary research in the types of mathematical neural networks needed to really understand the kind of intelligence we see in the brain, and to address the most demanding engineering applications. Only through a new (albeit short-lived) funding initiative, funding crossdisciplinary teams of systems engineers and neuroscientists, were we able to fund the critical empirical demonstrations which put our old basic principle of "deep learning" firmly on the map in computer science. Progress has rightly been inhibited at times by legitimate concerns about the "Terminator threat" and other possible abuses of technology. This year, at SPIE, in the quantum computing track, we outline the next stage ahead of us in breaking out of the box, again and again, and rising to fundamental challenges and opportunities still ahead of us.

  16. AI empowered context-aware smart system for medication adherence

    Directory of Open Access Journals (Sweden)

    Qiong Wu

    2017-06-01

    Full Text Available Purpose – Poor medication adherence leads to high hospital admission rate and heavy amount of health-care cost. To cope with this problem, various electronic pillboxes have been proposed to improve the medication adherence rate. However, most of the existing electronic pillboxes use time-based reminders which may often lead to ineffective reminding if the reminders are triggered at inopportune moments, e.g. user is sleeping or eating. Design/methodology/approach – In this paper, the authors propose an AI-empowered context-aware smart pillbox system. The pillbox system collects real-time sensor data from a smart home environment and analyzes the user’s contextual information through a computational abstract argumentation-based activity classifier. Findings – Based on user’s different contextual states, the smart pillbox will generate reminders at appropriate time and on appropriate devices. Originality/value – This paper presents a novel context-aware smart pillbox system that uses argumentation-based activity recognition and reminder generation.

  17. Dictionnaire étymologique du français

    CERN Document Server

    Picoche, Jacqueline

    1979-01-01

    Cette nouvelle édition du Dictionnaire étymologique du français, largement enrichie, présente l'arbre généalogique de près de 35 000 mots. Savez-vous que concerto, décret et discernement ont la même racine que crible ?. Que chauvin, espiègle et rocambolesque viennent de noms de personnages de la littérature ?. Que le sens premier de amadouer est " frotter avec de l'amadou " pour se jaunir le teint ?. Pour chaque mot, retrouvez sa famille, son origine, son sens originel ou le sens de sa racine, les diverses formes qu'il a prises depuis sa première attestation et les règles phonétiques expliquant son évolution. Des annexes traitent plus particulièrement des mots à syllabes redoublées (coco, zigzag), de ceux formés sur des onomatopées (hennir, ouistiti) et de ceux venant de noms de personnes (dahlia, praline) ou de lieux (bougie, rugby).

  18. AI and simulation: What can they learn from each other

    Science.gov (United States)

    Colombano, Silvano P.

    1988-01-01

    Simulation and Artificial Intelligence share a fertile common ground both from a practical and from a conceptual point of view. Strengths and weaknesses of both Knowledge Based System and Modeling and Simulation are examined and three types of systems that combine the strengths of both technologies are discussed. These types of systems are a practical starting point, however, the real strengths of both technologies will be exploited only when they are combined in a common knowledge representation paradigm. From an even deeper conceptual point of view, one might even argue that the ability to reason from a set of facts (i.e., Expert System) is less representative of human reasoning than the ability to make a model of the world, change it as required, and derive conclusions about the expected behavior of world entities. This is a fundamental problem in AI, and Modeling Theory can contribute to its solution. The application of Knowledge Engineering technology to a Distributed Processing Network Simulator (DPNS) is discussed.

  19. CURRENT ISSUES IN OUTSOURCING: MIS, AIS AND BEYOND

    Directory of Open Access Journals (Sweden)

    AIDA SY

    2012-01-01

    Full Text Available En años recientes, el outsourcing se ha venido convirtiendo en una tendencia tanto en empresas de Europa y los Estados Unidos. Ni siquiera, trabajadores muy calificados se salvan de este asalto.La vanidad de los intelectuales y los profesionales que ejecutan tanto sistemas de información contable(AIS, como sistemas de información de gestión (MIS es su creencia de que están exentos de estosprocesos de outsourcing. Algunos creen que disfrutan de una vida de ensueño, que la demanda de sus servicios está asegurada. Se consuelan pensando que el aumento de su dominiotécnico les ofrece una defensa suficiente contra los ataques provenientes del mercado laboral y de productos.Una interpretación desde los estudios críticos indicará que esta posición es un acto dearrogancia, siendo esto el eje de la discusión de este documento. Tal actitud de los profesionales contables es una reminiscencia del Rey Canuto esperando que la marea retroceda.

  20. Novel cross-linked alcohol-insoluble solid (CL-AIS) affinity gel from pea pod for pectinesterase purification.

    Science.gov (United States)

    Wu, Ming-Chang; Lin, Guan-Hui; Wang, Yuh-Tai; Jiang, Chii-Ming; Chang, Hung-Min

    2005-10-05

    Alcohol-insoluble solids (AIS) from pea pod were cross-linked (CL-AIS) and used as an affinity gel matrix to isolate pectin esterases (PEs) from tendril shoots of chayote (TSC) and jelly fig achenes (JFA), and the results were compared with those isolated by ion-exchange chromatography with a commercial resin. CL-AIS gel matrix in a column displayed poor absorption and purification fold of PE; however, highly methoxylated CL-AIS (HM-CL-AIS), by exposing CL-AIS to methanolic sulfuric acid to increase the degree of esterification (DE) to 92%, facilitated the enzyme purification. The purified TSC PE and JFA PE by the HM-CL-AIS column were proofed as a single band on an SDS-PAGE gel, showing that the HM-CL-AIS column was a good matrix for purification of PE, either with alkaline isoelectric point (pI) (TSC PE) or with acidic pI (JFA PE).

  1. A model of lipid-free apolipoprotein A-I revealed by iterative molecular dynamics simulation.

    Directory of Open Access Journals (Sweden)

    Xing Zhang

    Full Text Available Apolipoprotein A-I (apo A-I, the major protein component of high-density lipoprotein, has been proven inversely correlated to cardiovascular risk in past decades. The lipid-free state of apo A-I is the initial stage which binds to lipids forming high-density lipoprotein. Molecular models of lipid-free apo A-I have been reported by methods like X-ray crystallography and chemical cross-linking/mass spectrometry (CCL/MS. Through structural analysis we found that those current models had limited consistency with other experimental results, such as those from hydrogen exchange with mass spectrometry. Through molecular dynamics simulations, we also found those models could not reach a stable equilibrium state. Therefore, by integrating various experimental results, we proposed a new structural model for lipid-free apo A-I, which contains a bundled four-helix N-terminal domain (1-192 that forms a variable hydrophobic groove and a mobile short hairpin C-terminal domain (193-243. This model exhibits an equilibrium state through molecular dynamics simulation and is consistent with most of the experimental results known from CCL/MS on lysine pairs, fluorescence resonance energy transfer and hydrogen exchange. This solution-state lipid-free apo A-I model may elucidate the possible conformational transitions of apo A-I binding with lipids in high-density lipoprotein formation.

  2. Validation of the Avoidance and Inflexibility Scale (AIS) among treatment-seeking smokers.

    Science.gov (United States)

    Farris, Samantha G; Zvolensky, Michael J; DiBello, Angelo M; Schmidt, Norman B

    2015-06-01

    The Avoidance and Inflexibility Scale (AIS; Gifford et al., 2004) was derived as a smoking-specific measure of experiential avoidance. However, there has been little investigation of the psychometric proprieties of the AIS and no published work on the topic. The current study aimed to test the reliability and validity of the AIS among a sample of adult treatment-seeking daily smokers (n = 465; 48.2% female, 17.8 [SD = 9.60] cigarettes per day). The AIS was administered at 3 time points (baseline, quit-day, and 1 month postquit) as part of a larger smoking cessation trial. An exploratory factor analysis indicated a 2-factor solution, described by inflexibility and avoidance because of smoking related "thoughts/feelings" (9 items) and "somatic sensations" (4 items). Results revealed that the AIS-total and factor scores demonstrated high internal consistency and test-retest reliability. The AIS total and factor scores also displayed high convergent, discriminant, and incremental predictive validity with theoretically relevant smoking and affective variables. The present data suggest that the AIS measure appears to be a valid and reliable smoking-specific index of experiential avoidance. (c) 2015 APA, all rights reserved).

  3. Validation of the Avoidance and Inflexibility Scale (AIS) among Treatment-Seeking Smoker

    Science.gov (United States)

    Farris, Samantha G.; Zvolensky, Michael J.; DiBello, Angelo M.; Schmidt, Norman B.

    2015-01-01

    The Avoidance and Inflexibility Scale (AIS; Gifford et al., 2004) was derived as smoking-specific measure of experiential avoidance. However, there has been little investigation of the psychometric proprieties of the AIS and no published work on the topic. The current study aimed to test the reliability and validity of the AIS among a sample of adult treatment-seeking daily smokers (n = 465; 48.1% female, 17.8 [SD = 9.60] cigarettes per day). The AIS was administered at three time points (Baseline, Quit day, 1 month post-quit) as part of a larger smoking cessation trial. An exploratory factor analysis indicated a two-factor solution, described by inflexibility and avoidance due to smoking related “thoughts/feelings” (9 items) and “somatic sensations” (4 items). Results revealed that the AIS-total and factor scores demonstrated high internal consistency and test-retest reliability. The AIS total and factor scores also displayed high convergent, discriminant, and incremental predictive validity with theoretically-relevant smoking and affective variables. The present data suggest that the AIS measure appears to be a valid and reliable smoking-specific index of experiential avoidance. PMID:25642937

  4. Rapid and simple colorimetric method for the quantification of AI-2 produced from Salmonella Typhimurium.

    Science.gov (United States)

    Wattanavanitchakorn, Siriluck; Prakitchaiwattana, Cheunjit; Thamyongkit, Patchanita

    2014-04-01

    The aim of this study was to evaluate the feasibility of Fe(III) ion reduction for the simple and rapid quantification of autoinducer-2 (AI-2) produced from bacteria using Salmonella Typhimurium as a model. Since the molecular structure of AI-2 is somewhat similar to ascorbic acid it was expected that AI-2 would also act as a reducing agent and reduce Fe(III) ions in the presence of 1,10-phenanthroline to form the colored [(o-phen)3 Fe(II)]SO4 ferroin complex that could be quantified colorimetrically. In support of this, colony rinses and cell free supernatants from cultures of all tested AI-2 producing strains, but not the AI-2 negative Sinorhizobium meliloti, formed a colored complex with a λmax of 510nm. The OD510 values of these culture supernatants or colony rinses were in broad agreement with the % activity observed in the same samples using the standard Vibrio harveyi bioluminescence assay for AI-2 detection, and with previously reported results. This methodology could potentially be developed as an alternative method for the simple and rapid quantification of AI-2 levels produced in bacterial cultures. Copyright © 2014 Elsevier B.V. All rights reserved.

  5. «En los mayores peligros se conoce la amistad» («Friendship is Best Acknowledged when in Danger», an Auto Sacramental (Eucharistic Morality Play by José de Valdivieso, Staged at the Corpus Christi Feast in Seville, in 1619. An Analysis and a Virtual Reconstruction

    Directory of Open Access Journals (Sweden)

    Mercedes de los Reyes Peña

    2017-11-01

    Full Text Available This paper studies José de Valdivieso’s En los mayores peligros se conoce la amistad (Friendship is best acknowledged when in danger one of the five autos sacramentales (Eucharistic morality plays staged at the Corpus Christi feast in Seville, in 1619, by Diego de Vallejo. It also bears the title La amistad en el peligro (Friendship when in danger, and has never been published in a modern critical edition, though two published records (1622 and 1624 bear witness to the play, of which there are two 17 th Century manuscript versions extant. This article, based on contemporary records, studies the historical socio-religious- urban context of the Corpus Christi feast in Seville and virtually reconstructs the play’s performance, on pageant wagons, and its subsequent procession within the town.

  6. The Atomics International (AI) prototype large breeder reactor (PLBR)

    International Nuclear Information System (INIS)

    McDonald, J.S.; Campise, A.V.; Brunings, J.

    1978-01-01

    The AI-PLBR breeder plant design prepared for ERDA and EPRI is of 1000 MWe size, utilizing a loop-type sodium system configuration and producing 2200 psig/850 0 F steam. A 'bullseye' core geometry type sodium system configuration and is employed with Pu0 2 -UO 2 fuel and UO 2 fertile material. The reactor outlet coolant temperature is 930 0 F. A modified 'A'-frame refueling system is employed, which is capable of handling 1/3 of a core loading in 12 days. An inducer-type mechanical pump is used in the primary circuit because of its excellent NPSH characteristics. Hockey sticks steam generators are used to produce near-fossil steam conditions at the turbine throttle. The balance of plant (BOP) design was developed by the architectural-engineering firm of Burns and Roe. It includes Allis-Chalmers - KWU 1800-rpm tandem-compound turbine, selected with high-,intermediate-, and two double-flow low-pressure cylinders equipped with two moisture separator cyclones. A design feature to enhance the licensability of the reference design is the three-level Decay Heat Removal System (DHRS), which consists of normal, backup, and diverse decay heat removal paths. The Atomics International PLBR design illustrated the technical soundness of the LMFBR system for meeting the world's long-term electrical energy supply needs. The design includes design features to assure licensability and innovative engineering features to enhance reliability, constructability, economics, and U.S. utility grid compatibility. The design concept provides a sound basis for the future detailed design of a prototype plant and subsequent development of larger LMFBR plants. (author)

  7. Man-machine communication in reactor control using AI methods

    International Nuclear Information System (INIS)

    Klebau, J.; Lindner, A.; Fiedler, U.

    1987-01-01

    In the last years the interest in process control has expecially focused on problems of man-machine communication. It depends on its great importance to process performance and user acceptance. Advanced computerized operator aids, e.g. in nuclear power plants, are as well as their man-machine interface. In the Central Institute for Nuclear Research in Rossendorf a computerized operator support system for nuclear power plants is designed, which is involved in a decentralized process automation system. A similar but simpler system, the Hierarchical Informational System (HIS) at the Rossendorf Research Reactor, works with a computer controlled man-machine interface, based on menu. In the special case of the disturbance analysis program SAAP-2, which is included in the HIS, the limits of menu techniques are obviously. Therefore it seems to be necessary and with extended hard- and software possible to realize an user controlled natural language interface using Artificial Intelligence (AI) methods. The draft of such a system is described. It should be able to learn during a teaching phase all phrases and their meanings. The system will work on the basis of a self-organizing, associative data structure. It is used to recognize a great amount of words which are used in language analysis. Error recognition and, if possible, correction is done by means of a distance function in the word set. Language analysis should be carried out with a simplified word class controlled functional analysis. With this interface it is supposed to get experience in intelligent man-machine communication to enhance operational safety in future. (author)

  8. AI Techniques in a Context-Aware Ubiquitous Environment

    Science.gov (United States)

    Coppola, Paolo; Mea, Vincenzo Della; di Gaspero, Luca; Lomuscio, Raffaella; Mischis, Danny; Mizzaro, Stefano; Nazzi, Elena; Scagnetto, Ivan; Vassena, Luca

    Nowadays, the mobile computing paradigm and the widespread diffusion of mobile devices are quickly changing and replacing many common assumptions about software architectures and interaction/communication models. The environment, in particular, or more generally, the so-called user context is claiming a central role in everyday’s use of cellular phones, PDAs, etc. This is due to the huge amount of data “suggested” by the surrounding environment that can be helpful in many common tasks. For instance, the current context can help a search engine to refine the set of results in a useful way, providing the user with a more suitable and exploitable information. Moreover, we can take full advantage of this new data source by “pushing” active contents towards mobile devices, empowering the latter with new features (e.g., applications) that can allow the user to fruitfully interact with the current context. Following this vision, mobile devices become dynamic self-adapting tools, according to the user needs and the possibilities offered by the environment. The present work proposes MoBe: an approach for providing a basic infrastructure for pervasive context-aware applications on mobile devices, in which AI techniques (namely a principled combination of rule-based systems, Bayesian networks and ontologies) are applied to context inference. The aim is to devise a general inferential framework to make easier the development of context-aware applications by integrating the information coming from physical and logical sensors (e.g., position, agenda) and reasoning about this information in order to infer new and more abstract contexts.

  9. Spain; Financial System Stability Assessment

    OpenAIRE

    International Monetary Fund

    2012-01-01

    This report summarizes the findings of the Financial Sector Assessment Program (FSAP) Update for Spain. Although there is a core of strong banks that are well managed and appear resilient to further shocks, vulnerabilities remain. Substantial progress has been made in reforming the former savings banks, and the most vulnerable institutions have either been resolved or are being restructured. Recent measures address the most problematic part of banks’ portfolios. Moving ahead, a further restru...

  10. Update on Spain's oil market

    International Nuclear Information System (INIS)

    Whitaker, D.; Gutierrez, I.

    1994-01-01

    Since Spain's entry into the European Community a liberalisation of the oil industry has occurred culminating in two oil sector reform laws passed in 1992. While competition has increased, a return to the free-market policies which held sway before 1927 has not happened. Rather, three large companies dominate the Spanish oil market, with continuing input from government towards liberalization, if somewhat slowly. This paper describes recent changes and examines factors which limit liberalization policies. (UK)

  11. 7 CFR 319.56-34 - Clementines from Spain.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 5 2010-01-01 2010-01-01 false Clementines from Spain. 319.56-34 Section 319.56-34... Clementines from Spain. Clementines (Citrus reticulata) from Spain may only be imported into the United States... agreement. Clementines from Spain may be imported only if the Government of Spain or its designated...

  12. Construction industry accidents in Spain.

    Science.gov (United States)

    Camino López, Miguel A; Ritzel, Dale O; Fontaneda, Ignacio; González Alcantara, Oscar J

    2008-01-01

    This paper analyzed industrial accidents that take place on construction sites and their severity. Eighteen variables were studied. We analyzed the influence of each of these with respect to the severity and fatality of the accident. This descriptive analysis was grounded in 1,630,452 accidents, representing the total number of accidents suffered by workers in the construction sector in Spain over the period 1990-2000. It was shown that age, type of contract, time of accident, length of service in the company, company size, day of the week, and the remainder of the variables under analysis influenced the seriousness of the accident. IMPACT ON INJURY PREVENTION: The results obtained show that different training was needed, depending on the severity of accidents, for different age, length of service in the company, organization of work, and time when workers work. The research provides an insight to the likely causes of construction injuries in Spain. As a result of the analysis, industries and governmental agencies in Spain can start to provide appropriate strategies and training to the construction workers.

  13. Using experimental game theory to transit human values to ethical AI

    OpenAIRE

    Wang, Yijia; Wan, Yan; Wang, Zhijian

    2017-01-01

    Knowing the reflection of game theory and ethics, we develop a mathematical representation to bridge the gap between the concepts in moral philosophy (e.g., Kantian and Utilitarian) and AI ethics industry technology standard (e.g., IEEE P7000 standard series for Ethical AI). As an application, we demonstrate how human value can be obtained from the experimental game theory (e.g., trust game experiment) so as to build an ethical AI. Moreover, an approach to test the ethics (rightness or wrongn...

  14. How AI localisation in plant tissues determines the targeted pest spectrum of different chemistries

    DEFF Research Database (Denmark)

    Buchholz, Anke; Trapp, Stefan

    penetration as first crucial step can be modified by formulation whereas the active ingredient (AI) distribution within cells is usually solely determined by physicochemical properties. This passive AI distribution was calculated with the Fick-Nernst-Planck equation implemented in a cell model....... The predictions were compared to the measured biological effects against three different arthropods. Test compounds differed in log P (-0.1 to 4.3) and pKa (4.1 to 10.7). Efficacies in different bioassays are discussed with the postulated cellular AI localisation and the individual feeding behaviour...

  15. Combining AI Methods for Learning Bots in a Real-Time Strategy Game

    OpenAIRE

    Robin Baumgarten; Simon Colton; Mark Morris

    2009-01-01

    We describe an approach for simulating human game-play in strategy games using a variety of AI techniques, including simulated annealing, decision tree learning, and case-based reasoning. We have implemented an AI-bot that uses these techniques to form a novel approach for planning fleet movements and attacks in DEFCON, a nuclear war simulation strategy game released in 2006 by Introversion Software Ltd. The AI-bot retrieves plans from a case-base of recorded games, then uses these to generat...

  16. A Review of Future and Ethical Perspectives of Robotics and AI

    Directory of Open Access Journals (Sweden)

    Jim Torresen

    2018-01-01

    Full Text Available In recent years, there has been increased attention on the possible impact of future robotics and AI systems. Prominent thinkers have publicly warned about the risk of a dystopian future when the complexity of these systems progresses further. These warnings stand in contrast to the current state-of-the-art of the robotics and AI technology. This article reviews work considering both the future potential of robotics and AI systems, and ethical considerations that need to be taken in order to avoid a dystopian future. References to recent initiatives to outline ethical guidelines for both the design of systems and how they should operate are included.

  17. Selective oxidation of methionine residues in apolipoprotein A-I and its potential biological consequences

    International Nuclear Information System (INIS)

    Panzenboeck, U.; Waldeck, R.; Rye, K.A.; Sloane, T.; Kritharides, L.; Stocker, R.

    1998-01-01

    The earliest stages of HDL oxidation are accompanied by the oxidation of specific Met residues in apolipoprotein AI and AII and the formation of Met sulfoxides (Met(O)) has been proposed to play a significant role in the reduction and hence detoxification of lipid hydroperoxides associated with HDL. Oxidation of HDL may generally decrease the anti-atherogenic properties of this lipoprotein, although both, the inhibition and the enhancement of cholesterol removal from cells has been reported for different types of oxidation. In light of these findings we have investigated the secondary structure, lipid affinity, LCAT activation and cholesterol-efflux promoting properties of native and selectively oxidized apo A-I(apo A-I +32 , containing Met(O) at Met l12 and Met l48 ) in purified or reconstituted forms. Data obtained by circular dichroism revealed that selective oxidation of Met residues 112 and 148 does not alter alpha helicity of the protein in solution, indicating that this oxidation is not sufficient to influence significantly this type of secondary structure of apo A-I in its 'lipid-free' form. The lipid affinity of native apo A-I and apo A-I +32 was determined as the rate of clearance of DMPC multilamellar to small unilamellar vesicles. Compared with the native protein, apo A-I +32 induced a 2-3 fold faster rate of clearance, suggesting that the increased hydrophilicity due Met(O) increased the rate for protein-lipid interactions. Met residues 112 and 148 reside in the hydrophobic faces of helices 5 and 7, and both these regions have been suggested to be important for both, LCAT activation and cholesterol efflux. Kinetic experiments have revealed that the affinity for LCAT is comparable for HDL reconstituted with either apo A-I or apo A-I +32 . Efflux of [ 3 H]-cholesterol from lipid-laden human monocytederived macrophages to isolated apolipoproteins was enhanced for apo A-I +32 compared with apo A-I, consistent with the DMPC clearance data. Together these

  18. Detection of possible AI-2-mediated quorum sensing system in commensal intestinal bacteria.

    Science.gov (United States)

    Lukás, F; Gorenc, G; Kopecný, J

    2008-01-01

    The Vibrio harveyi strain BB170-autoinducer bioassay was used to detect possible quorum sensing autoinducer-2 molecule (AI-2) in culture fluids of commensal intestinal bacteria. Culture fluids of Bacteroides vulgatus, Clostridium proteoclasticum, Escherichia coli, Eubacterium rectale, Lachnospira multipara, Pseudobutyrivibrio ruminis, Roseburia intestinalis, Ruminococcus albus and Ruminococcus flavefaciens contained AI-2-like molecules. The PCR bands from some of the tested strains could be also amplified using primers designed for the luxS gene. These findings suggest that AI-2 is present in the gastrointestinal tract; however, it has not yet been proved whether it is used for bacterial cell-to-cell communication.

  19. 78 FR 63494 - Meeting of the National Coordination Committee on the AI/AN SANE-SART Initiative

    Science.gov (United States)

    2013-10-24

    ... National Coordination Committee on the AI/AN SANE--SART Initiative AGENCY: Office for Victims of Crime.../ Alaska Native (AI/AN) Sexual Assault Nurse Examiner (SANE)--Sexual Assault Response Team (SART..., victim-centered responses to sexual violence within AI/AN communities. DATES: The meeting will be held...

  20. Uptake of heavy metals and As by Brassica juncea grown in a contaminated soil in Aznalcollar (Spain): The effect of soil amendments

    Energy Technology Data Exchange (ETDEWEB)

    Clemente, Rafael [Department of Soil and Water Conservation and Organic Waste Management. Centro de Edafologia y Biologia Aplicada del Segura, CSIC. Apartado 164, 30100 Espinardo, Murcia (Spain); Walker, David J. [Department of Soil and Water Conservation and Organic Waste Management. Centro de Edafologia y Biologia Aplicada del Segura, CSIC. Apartado 164, 30100 Espinardo, Murcia (Spain); Bernal, M. Pilar [Department of Soil and Water Conservation and Organic Waste Management. Centro de Edafologia y Biologia Aplicada del Segura, CSIC. Apartado 164, 30100 Espinardo, Murcia (Spain)]. E-mail: pbernal@cebas.csic.es

    2005-11-15

    Two crops of Brassica juncea (L.) Czern. were grown in a field experiment, at the site affected by the toxic spillage of acidic, metal-rich waste in Aznalcollar (Seville, Spain), to study its metal accumulation and the feasibility of its use for metal phytoextraction. The effects of organic soil amendments (cow manure and mature compost) and lime on biomass production and plant survival were also assessed; plots without organic amendment and without lime were used as controls. Plots, with or without organic amendment, having pH<5 were limed for the second crop. Soil acidification conditioned plant growth and metal accumulation. The addition of lime and the organic amendments achieved higher plant biomass production, although effects concerning metal bioavailability and accumulation were masked somewhat by pH variability with time and between and within plots. Tissue metal concentrations of B. juncea were elevated for Zn, Cu and Pb, especially in leaves of plants from plots with low pH values (maxima of 2029, 71 and 55 {mu}g g{sup -1}, respectively). The total uptake of heavy metals in the plants was relatively low, emphasising the problems faced when attempting to employ phytoextraction for clean-up of pluri-contaminated sites. - Although organic amendments improved soil conditions and plant growth, the phytoextraction capacity of Brassica juncea (cv. Z1) is too low for efficient soil remediation.

  1. AI AND SAR APPROACHES FOR PREDICTING CHEMICAL CARCINOGENICITY: SURVEY AND STATUS REPORT

    Science.gov (United States)

    A wide variety of artificial intelligence (AI) and structure-activity relationship (SAR approaches have been applied to tackling the general problem of predicting rodent chemical carcinogenicity. Given the diversity of chemical structures and mechanisms relative to this endpoin...

  2. So Sorry––Never Sorry. Ai Weiwei’s Art between Tradition and Modernity

    Directory of Open Access Journals (Sweden)

    Tania Becker

    2011-12-01

    Full Text Available Ai Weiwei’s 艾未未 (b. 1957 artistic expression revolves around his use of traditional Chinese techniques to create new designs and forms, shaping traditional materials into contemporary configurations. In the face of obstruction from state officials and local politicians, Ai Weiwei exposes himself to considerable personal risk in order to continue his activities as an artist and stay loyal to his convictions. This paper examines the roots of Ai Weiwei’s work in Chinese art history and looks at how the artist has deliberately adapted traditional motifs to bring about a sense of alienation. Ai Weiwei’s unique stance between current trends in western art and the Chinese feeling for handicrafts is also explored.

  3. Application of artificial intelligence (AI) methods for designing and analysis of reconfigurable cellular manufacturing system (RCMS)

    CSIR Research Space (South Africa)

    Xing, B

    2009-12-01

    Full Text Available This work focuses on the design and control of a novel hybrid manufacturing system: Reconfigurable Cellular Manufacturing System (RCMS) by using Artificial Intelligence (AI) approach. It is hybrid as it combines the advantages of Cellular...

  4. An Empirical Study of AI Population Dynamics with Million-agent Reinforcement Learning

    OpenAIRE

    Yang, Yaodong; Yu, Lantao; Bai, Yiwei; Wang, Jun; Zhang, Weinan; Wen, Ying; Yu, Yong

    2017-01-01

    In this paper, we conduct an empirical study on discovering the ordered collective dynamics obtained by a population of artificial intelligence (AI) agents. Our intention is to put AI agents into a simulated natural context, and then to understand their induced dynamics at the population level. In particular, we aim to verify if the principles developed in the real world could also be used in understanding an artificially-created intelligent population. To achieve this, we simulate a large-sc...

  5. PERFORMATIVITAS DALAM MANGA SHONEN-AI: SEKAIICHI HATSUKOI, HENSHIN DEKINAI DAN HIMANANODE HAJIMETE MIMASHITA

    OpenAIRE

    Savitri Paramita, Ni Made

    2014-01-01

    This research underlies the analysis on the performance and performativity of characters in shonen-ai: Sekaiichi Hatsukoi, Henshin Dekinai, and Himananode Hajimete Mimashita manga. Characterization in shonen-ai manga is based on the characters’ role within the same-sex relationship, which are the male role (seme) and the female role (uke). The character of Seme tends to be aggressive, protective, smart, good looking, and unemotional. On the other hand, Uke is feminine, smaller, physically wea...

  6. Beyond AI: Multi-Intelligence (MI) Combining Natural and Artificial Intelligences in Hybrid Beings and Systems

    OpenAIRE

    Stephen Fox

    2017-01-01

    Framing strongly influences actions among technology proponents and end-users. Underlying much debate about artificial intelligence (AI) are several fundamental shortcomings in its framing. First, discussion of AI is atheoretical, and therefore has limited potential for addressing the complexity of causation. Second, intelligence is considered from an anthropocentric perspective that sees human intelligence, and intelligence developed by humans, as superior to all other intelligences. Thus, t...

  7. Towards an unanimous international regulatory body for responsible use of Artificial Intelligence [UIRB-AI

    OpenAIRE

    Chidambaram, Rajesh

    2017-01-01

    Artificial Intelligence (AI), is once again in the phase of drastic advancements. Unarguably, the technology itself can revolutionize the way we live our everyday life. But the exponential growth of technology poses a daunting task for policy researchers and law makers in making amendments to the existing norms. In addition, not everyone in the society is studying the potential socio-economic intricacies and cultural drifts that AI can bring about. It is prudence to reflect from our historica...

  8. Do older t'ai chi practitioners have better attention and memory function?

    Science.gov (United States)

    Man, David W K; Tsang, William W N; Hui-Chan, Christina W Y

    2010-12-01

    Cognitive declines are common in older people and can be a major health issue in an aging world. One type of body-mind exercises, t'ai chi, can be a possible means to help maintaining older adults' cognitive abilities, in addition to beneficial effects of physical exercises. The purpose of this study was to investigate whether t'ai chi practitioners had better attention and memory functions than older people with or without regular exercises. A cross-sectional study examining the relationship between t'ai chi practice and age-, gender- and education-similar older peoples' attention and memory functions. Forty-two (42) community-dwelling elderly subjects, aged 60 or older, recruited from t'ai chi clubs in Hong Kong formed the t'ai chi group. Another 49 elderly having regular exercise habits were recruited from community centers for inclusion in the exercise group. A nonexercise group (normal healthy control) consisting of 44 subjects were also recruited by random selection and through contacting local elderly centers. They were also screened by the Modified Barthel Index, Chinese Mini-mental Status Examination, Geriatric Depression Scale, and evaluated by attention tests (Color Trail Form A-1 and 2) and memory tests (including Rivermead Behavioral Memory Test and The Hong Kong List Learning Test). The main finding was that the three groups differed in attention and memory functions, and the t'ai chi group had demonstrated better performance than the other two groups in most subtests. As a causal relationship cannot be assumed in the present cross-sectional study, future research is required to examine how t'ai chi can improve cognitive function using a randomized control trial as well as determining whether t'ai chi practice can lead to better health status among elderly people.

  9. Augmentation index (AI) in a dose–response relationship with smoking habits in males

    Science.gov (United States)

    Tsuru, Tomoko; Adachi, Hisashi; Enomoto, Mika; Fukami, Ako; Kumagai, Eita; Nakamura, Sachiko; Nohara, Yume; Kono, Shoko; Nakao, Erika; Sakaue, Akiko; Morikawa, Nagisa; Fukumoto, Yoshihiro

    2016-01-01

    Abstract We investigated the relationship between augmentation index (AI) and smoking habits in community-dwelling Japanese. This cross-sectional study enrolled 1926 subjects (769 males and 1157 females) aged 40 to 95 years who underwent a health check-up in a Japanese cohort of the Seven Countries Study, in Tanushimaru, a typical farming town in Kyushu Island in 2009. The subjects’ medical history, alcohol intake, smoking habit, and current medications for hypertension, dyslipidemia, and diabetes were ascertained by questionnaire. Radial arterial pressure wave analysis was used to obtain AI. We analyzed the data stratified by gender. Age-adjusted means of AI in males showed a clear dose–response relationship in 4 categories of smoking habits (P = 0.010). There was no significant relationship between AI and smoking habits in females (P = 0.127). The significant dose–response relationship (P = 0.036) in males between AI and 4 categories of smoking habits still remained even after adjustment for age, body mass index, systolic blood pressure, estimated glomerular filtration rate, glucose, hypertensive medication, and alcohol intake. The present study demonstrated that AI values were significantly associated with smoking habits in a dose-dependent manner in Japanese males. PMID:28002323

  10. Dry eyes and AIs: If you don't ask you won't find out.

    Science.gov (United States)

    Inglis, Holly; Boyle, Frances M; Friedlander, Michael L; Watson, Stephanie L

    2015-12-01

    Our objective was to investigate the hypothesis that women on adjuvant aromatase inhibitors (AIs) for treatment of breast cancer have a higher prevalence of dry eye syndrome (DES) compared with controls. Exposure and control groups were recruited. A cross sectional questionnaire-based study was performed. Demographic data and medical histories were collected. The presence of dry eye syndrome was determined by the ocular surface disease index (OSDI). The Functional Assessment of Cancer Treatment - Endocrine Subscale (FACT-ES) was performed to investigate correlations with other side effects of AIs. 93 exposure group and 100 control group questionnaires were included. The groups were similar in all demographic variables. The prevalence of dry eye syndrome was 35% (exposure) and 18% (control) (p dry eyes. The OSDI score was negatively correlated with the total FACT-ES score and positively correlated with duration of treatment. Our study is the first to use a validated questionnaire to assess for DES in this population. DES is significantly more prevalent in women on AIs compared with controls. This is a newly emerging, and easily treated side effect of AIs. Self-reporting of dry eye symptoms underestimates the prevalence of DES with AIs. We recommend routine screening of patients on AIs with the OSDI with the aim of improving patient quality of life and possibly adherence. Copyright © 2015 Elsevier Ltd. All rights reserved.

  11. Combining AI Methods for Learning Bots in a Real-Time Strategy Game

    Directory of Open Access Journals (Sweden)

    Robin Baumgarten

    2009-01-01

    Full Text Available We describe an approach for simulating human game-play in strategy games using a variety of AI techniques, including simulated annealing, decision tree learning, and case-based reasoning. We have implemented an AI-bot that uses these techniques to form a novel approach for planning fleet movements and attacks in DEFCON, a nuclear war simulation strategy game released in 2006 by Introversion Software Ltd. The AI-bot retrieves plans from a case-base of recorded games, then uses these to generate a new plan using a method based on decision tree learning. In addition, we have implemented more sophisticated control over low-level actions that enable the AI-bot to synchronize bombing runs, and used a simulated annealing approach for assigning bombing targets to planes and opponent cities to missiles. We describe how our AI-bot operates, and the experimentation we have performed in order to determine an optimal configuration for it. With this configuration, our AI-bot beats Introversion's finite state machine automated player in 76.7% of 150 matches played. We briefly introduce the notion of ability versus enjoyability and discuss initial results of a survey we conducted with human players.

  12. Development and Validation of the Alcohol Identity Implicit Associations Test (AI-IAT)

    Science.gov (United States)

    Gray, Heather M.; LaPlante, Debi A.; Bannon, Brittany L.; Ambady, Nalini; Shaffer, Howard J.

    2011-01-01

    Alcohol identity is the extent to which an individual perceives drinking alcohol to be a defining characteristic of his or her self-identity. Although alcohol identity might play an important role in risky college drinking practices, there is currently no easily administered, implicit measure of this concept. Therefore we developed a computerized implicit measure of alcohol identity (the Alcohol Identity Implicit Associations Test; AI-IAT) and assessed its reliability and predictive validity in relation to risky college drinking practices. One hundred forty-one college students completed the AI-IAT. Again 3- and 6-months later, we administered the AI-IAT and indices of engagement in risky college drinking practices. A subset of participants also completed the previously-validated implicit measure of alcohol identity. Scores on the AI-IAT were stable over time, internally consistent, and positively correlated with the previously-validated measure of alcohol identity. Baseline AI-IAT scores predicted future engagement in risky college drinking practices, even after controlling for standard alcohol consumption measures. We conclude that the AI-IAT reliably measures alcohol identity, a concept that appears to play an important role in risky college drinking practices. PMID:21621924

  13. Substituted Benzamides Containing Azaspiro Rings as Upregulators of Apolipoprotein A-I Transcription

    Directory of Open Access Journals (Sweden)

    Bin Hong

    2012-06-01

    Full Text Available Apolipoprotein A-I (Apo A-I is the principal protein component of high density lipoprotein (HDL, which is generally considered as a potential therapeutic target against atherosclerosis. The understanding of the Apo A-I regulation mechanism has fuelled the development of novel HDL targeted therapeutic approaches. To identify novel agents that can upregulate Apo A-I expression, we performed a cell-based reporter assay to screen 25,600 small molecules. Based on the dataset obtained from screening, a series of novel analogs of substituted benzamides containing azaspiro rings were assessed for their ability to induce the transcription of the Apo A-I gene, and the structure-activity relationship (SAR around these analogs was also proposed. The results indicated that the trifluoromethyl substituted benzamide containing an azaspiro ring is a promising backbone for designing Apo A-I transcriptional upregulator and could be viable leads for development of new drugs to prevent and treat atherosclerosis in the future.

  14. The «C» campanian and grey seudocampanian pottery in the province of Seville | La cerámica campaniense «C» y seudocampaniense de pasta gris en la provincia de Sevilla

    Directory of Open Access Journals (Sweden)

    Juan José Ventura Martínez

    1985-12-01

    Full Text Available We want to make a contribution to the study of the Campanian pottery in the Iberian Peninsula. We analyse a lot of this pottery from various sites of the province of Seville, and carry out the study of the C Campanian pottery, and of the grey-paste pottery connected with it, in this area. | El presente estudio pretende ser una contribución al conocimiento de la cerámica campaniense en el ámbito de la Península Ibérica. En base al material reunido, procedente de diversos yacimientos de la provincia de Sevilla, el planteamiento del trabajo ha girado en torno a la documentación efectiva en dicho ámbito provincial tanto de la cerámica campaniense de tipo C como de una serie de cerámicas caracterizadas básicamente por su pasta gris y que en ocasiones, por sus características técnicas, formales o decorativas apuntan a una inspiración más o menos directa en las producciones propiamente campanienses.

  15. EELA Training Activities in Spain

    International Nuclear Information System (INIS)

    Cherubino, C.; Ciuffo, L. N.; Fuentes, A.; Mayo, R.

    2007-01-01

    EELA (E-Infrastructure shared between Europe and Latin America) is a collaboration project between Latin American and European institutions whose aim is to consolidate a shared e-Infrastructure for e-Science applications. Training activities play a crucial role in this scope, providing the necessary skills to the users and allowing them to properly utilize the available grid infrastructure at all levels. This paper highlights the results achieved by the knowledge dissemination task of the project, in particular those obtained in Spain, one of the most active EELA partners. The EELA project is funded by the European Commission under the contract number IST- 2006-026409. (Author)

  16. Acid Deposition Maps in Spain

    International Nuclear Information System (INIS)

    Artinano, B.; Cabal, H.; Garcia, C.

    1998-01-01

    Animal and monthly deposition velocity and total sulfur deposition maps have been performed for the peninsular Spain for 1992 by using the inferential method. To do this, updated databases with high space and time resolution, for land uses (CORINE) and meteorological information from analysis modelling for the same year, have been utilized. The final result are deposition maps in a 5x5 Km 2 grid which allow to assess the methodology used in Europe to obtain the maps of excedances over the critical loads of pollutants. (Author) 32 refs

  17. [Nuclear medicine in Spain: high technology 2013].

    Science.gov (United States)

    Soriano Castrejón, A M; Prats Rivera, E; Alonso Farto, J C; Vallejo Casas, J A; Rodriguez Gasen, A; Setoain Perego, J; Arbizu Lostao, J

    2014-01-01

    This article details the high technology equipment in Spain obtained through a survey sent to the three main provider companies of equipment installed in Spain. The geographical distribution of high technology by Autonomous Communities and its antiquity have been analyzed. Copyright © 2014 Elsevier España, S.L.U. y SEMNIM. All rights reserved.

  18. Spain succeeds on the PWR learning curve

    International Nuclear Information System (INIS)

    Varley, J.

    1982-01-01

    The development of nuclear power in Spain is described. Although the programme has been delayed and cut back, success has been achieved in carrying out technology transfer. Spain now has an industry capable of exporting nuclear components, equipment and expertise. An architect-engineering capability has also developed. (U.K.)

  19. Inspection of nuclear fuel transport in Spain

    International Nuclear Information System (INIS)

    Lobo Mendez, J.

    1977-01-01

    The experience acquired in inspecting nuclear fuel shipments carried out in Spain will serve as a basis for establishing the regulations wich must be adhered to for future transports, as the transport of nuclear fuels in Spain will increase considerably within the next years as a result of the Spanish nuclear program. The experience acquired in nuclear fuel transport inspection is described. (author) [es

  20. Teaching Gender and Geography in Spain

    Science.gov (United States)

    Garcia-Ramon, Maria-Dolors

    2011-01-01

    Since the introduction of gender themes into university teaching in geography in Spain in 1989, significant gains have been made but challenges remain in relation to placing gender into undergraduate curricula and developing teaching resources in local languages. Geographers in Spain have to meet those challenges in the near future in order to…

  1. Marriage strategies among immigrants in Spain

    NARCIS (Netherlands)

    Sánchez-Domínguez, M.; de Valk, H.A.G.; Reher, D.S.

    2011-01-01

    This paper studies patterns of endogamous marriages of immigrants in Spain by using data from the National Immigrant Survey of Spain (2007). First of all, we examine patterns of endogamous marriage and links between migration and marriage. Second, we assess the factors influencing the likelihood of

  2. Spain's marketing sector seeing more changes

    International Nuclear Information System (INIS)

    Anon.

    1992-01-01

    This paper reports that Spain's petroleum marketing sector continues to restructure. Partly state owned Repsol SA and Royal Dutch/Shell Group are discussing supplying each other's retail outlets in the UK and Spain. And Portugal's state owned Petroleos de Portugal (Petrogal), seeking to sharply expand retail operations in Spain, complains of government interference with foreign investment in Spanish marketing. Meantime, Conoco Inc. Has agreed with Saras SpA Raffinerie Sarde, Milan, to set up a network of service stations in northern Spain and Portugal at a cost of 100 billion pesetas (%972 million). The two are considering building an oil terminal at the port city of Gijon in Asturias, Spain, and the Exxon Corp., Total, and Shell are interested in participating in the project

  3. Do adolescent idiopathic scoliosis (AIS neglect proprioceptive information in sensory integration of postural control?

    Directory of Open Access Journals (Sweden)

    Christine Assaiante

    Full Text Available INTRODUCTION: It has been reported that AIS rely much more on ankle proprioception to control the amplitude of the balance control commands as compared to age-matched healthy adolescents. Our hypothesis was that AIS do not neglect proprioceptive information to control posture probably because of their vestibular deficits. We investigated the proprioceptive contribution to postural control in AIS which expresses spinal deformity during a crucial transitional period of ontogenesis. METHODS: 10 adolescents with idiopathic scoliosis (AIS with moderate spinal deformity (10° 35° and 10 control adolescents (CA had to maintain vertical stance while very slow oscillations in the frontal plane (below the detection threshold of the semicircular canal system were applied to the support with the eyes open and closed. Postural orientation and segmental stabilisation were analysed at head, shoulder, trunk and pelvis levels. RESULTS: Scoliosis did not affect vertical orientation control and segmental stabilization strategies. Vision improves postural control in both CA and AIS, which seem more dependent on visual cues than adults. CONCLUSIONS: AIS as CA were unable to control efficiently their postural orientation on the basis of the proprioceptive cues, the only sensory information available in the EC situation, whereas in the same condition healthy young adults present no difficulty to achieve the postural control. This suggests that AIS as CA transitory neglect proprioceptive information to control their posture. These results and previous studies suggest the existence of different afferent pathways for proprioceptive information subserving different parts in sensory integration of postural control. We conclude that the static proprioceptive system is not affected by the idiopathic scoliosis, while the dynamic proprioceptive system would be mainly affected.

  4. AI Reloaded: Objectives, Potentials, and Challenges of the Novel Field of Brain-Like Artificial Intelligence

    Directory of Open Access Journals (Sweden)

    Rosemarie Velik

    2012-11-01

    Full Text Available The general objective of Artificial Intelligence (AI is to make machines – particularly computers – do things that require intelligence when done by humans. In the last 60 years, AI has significantly progressed and today forms an important part of industry and technology. However, despite the many successes, fundamental questions concerning the creation of human-level intelligence in machines still remain open and will probably not be answerable when continuing on the current, mainly mathematic-algorithmically-guided path of AI. With the novel discipline of
    Brain-Like Artificial Intelligence, one potential way out of this dilemma has been suggested. Brain-Like AI aims at analyzing and deciphering the working mechanisms of the brain and translating this knowledge into implementable AI architectures with the objective to develop in this way more efficient, flexible, and capable technical systems This article aims at giving a review about this young and still heterogeneous and dynamic research field.

  5. Thiophenone Attenuates Enteropathogenic Escherichia coli O103:H2 Virulence by Interfering with AI-2 Signaling.

    Science.gov (United States)

    Witsø, Ingun Lund; Valen Rukke, Håkon; Benneche, Tore; Aamdal Scheie, Anne

    2016-01-01

    Interference with bacterial quorum sensing communication provides an anti-virulence strategy to control pathogenic bacteria. Here, using the Enteropathogenic E. coli (EPEC) O103:H2, we showed for the first time that thiophenone TF101 reduced expression of lsrB; the gene encoding the AI-2 receptor. Combined results of transcriptional and phenotypic analyses suggested that TF101 interfere with AI-2 signalling, possibly by competing with AI-2 for binding to LsrB. This is supported by in silico docking prediction of thiophenone TF101 in the LsrB pocket. Transcriptional analyses furthermore showed that thiophenone TF101 interfered with expression of the virulence genes eae and fimH. In addition, TF101 reduced AI-2 induced E. coli adhesion to colorectal adenocarcinoma cells. TF101, on the other hand, did not affect epinephrine or norepinephrine enhanced E. coli adhesion. Overall, our results showed that thiophenone TF101 interfered with virulence expression in E. coli O103:H2, suggestedly by interfering with AI-2 mediated quorum sensing. We thus conclude that thiophenone TF101 might represent a promising future anti-virulence agent in the fight against pathogenic E. coli.

  6. A regulator's viewpoint on the use of AI in the nuclear industry

    International Nuclear Information System (INIS)

    Wainwright, N.

    1995-01-01

    The regulatory position within the UK places the responsibility for safety on a nuclear site with the licensee. The licensee must produce a safety case that demonstrates that the plant is safe. Assessment of this safety case is performed by the regulator in the Health and Safety Executive (HSE) using HSE's published Safety Assessment Principles. This paper presents the personal views of a regulator on the use of artificial intelligence (AI) in the nuclear industry. The AI-based system considered are restricted to expert systems, neural networks and fuzzy logic. Some of the safety issues are discussed. The particular concerns associated with software-based systems are compounded by some of the inherent problems of AI-based systems. Such is the nature of these concerns that an acceptable safety case will be difficult to mount for safety systems and post-accident monitoring systems. However, given the present maturity of the technology, acceptable safety cases might be formulated in the areas of operator advisory systems designed to reduce accident frequencies, and robotics where dose reduction is important. There are also arguments that suggests that suitable safety cases could be formulated for AI-based plant control systems. Nevertheless, AI-based systems should be treated with caution - further research is required into suitable designs and safety demonstration techniques. (author)

  7. Emerging trends in geospatial artificial intelligence (geoAI): potential applications for environmental epidemiology.

    Science.gov (United States)

    VoPham, Trang; Hart, Jaime E; Laden, Francine; Chiang, Yao-Yi

    2018-04-17

    Geospatial artificial intelligence (geoAI) is an emerging scientific discipline that combines innovations in spatial science, artificial intelligence methods in machine learning (e.g., deep learning), data mining, and high-performance computing to extract knowledge from spatial big data. In environmental epidemiology, exposure modeling is a commonly used approach to conduct exposure assessment to determine the distribution of exposures in study populations. geoAI technologies provide important advantages for exposure modeling in environmental epidemiology, including the ability to incorporate large amounts of big spatial and temporal data in a variety of formats; computational efficiency; flexibility in algorithms and workflows to accommodate relevant characteristics of spatial (environmental) processes including spatial nonstationarity; and scalability to model other environmental exposures across different geographic areas. The objectives of this commentary are to provide an overview of key concepts surrounding the evolving and interdisciplinary field of geoAI including spatial data science, machine learning, deep learning, and data mining; recent geoAI applications in research; and potential future directions for geoAI in environmental epidemiology.

  8. A study on the applications of AI in finishing of additive manufacturing parts

    Science.gov (United States)

    Fathima Patham, K.

    2017-06-01

    Artificial intelligent and computer simulation are the technological powerful tools for solving complex problems in the manufacturing industries. Additive Manufacturing is one of the powerful manufacturing techniques that provide design flexibilities to the products. The products with complex shapes are directly manufactured without the need of any machining and tooling using Additive Manufacturing. However, the main drawback of the components produced using the Additive Manufacturing processes is the quality of the surfaces. This study aims to minimize the defects caused during Additive Manufacturing with the aid of Artificial Intelligence. The developed AI system has three layers, each layer is trying to eliminate or minimize the production errors. The first layer of the AI system optimizes the digitization of the 3D CAD model of the product and hence reduces the stair case errors. The second layer of the AI system optimizes the 3D printing machine parameters in order to eliminate the warping effect. The third layer of AI system helps to choose the surface finishing technique suitable for the printed component based on the Degree of Complexity of the product and the material. The efficiency of the developed AI system was examined on the functional parts such as gears.

  9. 7 CFR 319.56-31 - Peppers from Spain.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 5 2010-01-01 2010-01-01 false Peppers from Spain. 319.56-31 Section 319.56-31... from Spain. Peppers (fruit) (Capsicum spp.) may be imported into the United States from Spain only... subpart: (a) The peppers must be grown in the Alicante or Almeria Province of Spain in pest-proof...

  10. 78 FR 6227 - Importation of Fresh Apricots From Continental Spain

    Science.gov (United States)

    2013-01-30

    .... APHIS-2011-0132] RIN 0579-AD62 Importation of Fresh Apricots From Continental Spain AGENCY: Animal and... continental Spain. As a condition of entry, fresh apricots from continental Spain would have to be produced in... organization of Spain certifying that the fruit is free from all quarantine pests and has been produced in...

  11. Superconductivity in Spain. Midas program

    International Nuclear Information System (INIS)

    Yndurain, F.

    1996-01-01

    The different activities in the field of applied superconductivity carried out in Spain under the auspices of the MIDAS program are reported. Applications using both low- and high-temperature superconductors are considered. In the low temperature superconductors case, the design and construction of a 1 mega joule SMES (Superconducting Magnetic Energy Storage) unit, as well as the fabrication of voltage and resistance standards, are reviewed. Developments involving the design and fabrication of an inductive current fault limited and mono- and multi-filamentary wires and tapes using high-temperature superconductors are discussed. Finally, the prospects for the application of superconductivity technology to electric power systems for the electric utilities is considered. (author)

  12. Clinical biochemistry education in Spain.

    Science.gov (United States)

    Queraltó, J M

    1994-12-31

    Clinical biochemistry in Spain was first established in 1978 as an independent specialty. It is one of several clinical laboratory sciences specialties, together with haematology, microbiology, immunology and general laboratory (Clinical analysis, análisis clinicos). Graduates in Medicine, Pharmacy, Chemistry and Biological Sciences can enter post-graduate training in Clinical Chemistry after a nation-wide examination. Training in an accredited Clinical Chemistry department is 4 years. A national committee for medical and pharmacist specialties advises the government on the number of trainees, program and educational units accreditation criteria. Technical staff includes nurses and specifically trained technologists. Accreditation of laboratories is developed at different regional levels. The Spanish Society for Clinical Biochemistry and Molecular Pathology (SECQ), the national representative in the IFCC, has 1600 members, currently publishes a scientific journal (Química Clinica) and a newsletter. It organizes a continuous education program, a quality control program and an annual Congress.

  13. Nuclear insurance problems in Spain

    International Nuclear Information System (INIS)

    Gomez del Campo, Julian.

    1977-01-01

    The purpose of this paper is to study the problems raised in Spain by third party liability insurance for nuclear damage. National law in this field is based on the Paris Convention on nuclear third party liability and defines the conditions of liability of operators of nuclear installations. The insurance contract requirements must comply with the regulations on cover for nuclear risks, under the control of the Finance Ministry's competent services. Certain exceptional nuclear risks which cannot be covered entirely by ordinary insurance policies, are taken over by the Consorcio de Compensacion de Seguros which belongs to this Ministry. From the insurance viewpoint, the regulations make a distinction between nuclear and radioactive installations and nuclear transport. (NEA) [fr

  14. Uranium ore processing in Spain

    International Nuclear Information System (INIS)

    Josa, J.M.

    1976-01-01

    The paper presents a review of the Spanish needs of uranium concentrates and uranium ore processing technology and trends in Spain. Spain produces approximately 200t U 3 O 8 /a at two facilities. One plant in the south (Andujar, Jaen) can obtain 70t U 3 O 8 /a and uses a conventional acid leaching process with countercurrent solvent extraction. A second plant, situated in the west (Ciudad Rodrigo, Salamanca) has started in 1975 and has a capacity of 120-130t U 3 O 8 /a, using acid heap leaching and solvent extraction. There is another experimental facility (Don Benito, Badajoz) scheduled to start in 1976 and expected to produce about 25-35t U 3 O 8 /a as a by-product of the research work. For the near future (1978) it is hoped to increase the production with: (a) A new conventional acid leaching/solvent extraction plant in Ciudad Rodrigo; its tentative capacity is fixed at 550t U 3 O 8 /a. (b) A facility in the south, to recover about 130t U 3 O 8 /a from phosphoric acid. (c) Several small mobile plants (30t U 3 O 8 /a per plant); these will be placed near small and isolated mines. The next production increase (1979-1980) will come with the treatment of sandstones (Guadalajara and Cataluna) and lignites(Cataluna); this is being studied. There are also research programmes to study the recovery of uranium from low-grade ores (heap, in-situ and bacterial leaching) and from other industries. (author)

  15. AI based HealthCare Platform for Real Time, Predictive and Prescriptive Analytics using Reactive Programming

    Science.gov (United States)

    Kaur, Jagreet; Singh Mann, Kulwinder, Dr.

    2018-01-01

    AI in Healthcare needed to bring real, actionable insights and Individualized insights in real time for patients and Doctors to support treatment decisions., We need a Patient Centred Platform for integrating EHR Data, Patient Data, Prescriptions, Monitoring, Clinical research and Data. This paper proposes a generic architecture for enabling AI based healthcare analytics Platform by using open sources Technologies Apache beam, Apache Flink Apache Spark, Apache NiFi, Kafka, Tachyon, Gluster FS, NoSQL- Elasticsearch, Cassandra. This paper will show the importance of applying AI based predictive and prescriptive analytics techniques in Health sector. The system will be able to extract useful knowledge that helps in decision making and medical monitoring in real-time through an intelligent process analysis and big data processing.

  16. Molecular characterization of AI viruses from poultry and wild bird surveillance in Denmark

    DEFF Research Database (Denmark)

    Larsen, Lars Erik; Krog, Jesper Schak; Madsen, Jesper J.

    Infection with avian influenza virus (AIV) in poultry may cause devastating disease although the same virus may not cause disease in wild birds. Since AI viruses can be exchanged between poultry and wild birds, surveillance in wild birds provides important knowledge for control of disease...... in poultry. AIV’s from the Danish wild bird active surveillance were characterized, focusing on viruses from 2012, and from outbreaks of AI in poultry in Denmark. The matrix (M) gene from more than 50 viruses of different subtypes and the hemagglutinin (HA) gene from more than 30 subtype H5 low pathogenic...... viruses were sequenced and compared by alignment and phylogenetic analyses. The aim was to evaluate: the origin of viruses from outbreaks of AI in Danish poultry, the design of active surveillance in Denmark, and the suitability of the molecular diagnostic RT-PCR tests employed. All M-genes from Danish...

  17. An AI-based layout design system for nuclear power plants

    International Nuclear Information System (INIS)

    Fujita, Kikuo; Akagi, Shinsuke; Nakatogawa, Tetsundo; Tanaka, Kazuo; Takeuchi, Makoto.

    1991-01-01

    An AI-based layout design system for nuclear power plants has been developed. The design of the layout of nuclear power plants is a time-consuming task requiring expertise, in which a lot of machinery and equipment must be arranged in a plant building considering various kinds of design constraints, i.e. spatial, functional, economical etc. Computer aided layout design systems have been widely expected and the application of AI technology is expected as a promising approach for the synthesis phase of this task. In this paper, we present an approach to the layout design of nuclear power plants based on a constraint-directed search; one of the AI techniques. In addition, we show how it was implemented with an object-oriented programming technique and give an example of its application. (author)

  18. Past, present and prospect of an Artificial Intelligence (AI) based model for sediment transport prediction

    Science.gov (United States)

    Afan, Haitham Abdulmohsin; El-shafie, Ahmed; Mohtar, Wan Hanna Melini Wan; Yaseen, Zaher Mundher

    2016-10-01

    An accurate model for sediment prediction is a priority for all hydrological researchers. Many conventional methods have shown an inability to achieve an accurate prediction of suspended sediment. These methods are unable to understand the behaviour of sediment transport in rivers due to the complexity, noise, non-stationarity, and dynamism of the sediment pattern. In the past two decades, Artificial Intelligence (AI) and computational approaches have become a remarkable tool for developing an accurate model. These approaches are considered a powerful tool for solving any non-linear model, as they can deal easily with a large number of data and sophisticated models. This paper is a review of all AI approaches that have been applied in sediment modelling. The current research focuses on the development of AI application in sediment transport. In addition, the review identifies major challenges and opportunities for prospective research. Throughout the literature, complementary models superior to classical modelling.

  19. AIS as key component in modern vessel traffic management and information systems

    Energy Technology Data Exchange (ETDEWEB)

    Lamers, W. [DaimlerChrysler Aerospace AG (DASA), Ulm (Germany)

    1999-07-01

    The objective of this paper is to provide information in respect to universal shipborne identification system (UAIS) as main sensor in various vessel traffic applications. The presented paper will give general information concerning AIS functionality and the standardisation process. Based on experience from recent projects and various IALA working group activities, a typical future VTMIS architectures is also presented being based on AIS as key sensor. The required key performance of AIS associated with the HW components will be described. The results from European technology study Indris are presented and discussed. Finally, a summary and conclusion from the presented material will complete the technical paper. The elaboration of this presentation has been carried out as a joint task between Mr. Andre van Berg, MDS Suedafrika und Mr. Walter Lamers, DASA Ulm. (orig.)

  20. Identification of AI-2 Quorum Sensing Inhibitors in Vibrio harveyi Through Structure-Based Virtual Screening.

    Science.gov (United States)

    Jiang, Tianyu; Zhu, Peng; Du, Lupei; Li, Minyong

    2018-01-01

    Quorum sensing (QS) is a cell-to-cell communication system that regulates gene expression as a result of the production and perception of signal molecules called autoinducers (AIs). AI-2 is a QS autoinducer produced by both Gram-negative and Gram-positive bacteria, in which it regulates intraspecies and interspecies communication. The identification of QS inhibitors is considered a promising strategy for the development of anti-virulence drugs with reduced selective pressure for resistance. Here we describe a high-throughput virtual screening approach to identify AI-2 quorum sensing inhibitors on the basis of Vibrio harveyi LuxPQ crystal structure. Seven potent inhibitors with IC 50 values in the micromolar range were selected with no effect or low effect on V. harveyi growth rate.

  1. AI-2 signalling is induced by acidic shock in probiotic strains of Lactobacillus spp

    DEFF Research Database (Denmark)

    Moslehi Jenabian, Saloomeh; Gori, Klaus; Jespersen, Lene

    2009-01-01

    Survival and ability to respond to various environmental stresses such as low pH are important factors for lactobacilli for their function as probiotics. LuxS-mediated quorum sensing mechanism, which is based on the production of universal signal molecule called autoinducer-2 (AI-2), regulates...... important physiological traits and a variety of adaptive processes in different bacteria. The aim of this study was to investigate the effect of acidic stress on LuxS-mediated quorum sensing (AI-2 signalling) in four probiotic strains of different Lactobacillus species. Initially, the production of AI-2...... concomitant with the reduction of pH, reaching maximum at late exponential phase (L. rhamnosus GG) or at stationary phase (L. salivarius UCC118, L. acidophilus NCFM and L. johnsonii NCC533). Acidic shock experiments were conducted on L. rhamnosus GG and L. acidophilus NCFM after exposure to different acidic...

  2. Integration of AI-2 Based Cell-Cell Signaling with Metabolic Cues in Escherichia coli.

    Directory of Open Access Journals (Sweden)

    Arindam Mitra

    Full Text Available The quorum sensing molecule Autoinducer-2 (AI-2 is generated as a byproduct of activated methyl cycle by the action of LuxS in Escherichia coli. AI-2 is synthesized, released and later internalized in a cell-density dependent manner. Here, by mutational analysis of the genes, uvrY and csrA, we describe a regulatory circuit of accumulation and uptake of AI-2. We constructed a single-copy chromosomal luxS-lacZ fusion in a luxS + merodiploid strain and evaluated its relative expression in uvrY and csrA mutants. At the entry of stationary phase, the expression of the fusion and AI-2 accumulation was positively regulated by uvrY and negatively regulated by csrA respectively. A deletion of csrA altered message stability of the luxS transcript and CsrA protein exhibited weak binding to 5' luxS regulatory region. DNA protein interaction and chromatin immunoprecipitation analysis confirmed direct interaction of UvrY with the luxS promoter. Additionally, reduced expression of the fusion in hfq deletion mutant suggested involvement of small RNA interactions in luxS regulation. In contrast, the expression of lsrA operon involved in AI-2 uptake, is negatively regulated by uvrY and positively by csrA in a cell-density dependent manner. The dual role of csrA in AI-2 synthesis and uptake suggested a regulatory crosstalk of cell signaling with carbon regulation in Escherichia coli. We found that the cAMP-CRP mediated catabolite repression of luxS expression was uvrY dependent. This study suggests that luxS expression is complex and regulated at the level of transcription and translation. The multifactorial regulation supports the notion that cell-cell communication requires interaction and integration of multiple metabolic signals.

  3. Synthesized and characterization of AI and Gd substitute ferrite for microwave

    International Nuclear Information System (INIS)

    Sudjono, Hans K.; Muljadi; Soepriyanto, Syony

    2000-01-01

    Ferrite for microwave components has been synthesized from garnet ceramics (YIG)substituted by AI and Gd. Magnetic permeability and magnetic polarization changes according to the AI 3+ ion addition. XRD is performed to determined the sintering products at various temperatures. For some samples the magnetic property and performance in microwave region was tested. The testing is conducted in the form of completely assembled circulator which gives data on isolation, insertion loss when microwave circuit analyzer was employed. Due to high level of porosity insertion lost is still to large, improved process is necessary

  4. An Energy Dense-AI-NaBH4-PEMFC Based Power Generator for Unmanned Undersea Vehicles

    Science.gov (United States)

    2016-03-01

    From- To) 03/01/2016 Final 01/28/2013-12/31/2015 4. TITLE AND SUBTITLE Sa. CONTRACT NUMBER An Energy-Dense AI-NaBH4- PEMFC Based Power Generator for...combination of polymer electrolyte membrane fuel cell ( PEMFC ) with a compact hydrogen generator util izing AI-NaBH4 composite fuel. The conditions...ANSI Std. Z39.18 FLORIDA SOLAR ENERGY CENTER. Crl’nrmg EnPrgy lnrll’pendrnr£’ An Energy-Dense Al-NaBH4- PEMFC Based Power Generator for Unmanned

  5. AIS radiometry and the problem of contamination from mixed spectral orders

    Science.gov (United States)

    Conel, J. E.; Adams, S.; Alley, R. E.; Hoover, G.; Schultz, S.

    1988-01-01

    The spectral radiance of test areas under solar illumination is ascertained in view of Airborne Imaging Spectrometer (AIS) data from Mono Lake, CA, establishing an atmospheric correction method for major absorbers on the basis of the spectrometric data themselves. The apparent low contrast of all atmospheric absorption bands leads to a study of contamination from overlapping spectral orders in the AIS data; this contamination is found unambiguously above 1500 nm with a magnitude that is a factor of 1.5-2.0 greater than the expected uncontaminated signal alone.

  6. Effects of herd origin, AI stud and sire identification on genetic evaluation of Holstein Friesian bulls

    OpenAIRE

    Giovanni Bittante; Paolo Carnier; Luigi Gallo Gallo; Riccardo Dal Zotto; Martino Cassandro

    2010-01-01

    The purpose of this study was to estimate the effects of herd origin of bull, AI stud and sire identification number (ID)  on official estimated breeding values (EBV) for production traits of Holstein Friesian proven bulls. The data included 1,005  Italian Holstein-Friesian bulls, sons of 76 sires, born in 100 herds and progeny tested by 10 AI studs. Bulls were required  to have date of first proof between September 1992 and September 1997, to be born in a herd with at least on...

  7. Oil sector in Spain: Final adaptation

    International Nuclear Information System (INIS)

    Marin-Quemada, J.M.

    1992-01-01

    This paper analyzes organizational and marketing changes occurring in Spain's oil industry as a result of its conversion from a state run monopoly system to a free market system. The analysis uses statistical data to indicate national oil production, import and consumption trends and compares these with overall trends in the European Communities. An explanation of the way in which oil is marketed in Spain makes reference to data on Spain's refining capacity and pipeline network, deemed to be amongst the most complete and modern in Europe. Comments are also made on the efficacy of Spain's national energy policies which stress energy source diversification to lessen this country's heavy dependence on foreign supplied oil

  8. Transfer of nuclear technology from Spain

    International Nuclear Information System (INIS)

    Madrid, G.

    1985-01-01

    Technology transfer from Spain is possible in several fields of nuclear technology ranging from the head end of the fuel cycle (ENUSA) to the back end (ENRESA). The advantages of such a transfer are emphasized

  9. Description of the Energy System of Spain

    Energy Technology Data Exchange (ETDEWEB)

    Caldes, N; Lechon, Y; Labriet, M; Cabal, H; Rua, C de la; Saez, R; Varela, M

    2008-07-01

    The objective of this report is to describe the complete Spain energy system, in order to make possible its modelling with the TIMES model within the NEEDS project (http://www.needs-project.org). (Author) 56 refs.

  10. Kingipaanika, ai, ai, ai! / Mari Rebane

    Index Scriptorium Estoniae

    Rebane, Mari

    2003-01-01

    Jõulukingituseks sobilike raamatute ja heliplaatide tutvustus. Heliplaadid: Urmas Alender "Kohtumine Albertiga", Tõnu Tepandi "Kõlakoda", Pet Shop Boys "Pop Art", Erasure "Very Best Of", Depeche Mode "101", Kylie Minogue "Body Language", Korn "Take a Look in the Mirror", "Once Upon a time in Mexico"

  11. Spain: From massive immigration to vast emigration?

    OpenAIRE

    Izquierdo, Mario; Jimeno, Juan F.; Lacuesta, Aitor

    2016-01-01

    Large immigration flows during the 1995-2007 period increased the weight of foreigners living in Spain to 12 % of the total population. The rapid increase in unemployment associated with the Great Recession and the subsequent European debt crisis, substantially changed migration flows, so that, from the beginning of the 2010s, Spain experienced positive net outflows. In this paper, we take on three tasks. First, we show that sensitivity of migration flows to unemployment is similar between Sp...

  12. The Actual Problems of Modern Spain

    Directory of Open Access Journals (Sweden)

    Natalya E. Anikeeva

    2014-01-01

    Full Text Available The important aim of national and Spanish historiography and political science is to study history and foreign policy of modern Spain. The author studied articles and monographies of spanish politicians and researchers ( M. Rahoy, I. Aries, A. Rubalcaba, I. Molina for the preparation of this article during the scientific trip to Madrid (Complutense University, Faculty of Political Science and Sociology, which was held in the framework of cooperation between the Bank Santander and MGIMO (University. The paper analyzes the political and economic aspects of life in Spain, and its foreign policy of the period of government of Mariano Rajoy (from 2011 to the present time. The article is dedicated to actual problems of modern Spain: the economy and the priorities of the government of M.Rajoy, the problem of separatism and political system of the country. Modern Spain is still recovering economically from the euro debt crisis and continues to struggle with near-record unemployment. Domestic economic recovery of Spain and the country's foreign position are closely linked. The European integration process still remains the main strategic task of the spanish foreign policy. Spain increases its role in world politics and obtains a non-permanent UN's Security Council seat for the 2015-2016 term.

  13. Pathologies of AI: Responsible use of artificial intelligence in professional work

    NARCIS (Netherlands)

    Stamper, R.K.

    1988-01-01

    Although the AI paradigm is useful for building knowledge-based systems for the applied natural sciences, there are dangers when it is extended into the domains of business, law and other social systems. It is misleading to treat knowledge as a commodity that can be separated from the context in

  14. ReACT!: An Interactive Educational Tool for AI Planning for Robotics

    Science.gov (United States)

    Dogmus, Zeynep; Erdem, Esra; Patogulu, Volkan

    2015-01-01

    This paper presents ReAct!, an interactive educational tool for artificial intelligence (AI) planning for robotics. ReAct! enables students to describe robots' actions and change in dynamic domains without first having to know about the syntactic and semantic details of the underlying formalism, and to solve planning problems using…

  15. Grammaire progressive du français niveau intermédiaire

    CERN Document Server

    Grégoire, Maïa

    2017-01-01

    Quatrième édition de l'ouvrage de Grammaire de français langue étrangère (FLE), niveau intermédiaire, dans la collection Progressive du français destiné aux grands adolescents et adultes. Ce qui fait le succès de cet ouvrage de Grammaire: une organisation claire : la leçon de grammaire sur la page de gauche; les exercices d'entraînement sur la page de droite 52 chapitres présentant les points généralement abordés aux niveaux A2 et B1 du Cadre européen commun de référence pour les langues un apprentissage progressif : il suit la progression naturelle des méthodes de français un usage souple : pour la classe ou en auto-apprentissage une préparation adaptée aux certifications : un entreînement efficace pour mieux réussir aux examens NOUVEAU! Appli-web de la Grammaire progressive du français incluse Pour s'entraîner et s'évaluer en ligne en sollicitant toutes les compétences écrites et orales : près de 300 exercices interactifs avec dialogues, instructions, exemples et corrigés ora...

  16. Grammaire progressive du français corrigés : niveau intermédiaire

    CERN Document Server

    Thiévenaz, Odile

    2017-01-01

    Quatrième édition des corrigés de l'ouvrage de Grammaire de français langue étrangère (FLE), niveau intermédiaire, dans la collection Progressive du français destiné aux grands adolescents et adultes. Ce qui fait le succès de cet ouvrage de grammaire: Une organisation claire : la leçon de grammaire sur la page de gauche, les exercices d'entraînement sur la page de droite 52 chapitres présentant les points généralement abordés aux niveaux A2 et B1 du Cadre européen commun de référence pour les langues Un apprentissage progressif : il suit la progression naturelle des méthodes de français Un usage souple : pour la classe ou en auto-apprentissage Une préparation adaptée aux certifications : un entraînement efficace pour mieux réussir aux examens NOUVEAU!​ Appli-Web de la Grammaire progressive du français Pour s'entraîner et s'évaluer en ligne en sollicitant toutes les compétences écrites et orales: près de 300 exercices interactifs avec dialogues, instructions, exemples et corri...

  17. Using Ontological Engineering to Overcome AI-ED Problems: Contribution, Impact and Perspectives

    Science.gov (United States)

    Mizoguchi, Riichiro; Bourdeau, Jacqueline

    2016-01-01

    This article reflects on the ontology engineering methodology discussed by the paper entitled "Using Ontological Engineering to Overcome AI-ED Problems" published in this journal in 2000. We discuss the achievements obtained in the last 10 years, the impact of our work as well as recent trends and perspectives in ontology engineering for…

  18. Fragments of a Forgotten Aiōn. An Outline of a Gnostic Myth

    Directory of Open Access Journals (Sweden)

    Ezio Albrile

    2005-07-01

    Full Text Available Gnostics regard the cosmos as the result of an «error» or of a hybris begotten in the transcendent world. Reality is perceived as a great dream intentionally moulded by the Demiurge in order to forget the Light concealed in the creations. By consequence, the power of the Demiurge consists precisely in being the creator and keeper of a level of existence limited in space and time. Gnostic imagination plastically depicts the homicide and ignorant Demiurge with the features of an abnormous creature with the head of a lion and wings, enveloped in the coils of a snake. Thus, Gnostics reinterpreted a key figure in the syncretic pantheon of late Hellenism, i. e. Aiōn, the god of endless eternity, the Saeculum, the Iranic  Zurwān, the Jewish ‘Olām. This means that Aiōn involved contacts with two different visions: the Aiōnes are the creations that populate the gnostic plērōma, immortal and eternal entities, and outside the plērōma the demiurgic Aiōn arises as the result of a divine «fault», a monstrous being whose somatic features can be found in the Orphic and Mithriac iconography.

  19. Automated calculations for massive fermion production with ai-bar Talc

    International Nuclear Information System (INIS)

    Lorca, A.; Riemann, T.

    2004-01-01

    The package ai-bar Talc has been developed for the automated calculation of radiative corrections to two-fermion production at e + e - colliders. The package uses Diana, Qgraf, Form, Fortran, FF, LoopTools, and further unix/linux tools. Numerical results are presented for e + e - -> e + e - , μ + μ - , bs-bar , tc-bar

  20. Quality Control of Boar Sperm Processing : Implications from European AI Centres and Two Spermatology Reference Laboratories

    NARCIS (Netherlands)

    Riesenbeck, A; Schulze, M; Rüdiger, K; Henning, H; Waberski, D

    In recent years, increased automatization has resulted in a higher efficiency of boar semen processing in AI laboratories. Sophisticated laboratory management and efficient quality control programmes are needed for current tendencies in major pork-producing countries to reduce the sperm number per

  1. The (Dis)appearance of Ai Weiwei: Translations and (In)visibilities

    DEFF Research Database (Denmark)

    Glud, Louise Nørgaard; Stenbøg, Anne Sofie Christensen; Albrechtslund, Anders

    This paper offers a study of surveillance themes relating to Ai Weiwei’s highly discussed disappearance and later reappearance in 2011. Our study is based on an Actor-Network Theory (ANT) approach and we focus on the manifold negotiations and (in)visibilities relating to the dramatic events as well...... as Ai’s artwork and life....

  2. A Comparative Evaluation of Procedural Level Generators in the Mario AI Framework

    DEFF Research Database (Denmark)

    Horn, Britton; Dahlskog, Steve; Shaker, Noor

    dierent from another in terms of its output. To remedy this, we have conducted a large-scale comparative evaluation of level generators for the Mario AI Benchmark, a research-friendly clone of the classic platform game Super Mario Bros. In all, we compare the output of seven dierent level generators from...

  3. Vessel classification features using spatial Bayesian inference from historical AIS data

    CSIR Research Space (South Africa)

    Meyer, Rory GV

    2017-07-01

    Full Text Available Detections and classification of non-AIS-compliant vessels is an important ability for countries or institutions interested in MDA. SAR has been proven to be an effective method but there exists a trade-off between the area that can be imaged...

  4. Trimerization of apolipoprotein A-I retards plasma clearance and preserves antiatherosclerotic properties

    DEFF Research Database (Denmark)

    Graversen, Jonas Heilskov; Laurberg, Jacob Marsvin; Andersen, Mikkel Holmen

    2008-01-01

    An increased plasma level of the major high-density lipoprotein (HDL) component, apolipoprotein A-I (apoA-I) is the aim of several therapeutic strategies for combating atherosclerotic disease. HDL therapy by direct intravenous administration of apoA-I is a plausible way; however, a fast renal...

  5. The (Dis)appearance of Ai Weiwei: Translations and (In)visibilities

    DEFF Research Database (Denmark)

    Stenbøg, Sofie; Nørgaard Glud, Louise; Albrechtslund, Anders

    2013-01-01

    This paper offers a study of surveillance themes relating to Ai Weiwei’s highly discussed disappearance and later reappearance in 2011. Our study is based on an Actor-Network Theory (ANT) approach and we focus on the manifold negotiations and (in)visibilities relating to the dramatic events as well...... as Ai’s artwork and life....

  6. Prediction of shipboard electromagnetic interference (EMI) problems using artificial intelligence (AI) technology

    Science.gov (United States)

    Swanson, David J.

    1990-08-01

    The electromagnetic interference prediction problem is characteristically ill-defined and complicated. Severe EMI problems are prevalent throughout the U.S. Navy, causing both expected and unexpected impacts on the operational performance of electronic combat systems onboard ships. This paper focuses on applying artificial intelligence (AI) technology to the prediction of ship related electromagnetic interference (EMI) problems.

  7. Secondhand Tobacco Smoke Exposure and Lung Adenocarcinoma In Situ/Minimally Invasive Adenocarcinoma (AIS/MIA).

    Science.gov (United States)

    Kim, Claire H; Lee, Yuan-Chin Amy; Hung, Rayjean J; Boffetta, Paolo; Xie, Dong; Wampfler, Jason A; Cote, Michele L; Chang, Shen-Chih; Ugolini, Donatella; Neri, Monica; Le Marchand, Loic; Schwartz, Ann G; Morgenstern, Hal; Christiani, David C; Yang, Ping; Zhang, Zuo-Feng

    2015-12-01

    The aim of this study was to estimate the effect of exposure to secondhand tobacco smoke on the incidence of lung adenocarcinoma in situ/minimally invasive adenocarcinoma (AIS/MIA). Data from seven case-control studies participating in the International Lung Cancer Consortium (ILCCO) were pooled, resulting in 625 cases of AIS/MIA and 7,403 controls, of whom 170 cases and 3,035 controls were never smokers. Unconditional logistic regression was used to estimate adjusted ORs (ORadj) and 95% confidence intervals (CI), controlling for age, sex, race, smoking status (ever/never), and pack-years of smoking. Study center was included in the models as a random-effects intercept term. Ever versus never exposure to secondhand tobacco smoke was positively associated with AIS/MIA incidence in all subjects (ORadj = 1.48; 95% CI, 1.14-1.93) and in never smokers (ORadj = 1.45; 95% CI, 1.00-2.12). There was, however, appreciable heterogeneity of ORadj across studies (P = 0.01), and the pooled estimates were largely influenced by one large study (40% of all cases and 30% of all controls). These findings provide weak evidence for an effect of secondhand tobacco smoke exposure on AIS/MIA incidence. Further studies are needed to assess the impact of secondhand tobacco smoke exposure using the newly recommended classification of subtypes of lung adenocarcinoma. ©2015 American Association for Cancer Research.

  8. Cognitive Maps, AI Agents and Personalized Virtual Environments in Internet Learning Experiences.

    Science.gov (United States)

    Maule, R. William

    1998-01-01

    Develops frameworks to help Internet media designers address end-user information presentation preferences by advancing structures for assessing metadata design variables which are then linked to user cognitive styles. An underlying theme is that artificial intelligence (AI) methodologies may be used to help automate the Internet media design…

  9. LE RACCOMANDAZIONI SERVONO? MORAL SUASION SULLA GEO-LOCALIZZAZIONE PER SERVIZI AI CITTADINI

    Directory of Open Access Journals (Sweden)

    Mauro Salvemini

    2014-12-01

    Full Text Available Con modestia, ma con determinazione AMFM GIS Italia ha inteso esercitare la suafunzione di entità non governativa elaborando nell'anno in corso nove raccomandazioni circa LA GEO-LOCALIZZAZIONE COME ELEMENTO UNIFICANTE DELLE AZIONI E DELLE INFORMAZIONI PER I SERVIZI AI CITTADINI.

  10. Autonomously generating operations sequences for a Mars Rover using AI-based planning

    Science.gov (United States)

    Sherwood, Rob; Mishkin, Andrew; Estlin, Tara; Chien, Steve; Backes, Paul; Cooper, Brian; Maxwell, Scott; Rabideau, Gregg

    2001-01-01

    This paper discusses a proof-of-concept prototype for ground-based automatic generation of validated rover command sequences from highlevel science and engineering activities. This prototype is based on ASPEN, the Automated Scheduling and Planning Environment. This Artificial Intelligence (AI) based planning and scheduling system will automatically generate a command sequence that will execute within resource constraints and satisfy flight rules.

  11. Campus 3 méthode de français

    CERN Document Server

    Pécheur, Jacques; Molinié, Muriel

    2003-01-01

    Méthode de français pour grands adolescents et adultes sur 3 niveaux. Ce niveau comprend : un livre de l'élève, un cahier d'exercices, un livre du professeur, une vidéo, des cassettes audio collectives au CD, et pour l'élève : une cassette audio individuelle ou CD.

  12. NASA space station automation: AI-based technology review. Executive summary

    Science.gov (United States)

    Firschein, O.; Georgeff, M. P.; Park, W.; Cheeseman, P. C.; Goldberg, J.; Neumann, P.; Kautz, W. H.; Levitt, K. N.; Rom, R. J.; Poggio, A. A.

    1985-01-01

    Research and Development projects in automation technology for the Space Station are described. Artificial Intelligence (AI) based technologies are planned to enhance crew safety through reduced need for EVA, increase crew productivity through the reduction of routine operations, increase space station autonomy, and augment space station capability through the use of teleoperation and robotics.

  13. 142 Perspective Actionelle Visa-a-Vis L'enseignement du Français ...

    African Journals Online (AJOL)

    NGOZI

    29 avr. 2010 ... Français Langue Entrangele au Nigeria : Problem et. Vision. Scholastica .... La langue est conçue comme un instrument de communication et ... langue est un outil fournissant une base commune pour l'enseignement et ...

  14. Studies on Anti-Hepatoma Effect of Gan-Ai-Xiao Decoction | Yuan ...

    African Journals Online (AJOL)

    Purpose: To explore the anti-hepatoma effect of Gan-Ai-Xiao Decoction (GAXD), a folk remedy. Methods: High performance liquid chromatography (HPLC) was used to identify the major chemical components of GAXD ethanol extract (EE). The cytotoxic effect of GAXD EE against HepG2 cells was measured by methyl ...

  15. Lexique Pove–Français/Français– Pove, Mickala Manfoumbi ...

    African Journals Online (AJOL)

    rbr

    Français/Français–. Pove (Mickala Manfoumbi 2004) fait par Mavoungou (2005). En dehors des réserves sur les ques- tions purement lexicographiques, l'ouvrage de Mickala Manfoumbi suscite des interrogations inté- ressantes qui dépassent le ...

  16. Vers l'integration des textes dans le programme du fran9ais langue ...

    African Journals Online (AJOL)

    Au Malawi, on enseigne le fran9ais en tant que langue etrangere depuis une quarantaine d'annees .... !'organisation institutionnelle du systeme educatif du Malawi, le palier secondaire en ... Les objectifs du type : rediger une lettre, decrire une .... nouveau (rheme). Charolles souligne qu'il s'agit d'une performance delicate.

  17. The Simulation of a Major Automated Information System (AIS) on a Microcomputer

    Science.gov (United States)

    1984-03-01

    The AIS would be selected from a public zec cor application. Rationale for this choice are: a. Many public sector organizations have a far richer...19. Boehm, Barry W. and others, Characteristics of Software Quality, North-Holland, 1978. 20. Freeman, Peter and Wasserman, Anthony I., Tutorial on

  18. AI-2 signalling is induced by acidic shock in probiotic strains of Lactobacillus spp.

    Science.gov (United States)

    Moslehi-Jenabian, Saloomeh; Gori, Klaus; Jespersen, Lene

    2009-11-15

    Survival and ability to respond to various environmental stresses such as low pH are important factors for lactobacilli for their function as probiotics. LuxS-mediated quorum sensing mechanism, which is based on the production of universal signal molecule called autoinducer-2 (AI-2), regulates important physiological traits and a variety of adaptive processes in different bacteria. The aim of this study was to investigate the effect of acidic stress on LuxS-mediated quorum sensing (AI-2 signalling) in four probiotic strains of different Lactobacillus species. Initially, the production of AI-2-like molecule was investigated in four strains of Lactobacillus spp. at standard growth conditions using Vibrio harveyi bioluminescence assay. Species variation in AI-2 activity was observed. AI-2 activity started at early-exponential growth phase and increased during the mid-exponential phase concomitant with the reduction of pH, reaching maximum at late exponential phase (L. rhamnosus GG) or at stationary phase (L. salivarius UCC118, L. acidophilus NCFM and L. johnsonii NCC533). Acidic shock experiments were conducted on L. rhamnosus GG and L. acidophilus NCFM after exposure to different acidic shocks (pH 5.0, 4.0 and 3.0) and to pH 6.5 as control, measuring AI-2 activity and transcription of the luxS gene. AI-2 activity increased by lowering the pH in a dose dependent manner and was negatively influenced by acid adaptation. In both species, the luxS gene was repressed after exposure to pH 6.5 as control. However, after acidic shock (pH 4.0) a transient response of luxS gene was observed and the transcription augmented over time, reaching a maximum level and decreased subsequently. Acid adaptation of cells attenuated the transcription of this gene. Based on the observations done in the present study, the luxS gene appears to have a clear role in acidic stress response in probiotic lactobacilli. This might be important in the survival of these bacteria during the passage

  19. Spain and the Hamas government

    Directory of Open Access Journals (Sweden)

    Ignacio Álvarez-Ossorio Alvariño

    2007-12-01

    Full Text Available Since the restoration of democracy, Spain’s successive governments have been noted for their favourable stance toward the issue of Palestine and their support for the creation of a sovereign independent state in the territories that Israel occupied during the Six-Day War. Yasser Arafat’s visit to Spain in the time of the UCD, the holding of the Madrid Conference during the term of government of the PSOE and the designation of Miguel Ángel Moratinos as the EU’s special envoy for the Peace Process during the Partido Popular’s term of government are some of the landmarks that have expressed this exemplary relationship between the Spanish State and the Palestine question. However, the victory of Hamas in the legislative elections of 25 January 2006 radically changed the situation, as it led to Rodríguez Zapatero’s government joining the international boycott of the new Islamist executive; even so, the Spanish government clearly maintained its support for restarting the Peace Process, in the form of its backing for Mahmud Abbas, the President of the Palestine Authority. The armed conflict in Gaza in June 2007 which led to the Islamists retaking the Gaza Strip and the formation of a new government in the West Bank led by the technocrat Salam Fayad served to normalise the situation, given that it encouraged the raising of international sanctions and a return to normality in Spanish-Palestine relations.

  20. NDT performance demonstration in Spain

    International Nuclear Information System (INIS)

    Bollini, G.J.

    1994-01-01

    The experience obtained from the in-service inspection of reactor pressure vessels (RPV) of Spanish nuclear power plants and the participation in several international programs, such as PISC, has shown the need for a performance demonstration, not only for the ultrasonic inspection techniques of RPV, but also for other ISI non-destructive techniques as in the case of eddy current inspection of steam generator tubing. Section XI of the ASME Code, which is applied in Spain for ISI, has incorporated recently the Appendix VIII for performance demonstration of ultrasonic inspection techniques. As a direct consequence of this, a Spanish project for performance demonstration of ultrasonic inspection techniques has been launched recently, which includes the manufacturing of full-scale mock-ups of nozzle to vessel welds, reactor vessel welds, wrought austenitic piping welds and ferritic piping welds of PWR and BWR nuclear power plants from different suppliers. This considerable technical effort will let the different Spanish organizations which are part of the project to participate and colaborate with similar international projects and in particular with a European initiative for performance demonstration. (Author)

  1. Quality and safety in Spain

    International Nuclear Information System (INIS)

    Prieto Barrio, J. M.; Martinez Martin, D. J.

    2015-01-01

    For three decades, and after the entry of Spain into the EU, it has been developed a regulatory, stable but evolving, framework that has allowed to create the conditions and structures to have stringent safety conditions of products and manufacturing facilities, as well as all the activities necessary for their certification and control. This development has been possible, among others, by the work of impulse and coordination of the Ministry of industry, Energy and Tourism, and particularly of the quality and Industrial safety sub directorate. On the other hand it has been developed a quality infrastructure that has, at the State level, with a standardisation (AENOR) entity and an accreditation body (ENAC) with recognized prestige around the world. In this article, in the first part, a list the regulations which apply to products and manufacturing facilities is shown, as well as explain the role played by standards and accreditation system in industrial safety and the factor of competitiveness that this entails for our industrial sector, and, in the second part, the institutional role of the Ministry and, the aforementioned Sub directorate, is described. The aim of the article is to be a descriptive reference of the current regulatory framework as well as the role of the State in this process. (Author)

  2. Climate index for Spain - Methodology

    International Nuclear Information System (INIS)

    2006-01-01

    According to the U.S. Department of Energy, an estimated 25% of the GNP is affected by weather-related events. The variations in temperature - even small ones - can also have long-lasting effects on the operational results of a company. Among other, the Energy supply sector is sensitive to weather risks: a milder or harsher than usual winter leads to a decrease or increase of energy consumption. The price of electricity on power trading facilities like Powernext is especially sensitive to odd changes in temperatures. Powernext and Meteo-France (the French meteorological agency) have joined expertise in order to promote the use of weather indices in term of decision making or underlying of hedging tools to energy actors, end users from any other sector of activity and specialists of the weather risk hedging. The Powernext Weather indices are made from information collected by Meteo-France's main observation network according to the norms of international meteorology, in areas carefully selected. The gross data are submitted to a thorough review allowing the correction of abnormalities and the reconstitution of missing data. Each index is fashioned to take into account the economic activity in the various regions of the country as represented by each region's population. This demographic information represents a fair approximation of the weight of the regional economic activity. This document presents the calculation methodology of average, minimum and maximum weather indexes with the winter and summer regression equations for the different economical regions of Spain. (J.S.)

  3. Uranium mining operations in Spain

    International Nuclear Information System (INIS)

    Rios, J.-M.; Arnaiz, J.; Criado, M.; Lopez, A.

    1995-01-01

    The Empresa Nacional del Uranio, SA (ENUSA) was founded in 1972 to undertake and develop the industrial and procurement activities of the nuclear fuel cycle in Spain. Within the organisation of ENUSA, the Uranium Division is directly responsible for the uranium mining and production operations that have been carried out since 1973 in the area of Ciudad Rodrigo in the province of Salamanca. These activities are based on open pit mining, heap leaching and a hydrometallurgical plant (Elefante) for extracting uranium concentrates from the ore. This plant was shut down in 1993 and a new plant was started up on the same site (Quercus) with a dynamic leaching process. The nominal capacity of the new plant is 950 t U 3 O 8 per year. Because of the historically low uranium prices which have recently prevailed, the plant is currently running at a strategic production rate of 300 t U 3 O 8 per year. From 1981 to 1990, in the area of La Haba (Badajoz province), ENUSA also operated a uranium production site, based on open pit mining, and an experimental extraction plant (Lobo-G). ENUSA is currently decommissioning these installations. This paper describes innovations and improvements that ENUSA has recently introduced in the field of uranium concentrates production with a view to cutting production costs, and to improving the decommissioning and site restoration processes in those sites where production is being shut down or resources have been worked out. (author)

  4. Appreciative Inquiry and Autonomy-Supportive Classes in Business Education: A Semilongitudinal Study of AI in the Classroom

    Science.gov (United States)

    Conklin, Thomas A.; Hartman, Nathan S.

    2014-01-01

    In this article, we describe 10 separate classroom experiences where an appreciative inquiry (AI) exercise was used for course creation. Post-exercise surveys of students showed that the AI exercise was perceived to be a successful practice. Students indicated putting effort toward reaching their peak learning experience and were satisfied with…

  5. English Learners (ELs) Who Are American Indian and/or Alaska Native (AI/AN). Fast Facts

    Science.gov (United States)

    Office of English Language Acquisition, US Department of Education, 2016

    2016-01-01

    The Office of English Language Acquisition (OELA) has synthesized key data on English learners (ELs) into two-page PDF sheets, by topic, with graphics, plus key contacts. The topics for this report on English Learners (ELs) Who Are American Indian and/or Alaska Native (AI/AN) include: (1) States With the Highest Percentage of ELs Who Were AI/AN:…

  6. Purification and Characterization of BmooAi: A New Toxin from Bothrops moojeni Snake Venom That Inhibits Platelet Aggregation

    Directory of Open Access Journals (Sweden)

    Mayara Ribeiro de Queiroz

    2014-01-01

    Full Text Available In this paper, we describe the purification/characterization of BmooAi, a new toxin from Bothrops moojeni that inhibits platelet aggregation. The purification of BmooAi was carried out through three chromatographic steps (ion-exchange on a DEAE-Sephacel column, molecular exclusion on a Sephadex G-75 column, and reverse-phase HPLC chromatography on a C2/C18 column. BmooAi was homogeneous by SDS-PAGE and shown to be a single-chain protein of 15,000 Da. BmooAi was analysed by MALDI-TOF Spectrometry and revealed two major components with molecular masses 7824.4 and 7409.2 as well as a trace of protein with a molecular mass of 15,237.4 Da. Sequencing of BmooAi by Edman degradation showed two amino acid sequences: IRDFDPLTNAPENTA and ETEEGAEEGTQ, which revealed no homology to any known toxin from snake venom. BmooAi showed a rather specific inhibitory effect on platelet aggregation induced by collagen, adenosine diphosphate, or epinephrine in human platelet-rich plasma in a dose-dependent manner, whereas it had little or no effect on platelet aggregation induced by ristocetin. The effect on platelet aggregation induced by BmooAi remained active even when heated to 100°C. BmooAi could be of medical interest as a new tool for the development of novel therapeutic agents for the prevention and treatment of thrombotic disorders.

  7. AI-2 does not function as a quorum sensing molecule in Campylobacter jejuni during exponential growth in vitro

    NARCIS (Netherlands)

    Holmes, K.; Tavender, T.J.; Winzer, K.; Wells, J.; Hardie, K.

    2009-01-01

    Background - Campylobacter jejuni contains a homologue of the luxS gene shown to be responsible for the production of the signalling molecule autoinducer-2 (AI-2) in Vibrio harveyi and Vibrio cholerae. The aim of this study was to determine whether AI-2 acted as a diffusible quorum sensing signal

  8. Download and multiply sharing robot minds and bodies over the Web could take AI to the next level

    CERN Multimedia

    Graham-Rowe, D

    2002-01-01

    Some AI researchers believe progress is being held back because the problems are too great for any individual group to solve alone. They have suggested that instead of just publishing results in journals, AI software and robots should be made available across the Internet and accessible even to complete novices (1 page).

  9. Rétrospective de la diffusion du français en Espagne

    Directory of Open Access Journals (Sweden)

    Isabelle Cros

    2014-12-01

    Full Text Available Le français bénéficia longtemps en Espagne d’une vieille tradition francophile et de la forte implantation de l’Alliance française. Ainsi, il prédomina dans le système éducatif espagnol jusqu’au milieu du 20ème siècle sans intervention de l’État français pour en assurer la diffusion. Son déclin, amorcé sous Franco, nécessita toutefois la mise en place d’une politique linguistique et éducative compensatoire qui aboutit à un premier accord bilatéral favorisant surtout le développement de l’enseignement en français au sein du réseau de la Mission laïque mais qui eut peu d’effets à l’école espagnole où le français fut relégué au rang de deuxième langue étrangère. Cependant, suite à son adhésion à l’Europe, l’Espagne a recréé, en partenariat avec la France, une dynamique pour le français, notamment grâce aux sections bilingues qui connaissent un succès croissant. La langue française, considérée à présent davantage comme une langue utile, de communication et de travail, est enseignée suivant une méthodologie communicative plus adaptée aux réalités socio-économiques.

  10. Ship Emission Inventories in Estuary of the Yangtze River Using Terrestrial AIS Data

    Directory of Open Access Journals (Sweden)

    Xin Yao

    2016-12-01

    Full Text Available Estuary forms a transition zone between inland river and open sea. In China, the estuary of the Yangtze River plays a vital role in connecting the inland and oversea shipping, and witnesses heavy vessel traffic in the recent decades. Nowadays, more attentions have been directed to the issue of ship pollution in busy waterways. In order to investigate the ship emission inventory, this paper presents an Automatic Identification System(AIS based method. AIS data is the realistic data of vessel traffic including dynamic information (position, speed, course, etc. and static information (ship type, dimensions, name, etc.. According to ship dimensions, the power of engines is estimated for different ship types. By using AIS based bottom-up approach, ship emission inventories and shares of air pollutants and GHGs (Greenhouse gases are developed. Spatial distribution of ship emissions is illustrated in the form of heat map. As a case study, the emission inventories are analyzed using AIS data of 2010 in the estuary, and following results are made:(1 shares of the emission are cruise ships 6.59%, bulk carriers 5.16%, container ships 52.96%, tankers 15.16%, fishing ships 9.16%, other ships 10.97%; (2 CO2 is the dominant part of the emission. (3 Areas of highest emission intensity are generally clustered around the South Channel, the North Channel and ports in the vicinity. The proposed method is promising because it is derived from the AIS data which contains not only real data of individual ship but also vessel traffic situation in the study area. It can server as a reference for other researchers and policy makers working in this field.

  11. An artificial intelligence (AI) NOx/heat rate optimization system for Ontario Hydro`s fossil generating stations

    Energy Technology Data Exchange (ETDEWEB)

    Luk, J.; Frank, A.; Bodach, P. [Ontario Hydro, Toronto, ON (Canada); Warriner, G. [Radian International, Tucker, GA (United States); Noblett, J. [Radian International, Austin, TX (United States); Slatsky, M. [Southern Company, Birmingham, AL (United States)

    1999-08-01

    Artificial intelligence (AI)-based software packages which can optimize power plant operations that improves heat rate and also reduces nitrogen oxide emissions are now commonly available for commercial use. This paper discusses the implementation of the AI-based NOx and Heat Rate Optimization System at Ontario Hydro`s generation stations, emphasizing the current AI Optimization Project at Units 5 and 6 of the Lakeview Generating Station. These demonstration programs are showing promising results in NOx reduction and plant performance improvement. The availability of the plant Digital Control System (DCS) in implementing AI optimization in a closed-loop system was shown to be an important criterion for success. Implementation of AI technology at other Ontario Hydro fossil generating units as part of the overall NOx emission reduction system is envisaged to coincide with the retrofit of the original plant control system with the latest DCS systems. 14 refs., 3 figs.

  12. Training courses on radiation protection organized by the radioisotopes service of the University of Sevilla (Spain); Curos de formacion en proteccion radiologica organizados por el servicio de raioisotopos de la universidad de sevilla. Espana

    Energy Technology Data Exchange (ETDEWEB)

    Mateos, J. C.; Avalos, J.; Garcia-Leon, M.; Garcia-Tenorio, R.; Gomez-Puerto, A.; Gomez, M.; Herrador, M-; Lejeune, J.; Luis-simon, J.; Marquez, A.; Maranon, J.; Respaldiza, M. A.; Sanchez-Angulo, C.; Sanchez-Doblado, F.; Sarmiento, J. M.

    2003-07-01

    The University of Sevilla (Spain) through its Radioisotope Service has been organizing bi annually since 1995 Training courses for Supervisors and Operators of Radioactive Installations for university investigators that use radioactive sources or radiation equipment. The courses are imparted by professors from the university radioactive installations, hospital physicist specialists from medical physics services and medical doctors from prevention labour health service. The students are postgraduate students or professors that need operate, with ionising radiation in their research laboratories. Up to date, it has been organized 4 courses series with an average of 30 students per course. The courses are homologated by the Nuclear Security Council and let the student obtain the license for Supervisors or Operators of Radioactive Installations in each of the following applications fields. a) Laboratories with Non-Encapsulated Sources. This application includes research activities in Biology, Chemistry, Physics, Medicine and Pharmacy. b) Radiation Generator Equipment. This last one includes equipment such as X-Ray apparatus for diffraction studies in physics chemistry and art sciences, or Particle Accelerator for atomic physics research in the National Accelerator Centre. The practical sessions of the courses are imparted in the radioactive installations of the Seville university. In this study it is described the details of the organization of the courses. (Author) 4 refs.

  13. GC/MS in the study of deterioration process of historical monuments: characterization of the black crust formed in the Cathedral of Seville; GC/MS en el estudio del proceso de deterioro de monumentos historicos: caracterizacion de la costra negra presente en la Catedral de Sevilla

    Energy Technology Data Exchange (ETDEWEB)

    Reyes, J. [Programa de Corrosion del Golfo de Mexico. Universidad Autonoma de Campeche. Av. Agustin Melgar s/n, Campeche (Mexico); Hermosin, B.; Saiz J, C. [Instituto de Recursos Naturales y Agrobiologia de Sevilla. Avenida de la Reina Mercedes 10. Sevilla, Espana (Spain)]. e-mail: javreyes@uacam.mx

    2006-07-01

    Here, we present an interesting application of Gas Chromatography/Mass Spectrometry (GC/MS) technique which permitted to differentiate successfully between natural and anthropogenic compounds present in the black crust formed in the Cathedral of Seville. This building, considered as one of the most important historic and cultural European monuments suffers from intense blackening of its outside walls and sculptures due to the interaction with the urban environment. Fragment of black crusts were removed from the Cathedral walls and extraction process with organic solvents was carried out. The aliphatic, aromatic and polar fractions were separated and analyzed using GC/MS. A complex organic composition of the black crusts indicated the accumulative character of the deposition process of atmospheric particles as a function of the time. The presence of high molecular weight n-alkanes, n-fatty acids and natural molecular markers identified during the study were indicative of current biogenic contributions. It was also found an important group of petrogenic molecular markers related with diesel soot emissions from motor engines. The diesel soot and molecular markers were entrapped within the black crust mineral matrix and contribute to the observed blackening of the Seville Cathedral. (Author)

  14. The relevance of "Santa Pudia" calcarenite: a natural stone to preserve heritage buildings in Andalusia (Spain)

    Science.gov (United States)

    Navarro, Rafael; Molina, Eduardo; Baltuille, José Manuel

    2013-04-01

    "Santa Pudia" calcarenite, extracted in quarries from Granada (Andalusia, Spain), is a very important ornamental stone used in some of the main historical buildings in Andalusia, and particularly in the city of Granada. It has been used mainly outdoors with structural purposes (ashlars, columns), but is also used as decorative element in façades, pinnacles, etc. There are two main quarries, one historical ("Las Parideras") and another one currently under exploitation ("La Escribana"). Both were the source for all the material to make the different cited elements. Some of the main historical buildings using this stone in their construction, in one way or other, are the cathedral, The Royal Chapel, the Royal Hospital, San Juan de Dios monastery, the Royal Chancery or Carlos V Palace in the Alhambra, all of them in the city of Granada. In recent days, this natural stone has been used in the restoration of the Mosque of Córdoba and the Cinco Llagas Hospital in Seville. Although the main reference in industry for this natural stone is "Calcarenita de Santa Pudia", it can be found as well cited in the old literature under the denomination of "Piedra Franca". From a geological point of view is a white to yellow calcarenite, part of the Tortonian deposits of the Guadalquivir Basin (Post-Orogenic Neogene Basins of the Betic Chains). It's made up mainly by micritic matrix of calcite, with fragments of bioclasts (about 90%) including molluscs, echinoderms, briozoan, red algae and foraminifera. Other components, like metamorphic quartz, moscovite and/or schist or gneiss (rock fragments from the nearby metamorphic basement), can be found as well. The rock is poorly cemented with sparitic calcite. Regarding the main physical and mechanical properties, this rock has an open porosity between 25-36%, bulk density of 1,74 g/cm3, water absorption values at atmospheric pressure of 16%, compressive strength (dry) of 11 MPa, flexural strength (dry) of 2,3 MPa and salt crystallization

  15. A modelling case study to evaluate control strategies for ozone reduction in Southwestern Spain

    Science.gov (United States)

    Castell, N.; Mantilla, E.; Salvador, R.; Stein, A. F.; Millán, M.

    2009-09-01

    Ozone is a strong oxidant and when certain concentrations are reached it has adverse effects on health, vegetation and materials. With the aim of protecting human health and ecosystems, European Directive 2008/50/EC establishes target values for ozone concentrations, to be achieved from 2010 onwards. In our study area, located in southwestern Spain, ozone levels regularly exceed the human health protection threshold defined in the European Directive. Indeed, this threshold was exceeded on 92 days in 2007, despite the fact that the Directive stipulates that it should not be exceeded on more than 25 days per calendar year averaged over three years. It is urgent, therefore, to reduce the current ozone levels, but because ozone is a secondary pollutant, this reduction must necessarily involve limiting the emission of its precursors, primarily nitrogen oxides (NOx) and volatile organic compounds (VOC). During the central months of the year, southwestern Spain is under strong insolation and weak synoptic forcing, promoting the development of sea breezes and mountain-induced winds and creating re-circulations of pollutants. The complex topography of the area induces the formation of vertical layers, into which the pollutants are injected and subjected to long distance transport and compensatory subsidence. The characteristics of these highly complex flows have important effects on the pollutant dispersion. In this study two ozone pollution episodes have been selected to assess the ozone response to reductions in NOx and VOC emissions from industry and traffic. The first corresponds to a typical summer episode, with the development of breezes in an anticyclonic situation with low gradient pressure and high temperatures, while the second episode presents a configuration characteristic of spring or early summer, with a smooth westerly flow and more moderate temperatures. Air pollution studies in complex terrain require the use of high-resolution models to resolve the complex

  16. University Teacher’s Evaluation in Spain

    Directory of Open Access Journals (Sweden)

    Francisco Javier Tejedor Tejedor

    2008-08-01

    Full Text Available This article intends to make a brief overview about the performance evaluation for university teachers in democratic Spain. It contents: a considerations about teaching evaluation, in order to delimit the authors’ position in this matter, due to the fact that this position obviously conditions any revision; b a brief summary of the history of university teachers evaluation in Spain during the last years, since the Spanish Constitution of 1978 approval; c a typology of the evaluation plans, in order to define a map of the planning lines for evaluations applied in Spain; d the technical guidelines for teachers´ evaluation and presentation of the current model, exampled by its application in the university of Salamanca; and e as a conclusion, some considerations about the consequences of evaluation and its entailment with the professionalization of university teachers.

  17. Transparency and Good Governance in Spain

    Directory of Open Access Journals (Sweden)

    Catalina Larach

    2015-06-01

    Full Text Available Nowadays, transparency and Governance are relevant for Spain. Especially, for the dissatisfied citizenship and the weakness in national and local institutions over the last few years, with results like not trusting, less guarantee on healthcare and education system, the corruption in public administration, politics-economic issues, and so on. Although, in the European Union, Spain has been one of the last countries to regulate this issue, whit Act 19/2013 there are new objectives relating to open government, citizenship, technology, accountability. Moreover in relation with the structure of administration because the “commission for transparency and good governance” was initiated on last 19th January. In general, its effectiveness in moderating this issue and applying measures in order to get administration systems cleaner in countries like Spain.

  18. 9-cis-retinoic acid increases apolipoprotein AI secretion and mRNA expression in HepG2 cells.

    Science.gov (United States)

    Haghpassand, M; Moberly, J B

    1995-10-01

    HepG2 cells were studied as a model for regulation of hepatic apolipoprotein AI (apo AI) secretion and gene expression by 9-cis-retinoic acid. HepG2 cells cultured on plastic dishes were exposed to 9-cis-retinoic acid (9-cis-RA) for 48 h with a complete media change at 24 h. Apo AI mass in cultured media was determined by ELISA, by quantitative immunoblotting and by steady-state 35S-methionine labeling. Messenger RNA levels were determined by RNase protection using probes for apo AI and the housekeeping gene, glyceraldehyde 3-phosphate dehydrogenase (G3PDH). 9-cis-RA increased secretion of apo AI by 52% at doses of 10 and 1 microM (6.3 +/- 0.6 vs. 4.2 +/- 0.3; P G3PDH mRNA was slightly decreased (14%, P < 0.05). Thus, 9-cis-RA stimulates apo AI expression in HepG2 cells, suggesting a role for retinoids in activating endogenous apo AI gene expression.

  19. Microstructural studies of suck cast (Zr-SS)-3 and 5 AI alloys for nuclear metallic waste form

    International Nuclear Information System (INIS)

    Kumar, P.; Das, N.; Sengupta, P.; Arya, A.; Dey, G.K.

    2015-01-01

    Management of radioactive metallic waste using 'alloy melting route' is currently being investigated. For disposal of Zr and SS base nuclear metallic wastes, Zr-stainless steel (SS) hybrid alloys are being considered as baseline alloys for developing metallic-waste-form (MWF) alloys. In this context Zr-16 wt. %55 has been selected for MWF alloy in our previous study. In present study, to include amorphous phase in this alloy, 3 and 5 wt. % Al has been added in order to improve desirable properties and useful features of MWF and the two alloys have been prepared by suck casting techniques. Microstructure of these alloys have been investigated by optical and electron microscopy which shows occurrence of two different phases, e.g. dark grey and white phases, in (Zr-16 SS)-3 Al and three different phases, e.g. grey, dark grey and white phases in (Zr-16 SS)-5 AI. Electron diffraction and X-ray diffraction (XRD) analyses of these two alloy specimens revealed the occurrence of Zr (Fe, Cr, AI) (dark grey) and Zr 2 (Fe, Cr, AI) (white) phases in (Zr-16 SS)-3 Al whereas, Zr (Fe, Cr, AI) (dark grey), Zr 2 (Fe, Cr, AI) (grey) and Zr 3 (Fe, Cr, AI) (white) phases were found in (Zr-16 SS)-5 AI. In addition, presence of amorphous phase was indicated by XRD analysis that could be confirmed by transmission electron microscopy of these two alloys. (author)

  20. Taxation of nuclear waste in Spain

    OpenAIRE

    Rozas Valdés, José Andrés

    2014-01-01

    Law 15/2012 established in Spain four new environmental taxes and extended the scope objective excise duties on mineral oils to tax the use of natural gas and coal as sources of electricity. One of the newly created taxes falls on all electric power producers, and has as tax base the turnover. The second one tax hydropower production, and the other two fall on the nuclear industry. So, there are two new taxes in Spain on the production of electricity from nuclear sources. The first one is a t...

  1. Formal Safety Assessment (FSA for Analysis of Ship Collision Using AIS Data

    Directory of Open Access Journals (Sweden)

    Muhammad Badrus Zaman

    2015-03-01

    Full Text Available Currently, Maritime safety is the best issue in the world. International Maritime organization (IMO have recommended FSA methodology to enhance maritime safety. In this paper, the research conducted in the Malacca Strait. Malacca Strait is an area that has a high risk for shipping navigation. Many accidents occur in the area are like collision, fire, grounding and so on. Therefore a study on improving safety in this area is very important. it is to produce an output that can be used to provide input to the master and multiple stakeholders to improve safety on board at the time of sailing. In this study, AIS is used as a data source. Sea condition data collected actual traffic through the Automatic Identification System (AIS equipment installed at Kobe University, Japan, and Universiti Teknologi Malaysia (UTM in Johor, Malaysia. The data is applied to define a method with the help of Geographic Information Systems (GIS.

  2. Development of X-ray diffractometers XD-D1 AI qualitative analysis system

    International Nuclear Information System (INIS)

    Arai, Hiroshi; Uota, Atsushi; Ishida, Hidenobu

    1994-01-01

    Qualitative X-ray diffraction is a very important analytical method, however, it is also very difficult to perform and needs some special skills. Also, the analysis accuracy depends on the operators' knowledge of qualitative analysis. In order that even a beginner analyst can obtain accurate results, we have developed the 'XD-D1 AI Qualitative Analysis System'. This system can support analytical operations with the experts' knowledge made available by AI techniques. Systematizing the experts' knowledge, we applied the system to our expert shell 'GENZO-I/PRO'. This system enabled a beginner analyst to get the same results as a specialist would get. In this paper, we will describe the process of system design, system construction and an example analysis. (author)

  3. Polychronous Zirconology of Navysh Volcanics of the Ai Formation (Southern Urals)

    Science.gov (United States)

    Krasnobaev, A. A.; Puchkov, V. N.; Sergeeva, N. D.

    2018-01-01

    In order to resolve the age of Navysh volcanics (NV), which is usually attributed to the Lower Riphean of the Ai Formation, we have used geochronological, petrologic, and mineralogical methods of zirconology, apart from the SHRIMP isotopic data of single zircon grains. Moreover, TIMS isotope age analyses have been conducted, the results of which can be regarded as both controlling and providing the most correct information. The TIMS and SHRIMP data make it possible to suggest a polychronous character of the NV, which include not only Riphean, but also Paleozoic groups of volcanics. In this situation, an assessment of the scales of such polychroneity of NV and, correspondingly, of the Ai Formation as a whole becomes urgent.

  4. S&T converging trends in dealing with disaster: A review on AI tools

    International Nuclear Information System (INIS)

    Hasan, Abu Bakar; Isa, Mohd Hafez Mohd.

    2016-01-01

    Science and Technology (S&T) has been able to help mankind to solve or minimize problems when arise. Different methodologies, techniques and tools were developed or used for specific cases by researchers, engineers, scientists throughout the world, and numerous papers and articles have been written by them. Nine selected cases such as flash flood, earthquakes, workplace accident, fault in aircraft industry, seismic vulnerability, disaster mitigation and management, and early fault detection in nuclear industry have been studied. This paper looked at those cases, and their results showed nearly 60% uses artificial intelligence (AI) as a tool. This paper also did some review that will help young researchers in deciding the types of AI tools to be selected; thus proving the future trends in S&T

  5. S&T converging trends in dealing with disaster: A review on AI tools

    Science.gov (United States)

    Hasan, Abu Bakar; Isa, Mohd. Hafez Mohd.

    2016-01-01

    Science and Technology (S&T) has been able to help mankind to solve or minimize problems when arise. Different methodologies, techniques and tools were developed or used for specific cases by researchers, engineers, scientists throughout the world, and numerous papers and articles have been written by them. Nine selected cases such as flash flood, earthquakes, workplace accident, fault in aircraft industry, seismic vulnerability, disaster mitigation and management, and early fault detection in nuclear industry have been studied. This paper looked at those cases, and their results showed nearly 60% uses artificial intelligence (AI) as a tool. This paper also did some review that will help young researchers in deciding the types of AI tools to be selected; thus proving the future trends in S&T.

  6. A photometric and spectroscopic study of the early-type binary AI Crucis

    International Nuclear Information System (INIS)

    Bell, S.A.; Kilkenny, D.; Malcolm, G.J.

    1987-01-01

    New Stroemgren photometry and medium-dispersion spectroscopy of the early-type eclipsing binary AI Cru are presented. The masses and radii of the two components are found to be (9.8 +-0.5) and (5.8 +-0.3) solar masses and (4.9 +- 0.1) and (4.4 +- 0.1) solar radii, respectively. The semi-detached nature of the system is confirmed and by comparison with stationary models by previous authors it is shown that AI Cru has probably passed through the rapid phase of Case A mass transfer. It is suggested that the original system may have had a period of about 1.3 day and that the roles of the current primary and secondary components were at that time reversed. (author)

  7. S&T converging trends in dealing with disaster: A review on AI tools

    Energy Technology Data Exchange (ETDEWEB)

    Hasan, Abu Bakar, E-mail: abakarh@usim.edu.my; Isa, Mohd Hafez Mohd. [Faculty of Science and Technology, Universiti Sains Islam Malaysia, 71800 Nilai, Negeri Sembilan (Malaysia)

    2016-01-22

    Science and Technology (S&T) has been able to help mankind to solve or minimize problems when arise. Different methodologies, techniques and tools were developed or used for specific cases by researchers, engineers, scientists throughout the world, and numerous papers and articles have been written by them. Nine selected cases such as flash flood, earthquakes, workplace accident, fault in aircraft industry, seismic vulnerability, disaster mitigation and management, and early fault detection in nuclear industry have been studied. This paper looked at those cases, and their results showed nearly 60% uses artificial intelligence (AI) as a tool. This paper also did some review that will help young researchers in deciding the types of AI tools to be selected; thus proving the future trends in S&T.

  8. New progress of FEM simulation and AI application in rolling at RAL

    International Nuclear Information System (INIS)

    Liu Xianghua; Wang Guodong; Zhao Kun

    2000-01-01

    New progresses on FEM simulation and AI application in rolling have been achieved at RAL recently. The existence and uniqueness of the extreme point of total functional for rolling problem has been proved. Different rolling processes, such as H-beam rolling, ribbing strip rolling, slab sizing, have been solved by our in-house FEM software package. The simulation results have been put into production use to improve the precision of math models. The Artificial Neural Network has been used to predict rolling force, coiling temperature, microstructure and properties of the rolled products. An expert system for deviation diagnoses of strip thickness has been developed for industry use. Synergetic Artificial Intelligence has also been applied to rolling scheduling. We are making continuous efforts to develop AI applications for rolling line co-operating in China steel industry. (author)

  9. LE FRANÇAIS DANS LA PRESSE ECRITE DU NORD-CAMEROUN : DIAGNOSTIC, CRITIQUES ET ORIENTATIONS

    Directory of Open Access Journals (Sweden)

    Moïse MBEY MAKANG

    2013-11-01

    Full Text Available La présente réflexion tire son origine de la crise linguistique observée au sein de la presse écrite du Nord-Cameroun. Celle-ci fait échos des irrégularités de la langue de Voltaire dans la presse écrite de cette partie du pays. De plus en plus, on y assiste à une émergence des déviances syntaxiques et une profusion des écarts langagiers à connotation dépréciative. L’indécence verbale de la société, la mauvaise prestation des élèves en classe et lors des examens officiels en sont des indicateurs pertinents. Il est important de mentionner que la cohabitation entre les langues camerounaises et le français, la sous-scolarisation et ou l’ignorance, le laxisme des rédacteurs en chef, etc. sont les mobiles profonds de cette incorrection. Pourtant, nous savons tous que les media sont une forteresse où la langue doit être préservée de toute entorse et représentent un modèle pour la société. Néanmoins, des traits caractéristiques du français de la presse écrite du Nord-Cameroun s’inscrivent en faux par rapport à cette vocation naturelle des media. Dès lors, la question que nous pouvons nous poser est celle de savoir si ces mobiles ci-dessus cités sont des éléments qui favorisent l’émergence de cette dialectalisation du français. En clair qu’est-ce qui caractérise le français des journalistes? Quelle est la structure morphosyntaxique du français des rédacteurs des journaux? S’agit-il d’un français conforme à une norme locale ou (y retrouvons-nous des énoncés exogènes ? Quel type de morphosyntaxe utilisent les rédacteurs ? Une morphosyntaxe endogène, morphosyntaxe qui leur est propre, ou plutôt une morphosyntaxe exogène, supposée unique à tous les francophones ? Peut-on parler d’alternance codique, d’argotisation, ou de créolisation ? La présente analyse a pour ambitions de s’interroger sur les mobiles profonds qui incitent des journalistes à s’écarter de la norme du français

  10. 75 FR 51113 - Chlorinated Isocyanurates From China and Spain

    Science.gov (United States)

    2010-08-18

    ... Isocyanurates From China and Spain AGENCY: United States International Trade Commission. ACTION: Scheduling of... and Spain. SUMMARY: The Commission hereby gives notice of the scheduling of expedited reviews pursuant... revocation of the antidumping duty orders on chlorinated isocyanurates from China and Spain would be likely...

  11. 78 FR 32184 - Importation of Fresh Apricots From Continental Spain

    Science.gov (United States)

    2013-05-29

    .... APHIS-2011-0132] RIN 0579-AD62 Importation of Fresh Apricots From Continental Spain AGENCY: Animal and... United States of fresh apricots from continental Spain. This action will allow interested persons... importation of fruits and vegetables to allow the importation of fresh apricots from continental Spain into...

  12. 48 CFR 252.229-7005 - Tax exemptions (Spain).

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Tax exemptions (Spain... of Provisions And Clauses 252.229-7005 Tax exemptions (Spain). As prescribed in 229.402-70(e), use the following clause: Tax Exemptions (Spain) (JUN 1997) (a) The Contractor represents that the...

  13. 78 FR 32183 - Importation of Avocados From Continental Spain

    Science.gov (United States)

    2013-05-29

    .... APHIS-2012-0002] RIN 0579-AD63 Importation of Avocados From Continental Spain AGENCY: Animal and Plant... continental Spain (excluding the Balearic Islands and Canary Islands) into the United States. This action will... avocados from continental Spain (excluding the Balearic Islands and Canary Islands) into the United States...

  14. The Singularity, or How I Learned to Stop Worrying and Love AI

    OpenAIRE

    Bishop, Mark (J. M.)

    2015-01-01

    Professor Stephen Hawking recently warned about the growing power of Artificial Intelligence (AI) to imbue robots with the ability to both replicate them- selves and to increase the rate at which they get smarter - leading to a tipping point or ‘technological singularity’ when they can outsmart humans. In this chapter I will argue that Hawking is essentially correct to flag up an existential danger surrounding widespread deployment of ‘autonomous machines’, but wrong to be so concerned about ...

  15. Feeding Supplementation And Radioimmunoassay (RIA) Technique For The Improvement Of artificial Insemination (AI) Efficiency

    International Nuclear Information System (INIS)

    Tjiptosumirat, Totti; Supandi, Dadang; Firsoni

    2002-01-01

    Recent research activities have showed that RIA techniques may be use as a tool in the improvement of dairy cattle AI in . Cisurupan district, Garut. Although already indicate in the previous research, with a small number of dairy cattle tested, a more in depth study on the utilization of RIA for the improvement of AI efficiency is still required. It is indicated from the previous experiment results that administration of feeding supplementation might improved the efficiency of reproductive performance of dairy cattle. The current Study is a continuation from the previous study with a larger number of dairy cattle and wider area covered. The experiment is aimed to monitor the impact of feeding supplementation on the reproductive performance of dairy cattle using Artificial Insemination Database Application (AIDA) and RIA technique. Result from this study indicated that feeding supplementation improved conception rate between pre-supplemented and post-supplemented dairy cattle; 25% vs 40%, respectively, therefore improve ratio of Service per Conception of 4.0 vs 2.3, respectively for pre-supplemented and post-supplemented dairy cattle. Result of this experiment also showed that RIA might be use as an effective tool in monitoring the early failure of AI compared to if just relying on the conventional method, the rectal palpation. However, due to an increase in milk production as a result of feeding supplementation, tanners tend to lengthen the lactation period from 10.20 ± 0.5 months to 11.8 ± 0.6 months, respectively in dairy cattle pre-supplemented and post-supplemented. It can be conclude from this study that supplementation feeding improve reproductive performance. However, even AIDA and RIA may be of effective tool in monitoring the reproductive performance of dairy cattle, as an holistic approach for an improvement dairy farm management is still required due to other factors play important role for AI efficiency

  16. Des résumés en français

    Directory of Open Access Journals (Sweden)

    Bogdan Patrut

    2010-09-01

    Full Text Available Des résumés en français
    BRAIN. Broad Research in Artificial Intelligence and Neuroscience
    CERVEAU. Recherche large en intelligence artificielle et neurosciences
    Volume 1, Numéro 4
    Juillet 2010: « Automne 2010»
    www.brain.edusoft.ro
    Sous la direction de: Bogdan Pătruţ

  17. Administration of a luteolytic dose of PGF2α at the time of AI

    Directory of Open Access Journals (Sweden)

    G. Neglia

    2010-02-01

    Full Text Available The aim of this study was to verify if the administration of a luteolytic dose of PGF2α at the time of AI is able to anticipate ovulation and, hence, to increase fertility rate. Furthermore, the presence of a “farm effect” was also evaluated. The trial was performed in two commercial farms (A and B located in Caserta on 584 buffaloes (Farm A: n=389; Farm B: n=195, synchronized by the Ovsynch-TAI Program. In each farm buffaloes were divided in two groups: treated group (n=181 and n=95, respectively in farms A and B received an intramuscular injection of 0.524 mg cloprostenol (Estrumate®, Schering-Plough Animal health, S.p.A., Milan, Italy at the time of AI while control group (n=208 and n=100 received an intramuscular injection of physiologic saline (0.9% NaCl. No differences were present with regard to the number of AI/subject, in terms of pregnancy rate and ovulation rate between treated and control groups. It is worth pointing out that the control group in farm A showed a higher (P<0.01 conception rate compared to the control group in farm B (46.15 vs. 30.00. Furthermore, within farm B buffaloes treated by cloprostenol on the day of AI showed higher (P<0.01 pregnancy rate vs. animals that received saline (51.58% vs. 30.00%. These results suggest that if fertility in control group is high, treatment by cloprostenol does not affect pregnancy rate and ovulation rate.

  18. Citadels AI

    OpenAIRE

    Pekárek, Jakub

    2015-01-01

    The aim of this thesis is to implement a playable version of the game Citadels with console interface, and to use it for analysis of the game's properties and development of artificial intelligence. This thesis includes an analysis of strategies, a scheme for their design, an organization of turn processing, a model of intelligence implementation and testing tools. A number of approaches to specific moves have been developed, all of which achieved positive impact on overall intelligence perfo...

  19. LE CINÉMA FRANÇAIS EN ROUMANIE DANS L’ENTRE-DEUX-GUERRES

    Directory of Open Access Journals (Sweden)

    Georgiana MEDREA

    2013-05-01

    Full Text Available Avant même d’aborder la nature des films français importés en Roumanie dans l’entre-deux-guerres, il convient de situer cette production cinématographique dans l’ensemble de celles présentes sur le marché roumain, ce que permettent documents et articles critiques contemporains. La diversité des mises en scène et des acteurs, la variété des sujets traités plaisent à un large public. La plus grande place que connaît le cinéma français en Roumanie dans les années trente est sans doute due,également, à la présence, dans le monde cinématographique français, d’artistes roumains qui manifestent un souci d’intégration dans une culture d’accueil qu’ils admirent. Les exemplesde coopérations franco-roumaines sont nombreuses, jusqu’à se manifester parfois sous la forme de coproductions

  20. Application of Artificial Intelligence (AI) Programming Techniques to Tactical Guidance for Fighter Aircraft

    Science.gov (United States)

    McManus, John W.; Goodrich, Kenneth H.

    1989-01-01

    A research program investigating the use of Artificial Intelligence (AI) techniques to aid in the development of a Tactical Decision Generator (TDG) for Within-Visual-Range (WVR) air combat engagements is discussed. The application of AI methods for development and implementation of the TDG is presented. The history of the Adaptive Maneuvering Logic (AML) program is traced and current versions of the AML program are compared and contrasted with the TDG system. The Knowledge-Based Systems (KBS) used by the TDG to aid in the decision-making process are outlined in detail and example rules are presented. The results of tests to evaluate the performance of the TDG versus a version of AML and versus human pilots in the Langley Differential Maneuvering Simulator (DMS) are presented. To date, these results have shown significant performance gains in one-versus-one air combat engagements, and the AI-based TDG software has proven to be much easier to modify than the updated FORTRAN AML programs.

  1. Technological differences between açai and juçara pulps and their sorbets

    Directory of Open Access Journals (Sweden)

    Ana Paula Silva Siqueira

    2017-11-01

    Full Text Available Abstract Açai and juçara are palm trees that produce similar fruits. However, only the sale of açai is growing on the market for pulps and processed products for human consumption. The aim of this study was to compare açai and juçara pulps from the chemical, bioactive, rheological and technological points of view. Sorbets were elaborated with the pulps and evaluations were carried out regarding the antioxidant activity, polyphenols, anthocyanins, pH, acidity, soluble solids, ratio and colour. The pulps were evaluated rheologically and the sorbets for melting time. Juçara showed better results regarding the bioactive parameters (antioxidants ≈ 151 uM ferrous sulphate/ g and anthocyanins ≈ 77 mg.100g-1 and presented a more intense colour (Chroma 17. The pulps were physicochemically similar. The sorbet preserved much of the nutrients and presented a very intense colour, mainly in the juçara sorbet.

  2. Goldfish Leptin-AI and Leptin-AII: Function and Central Mechanism in Feeding Control

    Directory of Open Access Journals (Sweden)

    Ai-Fen Yan

    2016-05-01

    Full Text Available In mammals, leptin is a peripheral satiety factor that inhibits feeding by regulating a variety of appetite-related hormones in the brain. However, most of the previous studies examining leptin in fish feeding were performed with mammalian leptins, which share very low sequence homologies with fish leptins. To elucidate the function and mechanism of endogenous fish leptins in feeding regulation, recombinant goldfish leptin-AI and leptin-AII were expressed in methylotrophic yeast and purified by immobilized metal ion affinity chromatography (IMAC. By intraperitoneal (IP injection, both leptin-AI and leptin-AII were shown to inhibit the feeding behavior and to reduce the food consumption of goldfish in 2 h. In addition, co-treatment of leptin-AI or leptin-AII could block the feeding behavior and reduce the food consumption induced by neuropeptide Y (NPY injection. High levels of leptin receptor (lepR mRNA were detected in the hypothalamus, telencephalon, optic tectum and cerebellum of the goldfish brain. The appetite inhibitory effects of leptins were mediated by downregulating the mRNA levels of orexigenic NPY, agouti-related peptide (AgRP and orexin and upregulating the mRNA levels of anorexigenic cocaine-amphetamine-regulated transcript (CART, cholecystokinin (CCK, melanin-concentrating hormone (MCH and proopiomelanocortin (POMC in different areas of the goldfish brain. Our study, as a whole, provides new insights into the functions and mechanisms of leptins in appetite control in a fish model.

  3. ai Palm Fruit (Euterpe oleracea Mart.) Pulp Improves Survival of Flies on a High Fat Diet

    OpenAIRE

    Sun, Xiaoping; Seeberger, Jeanne; Alberico, Thomas; Wang, Chunxu; Wheeler, Charles T.; Schauss, Alexander G.; Zou, Sige

    2010-01-01

    Reducing oxidative damage is thought to be an effective aging intervention. Açai, a fruit indigenous to the Amazon, is rich in phytochemicals that possesses high anti-oxidant activities, and has anti-inflammatory, anti-cancer and anti-cardiovascular disease properties. However, little is known about its potential anti-aging properties especially at the organismal level. Here we evaluated the effect of açai pulp on modulating lifespan in Drosophila melanogaster. We found that açai supplementat...

  4. Balzac peint les français: social satire and construction of ideal types in Les français peints par eux-mêmes.

    Directory of Open Access Journals (Sweden)

    Marilisa Moccia

    2017-02-01

    Full Text Available Tra il 1840 e il 1842, negli stessi anni in cui prendeva forma quella che sarà di lì a poco la Comédie Humaine, furono dati alle stampe nove volumi dell’opera Les Français peints par eux-mêmes, pubblicata da Léon Curmer. L’opera vide la collaborazione di disegnatori e scrittori fra i quali Honoré de Balzac che contribuì al progetto scrivendo due voci l’épicier e la femme comme il faut. Les Français peints par eux-mêmes, definito nel sottotitolo Encyclopédie morale du XIXe siècle, è uno dei maggiori esempi di «letteratura panoramica», come ebbe a definirla Walter Benjamin (Benjamin 1979, e vi si mescolano caricatura e determinismo fisiologico impiegati per ritrarre, e non semplicemente descrivere, i tipi umani e sociali che popolano Parigi e la Provincia. L’introduzione di Léon Curmer e Jules Janin colloca il progetto globale dell’opera sotto l’etichetta di «tableau», già utilizzata da Louis-Sébastien Mercier (Mercier 1782, della società contemporanea messa al servizio della storia dei costumi. Da un lato, il dispositivo umoristico dell’opera scatena dall’idea di classificare gli uomini, svuotati della loro soggettività e degradati a tipi sociali, al pari delle specie animali e vegetali, ricalcando e “scoronando”, dunque, l’intento normalizzante dell’Enciclopedia dei lumi. Per questo motivo, la mise en page (ogni voce dell’opera è strutturata in type, tête de page, cul de lampe, contribuisce a creare un transtesto (Genette 1997, che stringe l’occhio al lettore del tempo, nutrito dalle opere di Buffon e Cuvier.  Dall’altro, però, l’intento dichiaratamente “serio” dell’opera che deve occuparsi di spiegare, con intento pedagogico e attraverso l’escamotage dell’autoritratto, i francesi ai Francesi, suggerisce una seconda ipotesi: la società tutta è risibile perché ridicola è la borghesia del regno di Luigi Filippo. Il contributo si propone di indagare il tipo di satira che

  5. Food-related life style in Spain

    DEFF Research Database (Denmark)

    Bredahl, Lone; Brunsø, Karen; Grunert, Klaus G.

    1996-01-01

    Executive summary 1. This report contains the main results of a survey of food-related lifestyle in Spain, based on a representative sample of 1000 Spanish households. 2. Generally speaking, Spanish food consumers are very interested in shopping for food and cooking. Compared with other European ...

  6. Wind turbines in Spain: la vuelta

    International Nuclear Information System (INIS)

    Jeanson, E.; Trancart, M.

    2000-01-01

    Ten years ago it was just the beginning of the wind industry in Spain. Today it takes the third place in Europe and the fourth in the world. The pilot regions are the Galicia and the Navarre. (A.L.B.)

  7. Border Disease Virus among Chamois, Spain

    Science.gov (United States)

    Rosell, Rosa; Cabezón, Oscar; Mentaberre, Gregorio; Casas, Encarna; Velarde, Roser; Lavín, Santiago

    2009-01-01

    Approximately 3,000 Pyrenean chamois (Rupicapra pyrenaica pyrenaica) died in northeastern Spain during 2005–2007. Border disease virus infection was identified by reverse transcription–PCR and sequencing analysis. These results implicate this virus as the primary cause of death, similar to findings in the previous epizootic in 2001. PMID:19239761

  8. Prospects of spent management in Spain

    International Nuclear Information System (INIS)

    Melches, C.; Ramirez, E.; Selgas, F.; Cabanilles, P.A.; Lopez Perez, B.; Uriarte, A.

    1978-01-01

    The purpose of this paper is to outline the forecast on spent fuel management in Spain, taking into account the international developments produced during the last years and specially on LWR fuels. This forecast is based on the following actions: increase of the storage capacity in the reactors: construction of an independent spent fuel storage installation (ISFSI) and a fuel reprocessing pilot plant. (author)

  9. The water footprint of tourism in Spain

    NARCIS (Netherlands)

    Cazcarro, I.; Hoekstra, Arjen Ysbert; Sánchez Chóliz, J.

    2014-01-01

    This study complements the water footprint (WF) estimations for Spain, incorporating insights of the process analysis and input–output (IO) analysis. We evaluate the virtual (both blue and green consumed) water trade of agricultural and industrial products, but also of services, especially through

  10. Chinese migration in Spain. General characteristics

    Directory of Open Access Journals (Sweden)

    Amelia Sáiz López

    2005-01-01

    Full Text Available In this paper the Chinese presence in Spain is analyzed from a chronological perspective along with the ongoing changes in geographic location and economic activity. The growth in numbers of this community has obliged its members to look for new locations, distancing themselves from their ethnic strongholds, with the aim of bringingtheir migratory plans to fruition.

  11. Road accidents and business cycles in Spain.

    Science.gov (United States)

    Rodríguez-López, Jesús; Marrero, Gustavo A; González, Rosa Marina; Leal-Linares, Teresa

    2016-11-01

    This paper explores the causes behind the downturn in road accidents in Spain across the last decade. Possible causes are grouped into three categories: Institutional factors (a Penalty Point System, PPS, dating from 2006), technological factors (active safety and passive safety of vehicles), and macroeconomic factors (the Great recession starting in 2008, and an increase in fuel prices during the spring of 2008). The PPS has been blessed by incumbent authorities as responsible for the decline of road fatalities in Spain. Using cointegration techniques, the GDP growth rate, the fuel price, the PPS, and technological items embedded in motor vehicles appear to be statistically significantly related with accidents. Importantly, PPS is found to be significant in reducing fatal accidents. However, PPS is not significant for non-fatal accidents. In view of these results, we conclude that road accidents in Spain are very sensitive to the business cycle, and that the PPS influenced the severity (fatality) rather than the quantity of accidents in Spain. Importantly, technological items help explain a sizable fraction in accidents downturn, their effects dating back from the end of the nineties. Copyright © 2016 Elsevier Ltd. All rights reserved.

  12. [Tuberculosis and immigration in Spain: scoping review].

    Science.gov (United States)

    Casals, Martí; Rodrigo, Teresa; Camprubí, Esteve; Orcau, Angels; Caylà, Joan A

    2014-01-01

    Immigration is a fairly recent phenomenon in Spain and there are still few scientific publications on tuberculosis (TB) and immigration. Therefore, the aim of this study is to describe the differential characteristics of TB in the immigrant population with respect to natives in Spain. Literature review of original articles written in Spanish or English and published 1998-2012 about TB among immigrant population. The articles with the key words "Tuberculosis", "immigrants" and "Spain" were included. Literature search was performed in Medline and MEDES. A total of 72,087 articles on TB were detected worldwide, 6% of them dealt with the immigration issue. Regarding Spain we found 2,917 articles representing 4% of the papers published worldwide, and in 219 (7.5%) immigration was considered. Of the 219 articles, 48% were published in Spanish journals and the 52% remaining in Anglo-Saxon journals. 93.5% of immigrants with TB were younger than 51, whereas this percentage was 64.9% in natives. Drug resistance can be seen in 7.8% of the immigrant population but in only 3.8% of natives. It was also detected that the unavailability of a health card could be a problem. Immigrants with TB were characterized by being younger and having more drug resistance and coming mostly from Latin America, Eastern Europe, Africa and Asia. It was also detected that the unavailability of a health card could be a problem.

  13. Does Education Affect Happiness? Evidence for Spain

    Science.gov (United States)

    Cunado, Juncal; de Gracia, Fernando Perez

    2012-01-01

    In this paper we study the impact of education on happiness in Spain using individual-level data from the European Social Survey, by means of estimating Ordinal Logit Models. We find both direct and indirect effects of education on happiness. First, we find an indirect effect of education on happiness through income and labour status. That is, we…

  14. ITER site selection studies in Spain

    International Nuclear Information System (INIS)

    Medrano, M.; Alejaldre, C.; Doncel, J.; Garcia, A.; Ibarra, A.; Jimenez, J.A.; Sanchez de Mora, M.A.; Alcala, F.; Diez, J.E.; Dominguez, M.; Albisu, F.

    2003-01-01

    The studies carried out to evaluate and select a candidate site for International Thermonuclear Experimental Reactor (ITER) construction in Spain are presented in this paper. The ITER design, completed in July 2001, considered a number of technical requirements that must be fulfilled by the selected site. Several assumptions concerning the ITER site were made in order to carry on the design before final site selection. In the studies undertaken for ITER site selection in Spain, the referred technical requirements and assumptions were applied across the whole of Spain and two areas were identified as being preferential. These areas are on the Mediterranean coast and are situated in the Catalan and Valencian regions. A comparative evaluation based on technical characteristics for the concrete plots, proposed within the preferential areas, has been done. The result of these studies was the selection of a site that was deemed to be the most competitive--Vandellos (Tarragona)--and it was proposed to the European Commission for detailed studies in order to be considered as a possible European site for ITER construction. Another key factor for hosting ITER in Spain, is the licensing process. The present status is summarised in this paper

  15. Economic crisis and nursing in Spain.

    Science.gov (United States)

    Zabalegui, Adelaida; Cabrera, Esther

    2010-07-01

    The purpose of the present study is to describe the economic context in Spain and its impact on the health care sector and in nursing schools. The global economic crisis is affecting nursing in Spain. This study analyses and compares indicators related to health care and nursing schools among European countries. Some new strategies to cope with the challenges arising from the health care crisis are suggested. Health care costs are increasing as a result of the ageing of the Spanish population, immigration, chronicity of health problems and new medical technology. Nursing education has changed in 2010 from a 3-year diploma programme to a 4-year University degree in Nursing. This change requires new resources involving staff, facilities and equipment, all of which are lacking because of the economic crisis in Spain. The worldwide economic crisis has affected Spain more than it has other European Union (EU) countries. This global crisis has an impact on the health care sector as well on nursing schools. It is essential for nursing management to develop creative approaches to maintain cost effective patient care. New programmes and technology must be carefully evaluated in terms of cost effectiveness before being implemented. All health care professionals should be well informed and have a solid understanding of this situation.

  16. Reviews of National Policies for Education: Spain.

    Science.gov (United States)

    Organisation for Economic Cooperation and Development, Paris (France).

    Recent reforms affecting every aspect of Spain's educational system are reviewed in this report. The first part presents the observations of three educators from other European countries ("The Examiners' Report"). Part 2 is a "Record of the Review Meeting" held in Paris in December of 1985 10 months after the examiners' visit…

  17. Aversive racism in Spain: testing the theory

    NARCIS (Netherlands)

    Wojcieszak, M.

    2015-01-01

    This study applies the aversive racism framework to Spain and tests whether aversive racism depends on intergroup contact. Relying on a 3 (qualifications) by 3 (ethnicity) experiment, this study finds that aversive racism is especially pronounced against the Mexican job applicant, and emerges among

  18. Book review: F. Azouvi, Le Mythe du grand silence: Auschwitz, les Français, la mémoire

    OpenAIRE

    Cavaletto , Andrea

    2014-01-01

    International audience; Review of: F. Azouvi, "Le Mythe du grand silence: Auschwitz, les Français, la mémoire", Fayard, 2012. Journal of Interdisciplinary History of Ideas, vol.2, n.4, December 2013

  19. Genetically elevated apolipoprotein A-I, high-density lipoprotein cholesterol levels, and risk of ischemic heart disease

    DEFF Research Database (Denmark)

    Lundegaard, Christiane; Tybjærg-Hansen, Anne; Grande, Peer

    2010-01-01

    Epidemiologically, levels of high-density lipoprotein (HDL) cholesterol and its major protein constituent, apolipoprotein A-I (apoA-I), are inversely related to risk of ischemic heart disease (IHD).......Epidemiologically, levels of high-density lipoprotein (HDL) cholesterol and its major protein constituent, apolipoprotein A-I (apoA-I), are inversely related to risk of ischemic heart disease (IHD)....

  20. Blue Sky Ideas in Artificial Intelligence Education from the EAAI 2017 New and Future AI Educator Program

    OpenAIRE

    Eaton, Eric; Koenig, Sven; Schulz, Claudia; Maurelli, Francesco; Lee, John; Eckroth, Joshua; Crowley, Mark; Freedman, Richard G.; Cardona-Rivera, Rogelio E.; Machado, Tiago; Williams, Tom

    2017-01-01

    The 7th Symposium on Educational Advances in Artificial Intelligence (EAAI'17, co-chaired by Sven Koenig and Eric Eaton) launched the EAAI New and Future AI Educator Program to support the training of early-career university faculty, secondary school faculty, and future educators (PhD candidates or postdocs who intend a career in academia). As part of the program, awardees were asked to address one of the following "blue sky" questions: * How could/should Artificial Intelligence (AI) courses ...

  1. Fire impact and assessment of post-fire actions of a typical Mediterranean forest from SW Spain

    Science.gov (United States)

    Jiménez-González, Marco A.; María De la Rosa, José; Jiménez-Morillo, Nicasio T.; Zavala, Lorena M.; Knicker, Heike

    2015-04-01

    Wildfires may cause significant changes in soil physical and chemical properties. In addition, soil organic matter (SOM) content and chemical properties are usually affected by fire. Fire impacts may negatively affect soil health and quality, and induce or enhance runoff generation and, thereby, soil erosion risk and cause damages to the habitat of species. This fact is especially dramatic in Mediterranean ecosystems, where forest fires are a frequent phenomenon and restoration strategies are a key issue. The goals of this study are to determine: i) the immediate effects of fire on soil properties, including changes occurred in the quantity and quality of SOM and ii) the effect of post-fire actions on soil properties. In August 2012, a wildfire affected a forest area of approx. 90 ha in Montellano (Seville, SW Spain; longitude 37.00 °, latitude -5.56 °). This area is dominated by pines (Pinus pinaster and Pinus halepensis), and eucalypts (Eucaliptus globulus) with a Mediterranean climate. Dominant soil types are Rendzic Leptosols and Calcaric Haplic Regosols. It is a poorly limestone-developed soil (usually swallower than 25 cm). Four soil subsamples were collected 1 month and 25 months after fire within an area of approximately 200 m2. Subsamples were mixed together, homogenized, air-dried, crushed and sieved (2 mm). One control sample was collected in an adjacent area. The litter layer was removed by hand and studied separately. Branches, stems, bushes and plant residues on the fire-affected area were removed 16 months after the fire using heavy machinery as part of the post-fire management. The present research focuses on the study of the elemental composition (C, H and N) and physical properties (pH, water holding capacity, electrical conductivity) of bulk soil samples, and on the spectroscopic analysis (FT-IR, 13C NMR) and analytical pyrolysis data obtained from bulk the oils and from the humic acid fraction. immediate effects of fire, including the charring

  2. Effects of Ai Chi on balance, quality of life, functional mobility, and motor impairment in patients with Parkinson's disease.

    Science.gov (United States)

    Kurt, Emine Eda; Büyükturan, Buket; Büyükturan, Öznur; Erdem, Hatice Rana; Tuncay, Figen

    2018-04-01

    In this study, we aimed to investigate effects of Ai Chi on balance, functional mobility, health-related quality of life, and motor impairment in patients with Parkinson's disease. This study was conducted as an open-label randomized controlled trial (ISRCTN26292510) with repeated measures. Forty patients with Parkinson's disease stages 2 to 3 according to the Hoehn and Yahr Scale were randomly allocated to either an Ai Chi exercise group or a land-based exercise control group for 5 weeks. Balance was measured using the Biodex-3,1 and the Berg Balance Scale. Functional mobility was evaluated using the Timed Up and Go Test. Additionally, health-related quality of life and motor activity were assessed with the Parkinson's Disease Questionnaire-39 and the Unified Parkinson's Disease Rating Scale-III. Although patients in both groups showed significant improvement in all outcome variables, improvement of dynamic balance was significantly greater in the Ai Chi group (p Balance Scale (p balance, mobility, motor ability, and quality of life. In addition, Ai Chi exercise was more effective as an intervention than land-based exercise in patients with mild to moderate Parkinson's disease. Implications for rehabilitation Ai Chi exercises (aquatic exercises) may help improve balance, functional mobility, health-related quality of life, and motor ability in patients with mild to moderate Parkinson's disease more efficiently than similar land-based exercises. Ai Chi exercises should be considered as a rehabilitation option for treatment of patients with mild or moderate Parkinson's disease.

  3. BanII dimorphic site located in the third intron of the human apolipoprotein AI (APOA1) gene

    Energy Technology Data Exchange (ETDEWEB)

    Coleman, R T; Kresnak, M T; Frossard, P M

    1988-02-11

    A 0.7kb fragment generated by AvaII digestion of pBL13AI, a 0.965kb full-length human apolipoprotein AI cDNA was cloned into the EcoRI site of pBR322. The apoAI cDNA was isolated from a lambdagt10 human fetal liver cDNA library. BanII (GPuGCPyC) (International Biotechnologies, Inc.) identifies two invariant bands at 1122bp and 417bp, and a single two-allele polymorphism with bands at either 274bp or 452bp. The human apolipoprotein AI-CIII-AIV gene complex has been localized on the long arm of chromosome 11 by Southern blot analysis of human-chinese hamster cell hybrids. Co-dominant segregation has been observed in two families (13 individuals). The BanII restriction map was constructed from DNA sequence data of the human apoAI gene. The 452bp fragment is generated by the loss of a BanII dimorphic site in the third intron of the apoAI gene, between the 178bp and the 274bp fragments.

  4. Augmentation index (AI) in a dose-response relationship with smoking habits in males: The Tanushimaru study.

    Science.gov (United States)

    Tsuru, Tomoko; Adachi, Hisashi; Enomoto, Mika; Fukami, Ako; Kumagai, Eita; Nakamura, Sachiko; Nohara, Yume; Kono, Shoko; Nakao, Erika; Sakaue, Akiko; Morikawa, Nagisa; Fukumoto, Yoshihiro

    2016-12-01

    We investigated the relationship between augmentation index (AI) and smoking habits in community-dwelling Japanese.This cross-sectional study enrolled 1926 subjects (769 males and 1157 females) aged 40 to 95 years who underwent a health check-up in a Japanese cohort of the Seven Countries Study, in Tanushimaru, a typical farming town in Kyushu Island in 2009. The subjects' medical history, alcohol intake, smoking habit, and current medications for hypertension, dyslipidemia, and diabetes were ascertained by questionnaire. Radial arterial pressure wave analysis was used to obtain AI. We analyzed the data stratified by gender.Age-adjusted means of AI in males showed a clear dose-response relationship in 4 categories of smoking habits (P = 0.010). There was no significant relationship between AI and smoking habits in females (P = 0.127). The significant dose-response relationship (P = 0.036) in males between AI and 4 categories of smoking habits still remained even after adjustment for age, body mass index, systolic blood pressure, estimated glomerular filtration rate, glucose, hypertensive medication, and alcohol intake.The present study demonstrated that AI values were significantly associated with smoking habits in a dose-dependent manner in Japanese males.

  5. Pharmaceutical costs of assisted reproduction in Spain.

    Science.gov (United States)

    Lorente, Maria-Reyes; Hernández, Juana; Antoñanzas, Fernando

    2013-11-01

    Assisted reproduction is one of the health services currently being considered for possible limitation or exclusion from the public health services portfolio in Spain. One of the main reasons claimed for this is the impact on the budget for pharmaceutical expenditure. The objective of this study was to assess the significance of the pharmaceutical costs of assisted reproduction in Spain. This study focused on medical practice in Spain, and is based on the opinions of experts in assisted reproduction and the results provided by professional societies' publications. The reference year is 2012 and the setting was secondary care. We have included all existing pharmaceutical modalities for assisted reproduction, as well as the most common drug for each modality. We have considered the pharmaceutical cost per cycle for artificial insemination, in vitro fertilisation with or without intracytoplasmic sperm injection (IVF_ICSI), and cryotransfer and donated fresh oocytes reception. In Spain, artificial insemination has a pharmaceutical cost per cycle of between €69.36 and €873.79. This amounts to an average cycle cost of €364.87 for partner's sperm and €327.10 for donor sperm. The pharmaceutical cost of IVF_ICSI ranges between €278.16 and €1,902.66, giving an average cost per cycle of €1,139.65. In the case of cryotransfer and donated fresh oocytes reception, the pharmaceutical cost per cycle is between €22.61 and €58.73, yielding an average cost of €40.67. The budgetary impact of pharmaceutical expenditure for assisted reproduction in Spain for the year 2012 was estimated at €98.7 million. In Spain, the total pharmaceutical cost of assisted reproduction is substantial. According to our results, we can say that about 29% of the total pharmaceutical expenditure for assisted reproduction techniques is funded by the National Health System and the rest represents 2.4% of the total annual out-of-pocket family expenditure on drugs.

  6. De l’harmonie dans la construction des mots français

    Directory of Open Access Journals (Sweden)

    Roché Michel

    2016-01-01

    Full Text Available La formation des gentilés, particulièrement sensible aux contraintes d’euphonie, permet de mettre en évidence, pour le français, deux manifestations complémentaires de la contrainte dissimilative. L’une, négative, tend à éviter la consécution à faible distance du même phonème ou de deux phonèmes proches. Elle explique la sous-représentation des deux principaux suffixes, -ais et -ois, après une accroche en sifflante, à cause de la sifflante conte-nue par le suffixe au féminin, ainsi que la sous-représentation de -ais après /E/ et de -ois après /A/. L’autre, positive, favorise entre les voyelles une harmonie fondée sur les contrastes. De-vant les suffixes dont la voyelle est une voyelle d’avant moyenne ou haute (-ais, -ain, -in, -ier…, sont privilégiés les radicaux dont la dernière voyelle est une voyelle d’arrière moyenne ou basse, et de préférence un /O/ plutôt qu’un /A/. Devant les suffixes dont la voyelle est une voyelles d’arrière moyenne ou basse (-ois, -ot, -on, -and, -at, -ard…, sont privilégiés les radi-caux dont la dernière voyelle est une voyelle d’avant moyenne ou haute, et de préférence un /i/ plutôt qu’un /E/. Pour cela, un yod au contact du suffixe joue le même rôle qu’un /i/ dans la syllabe précédente. Cette harmonie est obtenue soit par la sélection du suffixe, soit par un aménagement – substitution, épenthèse, troncation, insertion d’un interfixe, etc. – du radical fourni par la base. On observe d’autre part une harmonisation de l’accroche consonantique du radical avec la voyelle du suffixe. Devant -ois, sont privilégiées les attaques en labiale ou en vélaire, en accord avec le double caractère du /w/ propre à ce suffixe. Devant -ais et -ain, ce sont les attaques en dentale. Devant -ot, -on, -and, -at, -ard, la tendance à rapprocher l’articu-lation de la consonne de celle de la voyelle peut aller jusqu’aux vélaires mais elle s’arrête sou

  7. AI in medical education--another grand challenge for medical informatics.

    Science.gov (United States)

    Lillehaug, S I; Lajoie, S P

    1998-03-01

    The potential benefits of artificial intelligence in medicine (AIM) were never realized as anticipated. This paper addresses ways in which such potential can be achieved. Recent discussions of this topic have proposed a stronger integration between AIM applications and health information systems, and emphasize computer guidelines to support the new health care paradigms of evidence-based medicine and cost-effectiveness. These proposals, however, promote the initial definition of AIM applications as being AI systems that can perform or aid in diagnoses. We challenge this traditional philosophy of AIM and propose a new approach aiming at empowering health care workers to become independent self-sufficient problem solvers and decision makers. Our philosophy is based on findings from a review of empirical research that examines the relationship between the health care personnel's level of knowledge and skills, their job satisfaction, and the quality of the health care they provide. This review supports addressing the quality of health care by empowering health care workers to reach their full potential. As an aid in this empowerment process we argue for reviving a long forgotten AIM research area, namely, AI based applications for medical education and training. There is a growing body of research in artificial intelligence in education that demonstrates that the use of artificial intelligence can enhance learning in numerous domains. By examining the strengths of these educational applications and the results from previous AIM research we derive a framework for empowering medical personnel and consequently raising the quality of health care through the use of advanced AI based technology.

  8. ILALOK. Dictionnaire vili–français/Mpisukulu bi kum' bi tshi vili ku tshi mputu.

    Directory of Open Access Journals (Sweden)

    P.A. Mavoungou

    2011-10-01

    Full Text Available On connaît le vif intérêt de l'Institut des Langues Locales au Kouilou pour la promotion des langues maternelles et des cultures dont elles sont le véhicule irremplaçable. La parution aux Éditions L'Harmattan du Dictionnaire vili–fran-çais en 2008 vient couronner des années d'efforts acharnés et de privations. Ce dictionnaire, consacré au civili, poursuit ainsi la tradition des ouvrages lexico-graphiques commencés par les missionnaires. Pour le civili notamment on peut citer les contributions des révérends pères Derouet (n.d. et Marichelle (1902 qui furent imprimés à la vieille imprimerie de Loango. Dans la préface du Dic-tionnaire vili–français (en abrégé DVF dans le reste du texte, le R.P. Marichelle précise que la parution de son dictionnaire vient compléter l'oeuvre du R.P. Derouet auteur du Dictionnaire français–vili. Hormis les travaux lexicographi-ques sur le civili, deux autres ouvrages ont également été publiés. Il s'agit de Proverbes et dictons du Loango en Afrique Centrale de René Mavoungou Pambou (1997 et de Parlons vili de Gervais Loembé (2005. La parution du Dictionnaire vili–français complète parfaitement bien cette série.

  9. DESIGNING AI TEACHER ASSISTANT ON ONLINE-COURSE BASED ON WORD2VEC TECHNOLOGY

    Directory of Open Access Journals (Sweden)

    Pavel Aleksandrovich Rozhkin

    2018-05-01

    Full Text Available The purpose of this work is to develop an AI teacher assistant, who can find answers to online course participants questions among answers previously published at the training forum. Currently, there are already successful experiments on the use of artificial intelligence systems (IBM WATSON in online training. In this paper, we investigate the possibility of constructing such a system using word2vec technology. A two-stage method for finding an answer to a question is constructed. Method use word2vec technology for vector representation of questions and answers. At the first stage, the subject matter of the issue is determined and, if it corresponds to the theme of the forum, then the articles most relevant to the question are searched. A real situation was simulated with 16 themes and 80 answers to possible questions within the section of the online course “Linear Algebra and Geometry”. The question-answer system was designed and its performance was evaluated. The parameters have been chosen to achieve the best result. In 83% of the cases, the relevant answer to the formulated question was contained among the top 3 responses that the system offered. The issues of further development of applied approaches and increasing utility of the constructed question-answer system are considered. Purpose: developing an AI teacher assistant, who can find answers to online course participants questions among answers previously published at the training forum. Methodology: vectorization of questions and answers, neural network classification of the subject matter, construction of the answers rating. Results: acceptable accuracy in finding a relevant answer to a question are received. Practical implications: The results of the research can be used as a basis for designing an AI teacher assistant in online courses.

  10. Traditional Chinese Medicine Bionic Tiger Bone Powder for the Treatment of AI-Associated Musculoskeletal Symptoms

    Directory of Open Access Journals (Sweden)

    Yifan Li

    2017-01-01

    Full Text Available Background. Aromatase inhibitors (AIs are used for adjuvant therapy of breast cancer; however AIMSS (AI-Associated Musculoskeletal Symptoms can negatively affect quality of life and compliance. Most patients in China moved to TCM (traditional Chinese medicine for help. TB (tiger bone is used to treat bone disease, whose main ingredients are calcium and collagen. The objective of this study was to evaluate whether the TB prevented AIMSS in postmenopausal women with ER/PR+ breast cancer. Methods. We conducted a randomized, blind, controlled study of comparing TB versus placebo for 12 weeks in postmenopausal women with breast cancer who have taken AI for less than a month. Patients completed the M-BPI, VAS, and FACT-B at baseline, 6 weeks, and 12 weeks. M-BPI and VAS were used as the primary outcomes. FACT-B was used as the secondary outcome. Serum E2 and FSH were tested every 6 weeks. Results. Of 70 evaluable cases, 8 of 35 patients (22.9% developed new or worsening point symptoms in TB group, compared to 21 of 35 (60% in placebo group (P<0.001. We also found differences between 2 groups in average pain (2 to 5.6, worst pain (3.9 to 8, pain interference severity (1.9 to 5.3, stiffness (2.4 to 6.9, and joint symptom interference (1.8 to 5.7, all P<0.001; similar findings were seen in VAS value (3 to 6.6 at the end of intervention. HRQoL measured by FACT-B (P<0.05 was improved. No change of serum estradiol and FSH between two groups. Conclusions. TB appeared to be effective and safe in the prevention of AIMSS. This trial is registered with ChiCTR-IPR-15007081.

  11. FEASIBILITY STUDY OF ESTABLISHING AN ARTIFICIAL INSEMINATION (AI CENTER FOR CARABAOS IN SAN ILDEFONSO, BULACAN, PHILIPPINES

    Directory of Open Access Journals (Sweden)

    F.Q. Arrienda II

    2014-10-01

    Full Text Available The productivity of the carabao subsector is influenced by several constraints such as social,technical, economic and policy factors. The need to enhance the local production of carabaos will helplocal farmers to increase their income. Thus, producing thorough breeds of carabaos and improving itgenetically is the best response to these constraints. This study was conducted to present the feasibilitystudy of establishing an Artificial Insemination (AI Center and its planned area of operation in Brgy.San Juan, Ildefonso, Bulacan. The market, production, organizational and financial viability of operatingthe business would also be evaluated. This particular study will provide insights in establishing an AICenter. Included in this study is the identification of anticipated problems that could affect the businessand recommendation of specific courses of action to counteract these possible problems. Primary datawere obtained through interviews with key informants from the Philippine. Carabao Center (PCC. Togain insights about the present status of an AI Center, interviews with the technicians of PCC and privatefarm were done to get additional information. Secondary data were acquired from various literatures andfrom San Ildefonso Municipal Office. The proposed area would be 1,500 square meters that would beallotted for the laboratory and bullpen. The AI Center will operate six days a week and will be openedfrom 8 AM until 5 PM. However, customers or farmers can call the technicians beyond the office hoursin case of emergency. The total initial investment of Php 3,825,417.39 is needed in establishing the AICenter. The whole amount will be sourced from the owner’s equity. Financial projection showed an IRRof 30% with a computed NPV of Php 2,415,597.00 and a payback period of 3.97 years. Based on all themarket, technical, organizational, financial factors, projections and data analysis, it is said that thisbusiness endeavor is viable and feasible.

  12. La muerte del príncipe Don Juan. Exequias y duelo en Córdoba y Sevilla durante el otoño de 1497 = The Death of Prince Juan. Funeral Rites and Mourning in Cordoba and Seville during the Autumn of 1497

    Directory of Open Access Journals (Sweden)

    Margarita Cabrera Sánchez

    2018-05-01

    Full Text Available La finalidad de este trabajo es estudiar las circunstancias de la muerte del príncipe don Juan, los ritos post mortem y las ceremonias fúnebres que tuvieron lugar en Córdoba y Sevilla. Además, nos hemos detenido a analizar cómo pudieron transcurrir los primeros años de su vida y su adolescencia, ya que los testimonios consultados revelan una salud frágil, que, probablemente, pudo precipitar su temprano fallecimiento. Las numerosas fuentes a las que hemos tenido acceso nos han permitido obtener datos inéditos sobre el ceremonial funerario, las manifestaciones de duelo y el volumen de gastos al que tuvieron que hacer frente los concejos de Córdoba y Sevilla para despedir, como la ocasión merecía, al príncipe heredero.   The purpose of this paper is to study the circumstances of the death of prince Juan, the post mortem rites and the funeral ceremonies that took place in Cordoba and Seville. In addition, we have analysed how the first years of his life and adolescence may have taken place, since the testimonies consulted reveal a fragile health that probably could have determined his early death. The numerous sources to which we have had access allowed us to obtain unpublished information on the funerary ceremonial, the demonstrations of mourning and the level of expenditure that was assumed by the councils of Cordoba and Seville to pay their last respects to the heir prince.

  13. [Effects of a programme of aquatic Ai Chi exercise in patients with fibromyalgia. A pilot study].

    Science.gov (United States)

    Perez-De la Cruz, Sagrario; Lambeck, Johan

    2015-01-16

    Fibromyalgia is rheumathological disease a combination of physical, psychological and social limitations. The aim of the present study is to determinate the benefits of Ai Chi program on quality of life, depression and pain. An experimental study was performed with 20 fibromyalgia patients two different cities. Outcome measures were functional capacity (Fibromyalgia Impact Questionnaire), pain (Visual Analogue Scale) and quality of life (Short Form-36). Measures were performed at baseline and after ten weeks post-intervention. After ten weeks of treatment, the results showed significant reduction (p physical and mental health in patients with fibromyalgia.

  14. The Human Touch: Practical and Ethical Implications of Putting AI and Robotics to Work for Patients.

    Science.gov (United States)

    Banks, Jim

    2018-01-01

    We live in a time when science fiction can quickly become science fact. Within a generation, the Internet has matured from a technological marvel to a utility, and mobile telephones have redefined how we communicate. Health care, as an industry, is quick to embrace technology, so it is no surprise that the application of programmable robotic systems that can carry out actions automatically and artificial intelligence (AI), e.g., machines that learn, solve problems, and respond to their environment, is being keenly explored.

  15. Amazonian açai and food dyes for staining arbuscular- micorrhizal fungi

    Directory of Open Access Journals (Sweden)

    Aline Lourdes Martins Silva

    2015-12-01

    Full Text Available Arbuscular mycorrhizae microscopy requires differential staining of typical structures. Dyes employed, such as trypan blue, pose risks to health and environment. Alternative dyes such as pen ink and aniline have variable coloring efficiency. In this work, Brachiaria decumbens roots, discolored with caustic soda (NaOH, were stained with açai, annatto, saffron, trypan blue and pen inks. There were significant differences among dyes regarding stained mycorrhizal structures and pictures quality. Acai was considered the best alternative dye, with similar results to trypan blue.

  16. Will we Succeed in Making the AI Revolution Work for Everyone?

    OpenAIRE

    Miailhe, Nicolas

    2018-01-01

    Is this time different?” is the question that expert worryingly argue over when they analyze the socio-economic impact of the AI revolution as compared with the previous industrial revolutions of the 19th and 20th centuries. This Schumpeterian wave may prove to be a creative destruction raising incomes, enhancing quality of life for all and generating previously unimagined jobs to replace those that get automatized. Or it may turn out to be a destructive creation leading to mass unemployment...

  17. Treat a new and efficient match algorithm for AI production system

    CERN Document Server

    Miranker, Daniel P

    1988-01-01

    TREAT: A New and Efficient Match Algorithm for AI Production Systems describes the architecture and software systems embodying the DADO machine, a parallel tree-structured computer designed to provide significant performance improvements over serial computers of comparable hardware complexity in the execution of large expert systems implemented in production system form.This book focuses on TREAT as a match algorithm for executing production systems that is presented and comparatively analyzed with the RETE match algorithm. TREAT, originally designed specifically for the DADO machine architect

  18. Characterization of immortalized MARCO and SR-AI/II-deficient murine alveolar macrophage cell lines

    Directory of Open Access Journals (Sweden)

    Imrich Amy

    2008-05-01

    Full Text Available Abstract Background Alveolar macrophages (AM avidly bind and ingest unopsonized inhaled particles and bacteria through class A scavenger receptors (SRAs MARCO and SR-AI/II. Studies to characterize the function of these SRAs have used AMs from MARCO or SR-AI/II null mice, but this approach is limited by the relatively low yield of AMs. Moreover, studies using both MARCO and SR-AI/II-deficient (MS-/- mice have not been reported yet. Hence, we sought to develop continuous cell lines from primary alveolar macrophages from MS-/- mice. Results We used in vitro infection of the primary AMs with the J2 retrovirus carrying the v-raf and v-myc oncogenes. Following initial isolation in media supplemented with murine macrophage colony-stimulating factor (M-CSF, we subcloned three AM cell lines, designated ZK-1, ZK-2 and ZK-6. These cell lines grow well in RPMI-1640-10% FBS in the absence of M-CSF. These adherent but trypsin-sensitive cell lines have a doubling time of approximately 14 hours, exhibit typical macrophage morphology, and express macrophage-associated cell surface Mac-1 (CD11b and F4/80 antigens. The cell lines show robust Fc-receptor dependent phagocytosis of opsonized red blood cells. Similar to freshly isolated AMs from MS-/- mice, the cell lines exhibit decreased phagocytosis of unopsonized titanium dioxide (TiO2, fluorescent latex beads and bacteria (Staphylococcus aureus compared with the primary AMs from wild type (WT C57BL/6 mice. Conclusion Our results indicated that three contiguous murine alveolar macrophage cell lines with MS-/- (ZK1, ZK2 and ZK6 were established successfully. These cell lines demonstrated macrophage morphology and functional activity. Interestingly, similar to freshly isolated AMs from MS-/- mice, the cell lines have a reduced, but not absent, ability to bind and ingest particles, with an altered pattern of blockade by scavenger receptor inhibitors. These cell lines will facilitate in vitro studies to further define

  19. The Use of AIS Data for Identifying and Mapping Calcareous Soils in Western Nebraska

    Science.gov (United States)

    Samson, S. A.

    1985-01-01

    The identification of calcareous soils, through unique spectral responses of the vegetation to the chemical nature of calcareous soils, can improve the accuracy of delineating the boundaries of soil mapping units over conventional field techniques. The objective of this experiment is to evaluate the use of the Airborne Imaging Spectrometer (AIS) in the identification and delineation of calcareous soils in the western Sandhills of Nebraska. Based upon statistical differences found in separating the spectral curves below 1.3 microns, calcareous and non-calcareous soils may be identified by differences in species of vegetation. Additional work is needed to identify biogeochemical differences between the two soils.

  20. Social risk perception: recent findings in Spain

    International Nuclear Information System (INIS)

    Prades-Lopez, A.; Martinez-Arias, R.; Diaz-Hidalgo, M.

    1998-01-01

    The purpose of this paper is to present our main results from a survey carried out in Spain in the context of social risk perception. This survey is included in a broad project (PRISP) sponsored by the UE and the national Civil Protection Service, and carried out simultaneously in three countries: Spain, Italy and UK. The project combined qualitative and quantitative assessment methods, although only survey results are presented here. A random sample of 600 subjects from two different Spanish communities close to a COMAH chemical site was selected for the research. Main findings regarding, differential perception between both community populations, sex differences, and 'bias perception' of risks among others have been achieved. Main dimensions were obtained by multidimensional scaling and Factor Analysis. Dimensions reported here are similar to the usual findings from the psychometric paradigm. (authors)