Relation between the adsorbed quantity and the immersion enthalpy in catechol aqueous solutions on activated carbons.

Science.gov (United States)

Moreno-Piraján, Juan Carlos; Blanco, Diego; Giraldo, Liliana

2012-01-01

An activated carbon, Carbochem(TM)-PS230, was modified by chemical and thermal treatment in flow of H(2), in order to evaluate the influence of the activated carbon chemical characteristics in the adsorption of the catechol. The catechol adsorption in aqueous solution was studied along with the effect of the pH solution in the adsorption process of modified activated carbons and the variation of immersion enthalpy of activated carbons in the aqueous solutions of catechol. The interaction solid-solution is characterized by adsorption isotherms analysis, at 298 K and pH 7, 9 and 11 in order to evaluate the adsorption value above and below that of the catechol pK(a). The adsorption capacity of carbons increases when the solution pH decreases. The retained amount increases slightly in the reduced carbon to maximum adsorption pH and diminishes in the oxidized carbon. Similar conclusions are obtained from the immersion enthalpies, whose values increase with the solute quantity retained. In granular activated carbon (CAG), the immersion enthalpies obtained are between 21.5 and 45.7 J·g(-1) for catechol aqueous solutions in a range of 20 at 1500 mg·L(-1).

Relation Between the Adsorbed Quantity and the Immersion Enthalpy in Catechol Aqueous Solutions on Activated Carbons

Directory of Open Access Journals (Sweden)

Liliana Giraldo

2011-12-01

Full Text Available An activated carbon, CarbochemTM—PS230, was modified by chemical and thermal treatment in flow of H2, in order to evaluate the influence of the activated carbon chemical characteristics in the adsorption of the catechol. The catechol adsorption in aqueous solution was studied along with the effect of the pH solution in the adsorption process of modified activated carbons and the variation of immersion enthalpy of activated carbons in the aqueous solutions of catechol. The interaction solid-solution is characterized by adsorption isotherms analysis, at 298 K and pH 7, 9 and 11 in order to evaluate the adsorption value above and below that of the catechol pKa. The adsorption capacity of carbons increases when the solution pH decreases. The retained amount increases slightly in the reduced carbon to maximum adsorption pH and diminishes in the oxidized carbon. Similar conclusions are obtained from the immersion enthalpies, whose values increase with the solute quantity retained. In granular activated carbon (CAG, the immersion enthalpies obtained are between 21.5 and 45.7 J·g−1 for catechol aqueous solutions in a range of 20 at 1500 mg·L−1.

Comparison of two electrolyte models for the carbon capture with aqueous ammonia

DEFF Research Database (Denmark)

Darde, Victor; Thomsen, Kaj; van Well, Willy J.M.

2012-01-01

Post-combustion carbon capture is attracting much attention due to the fact that it can be retrofitted on existing coal power plants. Among the most interesting technologies is the one that employs aqueous ammonia solutions to absorb the generated carbon dioxide. The evaluation of such process.......2). Subsequently, a simple absorption/regeneration layout is simulated employing both models and the process performances are compared. In general, the Extended UNIQUAC appears to describe the experimental data for larger ranges of temperature, pressure and concentration of ammonia more satisfactorily. The energy...

Continuing Studies on Direct Aqueous Mineral Carbonation of CO{sub 2} Sequestration

Energy Technology Data Exchange (ETDEWEB)

O' Connor, W.K.; Dahlin, D.C.; Nilsen, D.N.; Gerdemann, S.J.; Rush, G.E.; Penner, L.R.; Walters, R.P.; Turner, P.C.

2002-03-04

Direct aqueous mineral carbonation has been investigated as a process to convert gaseous CO{sub 2} into a geologically stable, solid final form. The process utilizes a solution of sodium bicarbonate (NaHCO{sub 3}), sodium chloride (NaCl), and water, mixed with a mineral reactant, such as olivine (Mg{sub 2}SiO{sub 4}) or serpentine [Mg{sub 3}Si{sub 2}O{sub 5}(OH){sub 4}]. Carbon dioxide is dissolved into this slurry, by diffusion through the surface and gas dispersion within the aqueous phase. The process includes dissolution of the mineral and precipitation of the magnesium carbonate mineral magnesite (MgCO{sub 3}) in a single unit operation. Activation of the silicate minerals has been achieved by thermal and mechanical means, resulting in up to 80% stoichiometric conversion of the silicate to the carbonate within 30 minutes. Heat treatment of the serpentine, or attrition grinding of the olivine and/or serpentine, appear to activate the minerals by the generation of a non-crystalline phase. Successful conversion to the carbonate has been demonstrated at ambient temperature and relatively low (10 atm) partial pressure of CO{sub 2} (P{sub CO2}). However, optimum results have been achieved using the bicarbonate-bearing solution, and high P{sub CO2}. Specific conditions include: 185 C; P{sub CO2}=150 atm; 30% solids. Studies suggest that the mineral dissolution rate is not solely surface controlled, while the carbonate precipitation rate is primarily dependent on the bicarbonate concentration of the slurry. Current and future activities include further examination of the reaction pathways and pretreatment options, the development of a continuous flow reactor, and an evaluation of the economic feasibility of the process.

Development of a Rapid, Nondestructive Method to Measure Aqueous Carbonate in High Salinity Brines Using Raman Spectroscopy

Science.gov (United States)

McGraw, L.; Phillips-Lander, C. M.; Elwood Madden, A. S.; Parnell, S.; Elwood Madden, M.

2015-12-01

Traditional methods of quantitative analysis are often ill-suited to determining the bulk chemistry of high salinity brines due to their corrosive and clogging properties. Such methods are also often difficult to apply remotely in planetary environments. However, Raman spectroscopy can be used remotely without physical contact with the fluid and is not affected by many ionic brines. Developing methods to study aqueous carbonates is vital to future study of brines on Mars and other planetary bodies, as they can reveal important information about modern and ancient near-surface aqueous processes. Both sodium carbonate standards and unknown samples from carbonate mineral dissolution experiments in high salinity brines were analyzed using a 532 nm laser coupled to an inVia Renishaw spectrometer to collect carbonate spectra from near-saturated sodium chloride and sodium sulfate brines. A calibration curve was determined by collecting spectra from solutions of known carbonate concentrations mixed with a pH 13 buffer and a near-saturated NaCl or Na2SO4 brine matrix. The spectra were processed and curve fitted to determine the height ratio of the carbonate peak at 1066 cm-1 to the 1640 cm-1 water peak. The calibration curve determined using the standards was then applied to the experimental data after accounting for dilutions. Concentrations determined based on Raman spectra were compared against traditional acid titration measurements. We found that the two techniques vary by less than one order of magnitude. Further work is ongoing to verify the method and apply similar techniques to measure aqueous carbonate concentrations in other high salinity brines.Traditional methods of quantitative analysis are often ill-suited to determining the bulk chemistry of high salinity brines due to their corrosive and clogging properties. Such methods are also often difficult to apply remotely in planetary environments. However, Raman spectroscopy can be used remotely without physical

Behavior of americium in aqueous carbonate systems

Energy Technology Data Exchange (ETDEWEB)

Silva, R.J.

1983-11-01

The solubilities of crystalline Am(OH)/sub 3/ and AmOHCO/sub 3/ were measured at 25/sup 0/C in aqueous solutions of 0.1 M NaClO/sub 4/ by determination of the solution concentrations of Am. Prior to use in the measurements, the solid materials were characterized by their x-ray powder diffraction patterns. The solubility product quotients were calculated from the experimental data. The hydrolysis quotients of Am/sup 3 +/ were also estimated from the hydroxide solubility data. Using the thermodynamic data derived from these experiments and the recently reported formation constants for the Am/sup 3 +/ carbonate complexes, the solid phases and concentrations of solution species of americium in several aqueous carbonate systems were calculated using the computer code MINEQL. 20 references, 1 figure, 1 table.

High-performance zno transistors processed via an aqueous carbon-free metal oxide precursor route at temperatures between 80-180 °c

KAUST Repository

Lin, Yenhung

2013-06-25

An aqueous and carbon-free metal-oxide precursor route is used in combination with a UV irradiation-assisted low-temperature conversion method to fabricate low-voltage ZnO transistors with electron mobilities exceeding 10 cm2/Vs at temperatures <180°C. Because of its low temperature requirements the method allows processing of high-performance transistors onto temperature sensitive substrates such as plastic. Copyright © 2013 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

Process for obtaining ammonium uranyl tri carbonate

International Nuclear Information System (INIS)

Santos, L.R. dos; Riella, H.G.

1992-01-01

The procedure adopted for obtaining Ammonium Uranyl Carbonate (AUC) from uranium hexafluoride (U F 6 ) in a aqueous solutions of ammonium hydrogen carbonate is described in this work. The precipitation is made in temperature and pH controlled. This process consists of three steps: evaporation of U F 6 , AUC precipitation and filtration of the AUC slurry. An attempt is made of correlate the parameters involved in the precipitation process of AUC with its and U O 2 characteristics. (author)

Energy and economic considerations for ex-situ and aqueous mineral carbonation

Energy Technology Data Exchange (ETDEWEB)

O' Connor, William K.; Dahlin, David C.; Rush, G.E.; Gerdemann, Stephen J.; Penner, L.R.

2004-01-01

Due to the scale and breadth of carbon dioxide emissions, and speculation regarding their impact on global climate, sequestration of some portion of these emissions has been under increased study. A practical approach to carbon sequestration will likely include several options, which will be driven largely by the energy demand and economics of operation. Aqueous mineral carbonation of calcium and magnesium silicate minerals has been studied as one potential method to sequester carbon dioxide. Although these carbonation reactions are all thermodynamically favored, they occur at geologic rates of reaction. Laboratory studies have demonstrated that these rates of reaction are accelerated with increasing temperature, pressure, and particle surface area. Mineral-specific activation methods were identified, however, each of these techniques incurs energy as well as economic costs. An overview of the mineral availability, pretreatment options and energy demands, and process economics is provided.

Heterogeneity of activated carbons in adsorption of aniline from aqueous solutions

Science.gov (United States)

Podkościelny, P.; László, K.

2007-08-01

The heterogeneity of activated carbons (ACs) prepared from different precursors is investigated on the basis of adsorption isotherms of aniline from dilute aqueous solutions at various pH values. The APET carbon prepared from polyethyleneterephthalate (PET), as well as, commercial ACP carbon prepared from peat were used. Besides, to investigate the influence of carbon surface chemistry, the adsorption was studied on modified carbons based on ACP carbon. Its various oxygen surface groups were changed by both nitric acid and thermal treatments. The Dubinin-Astakhov (DA) equation and Langmuir-Freundlich (LF) one have been used to model the phenomenon of aniline adsorption from aqueous solutions on heterogeneous carbon surfaces. Adsorption-energy distribution (AED) functions have been calculated by using an algorithm based on a regularization method. Analysis of these functions for activated carbons studied provides important comparative information about their surface heterogeneity.

Theoretical isotopic fractionation between structural boron in carbonates and aqueous boric acid and borate ion

Science.gov (United States)

Balan, Etienne; Noireaux, Johanna; Mavromatis, Vasileios; Saldi, Giuseppe D.; Montouillout, Valérie; Blanchard, Marc; Pietrucci, Fabio; Gervais, Christel; Rustad, James R.; Schott, Jacques; Gaillardet, Jérôme

2018-02-01

The 11B/10B ratio in calcite and aragonite is an important proxy of oceanic water pH. However, the physico-chemical mechanisms underpinning this approach are still poorly known. In the present study, we theoretically determine the equilibrium isotopic fractionation properties of structural boron species in calcium carbonates, BO33-, BO2(OH)2- and B(OH)4- anions substituted for carbonate groups, as well as those of B(OH)4- and B(OH)3 species in vacuum. Significant variability of equilibrium isotopic fractionation properties is observed among these structural species which is related to their contrasted coordination state, Bsbnd O bond lengths and atomic-scale environment. The isotopic composition of structural boron does not only depend on its coordination number but also on its medium range environment, i.e. farther than its first coordination shell. The isotopic fractionation between aqueous species and their counterparts in vacuum are assessed using previous investigations based on similar quantum-mechanical modeling approaches. At 300 K, the equilibrium isotope composition of structural trigonal species is 7-15‰ lighter than that of aqueous boric acid molecules, whereas substituted tetrahedral borate ions are heavier than their aqueous counterparts by 10-13‰. Although significant uncertainties are known to affect the theoretical prediction of fractionation factors between solids and solutions, the usually assumed lack of isotopic fractionation during borate incorporation in carbonates is challenged by these theoretical results. The present theoretical equilibrium fractionation factors between structural boron and aqueous species differ from those inferred from experiments which may indicate that isotopic equilibrium, unlike chemical equilibrium, was not reached in most experiments. Further research into the isotopic fractionation processes at the interface between calcium carbonates and aqueous solution as well as long duration experiments aimed at

Aqueous Extracts of Hibiscus sabdariffa Calyces to Control Aichi Virus.

Science.gov (United States)

D'Souza, Doris H; Dice, Lezlee; Davidson, P Michael

2016-06-01

Aqueous Hibiscus sabdariffa extracts possess antimicrobial properties with limited information available on their antiviral effects. Aichi virus (AiV) is an emerging foodborne pathogen that causes gastroenteritis. Vaccines are currently unavailable to prevent their disease transmission. The objective of this study was to determine the antiviral effects of aqueous H. sabdariffa extracts against AiV. AiV at ~5 log PFU/ml was incubated with undiluted (200 mg/ml), 1:1 (100 mg/ml) or 1:5 (40 mg/ml) diluted aqueous hibiscus extract (pH 3.6), phosphate-buffered saline (pH 7.2 as control), or malic acid (pH 3.0, acid control) at 37 °C over 24 h. Treatments were stopped by serially diluting in cell-culture media containing fetal bovine serum and titers were determined using plaque assays on confluent Vero cells. Each treatment was replicated thrice and assayed in duplicate. AiV did not show any significant reduction with 1:1 (100 mg/ml) or 1:5 (40 mg/ml) diluted aqueous hibiscus extracts or malic acid after 0.5, 1, or 2 h at 37 °C. However, AiV titers were reduced to non-detectable levels after 24 h with all the three tested concentrations, while malic acid showed only 0.93 log PFU/ml reduction after 24 h. AiV was reduced by 0.5 and 0.9 log PFU/ml with undiluted extracts (200 mg/ml) after 2 and 6 h, respectively. AiV treated with 1:1 (100 mg/ml) and 1:5 (40 mg/ml) diluted extracts showed a minimal ~0.3 log PFU/ml reduction after 6 h. These extracts show promise to reduce AiV titers mainly through alteration of virus structure, though higher concentrations may have improved effects.

Aqueous solutions of acidic ionic liquids for enhanced stability of polyoxometalate-carbon supercapacitor electrodes

Science.gov (United States)

Hu, Chenchen; Zhao, Enbo; Nitta, Naoki; Magasinski, Alexandre; Berdichevsky, Gene; Yushin, Gleb

2016-09-01

Nanocomposites based on polyoxometalates (POMs) nanoconfined in microporous carbons have been synthesized and used as electrodes for supercapacitors. The addition of the pseudocapacitance from highly reversible redox reaction of POMs to the electric double-layer capacitance of carbon lead to an increase in specific capacitance of ∼90% at 1 mV s-1. However, high solubility of POM in traditional aqueous electrolytes leads to rapid capacity fading. Here we demonstrate that the use of aqueous solutions of protic ionic liquids (P-IL) as electrolyte instead of aqueous sulfuric acid solutions offers an opportunity to significantly improve POM cycling stability. Virtually no degradation in capacitance was observed in POM-based positive electrode after 10,000 cycles in an asymmetric capacitor with P-IL aqueous electrolyte. As such, POM-based carbon composites may now present a viable solution for enhancing energy density of electrical double layer capacitors (EDLC) based on pure carbon electrodes.

Enhanced Oil Recovery from Oil-wet Carbonate Rock by Spontaneous Imbibition of Aqueous Surfactant Solutions

Energy Technology Data Exchange (ETDEWEB)

Standnes, Dag Chun

2001-09-01

The main theme of this thesis is an experimental investigation of spontaneous imbibition (SI) of aqueous cationic surfactant solution into oil-wet carbonate (chalk- and dolomite cores). The static imbibition process is believed to represent the matrix flow of oil and water in a fractured reservoir. It was known that aqueous solution of C{sub 12}-N(CH{sub 3}){sub 3}Br (C12TAB) was able to imbibe spontaneously into nearly oil-wet chalk material, but the underlying mechanism was not understood. The present work was therefore initiated, with the following objectives: (1) Put forward a hypothesis for the chemical mechanism underlying the SI of C12TAB solutions into oil-wet chalk material based on experimental data and (2) Perform screening tests of low-cost commercially available surfactants for their ability to displace oil by SI of water into oil-wet carbonate rock material. It is essential for optimal use of the surfactant in field application to have detailed knowledge about the mechanism underlying the SI process. The thesis also discusses some preliminary experimental results and suggests mechanisms for enhanced oil recovery from oil-wet carbonate rock induced by supply of thermal energy.

Carbon nanoparticle stabilised liquid|liquid micro-interfaces for electrochemically driven ion-transfer processes

International Nuclear Information System (INIS)

MacDonald, Stuart M.; Fletcher, Paul D.I.; Cui Zhenggang; Opallo, Marcin; Chen Jingyuan; Marken, Frank

2007-01-01

Stabilised liquid|liquid interfaces between an organic 4-(3-phenylpropyl)-pyridine (PPP) phase and an aqueous electrolyte phase are obtained in the presence of suitable nanoparticles. The use of nanoparticulate stabilisers (ca. 30 nm diameter laponite or 9-18 nm diameter carbon) in 'Pickering' emulsion systems allows stable organic microdroplets to be formed and these are readily deposited onto conventional tin-doped indium oxide (ITO) electrodes. In contrast to the electrically insulating laponite nanoparticles, conducting carbon nanoparticles are shown to effectively catalyse the simultaneous electron transfer and ion transfer process at triple phase boundary junctions. Anion transfer processes between the aqueous and organic phase are driven electrochemically at the extensive triple phase junction carbon nanoparticle|4-(3-phenylpropyl)-pyridine|aqueous electrolyte. The organic phase consists of a redox active reagent 5,10,15,20-tetraphenyl-21H,23H-porphinato manganese(III) (MnTPP + ), 5,10,15,20-tetraphenyl-21H,23H-porphinato iron(III) (FeTPP + ), or proto-porphyrinato-IX iron(III) (hemin) dissolved in 4-(3-phenylpropyl)-pyridine (PPP). The composition of the aqueous electrolyte phase determines the reversible potential for the Nernstian anion transfer process. The methodology is shown to be versatile and, in future, could be applied more generally in liquid|liquid electroanalysis

Comparison studies of surface cleaning methods for PAN-based carbon fibers with acetone, supercritical acetone and subcritical alkali aqueous solutions

International Nuclear Information System (INIS)

Meng Linghui; Fan Dapeng; Huang Yudong; Jiang Zaixing; Zhang Chunhua

2012-01-01

Highlights: ► Cleaning with supercritical acetone is appropriate to wipe off the oxygenated contaminants. ► Cleaning with supercritical acetone causes smaller damage to bulk strength of carbon fibers. ► Cleaning with subcritical alkali aqueous solution can thoroughly remove silicious contaminants. - Abstract: Four kinds of polyacrylonitrile-based carbon fibers were cleaned by three methods and were characterized by X-ray photoelectron spectroscopy, monofilament tensile strength test and atomic force microscopy (AFM). Experimental results of these tests reveal that the method using supercritical acetone or subcritical potassium hydroxide aqueous solution act as the processing medium shows a better cleaning effect compared to the traditional method, Soxhlet extraction with acetone. The method using supercritical acetone is more appropriate to wipe off the oxygenated contaminants on carbon fibers’ surfaces and causes a relatively smaller damage to the bulk strength of each carbon fiber. As far as treating method using the subcritical alkali aqueous solution, it can thoroughly remove silicious contaminants on the surfaces of treated fibers.

Chemically immobilised carbon nanotubes on silicon: Stable surfaces for aqueous electrochemistry

Energy Technology Data Exchange (ETDEWEB)

Flavel, Benjamin S., E-mail: ben.flavel@flinders.edu.a [Department of Chemistry, University of Canterbury, Private Bag 4800, Christchurch 8140 (New Zealand); School of Chemistry, Physics and Earth Sciences, Flinders University, Sturt Road, Bedford Park, Adelaide, South Australia 5001 (Australia); Garrett, David J.; Lehr, Joshua [Department of Chemistry, University of Canterbury, Private Bag 4800, Christchurch 8140 (New Zealand); MacDiarmid Institute for Advanced Materials and Nanotechnology, Private Bag 4800, Christchurch 8140 (New Zealand); Shapter, Joseph G. [School of Chemistry, Physics and Earth Sciences, Flinders University, Sturt Road, Bedford Park, Adelaide, South Australia 5001 (Australia); Downard, Alison J., E-mail: alison.downard@canterbury.ac.n [Department of Chemistry, University of Canterbury, Private Bag 4800, Christchurch 8140 (New Zealand); MacDiarmid Institute for Advanced Materials and Nanotechnology, Private Bag 4800, Christchurch 8140 (New Zealand)

2010-04-30

Diazonium ion chemistry has been used to electrochemically graft aminophenyl layers onto p-type silicon (1 0 0) substrates. A condensation reaction was used to immobilise single-walled carbon nanotubes with high carboxylic acid functionality directly to this layer. Electrochemical monitoring of the aminophenyl groups confirmed the formation of an amide linkage between the single-walled carbon nanotubes and the aminophenyl layer. The carbon nanotube electrode showed high stability and good electrochemical performance in aqueous solution. At moderate scan rates the Ru(NH{sub 3}){sub 6}{sup +3/+2} couple exhibited quasi-reversible electron transfer kinetics with a standard heterogenous rate constant of 1.2 x 10{sup -3} cm s{sup -1} at the covalently-linked carbon nanotube surface. The electrode thus combines the advantages of a silicon substrate for easy integration into sophisticated electrical and electronic devices, carbon nanotubes for desirable electrochemical properties, and stability in aqueous medium for future applications in environmental sensing.

Chemically immobilised carbon nanotubes on silicon: Stable surfaces for aqueous electrochemistry

International Nuclear Information System (INIS)

Flavel, Benjamin S.; Garrett, David J.; Lehr, Joshua; Shapter, Joseph G.; Downard, Alison J.

2010-01-01

Diazonium ion chemistry has been used to electrochemically graft aminophenyl layers onto p-type silicon (1 0 0) substrates. A condensation reaction was used to immobilise single-walled carbon nanotubes with high carboxylic acid functionality directly to this layer. Electrochemical monitoring of the aminophenyl groups confirmed the formation of an amide linkage between the single-walled carbon nanotubes and the aminophenyl layer. The carbon nanotube electrode showed high stability and good electrochemical performance in aqueous solution. At moderate scan rates the Ru(NH 3 ) 6 +3/+2 couple exhibited quasi-reversible electron transfer kinetics with a standard heterogenous rate constant of 1.2 x 10 -3 cm s -1 at the covalently-linked carbon nanotube surface. The electrode thus combines the advantages of a silicon substrate for easy integration into sophisticated electrical and electronic devices, carbon nanotubes for desirable electrochemical properties, and stability in aqueous medium for future applications in environmental sensing.

Tweeting AI: Perceptions of AI-Tweeters (AIT) vs Expert AI-Tweeters (EAIT)

OpenAIRE

Manikonda, Lydia; Dudley, Cameron; Kambhampati, Subbarao

2017-01-01

With the recent advancements in Artificial Intelligence (AI), various organizations and individuals started debating about the progress of AI as a blessing or a curse for the future of the society. This paper conducts an investigation on how the public perceives the progress of AI by utilizing the data shared on Twitter. Specifically, this paper performs a comparative analysis on the understanding of users from two categories -- general AI-Tweeters (AIT) and the expert AI-Tweeters (EAIT) who ...

Sorption of a phenols mixture in aqueous solution with activated carbon

International Nuclear Information System (INIS)

Mejia M, D.

2004-01-01

The constant population growth and the quick industrialization have caused severe damages to our natural aquifer resources for a great variety of organic and inorganic pollutants. Among these they are those phenol compounds that are highly toxic, resistant (to the degradation chemistry) and poorly biodegradable. The phenolic compounds is used in a great variety of industries, like it is the production of resins, nylon, plastifiers, anti-oxidants, oil additives, drugs, pesticides, colorants, explosives, disinfectants and others. The disseminated discharges or effluents coming from the industrial processes toward lakes and rivers are causing a growing adverse effect in the environment, as well as a risk for the health. Numerous studies exist on the phenols removal and phenols substituted for very varied techniques, among them they are the adsorption in activated carbon. This finishes it has been used successfully for the treatment of residual waters municipal and industrial and of drinking waters and it is considered as the best technique available to eliminate organic compounds not biodegradable and toxic present in aqueous solution (US EPA, 1991). However a little information exists on studies carried out in aqueous systems with more of a phenolic compound. The activated carbon is broadly used as adsorbent due to its superficial properties in the so much treatment of water as of aqueous wastes, adsorbent for the removal of organic pollutants. The main objective of this work is the adsorption of a aqueous mixture of phenol-4 chloro phenol of different concentrations in activated carbon of mineral origin of different meshes and to diminish with it their presence in water. The experiments were carried out for lots, in normal conditions of temperature and pressure. The experimental results show that the removal capacity depends so much of the superficial properties of the sorbent like of the physical properties and chemical of the sorbate. The isotherms were carried

Alarm processing system using AI techniques for nuclear power plant

International Nuclear Information System (INIS)

Yang, Joon On; Chang, Soon Heung

1990-01-01

An alarm processing system (APS) has been developed using artificial intelligence (AI) techniques. The alarms of nuclear power plants (NPP's) are classified into the generalized and special alarms. The generalized alarms are also classified into the global and local alarms. For each type of alarms, the specific processing rules are applied to filter and suppress unnecessary and potentially misleading alarms. The local processing are based on 'model-based reasoning.' The global and special alarms are processed by using the general cause-consequence check rules. The priorities of alarms are determined according to the plant state and the consistencies between them

Removing Phosphorus from Aqueous Solutions Using Lanthanum Modified Pine Needles.

Directory of Open Access Journals (Sweden)

Xianze Wang

Full Text Available The renewable pine needles was used as an adsorbent to remove phosphorus from aqueous solutions. Using batch experiments, pine needles pretreated with alkali-isopropanol (AI failed to effectively remove phosphorus, while pine needles modified with lanthanum hydroxide (LH showed relatively high removal efficiency. LH pine needles were effective at a wide pH ranges, with the highest removal efficiency reaching approximately 85% at a pH of 3. The removal efficiency was kept above 65% using 10 mg/L phosphorus solutions at desired pH values. There was no apparent significant competitive behavior between co-existing anions of sulfate, nitrate, and chloride (SO4(2-, NO3(- and Cl(-; however, CO3(2- exhibited increased interfering behavior as concentrations increased. An intraparticle diffusion model showed that the adsorption process occurred in three phases, suggesting that a boundary layer adsorption phenomena slightly affected the adsorption process, and that intraparticle diffusion was dominant. The adsorption process was thermodynamically unfavorable and non-spontaneous; temperature increases improved phosphorus removal. Total organic carbon (TOC assays indicated that chemical modification reduced the release of soluble organic compounds from 135.6 mg/L to 7.76 mg/L. This new information about adsorption performances provides valuable information, and can inform future technological applications designed to remove phosphorus from aqueous solutions.

Removal of Methylene Blue from Aqueous Solution by Activated Carbon Prepared from Pea Shells (Pisum sativum

Directory of Open Access Journals (Sweden)

Ünal Geçgel

2013-01-01

Full Text Available An activated carbon was prepared from pea shells and used for the removal of methylene blue (MB from aqueous solutions. The influence of various factors such as adsorbent concentration, initial dye concentration, temperature, contact time, pH, and surfactant was studied. The experimental data were analyzed by the Langmuir and Freundlich models of adsorption. The adsorption isotherm was found to follow the Langmuir model. The monolayer sorption capacity of activated carbon prepared from pea shell for MB was found to be 246.91 mg g−1 at 25 ∘C. Two simplified kinetic models including pseudo-first-order and pseudo-second-order equation were selected to follow the adsorption processes. Kinetic studies showed that the adsorption followed pseudo-second-order kinetic model. Various thermodynamic parameters such as , , and were evaluated. The results in this study indicated that activated carbon prepared from pea shell could be employed as an adsorbent for the removal of MB from aqueous solutions.

Aqueous solution dispersement of carbon nanotubes

Science.gov (United States)

Kim, Jae-Woo (Inventor); Park, Cheol (Inventor); Choi, Sang H. (Inventor); Lillehei, Peter T. (Inventor); Harrison, Joycelyn S. (Inventor)

2011-01-01

Carbon nanotubes (CNTs) are dispersed in an aqueous buffer solution consisting of at least 50 weight percent water and a remainder weight percent that includes a buffer material. The buffer material has a molecular structure defined by a first end, a second end, and a middle disposed between the first and second ends. The first end is a cyclic ring with nitrogen and oxygen heteroatomes, the middle is a hydrophobic alkyl chain, and the second end is a charged group.

Electrocatalysis aqueous phenol with carbon nanotubes networks as anodes: Electrodes passivation and regeneration and prevention

International Nuclear Information System (INIS)

Gao, Guandao; Vecitis, Chad D.

2013-01-01

Highlights: ► The electrochemical filtration used carbon nanotube network is effective to remove aqueous pollutants. ► Electrodes passivation is one of the most urgent challenges to overcome to 3-D electrode technology. ► Generally running system at higher potential can avoid generating polymer. ► Washing electrodes with suitable solvents is an effective alternative for removing polymer if it is not the best. -- Abstract: Electrochemical filtration using three-dimensional carbon nanotube (CNT) networks has been reported to increase the electrooxidation rate of aqueous pollutants due to convective mass transfer enhancements resulting from the flow through the electrode. In regards to the long term application of this novel electrochemical technology, electrode passivation is one of the most important challenges to overcome. Here, electrochemical filtration of aqueous phenol in a sodium sulfate electrolyte is utilized to investigate the primary passivation mechanisms and electrode regeneration methodologies, in which chronoamperometry and effluent total organic carbon measurements are utilized to monitor the passivation process in real-time, and electrochemical impedance spectroscopy, linear sweep voltammetry, and scanning electron microscopy are utilized to examine the CNT networks before passivation, after passivation and after regeneration. Finnaly, the carbon nanotube electrode passivation mechanisms and regeneration methods are discussed. Generally it is better choice to run system at higher potential in order to avoid generating polymer firstly other than regenerate complicatedly it after its passivation. Polymer formation can be prevented by application of an anode potential ≥2.1 V, which can completely mineralize phenol to carbon dioxide etc. and prevent polymerization of phenol. If there is still a bit of polymer formed inevitably, washing electrodes with suitable solvents is an effective alternative

Spectroscopic and redox properties of curium and californium ions in concentrated aqueous carbonate-bicarbonate media

International Nuclear Information System (INIS)

Hobart, D.E.; Varlashkin, P.G.; Samhoun, K.; Haire, R.G.; Peterson, J.R.

1983-01-01

Multimilligram quantities of trivalent curium-248 and californium-249 were investigated by absorption spectroscopy, cyclic voltammetry, and bulk solution electrolysis in concentrated aqueous carbonate-bicarbonate solution. Actinide concentrations between 10 -4 and 10 -2 M were studied in 2 M sodium carbonate and 5.5 M potassium carbonate solutions at pH values from 8 to 14. The solution absorption spectra of Cm(III) and Cf(III) in carbonate media are presented for the first time and compared to literature spectra of these species in noncomplexing aqueous solution. It was anticipated that carbonate complexation of the actinide ions could provide a sufficient negative shift in the formal potentials of the M(IV)/M(III) couples of Cm and Cf to permit the generation and stabilization of their tetravalent states in aqueous carbonate-bicarbonate medium. No conclusive evidence was found in the present work to indicate the existence of any higher oxidation states of curium or californium in carbonate solution. Some possible reasons for our inability to generate and detect oxidized species of curium and californium in this medium are discussed

Treated Carbon Nanofibers for Storing Energy in Aqueous KOH

Science.gov (United States)

Firsich, David W.

2004-01-01

A surface treatment has been found to enhance the performances of carbon nanofibers as electrode materials for electrochemical capacitors in which aqueous solutions of potassium hydroxide are used as the electrolytes. In the treatment, sulfonic acid groups are attached to edge plane sites on carbon atoms. The treatment is applicable to a variety of carbon nanofibers, including fibrils and both single- and multiple-wall nanotubes. The reason for choosing nanofibers over powders and other forms of carbon is that nanofibers offer greater power features. In previous research, it was found that the surface treatment of carbon nanofibers increased energy-storage densities in the presence of acid electrolytes. Now, it has been found that the same treatment increases energy-storage densities of carbon nanofibers in the presence of alkaline electrolytes when the carbon is paired with a NiOOH electrode. This beneficial effect varies depending on the variety of carbon substrate to which it is applied. It has been conjectured that the sulfonic acid groups, which exist in a deprotonated state in aqueous KOH solutions, undergo reversible electro-chemical reactions that are responsible for the observed increases in energystorage capacities. The increases can be considerable: For example, in one case, nanofibers exhibited a specific capacitance of 34 Farads per gram before treatment and 172 Farads per gram (an increase of about 400 percent) after treatment. The most promising application of this development appears to lie in hybrid capacitors, which are devices designed primarily for storing energy. These devices are designed to be capable of (1) discharge at rates greater than those of batteries and (2) storing energy at densities approaching those of batteries. A hybrid capacitor includes one electrode like that of a battery and one electrode like that of an electrochemical capacitor. For example, a hybrid capacitor could contain a potassium hydroxide solution as the electrolyte

Precipitation of calcium carbonate in aqueous solutions in presence of ethylene glycol and dodecane.

Science.gov (United States)

Natsi, Panagiota D.; Rokidi, Stamatia; Koutsoukos, Petros G.

2015-04-01

The formation of calcium carbonate (CaCO3) in aqueous supersaturated solutions has been intensively studied over the past decades, because of its significance for a number of processes of industrial and environmental interest. In the oil and gas production industry the deposition of calcium carbonate affects adversely the productivity of the wells. Calcium carbonate scale deposits formation causes serious problems in water desalination, CO2 sequestration in subsoil wells, in geothermal systems and in heat exchangers because of the low thermal coefficient of the salt. Amelioration of the operational conditions is possible only when the mechanisms underlying nucleation and crystal growth of calcium carbonate in the aqueous fluids is clarified. Given the fact that in oil production processes water miscible and immiscible hydrocarbons are present the changes of the dielectric constant of the fluid phase has serious impact in the kinetics of calcium carbonate precipitation, which remains largely unknown. The problem becomes even more complicated if polymorphism exhibited by calcium carbonate is also taken into consideration. In the present work, the stability of aqueous solutions supersaturated with respect to all calcium carbonate polymorphs and the subsequent kinetics of calcium carbonate precipitation were measured. The measurements included aqueous solutions and solutions in the presence of water miscible (ethylene glycol, MEG) and water immiscible organics (n-dodecane). All measurements were done at conditions of sustained supersaturation using the glass/ Ag/AgCl combination electrode as a probe of the precipitation and pH as the master variable for the addition of titrant solutions with appropriate concentration needed to maintenance the solution supersaturation. Initially, the metastable zone width was determined from measurements of the effect of the solution supersaturation on the induction time preceding the onset of precipitation at free-drift conditions. The

Commentary: Ex Situ Aqueous Mineral Carbonation

Energy Technology Data Exchange (ETDEWEB)

Gadikota, Greeshma, E-mail: gadikota@princeton.edu [Department of Civil and Environmental Engineering, Princeton University, Princeton, NJ (United States)

2016-05-26

CO{sub 2} conversion to calcium and magnesium carbonates has garnered considerable attention since it is a thermodynamically downhill pathway to safely and permanently sequester large quantities of CO{sub 2}. This seminal work performed at The National Energy Technology Laboratory in Albany (NETL-Albany) reports the conversion of calcium- and magnesium-bearing silicate minerals, such as olivine [(Mg, Fe){sub 2}SiO{sub 4}], wollastonite (CaSiO{sub 3}), and serpentine [Mg{sub 3}Si{sub 2}O{sub 5}(OH){sub 4}], as they are reacted with CO{sub 2} in an aqueous environment to form magnesium or calcium carbonates. This paper discusses various pretreatment methods of the starting materials, such as grinding or heat treatment of hydroxylated Mg silicates, to enhance the reaction kinetics. The effects of various chemical additives (e.g., NaCl and NaHCO{sub 3}), and reaction parameters, such as temperature, pressure, and reaction time, on the conversion are investigated. Feasibility assessments and energy and economic analyses of the direct carbonation of calcium- and magnesium-bearing minerals are presented.

Toward an Aqueous Solar Battery: Direct Electrochemical Storage of Solar Energy in Carbon Nitrides.

Science.gov (United States)

Podjaski, Filip; Kröger, Julia; Lotsch, Bettina V

2018-03-01

Graphitic carbon nitrides have emerged as an earth-abundant family of polymeric materials for solar energy conversion. Herein, a 2D cyanamide-functionalized polyheptazine imide (NCN-PHI) is reported, which for the first time enables the synergistic coupling of two key functions of energy conversion within one single material: light harvesting and electrical energy storage. Photo-electrochemical measurements in aqueous electrolytes reveal the underlying mechanism of this "solar battery" material: the charge storage in NCN-PHI is based on the photoreduction of the carbon nitride backbone and charge compensation is realized by adsorption of alkali metal ions within the NCN-PHI layers and at the solution interface. The photoreduced carbon nitride can thus be described as a battery anode operating as a pseudocapacitor, which can store light-induced charge in the form of long-lived, "trapped" electrons for hours. Importantly, the potential window of this process is not limited by the water reduction reaction due to the high intrinsic overpotential of carbon nitrides for hydrogen evolution, potentially enabling new applications for aqueous batteries. Thus, the feasibility of light-induced electrical energy storage and release on demand by a one-component light-charged battery anode is demonstrated, which provides a sustainable solution to overcome the intermittency of solar radiation. © 2018 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

Carbon steel protection in G.S. (Girlder sulfide) plants. CITROSOLV process influence. Pt. 6

International Nuclear Information System (INIS)

Lires, O.A.; Burkart, A.L.; Delfino, C.A.; Rojo, E.A.

1988-01-01

In order to protect carbon steel towers and piping of Girlder sulfide (G.S.) experimental heavy water plants against corrosion produced by the action of aqueous solutions of hydrogen sulfides, a method, previously published, was developed. Carbon steel, exposed to saturated aqueous solutions of hydrogen sulfide, forms iron sulfide scales. In oxygen free solutions evolution of corrosion follows the sequence: mackinawite → cubic ferrous sulfide → troilite → pyrrotite → pyrite. Scales formed by pyrrotite-pyrite or pyrite are the most protective layers (these are obtained at 130 deg C, 2 MPa, for periods of 14 days). CITROSOLV Process (Pfizer) is used to descaling and passivating stainless steel plant's components. This process must be used in mixed (carbon steel - stainless steel) circuits and may cause the formation of magnetite scales over the carbon steel. The influence of magnetite in the pyrrotite-pyrite scales formation is studied in this work. (Author) [es

Bulk and Surface Aqueous Speciation of Calcite: Implications for Low-Salinity Waterflooding of Carbonate Reservoirs

KAUST Repository

Yutkin, Maxim P.

2017-08-25

Low-salinity waterflooding (LSW) is ineffective when reservoir rock is strongly water-wet or when crude oil is not asphaltenic. Success of LSW relies heavily on the ability of injected brine to alter surface chemistry of reservoir crude-oil brine/rock (COBR) interfaces. Implementation of LSW in carbonate reservoirs is especially challenging because of high reservoir-brine salinity and, more importantly, because of high reactivity of the rock minerals. Both features complicate understanding of the COBR surface chemistries pertinent to successful LSW. Here, we tackle the complex physicochemical processes in chemically active carbonates flooded with diluted brine that is saturated with atmospheric carbon dioxide (CO2) and possibly supplemented with additional ionic species, such as sulfates or phosphates. When waterflooding carbonate reservoirs, rock equilibrates with the injected brine over short distances. Injected-brine ion speciation is shifted substantially in the presence of reactive carbonate rock. Our new calculations demonstrate that rock-equilibrated aqueous pH is slightly alkaline quite independent of injected-brine pH. We establish, for the first time, that CO2 content of a carbonate reservoir, originating from CO2-rich crude oil and gas, plays a dominant role in setting aqueous pH and rock-surface speciation. A simple ion-complexing model predicts the calcite-surface charge as a function of composition of reservoir brine. The surface charge of calcite may be positive or negative, depending on speciation of reservoir brine in contact with the calcite. There is no single point of zero charge; all dissolved aqueous species are charge determining. Rock-equilibrated aqueous composition controls the calcite-surface ion-exchange behavior, not the injected-brine composition. At high ionic strength, the electrical double layer collapses and is no longer diffuse. All surface charges are located directly in the inner and outer Helmholtz planes. Our evaluation of

Carbon dioxide assist for non-aqueous sodium–oxygen batteries

KAUST Repository

Das, Shyamal K.; Xu, Shaomao; Archer, Lynden A.

2013-01-01

We report a novel non-aqueous Na-air battery that utilizes a gas mixture of CO2 and O2. The battery exhibits a high specific energy of 6500-7000 Whkg- 1 (based on the carbon mass) over a range of CO2 feed compositions. The energy density achieved

High-performance zno transistors processed via an aqueous carbon-free metal oxide precursor route at temperatures between 80-180 °c

KAUST Repository

Lin, Yenhung; Faber, Hendrik; Zhao, Kui; Wang, Qingxiao; Amassian, Aram; McLachlan, Martyn A.; Anthopoulos, Thomas D.

2013-01-01

An aqueous and carbon-free metal-oxide precursor route is used in combination with a UV irradiation-assisted low-temperature conversion method to fabricate low-voltage ZnO transistors with electron mobilities exceeding 10 cm2/Vs at temperatures <

Recovery of glycols, sugars, and Related Multiple -OH Compounds from Dilute-Aqueous Solution by Regenerable Adsorption onto Activated Carbons

Energy Technology Data Exchange (ETDEWEB)

Chinn, Daniel [Univ. of California, Berkeley, CA (United States)

1999-06-01

The present research explores the use of adsorption onto activated carbons as a means of recover glycerol, glycols, and sugars from dilute-aqueous solution. Our work is focused on understanding the mechanisms of adsorption onto carbons, assessing the degree of adsorption reversibility with precision, and implementing a bench-scale recovery process that results in a higher product concentration and reduction of the energy load for final purification.

AI applications in sheet metal forming

CERN Document Server

Hussein, Hussein

2017-01-01

This book comprises chapters on research work done around the globe in the area of artificial intelligence (AI) applications in sheet metal forming. The first chapter offers an introduction to various AI techniques and sheet metal forming, while subsequent chapters describe traditional procedures/methods used in various sheet metal forming processes, and focus on the automation of those processes by means of AI techniques, such as KBS, ANN, GA, CBR, etc. Feature recognition and the manufacturability assessment of sheet metal parts, process planning, strip-layout design, selecting the type and size of die components, die modeling, and predicting die life are some of the most important aspects of sheet metal work. Traditionally, these activities are highly experience-based, tedious and time consuming. In response, researchers in several countries have applied various AI techniques to automate these activities, which are covered in this book. This book will be useful for engineers working in sheet metal industri...

Thermodynamics of aqueous carbonate solutions including mixtures of sodium carbonate, bicarbonate, and chloride

Energy Technology Data Exchange (ETDEWEB)

Peiper, J.C.; Pitzer, K.S.

1982-01-01

Recently the authors examined electrochemical-cell data leading to values of the activity coefficient for aqueous sodium bicarbonate. Since that preliminary analysis, new experimental measurements have been published which contribute significantly to the overall thermodynamic understanding of (sodium carbonate + sodium bicarbonate + carbonic acid). In this more extensive examination we consider a wide variety of measurements leading to activity coefficients of Na/sub 2/CO/sub 3/ and NaHCO/sub 3/ from 273 to 323 K and to relative molar enthalpies and heat capacities at 298.15 K. Tables of thermodynamic quantities at selected temperatures are included. 47 references, 2 figures, 6 tables.

Relationship between structural properties and electrochemical characteristics of monolithic carbon xerogel-based electrochemical double-layer electrodes in aqueous and organic electrolytes

Energy Technology Data Exchange (ETDEWEB)

Zeller, Mario [Bavarian Center for Applied Energy Research e.V. (ZAE Bayern), Wuerzburg (Germany); Institute of Radiology, University Clinic, University of Wuerzburg (Germany); Lorrmann, Volker; Reichenauer, Gudrun; Wiener, Matthias [Bavarian Center for Applied Energy Research e.V. (ZAE Bayern), Wuerzburg (Germany); Pflaum, Jens [Bavarian Center for Applied Energy Research e.V. (ZAE Bayern), Wuerzburg (Germany); Department of Experimental Physics VI, Julius-Maximilians-University of Wuerzburg (Germany)

2012-05-15

The impact of the micropore width, external surface area, and meso-/macropore size on the charging performance of electrochemical double-layer capacitor (EDLC) electrodes is systematically investigated. Nonactivated carbon xerogels are used as model electrodes in aqueous and organic electrolytes. Monolithic porous model carbons with different structural parameters are prepared using a resorcinol-formaldehyde-based sol-gel process and subsequent pyrolysis of the organic precursors. Electrochemical properties are characterized by utilizing them as EDLC half-cells operated in aqueous and organic electrolytes, respectively. Experimental data derived for organic electrolytes reveals that the respective ions cannot enter the micropores within the skeleton of the meso- and macroporous carbons. Therefore the total capacitance is limited by the external surface formed by the interface between the meso-/macropores and the microporous carbon particles forming the xerogel skeleton. In contrast, for aqueous electrolytes the total capacitance solely depends on the total surface area, including interfaces at the micropore scale. For both types of electrolytes the charging rate of the electrodes is systematically enhanced when increasing the diameter of the carbon xerogel particles from 10 to 75 nm and the meso-/macropore size from 10 to 121 nm. (Copyright copyright 2012 WILEY-VCH Verlag GmbH and Co. KGaA, Weinheim)

Carbon activation process for increased surface accessibility in electrochemical capacitors

Science.gov (United States)

Doughty, Daniel H.; Eisenmann, Erhard T.

2001-01-01

A process for making carbon film or powder suitable for double capacitor electrodes having a capacitance of up to about 300 F/cm.sup.3 is disclosed. This is accomplished by treating in aqueous nitric acid for a period of about 5 to 15 minutes thin carbon films obtained by carbonizing carbon-containing polymeric material having a high degree of molecular directionality, such as polyimide film, then heating the treated carbon film in a non-oxidizing atmosphere at a non-graphitizing temperature of at least 350.degree. C. for about 20 minutes, and repeating alternately the nitric acid step and the heating step from 7 to 10 times. Capacitors made with this carbon may find uses ranging from electronic devices to electric vehicle applications.

Activated carbons employed to remove ionic liquids from aqueous solutions

International Nuclear Information System (INIS)

Hassan, S.; Farooq, A.; Ahmad, M.A.; Irfan, N.; Tufail, M.

2011-01-01

Imidazolium and pyridinium based ionic liquids (ILs) have been separated from aqueous solutions by adsorption using a raw Chinese activated carbon (CAC), a bleached Chinese activated carbon (BAC) and an acid treated Chinese activated carbon (AAC) as adsorbent. Adsorption isotherms data of ionic liquids on activated carbons has been obtained. The influence of both cations and anions was analyzed by studying three different ILs. The role of surface chemistry of the adsorbent was also examined using activated carbons modified by oxidative treatments. The BET surface area of activated carbons was measured by nitrogen adsorption. The results of this work indicate that activated carbon is an attractive adsorbent to remove ionic liquids from water streams. It has also been demonstrated that the adsorption of hydrophilic ionic liquids can be improved by modifying the amount and nature of oxygen groups on the activated carbon surface specially by increasing basic groups. The adsorption data for isotherms was studied at acidic, neutral and basic pH values. (author)

Combined Effect of Temperature and pKa on the Kinetics of Absorption of Carbon Dioxide in Aqueous Alkanolamine and Carbonate Solutions with Carbonic Anhydrase

NARCIS (Netherlands)

Penders-Van Elk, Nathalie J M C; Oversteegen, S. Martijn; Versteeg, Geert F.

2016-01-01

In present work the absorption of carbon dioxide in aqueous N-methyldiethanolamine, N,N-dimethylethanolamine, and triisopropanolamine solutions with and without the enzyme carbonic anhydrase has been studied in a stirred cell reactor at temperatures varying between 278 and 313 K, at an alkanolamine

A Layout for the Carbon Capture with Aqueous Ammonia without Salt Precipitation

DEFF Research Database (Denmark)

Bonalumi, Davide; Valenti, Gianluca; Lillia, Stefano

2016-01-01

Post-combustion carbon capture technologies seem to be necessary to realize the CO2 mitigation policies internationally shared for the next future, despite none of them appears to be ready for full-scale applications. This work considers the aqueous ammonia based process for a coal-fired Ultra....... The second layout operates at cooled conditions, which does not yield any salt precipitation. The Chilled layout reveals low specific heat duty and SPECCA equal to 2.2 and 2.86 MJ/kgco2, respectively. In contrast, the Cooled layout presents a higher specific heat duty of almost 3 MJ/kgco2 but, importantly...

Adsorption of cadmium from aqueous solutions on sulfurized activated carbon prepared from nut shells

International Nuclear Information System (INIS)

Fouladi Tajar, Amir; Kaghazchi, Tahereh; Soleimani, Mansooreh

2009-01-01

Low-cost activated carbon, derived from nut shells, and its modified sample have been used as replacements for the current expensive methods of removing cadmium from aqueous solutions and waste waters. Adsorption of cadmium onto four kinds of activated carbons has been studied; prepared activated carbon (PAC), commercial activated carbon (CAC), and the sulfurized ones (SPAC and SCAC). The activated carbon has been derived, characterized, treated with sulfur and then utilized for the removal of Cd 2+ . Sulfurizing agent (SO 2 gas) was successfully used in adsorbents' modification process at the ambient temperature. Samples were then characterized and tested as adsorbents of cadmium. Effect of some parameters such as contact time, initial concentration and pH were examined. With increasing pH, the adsorption of cadmium ions was increased and maximum removal, 92.4% for SPAC, was observed in pH > 8.0 (C 0 = 100 mg/L). The H-type adsorption isotherms, obtained for the adsorbents, indicated a favorable process. Adsorption data on both prepared and commercial activated carbon, before and after sulfurization, followed both the Frendlich and Langmuir models. They were better fitted by Frendlich isotherm as compared to Langmuir. The maximum adsorption capacities were 90.09, 104.17, 126.58 and 142.86 mg/g for CAC, PAC, SCAC and SPAC, respectively. Accordingly, surface modification of activated carbons using SO 2 greatly enhanced cadmium removal. The reversibility of the process has been studied in a qualitative manner and it shows that the spent SPAC can be effectively regenerated for further use easily.

Apolipoprotein A-I configuration and cell cholesterol efflux activity of discoidal lipoproteins depend on the reconstitution process.

Science.gov (United States)

Cuellar, Luz Ángela; Prieto, Eduardo Daniel; Cabaleiro, Laura Virginia; Garda, Horacio Alberto

2014-01-01

Discoidal high-density lipoproteins (D-HDL) are critical intermediates in reverse cholesterol transport. Most of the present knowledge of D-HDL is based on studies with reconstituted lipoprotein complexes of apolipoprotein A-I (apoA-I) obtained by cholate dialysis (CD). D-HDL can also be generated by the direct microsolubilization (DM) of phospholipid vesicles at the gel/fluid phase transition temperature, a process mechanistically similar to the "in vivo" apoAI lipidation via ABCA1. We compared the apoA-I configuration in D-HDL reconstituted with dimyristoylphosphatidylcholine by both procedures using fluorescence resonance energy transfer measurements with apoA-I tryptophan mutants and fluorescently labeled cysteine mutants. Results indicate that apoA-I configuration in D-HDL depends on the reconstitution process and are consistent with a "double belt" molecular arrangement with different helix registry. As reported by others, a configuration with juxtaposition of helices 5 of each apoAI monomer (5/5 registry) predominates in D-HDL obtained by CD. However, a configuration with helix 5 of one monomer juxtaposed with helix 2 of the other (5/2 registry) would predominate in D-HDL generated by DM. Moreover, we also show that the kinetics of cholesterol efflux from macrophage cultures depends on the reconstitution process, suggesting that apoAI configuration is important for this HDL function. Copyright © 2013 Elsevier B.V. All rights reserved.

AIS authentication

CERN Multimedia

2006-01-01

Users are invited to use the NICE password for AIS authentication. As announced in CNL June-August 2006 (see http://www.cerncourier.com/articles/cnl/3/6/14/1) it is possible to use the NICE username and password to log on to AIS. The procedure is now fully operational and users can themselves reset the AIS password such that the NICE password will be used for authentication required by AIS applications. We strongly recommend CERN users who have a NICE account (this is the case of most users) to do this, with the objective to reduce the number of passwords they need to remember. This can be achieved very easily, directly from the Change Password option on the AIS login (https://aislogin.cern.ch/). Users should just select the '[Change Password]' option displayed at the bottom of the page, provide the 'Old Password' and then click on the button 'Use Nice password' followed by 'Submit'. Change Password option on the AIS login windowSetting the AIS password - Use Nice Password It should be noted that the proce...

Interaction of indium trichloride with calcium carbonate in aqueous solutions

International Nuclear Information System (INIS)

Kochetkova, N.V.; Toptygina, G.M.; Soklakova, O.V.; Evdokimov, V.I.

1991-01-01

Interaction of indium trichloride with calcium carbonate in aqueous solutions was studied, using methods of potentiometry, isothermal solubility and physicochemical computer simulating. The Gibb's energy value for crystal indium trihydroxide formation was calculated on the basis of experimental data on In(OH) 3 solubility. The value obtained was used for estimating equilibrium composition of InCl 3 -HCl-CaCO 3 -CO 2 -H 2 O system at a temperature of 25 deg C and carbon dioxide partial pressure of 0.05 to 1 at

Experimental measurement and thermodynamic modeling of the solubility of carbon dioxide in aqueous blends of monoethanolamine and diethanolamine

Science.gov (United States)

Suleman, Humbul; Maulud, Abdulhalim Shah; Man, Zakaria

2017-12-01

In this study, the solubilities of carbon dioxide in aqueous mixtures of monoethanolamine (MEA) and diethanolamine (DEA) were determined using a high pressure vapor-liquid equilibrium apparatus. The carbon dioxide loadings (mole of CO2/mole of amine mixture) were reported for a wide range of temperature (303.15, 323.15, 343.15 K) and pressure (100 - 4100 kPa). The carbon dioxide solubility shows an increase with increase in pressure and amine concentration and a decrease with increase in temperature in the aqueous blends of MEA and DEA. At carbon dioxide loadings above 1.0, the carbon dioxide solubility becomes a weak function of pressure and follows the general trend of carbon dioxide solubility in aqueous alkanolamines. The new experimental data points determined in this study were correlated by using a recently developed, enhanced Kent-Eisenberg model. An average absolute relative error of 9.4 % was observed between the model results and experimental data, indicating good correlative capability of the thermodynamic model.

Predicting adsorptive removal of chlorophenol from aqueous solution using artificial intelligence based modeling approaches.

Science.gov (United States)

Singh, Kunwar P; Gupta, Shikha; Ojha, Priyanka; Rai, Premanjali

2013-04-01

The research aims to develop artificial intelligence (AI)-based model to predict the adsorptive removal of 2-chlorophenol (CP) in aqueous solution by coconut shell carbon (CSC) using four operational variables (pH of solution, adsorbate concentration, temperature, and contact time), and to investigate their effects on the adsorption process. Accordingly, based on a factorial design, 640 batch experiments were conducted. Nonlinearities in experimental data were checked using Brock-Dechert-Scheimkman (BDS) statistics. Five nonlinear models were constructed to predict the adsorptive removal of CP in aqueous solution by CSC using four variables as input. Performances of the constructed models were evaluated and compared using statistical criteria. BDS statistics revealed strong nonlinearity in experimental data. Performance of all the models constructed here was satisfactory. Radial basis function network (RBFN) and multilayer perceptron network (MLPN) models performed better than generalized regression neural network, support vector machines, and gene expression programming models. Sensitivity analysis revealed that the contact time had highest effect on adsorption followed by the solution pH, temperature, and CP concentration. The study concluded that all the models constructed here were capable of capturing the nonlinearity in data. A better generalization and predictive performance of RBFN and MLPN models suggested that these can be used to predict the adsorption of CP in aqueous solution using CSC.

Removal of mercury ion from aqueous solution by activated carbons obtained from biomass and coals

Energy Technology Data Exchange (ETDEWEB)

Ekinci, E.; Yardim, F. [Faculty of Chemical Engineering, Istanbul Technical University, Ayazaga, 80626 Istanbul (Turkey); Budinova, T.; Petrov, N.; Razvigorova, M.; Minkova, V. [Institute of Organic Chemistry, Bulgarian Academy of Sciences, Acad.G.Bonchev, str. bl. 9, Sofia (Bulgaria)

2002-06-20

The adsorption of Hg(II) from aqueous solution at 293 K by activated carbons obtained from apricot stones, furfural and coals was studied. Adsorption studies were performed under the varying conditions of time of treatment, metal ion concentration and pH. The process of adsorption followed Langmuir isotherm. The removal of Hg(II) increased with the increase of pH of the solution from 2 to 5 and remained constant up to pH 10. Desorption studies were preformed.

Carbon microspheres as ball bearings in aqueous-based lubrication.

Science.gov (United States)

St Dennis, J E; Jin, Kejia; John, Vijay T; Pesika, Noshir S

2011-07-01

We present an exploratory study on a suspension of uniform carbon microspheres as a new class of aqueous-based lubricants. The surfactant-functionalized carbon microspheres (∼0.1 wt %) employ a rolling mechanism similar to ball bearings to provide low friction coefficients (μ ≈ 0.03) and minimize surface wear in shear experiments between various surfaces, even at high loads and high contact pressures. The size range, high monodispersity, and large yield stress of the C(μsphere), as well as the minimal environmental impact, are all desirable characteristics for the use of a C(μsphere)-SDS suspension as an alternative to oil-based lubricants in compatible devices and machinery.

Effect of pKa on the kinetics of carbon dioxide absorption in aqueous alkanolamine solutions containing carbonic anhydrase at 298K

NARCIS (Netherlands)

Penders-van Elk, Nathalie J M C; Fradette, Sylvie; Versteeg, Geert F.

2015-01-01

The absorption of carbon dioxide in various aqueous alkanolamine solutions have been studied with and without carbonic anhydrase respectively in a stirred cell reactor at 298K. The examined alkanolamines were: N,N-diethylethanolamine (DEMEA), N,N-dimethylethanolamine (DMMEA), monoethanolamine (MEA),

The Potential of AI Techniques for Remote Sensing

Science.gov (United States)

Estes, J. E.; Sailer, C. T. (Principal Investigator); Tinney, L. R.

1984-01-01

The current status of artificial intelligence AI technology is discussed along with imagery data management, database interrogation, and decision making. Techniques adapted from the field of artificial intelligence (AI) have significant, wide ranging impacts upon computer-assisted remote sensing analysis. AI based techniques offer a powerful and fundamentally different approach to many remote sensing tasks. In addition to computer assisted analysis, AI techniques can also aid onboard spacecraft data processing and analysis and database access and query.

Ligand adsorption on an activated carbon for the removal of chromate ions from aqueous solutions.

Science.gov (United States)

García-Martín, J; López-Garzón, R; Godino-Salido, M Luz; Gutiérrez-Valero, M Dolores; Arranz-Mascarós, P; Cuesta, R; Carrasco-Marín, F

2005-07-19

The results presented in this work are related to the design of a guideline to develop specific properties at the surface of an activated carbon (AC). For this, two model aromatic compounds have been synthesized and their electrolytic behavior in aqueous solutions was studied by a potentiometric method. The textural characteristics of the activated carbon were determined by porosimetry methods. The nature of oxygen-carrying functions and the acid-base behavior of the AC surface were characterized by TPD and potentiometric titration methods, respectively. The adsorption and desorption equilibria of the aromatic compounds on activated carbon were measured in aqueous solutions, and the hysteresis between adsorption and desorption, which reveals irreversible adsorption, was discussed on the basis of the frontier orbital theory. HOMO and LUMO orbitals of the adsorbent and adsorbates were calculated, and irreversible adsorption was attributed to the small energy difference between HOMO and LUMO of the aromatic adsorbates and the adsorbent. Adsorption equilibria of K2CrO4 in aqueous solution on the AC alone and on the AC-aromatic ligand adsorbents, respectively, prove the efficient development of specific chemical functions at the carbon surface provided by the adsorbed aromatic compounds.

Sustainable Carbon/Carbon Supercapacitors Operating Down to -40 °C in Aqueous Electrolyte Made with Cholinium Salt.

Science.gov (United States)

Abbas, Qamar; Béguin, François

2018-03-09

Cholinium chloride at a concentration of 5 mol kg -1 in water is proposed as a low-cost and environmentally friendly aqueous electrolyte, enabling extension of the operating range of carbon/carbon supercapacitors (SCs) down to -40 °C. This solution has a pH close to neutrality (pH 6.1) and high conductivity of 88 mS cm -1 at 24 °C. The supercapacitors demonstrate a high capacitance of 126 F g -1 (per mass of one electrode) and long life span at voltages up to 1.5 V. At -40 °C, the carbon/carbon SCs display excellent electrochemical characteristics with only slightly reduced capacitance of 106 F g -1 and negligible ohmic losses. As compared to previous works, where antifreezing additives were introduced in traditional neutral electrolytes, the low solubility of the salt and related poor conductivity of the solution is no longer an issue, which makes cholinium salt aqueous solutions very promising for SCs operating at sub-ambient temperature conditions. © 2018 Wiley-VCH Verlag GmbH & Co. KGaA, Weinheim.

Kinetics of absorption of carbon dioxide in aqueous ammonia solutions

NARCIS (Netherlands)

Derks, P. W. J.; Versteeg, G. F.

2009-01-01

In the present work the absorption of carbon dioxide into aqueous ammonia solutions has been studied in a stirred cell reactor, at low temperatures and ammonia concentrations ranging from 0.1 to about 7 kmol m-3. The absorption experiments were carried out at conditions where the so-called pseudo

Catalytic ozonation of pentachlorophenol in aqueous solutions using granular activated carbon

Science.gov (United States)

Asgari, Ghorban; Samiee, Fateme; Ahmadian, Mohammad; Poormohammadi, Ali; solimanzadeh, Bahman

2017-03-01

The efficiency of granular activated carbon (GAC) was investigated in this study as a catalyst for the elimination of pentachlorophenol (PCP) from contaminated streams in a laboratory-scale semi-batch reactor. The influence of important parameters including solution pH (2-10), radical scavenger (tert-butanol, 0.04 mol/L), catalyst dosage (0.416-8.33 g/L), initial PCP concentration (100-1000 mg/L) and ozone flow rate (2.3-12 mg/min) was examined on the efficiency of the catalytic ozonation process (COP) in degradation and mineralization of PCP in aqueous solution. The experimental results showed that catalytic ozonation with GAC was most effective at pH of 8 with ozone flow rate of 12 mg/min and a GAC dosage of 2 g. Compared to the sole ozonation process (SOP), the removal levels of PCP and COP were, 98, and 79 %, respectively. The degradation rate of kinetics was also investigated. The results showed that using a GAC catalyst in the ozonation of PCP produced an 8.33-fold increase in rate kinetic compared to the SOP under optimum conditions. Tert-butanol alcohol (TBA) was used as a radical scavenger. The results demonstrated that COP was affected less by TBA than by SOP. These findings suggested that GAC acts as a suitable catalyst in COP to remove refractory pollutants from aqueous solution.

Preparation and Utilization of Kapok Hull Carbon for the Removal of Rhodamine-B from Aqueous Solution

Directory of Open Access Journals (Sweden)

P. S. Syed Shabudeen

2006-01-01

Full Text Available A carbonaceous sorbent prepared from the indegeneous agricultural waste (which is facing solid waste disposal problem Kapok Hull, by acid treatment was tested for its efficiency in removing basic dyes. Batch kinetic and isotherm experiments were conducted to determine the sorption and desorption of the Rhodamine-B from aqueous solution with activated carbon. The factors affecting the rate processes involved in the removal of dye for initial dye concentration, agitation time, and carbon dose and particle size have been studied at ambient temperature. The adsorption process followed first order rate kinetics. The first-order rate equation by Lagergren was tested on the kinetic data, and isotherm data was analyzed for possible agreement with the Langmuir and Freundlich adsorption isotherm equations. The intraparticle diffusion rate equation from which adsorption rate constants, diffusion rate constants and diffusion coefficients were determined. Intraparticle diffusion was found to be the rate-limiting step. The structural and morphological of activated carbon were characterized by XRD and SEM studies respectively.

Application of Activated Carbon for Removal of Arsenic Ions from Aqueous Solutions

Directory of Open Access Journals (Sweden)

R. Ansari

2007-01-01

Full Text Available The activated carbon (AC was used for removal of As(III and As(V ions from aqueous solutions. Sorption experiments were conducted using both batch and column systems. The effect of some important parameters on sorption of these by AC was studied. It was found that among the different factors affecting sorption capacity and efficiency in removal of arsenic from aqueous solutions, the effect of pH and the oxidation state were the most prominent. The optimum pH values for removal of As(III and As(V from aqueous solutions using AC was found 12 and 3 respectively. Impregnation of AC with sulphur contain organic dyes, it is possible to improve As(III uptake considerably.

GPU: the biggest key processor for AI and parallel processing

Science.gov (United States)

Baji, Toru

2017-07-01

Two types of processors exist in the market. One is the conventional CPU and the other is Graphic Processor Unit (GPU). Typical CPU is composed of 1 to 8 cores while GPU has thousands of cores. CPU is good for sequential processing, while GPU is good to accelerate software with heavy parallel executions. GPU was initially dedicated for 3D graphics. However from 2006, when GPU started to apply general-purpose cores, it was noticed that this architecture can be used as a general purpose massive-parallel processor. NVIDIA developed a software framework Compute Unified Device Architecture (CUDA) that make it possible to easily program the GPU for these application. With CUDA, GPU started to be used in workstations and supercomputers widely. Recently two key technologies are highlighted in the industry. The Artificial Intelligence (AI) and Autonomous Driving Cars. AI requires a massive parallel operation to train many-layers of neural networks. With CPU alone, it was impossible to finish the training in a practical time. The latest multi-GPU system with P100 makes it possible to finish the training in a few hours. For the autonomous driving cars, TOPS class of performance is required to implement perception, localization, path planning processing and again SoC with integrated GPU will play a key role there. In this paper, the evolution of the GPU which is one of the biggest commercial devices requiring state-of-the-art fabrication technology will be introduced. Also overview of the GPU demanding key application like the ones described above will be introduced.

Novel star-like surfactant as dispersant for multi-walled carbon nanotubes in aqueous suspensions at high concentration

Science.gov (United States)

Qiao, Min; Ran, Qianping; Wu, Shishan

2018-03-01

A kind of novel surfactant with star-like molecular structure and terminated sulfonate was synthesized, and it was used as the dispersant for multi-walled carbon nanotubes (CNTs) in aqueous suspensions compared with a traditional single-chained surfactant. The star-like surfactant showed good dispersing ability for multi-walled CNTs in aqueous suspensions. Surface tension analysis, total organic carbon analysis, X-ray photoelectron spectroscopy, zeta potential, dynamic light scattering and transmission electron microscopy were performed to research the effect of star-like surfactant on the dispersion of multi-walled CNTs in aqueous suspensions. With the assistance of star-like surfactant, the CNTs could disperse well in aqueous suspension at high concentration of 50 g/L for more than 30 days, while the CNTs precipitated completely in aqueous suspension after 1 day without any dispersant or after 10 days with sodium 4-dodecylbenzenesulfonic acid as dispersant.

Electrochemical Study of Modified Glassy Carbon Electrode with Carboxyphenyl Diazonium Salt in Aqueous Solutions

Directory of Open Access Journals (Sweden)

Mariem BOUROUROU

2014-05-01

Full Text Available The covalent grafting of carboxyphenyl functionalities to planar carbon substrates by reaction with 2-carboxybenezenediazonium salt has been studied in aqueous acid solution. The surface was characterized, before and after the functionnalization process, by cyclic voltammetry, electrochemical impedance spectroscopy and linear sweep voltammetry (LSV in order to control and to prove the formation of a coating on the carbon surface. The results indicate the presence of substituted phenyl groups on the investigated surface. Electrochemical impedance measurements show that the slowing down of the electron transfer kinetics was more evident by increasing the number of cycles resulting to higher DEp and RCT parameters. Besides, the effect of the pH on the electron transfer processes of the Fe(CN63-/4- at the modified electrode is studied. By changing the solution pH the terminal group’s charge state would vary, based on which the surface pKa value is estimated.

Removal of mercury from aqueous solutions using activated carbon prepared from agricultural by-product/waste.

Science.gov (United States)

Rao, M Madhava; Reddy, D H K Kumar; Venkateswarlu, Padala; Seshaiah, K

2009-01-01

Removal of mercury from aqueous solutions using activated carbon prepared from Ceiba pentandra hulls, Phaseolus aureus hulls and Cicer arietinum waste was investigated. The influence of various parameters such as effect of pH, contact time, initial metal ion concentration and adsorbent dose for the removal of mercury was studied using a batch process. The experiments demonstrated that the adsorption process corresponds to the pseudo-second-order-kinetic models and the equilibrium adsorption data fit the Freundlich isotherm model well. The prepared adsorbents ACCPH, ACPAH and ACCAW had removal capacities of 25.88 mg/g, 23.66 mg/g and 22.88 mg/g, respectively, at an initial Hg(II) concentration of 40 mg/L. The order of Hg(II) removal capacities of these three adsorbents was ACCPH>ACPAH>ACCAW. The adsorption behavior of the activated carbon is explained on the basis of its chemical nature. The feasibility of regeneration of spent activated carbon adsorbents for recovery of Hg(II) and reuse of the adsorbent was determined using HCl solution.

Preparation of Multiwalled Carbon Nanotube-Poly (4-Styrenesulfonic Acid Aqueous Dispersion for Dopamine Sensing

Directory of Open Access Journals (Sweden)

Aihua LIU

2006-12-01

Full Text Available A simple and facile method for the non-covalent functionalization of multi-walled carbon nanotubes (MWNTs using poly(4-styrenesulfonic acid (PSS is proposed. The resulting PSS-MWNTs dispersion is readily soluble in water and can be left to stand for 2 weeks at room temperature, no phase separation with aggregation of nanotubes at the bottom of the vials was observed. The as-prepared PSS-MWNTs dispersions could facilitate the processing of the nanotubes into composites with high nanotube loading. The PSS-MWNTs complex shows high electrocatalytic activity to the oxidation of neutrontransmitter of dopamine, suggesting that the coating of PSS onto carbon nanotubes surface without destroying the electronic structures of the pristine carbon nanotubes; therefore, the unique properties including the catalytic property of the nanotubes retained. It is envisioned that the PSS-MWNTs aqueous dispersions may find possible applications in the development of biosensors, bioelectronics, separation and environment protection as well as other biological events where water-based environment is required.

Pulse electrodeposition of Pt and Pt–Ru methanol-oxidation nanocatalysts onto carbon nanotubes in citric acid aqueous solutions

Energy Technology Data Exchange (ETDEWEB)

Chou, Huei-Yu [Department of Engineering and System Science, National Tsing Hua University, Hsinchu 30013, Taiwan, ROC (China); Hsieh, Chien-Kuo [Department of Materials Engineering, Ming Chi University of Technology, New Taipei City 24301, Taiwan, ROC (China); Tsai, Ming-Chi; Wei, Yu-Hsuan; Yeh, Tsung-Kuang [Department of Engineering and System Science, National Tsing Hua University, Hsinchu 30013, Taiwan, ROC (China); Tsai, Chuen-Horng, E-mail: tsai@aec.gov.tw [Department of Engineering and System Science, National Tsing Hua University, Hsinchu 30013, Taiwan, ROC (China)

2015-06-01

In this study, platinum nanoparticle/carbon nanotube (Pt NP/CNT) and platinum–ruthenium nanoparticle (Pt–Ru NP/CNT) hybrid nanocatalysts were prepared by the pulse-electrodeposition method in different aqueous solutions containing citric acid (CA) or sulfuric acid (SA). The electrocatalytic properties of the Pt NP/CNT and Pt–Ru NP/CNT electrodes prepared using different aqueous solutions were investigated for methanol oxidation. The results show that the electrochemical mass activities of these hybrid nanocatalysts prepared in the CA aqueous solution were increased by factors of 1.46 and 2.77 for Pt NPs and Pt–Ru NPs, respectively, compared with those prepared in SA aqueous solutions using the same procedure. These increased mass activities are attributed to the CA playing dual roles as both a stabilizing agent and a particle size reducing agent in the aqueous solutions. The approach developed in this work enables further reductions in the particle sizes of noble-metal nanocatalysts. - Highlights: • Pulse-electrodeposition of Pt or Pt–Ru nanoparticles on carbon nanotubes • Carbon nanotubes used as a catalyst-supporting material • Citric acid used as reducing agent in the aqueous electrodeposition solutions • Electrochemical activity for methanol oxidation improved by a factor of 1.46 to 2.77.

Processing methods, characteristics and adsorption behavior of tire derived carbons: a review.

Science.gov (United States)

Saleh, Tawfik A; Gupta, Vinod Kumar

2014-09-01

The remarkable increase in the number of vehicles worldwide; and the lack of both technical and economical mechanisms of disposal make waste tires to be a serious source of pollution. One potential recycling process is pyrolysis followed by chemical activation process to produce porous activated carbons. Many researchers have recently proved the capability of such carbons as adsorbents to remove various types of pollutants including organic and inorganic species. This review attempts to compile relevant knowledge about the production methods of carbon from waste rubber tires. The effects of various process parameters including temperature and heating rate, on the pyrolysis stage; activation temperature and time, activation agent and activating gas are reviewed. This review highlights the use of waste-tires derived carbon to remove various types of pollutants like heavy metals, dye, pesticides and others from aqueous media. Copyright © 2014 Elsevier B.V. All rights reserved.

Removal of Ni(II), Zn(II) and Pb(II) ions from single metal aqueous solution using rice husk-based activated carbon

Energy Technology Data Exchange (ETDEWEB)

Taha, Mohd F., E-mail: faisalt@petronas.com.my; Shaharun, Maizatul S. [Fundamental and Applied Sciences Department, Universiti Teknologi PETRONAS, Bandar Seri Iskandar, 31750, Perak Darul Ridzuan (Malaysia); Shuib, Anis Suhaila, E-mail: anisuha@petronas.com.my; Borhan, Azry [Chemical Engineering Department, Universiti Teknologi PETRONAS, Bandar Seri Iskandar, 31750, Perak Darul Ridzuan (Malaysia)

2014-10-24

An attempt was made to investigate the potential of rice husk-based activated carbon as an alternative low-cost adsorbent for the removal of Ni(II), Zn(II) and Pb(II) ions from single aqueous solution. Rice husk-based activated carbon was prepared via treatment of rice husk with NaOH followed by the carbonization process at 400°C for 2 hours. Three samples, i.e. raw rice husk, rice husk treated with NaOH and rice husk-based activated carbon, were analyzed for their morphological characteristics using field-emission scanning electron microscope/energy dispersive X-ray (FESEM/EDX). These samples were also analyzed for their carbon, hydrogen, nitrogen, oxygen and silica contents using CHN elemental analyzer and FESEM/EDX. The porous properties of rice husk-based activated carbon were determined by Brunauer-Emmett-Teller (BET) surface area analyzer, and its surface area and pore volume were 255 m{sup 2}/g and 0.17 cm{sup 2}/g, respectively. The adsorption studies for the removal of Ni(II), Zn(II) and Pb(II) ions from single metal aqueous solution were carried out at a fixed initial concentration of metal ion (150 ppm) with variation amount of adsorbent (rice husk-based activated carbon) as a function of varied contact time at room temperature. The concentration of each metal ion was analyzed using atomic absorption spectrophotometer (AAS). The results obtained from adsorption studies indicate the potential of rice husk as an economically promising precursor for the preparation of activated carbon for removal of Ni(II), Zn(II) and Pb(II) ions from single aqueous solution. Isotherm and kinetic model analyses suggested that the experimental data of adsorption studies fitted well with Langmuir, Freundlich and second-order kinetic models.

Metal-free supercapacitor with aqueous electrolyte and low-cost carbon materials

Science.gov (United States)

Blomquist, Nicklas; Wells, Thomas; Andres, Britta; Bäckström, Joakim; Forsberg, Sven; Olin, Håkan

2017-01-01

Electric double-layer capacitors (EDLCs) or supercapacitors (SCs) are fast energy storage devices with high pulse efficiency and superior cyclability, which makes them useful in various applications including electronics, vehicles and grids. Aqueous SCs are considered to be more environmentally friendly than those based on organic electrolytes. Because of the corrosive nature of the aqueous environment, however, expensive electrochemically stable materials are needed for the current collectors and electrodes in aqueous SCs. This results in high costs for a given energy-storage capacity. To address this, we developed a novel low-cost aqueous SC using graphite foil as the current collector and a mix of graphene, nanographite, simple water-purification carbons and nanocellulose as electrodes. The electrodes were coated directly onto the graphite foil by using casting frames and the SCs were assembled in a pouch cell design. With this approach, we achieved a material cost reduction of greater than 90% while maintaining approximately one-half of the specific capacitance of a commercial unit, thus demonstrating that the proposed SC can be an environmentally friendly, low-cost alternative to conventional SCs.

Ultrasonic Assisted Synthesis of Chromenes Catalyzed by Sodium Carbonate in Aqueous Media.

Science.gov (United States)

Sabbaghan, Maryam; Sofalgar, Pegah

2015-01-01

A simple, efficient, and environmentally benign procedure for the synthesis of 2-amino-4H-chromene ring has been achieved by the three-component reaction of an aromatic aldehyde, malononitrile and diverse enolizable C-H activated compound under ultrasound irradiation using sodium carbonate as a catalyst in aqueous media. Sodium carbonate as a natural salt, being available as an inexpensive catalyst combined with ultrasound method promoted this protocol in comparison to other methods and catalysts.

Functionalization and Dispersion of Carbon Nanomaterials Using an Environmentally Friendly Ultrasonicated Ozonolysis Process.

Science.gov (United States)

Yeo, Eudora S Y; Mathys, Gary I; Brack, Narelle; Thostenson, Erik T; Rider, Andrew N

2017-05-30

Functionalization of carbon nanomaterials is often a critical step that facilitates their integration into larger material systems and devices. In the as-received form, carbon nanomaterials, such as carbon nanotubes (CNTs) or graphene nanoplatelets (GNPs), may contain large agglomerates. Both agglomerates and impurities will diminish the benefits of the unique electrical and mechanical properties offered when CNTs or GNPs are incorporated into polymers or composite material systems. Whilst a variety of methods exist to functionalize carbon nanomaterials and to create stable dispersions, many the processes use harsh chemicals, organic solvents, or surfactants, which are environmentally unfriendly and may increase the processing burden when isolating the nanomaterials for subsequent use. The current research details the use of an alternative, environmentally friendly technique for functionalizing CNTs and GNPs. It produces stable, aqueous dispersions free of harmful chemicals. Both CNTs and GNPs can be added to water at concentrations up to 5 g/L and can be recirculated through a high-powered ultrasonic cell. The simultaneous injection of ozone into the cell progressively oxidizes the carbon nanomaterials, and the combined ultrasonication breaks down agglomerates and immediately exposes fresh material for functionalization. The prepared dispersions are ideally suited for the deposition of thin films onto solid substrates using electrophoretic deposition (EPD). CNTs and GNPs from the aqueous dispersions can be readily used to coat carbon- and glass-reinforcing fibers using EPD for the preparation of hierarchical composite materials.

Ion from Aqueous Solution using Magnetite, Activated Carbon

African Journals Online (AJOL)

ADOWIE PERE

Thermodynamic studies on Adsorption of lead (II) Ion from Aqueous Solution using. Magnetite ... process industries and agricultural activities, which tends to ... osmosis. These processes are however, not economically feasible for small scale industries .... Freundlich coefficient. ..... from binary component system, Beni-suef.

Regeneration of an aqueous solution from an acid gas absorption process by matrix stripping

Science.gov (United States)

Rochelle, Gary T [Austin, TX; Oyenekan, Babatunde A [Katy, TX

2011-03-08

Carbon dioxide and other acid gases are removed from gaseous streams using aqueous absorption and stripping processes. By replacing the conventional stripper used to regenerate the aqueous solvent and capture the acid gas with a matrix stripping configuration, less energy is consumed. The matrix stripping configuration uses two or more reboiled strippers at different pressures. The rich feed from the absorption equipment is split among the strippers, and partially regenerated solvent from the highest pressure stripper flows to the middle of sequentially lower pressure strippers in a "matrix" pattern. By selecting certain parameters of the matrix stripping configuration such that the total energy required by the strippers to achieve a desired percentage of acid gas removal from the gaseous stream is minimized, further energy savings can be realized.

Chemistry of the aqueous medium - Determining factor of corrosion in carbon steel components of secondary circuit

International Nuclear Information System (INIS)

Radulescu, M.; Pirvan, I.; Dinu, A.; Velciu, L.

2003-01-01

The interplay of chemistry of aqueous medium and corrosion processes followed by deposition and/or release of corrosion products determines both formation and growth of superficial films as well as the kinetics of ion release from materials into the aqueous medium. Material corrosion in the secondary circuit of a NPP can be minimized by choosing the materials of the components and by a rigorous inspection of the chemistry of aqueous agent. The chemical inspection helps in minimizing: - the corrosion of the components immersed in feedwater and vapor and of Steam Generator components; - 'dirtying' of the systems particularly of the surfaces implied in heat transfer; - the amount of insoluble chemical species resulting in corrosion process and carried along the circuit; - the corrosion of secondary circuit components during revisions or outages. An important role among the chemical parameters of the fluids circulated in NPP tubing appears to be the pH. In CANDU reactors it must be kept within the range of 8.7 to 9.4 by treating the medium with volatile amines (morpholine and cyclohexylamine). A plot is presented giving the corrosion rate of carbon steels as a function of the pH of the medium. Besides, the oxygen concentration dissolved in the aqueous medium must be maintained under 5 μg per water kg. Other factors determining the corrosion rates are also discussed. The paper gives the results of the experiments done with various materials, solutions and analysis methods

Studies on the Removal of Rhodamine B and Malachite Green from Aqueous Solutions by Activated Carbon

Directory of Open Access Journals (Sweden)

A. Edwin Vasu

2008-01-01

Full Text Available Activated carbon prepared from tamarind fruit shells by direct carbonization was used for the removal of rhodamine B and malachite green dyes from aqueous solutions. Adsorption studies were performed by varying such parameters as dye concentration, pH of the dye solution, time and temperature. The equilibrium adsorption data obtained were used to calculate the Freundlich, Langmuir and Redlich-Peterson isotherm parameters. Increase in pH of the solution pH resulted in increased adsorption of both the dyes. Kinetic studies indicate that the pseudo-second order model can be used for describing the dynamics of the sorption processes. Film diffusion of the dyes was the rate determining step at low dye concentrations while diffusion of dyes through the pores the carbon particles determined the overall uptake at high concentrations. Thermodynamic parameters of the endothermic sorptions were evaluated using van’t Hoff equation. Desorption studies with acids were also performed in order to regenerate the used carbons.

Mars Aqueous Processing System, Phase II

Data.gov (United States)

National Aeronautics and Space Administration — The Mars Aqueous Processing System (MAPS) is a novel technology for recovering oxygen, iron, and other constituents from lunar and Mars soils. The closed-loop...

An Aqueous Metal-ion Capacitor with Oxidised Carbon Nanotubes and Metallic Zinc Electrodes

Directory of Open Access Journals (Sweden)

Yuheng Tian

2016-10-01

Full Text Available An aqueous metal ion capacitor comprising of a zinc anode, an oxidized carbon nanotubes (oCNTs cathode and a zinc sulfate electrolyte is reported. Since the shuttling cation is Zn2+, this typical metal ion capacitor is named as zinc-ion capacitor (ZIC. The ZIC integrates the divalent zinc stripping/plating chemistry with the surface-enabled pseudocapacitive cation adsorption/desorption on oCNTs. The surface chemistry and crystallographic structure of oCNTs were extensively characterized by combining X-ray photoelectron spectroscopy, Fourier-transformed infrared spectroscopy, Raman spectroscopy and X-ray powder diffraction. The function of the surface oxygen groups in surface cation storage was elucidated by a series of electrochemical measurement and the surface-enabled ZIC showed better performance than the ZIC with an un-oxidized CNT cathode. The reaction mechanism at the oCNT cathode involves the additional reversible Faradaic process, while the CNTs merely show electric double layer capacitive behavior involving a non-Faradaic process. The aqueous hybrid ZIC comprising the oCNT cathode exhibited a specific capacitance of 20 mF cm-2 (corresponding to 53 F g-1 in the range of 0-1.8 V at 10 mV s-1 and a stable cycling performance up to 5000 cycles.

An Aqueous Metal-Ion Capacitor with Oxidized Carbon Nanotubes and Metallic Zinc Electrodes

Energy Technology Data Exchange (ETDEWEB)

Tian, Yuheng; Amal, Rose; Wang, Da-Wei, E-mail: da-wei.wang@unsw.edu.au [School of Chemical Engineering, The University of New South Wales (UNSW), Sydney, NSW (Australia)

2016-10-03

An aqueous metal ion capacitor comprising of a zinc anode, oxidized carbon nanotubes (oCNTs) cathode, and a zinc sulfate electrolyte is reported. Since the shuttling cation is Zn{sup 2+}, this typical metal ion capacitor is named as zinc-ion capacitor (ZIC). The ZIC integrates the divalent zinc stripping/plating chemistry with the surface-enabled pseudocapacitive cation adsorption/desorption on oCNTs. The surface chemistry and crystallographic structure of oCNTs were extensively characterized by combining X-ray photoelectron spectroscopy, Fourier-transformed infrared spectroscopy, Raman spectroscopy, and X-ray powder diffraction. The function of the surface oxygen groups in surface cation storage was elucidated by a series of electrochemical measurement and the surface-enabled ZIC showed better performance than the ZIC with an un-oxidized CNT cathode. The reaction mechanism at the oCNT cathode involves the additional reversible Faradaic process, while the CNTs merely show electric double layer capacitive behavior involving a non-Faradaic process. The aqueous hybrid ZIC comprising the oCNT cathode exhibited a specific capacitance of 20 mF cm{sup −2} (corresponding to 53 F g{sup −1}) in the range of 0–1.8 V at 10 mV s{sup −1} and a stable cycling performance up to 5000 cycles.

Experiments and model for the viscosity of carbonated 2-amino-2-methyl-1-propanol and piperazine aqueous solution

International Nuclear Information System (INIS)

Fu, Dong; Li, Zhixin; Liu, Feng

2014-01-01

Highlights: • The viscosities of the carbonated AMP-PZ aqueous solutions were measured. • The experiments were modeled satisfactorily by using the Weiland equation. • The influence of the mass fractions of amines on the viscosity was illustrated. • The temperature and CO 2 loading dependences of the viscosity were demonstrated. -- Abstract: The viscosities (η) of carbonated 2-amino-2-methyl-1-propanol (AMP)-piperazine (PZ) aqueous solutions were measured by using a NDJ-1 rotational viscometer, with temperatures ranging from 298.15 K to 323.15 K. The total mass fraction of amines ranged from 0.3 to 0.4. The mass fraction of PZ ranged from 0.05 to 0.10. The Weiland equation was used to correlate the viscosities of both CO 2 -unloaded and CO 2 -loaded aqueous solutions and the calculated results agreed well with the experiments. The effects of temperature, mass fractions of amines and CO 2 loading (α) on the viscosities of carbonated aqueous solutions were demonstrated on the basis of experiments and calculations

Removal of Lead (II from Aqueous Solution Using Chitosan Impregnated Granular Activated Carbon

Directory of Open Access Journals (Sweden)

Ali Mousa Ridha

2017-03-01

Full Text Available The use of biopolymer material Chitosan impregnated granular activated carbon CHGAC as adsorbent in the removal of lead ions pb.2+ from aqueous solution was studied using batch adsorption mode. The prepared CHGAC was characterized by Scanning Electronic Microscopy (SEM and atomic-absorption pectrophotometer. The adsorption of lead ions onto Chitosan-impregnated granular activated carbon was examined as a function of adsorbent weight, pH and contact time in Batch system. Langmuir and Freundlich models were employed to analyze the resulting experimental data demonstrated that better fitted by Langmuir isotherm model than Freundlich model, with good correlation coefficient. The maximum adsorption capacity calculated from the pseudo second order model in conformity to the experimental values. This means that the adsorption performance of lead ions onto CHGAC follows a pseudo second order model, which illustrates that the adsorption of Pb2+ onto CHGAC was controlled by chemisorption. The granular activated carbon GAC impregnated by Chitosan was effectively applied as adsorbent for the elimination of lead ions from aqueous solution.

Sorption of a phenols mixture in aqueous solution with activated carbon; Sorcion de una mezcla de fenoles en solucion acuosa con carbon activado

Energy Technology Data Exchange (ETDEWEB)

Mejia M, D

2004-07-01

The constant population growth and the quick industrialization have caused severe damages to our natural aquifer resources for a great variety of organic and inorganic pollutants. Among these they are those phenol compounds that are highly toxic, resistant (to the degradation chemistry) and poorly biodegradable. The phenolic compounds is used in a great variety of industries, like it is the production of resins, nylon, plastifiers, anti-oxidants, oil additives, drugs, pesticides, colorants, explosives, disinfectants and others. The disseminated discharges or effluents coming from the industrial processes toward lakes and rivers are causing a growing adverse effect in the environment, as well as a risk for the health. Numerous studies exist on the phenols removal and phenols substituted for very varied techniques, among them they are the adsorption in activated carbon. This finishes it has been used successfully for the treatment of residual waters municipal and industrial and of drinking waters and it is considered as the best technique available to eliminate organic compounds not biodegradable and toxic present in aqueous solution (US EPA, 1991). However a little information exists on studies carried out in aqueous systems with more of a phenolic compound. The activated carbon is broadly used as adsorbent due to its superficial properties in the so much treatment of water as of aqueous wastes, adsorbent for the removal of organic pollutants. The main objective of this work is the adsorption of a aqueous mixture of phenol-4 chloro phenol of different concentrations in activated carbon of mineral origin of different meshes and to diminish with it their presence in water. The experiments were carried out for lots, in normal conditions of temperature and pressure. The experimental results show that the removal capacity depends so much of the superficial properties of the sorbent like of the physical properties and chemical of the sorbate. The isotherms were carried

Electrocatalytic reduction of dioxygen by cobalt porphyrin-modified glassy carbon electrode with single-walled carbon nanotubes and nafion in aqueous solutions

International Nuclear Information System (INIS)

Choi, Ayoung; Jeong, Haesang; Kim, Songmi; Jo, Suhee; Jeon, Seungwon

2008-01-01

Cobalt porphyrin (CoP)-modified glassy carbon electrode (GCE) with single-walled carbon nanotubes (SWNTs) and Nafion demonstrated a higher electrocatalytic activity for the reduction of dioxygen in 0.1 M H 2 SO 4 solution. Cyclic and hydrodynamic voltammetry at the CoP-SWNTs/GCE-modified electrodes in O 2 -saturated aqueous solutions was used to study the electrocatalytic pathway. Compared with the CoP/GCE-modified electrodes, the reduction potential of dioxygen at the CoP-SWNTs/GCE-modified electrodes was shifted to the positive direction and the limiting current was greatly increased. Especially, the Co(TMPP)-SWNTs/GCE-modified electrode was catalyzed effectively by the 4e - reduction of dioxygen to water, because hydrodynamic voltammetry revealed the transference of approximately four electrons for dioxygen reduction and the minimal generation of hydrogen peroxide in the process of dioxygen reduction

Sodium phthalamates as corrosion inhibitors for carbon steel in aqueous hydrochloric acid solution

International Nuclear Information System (INIS)

Flores, Eugenio A.; Olivares, Octavio; Likhanova, Natalya V.; Dominguez-Aguilar, Marco A.; Nava, Noel; Guzman-Lucero, Diego; Corrales, Monica

2011-01-01

Highlights: → N-Alkyl-sodium phthalamates as corrosion inhibitors for industry in acidic medium. → Compounds behaved as mixed type inhibitors and followed Langmuir adsorption isotherm. → Efficiencies were proportional to aliphatic chain length and inhibitor concentration. → Iron complexes and chelates with phthalamates contributed to carbon steel protection. - Abstract: Three compounds of N-alkyl-sodium phthalamates were synthesized and tested as corrosion inhibitors for carbon steel in 0.5 M aqueous hydrochloric acid. Tests showed that inhibitor efficiencies were related to aliphatic chain length and dependent on concentration. N-1-n-tetradecyl-sodium phthalamate displayed moderate efficiency against uniform corrosion, 42-86% at 25 deg. C and 25-60% at 40 o C. Tests indicated that compounds behave as mixed type inhibitors where molecular adsorption on steel followed Langmuir isotherm, whereas thermodynamic suggested that a physisorption process occurred. XPS analysis confirmed film formation on surface, where Fe +2 complexes and Fe +2 chelates with phthalamates prevented steel from further corrosion.

ADSORPTION OF COPPER FROM AQUEOUS SOLUTION BY ELAIS GUINEENSIS KERNEL ACTIVATED CARBON

Directory of Open Access Journals (Sweden)

NAJUA DELAILA TUMIN

2008-08-01

Full Text Available In this study, a series of batch laboratory experiments were conducted in order to investigate the feasibility of Elais Guineensis kernel or known as palm kernel shell (PKS-based activated carbon for the removal of copper from aqueous solution by the adsorption process. Investigation was carried out by studying the influence of initial solution pH, adsorbent dosage and initial concentration of copper. The particle size of PKS used was categorized as PKS–M. All batch experiments were carried out at a constant temperature of 30°C (±2°C using mechanical shaker that operated at 100 rpm. The single component equilibrium data was analyzed using Langmuir, Freundlich, Redlich-Peterson, Temkin and Toth adsorption isotherms.

4th June: AIS and NICE/MAIL unique authentication

CERN Multimedia

AIS and NICE teams

2007-01-01

Over the past few years, the IT department has been in the process of streamlining CERN users' access to all central computing services. The long term goal is to converge on a unique computer account, which will increase computer security and simplify account maintenance. The next step of this process will occur on 4th June 2007, as of when authenticating on the AIS applications (EDH, HRT, CET, APT, ERT, CRA, Foundation, ...) and on NICE (Windows) and MAIL will be done using the same username and password. As a reminder, this account can also be used on EDMS, INDICO, CDS and SIMBA. So starting on 4th June 2007, authentication on the AIS applications must be done using your AIS username and your MAIL/NICE password. Thanks for your understanding, The AIS and NICE teams

Quantitative characterization of the aqueous fraction from hydrothermal liquefaction of algae

Energy Technology Data Exchange (ETDEWEB)

Maddi, Balakrishna; Panisko, Ellen; Wietsma, Thomas; Lemmon, Teresa; Swita, Marie; Albrecht, Karl; Howe, Daniel

2016-10-01

Aqueous streams generated from hydrothermal liquefaction contain approximately 30% of the total carbon present from the algal feed. Hence, this aqueous carbon must be utilized to produce liquid fuels and/or specialty chemicals for economic sustainability of hydrothermal liquefaction on industrial scale. In this study, aqueous fractions produced from the hydrothermal liquefaction of fresh water and saline water algal cultures were analyzed using a wide variety of analytical instruments to determine their compositional characteristics. This study will also inform researchers designing catalysts for down-stream processing such as high-pressure catalytic conversion of organics in aqueous phase, catalytic hydrothermal gasification, and biological conversions. Organic chemical compounds present in all eight aqueous fractions were identified using two-dimensional gas chromatography equipped with time-of-flight mass spectrometry. Identified compounds include organic acids, nitrogen compounds and aldehydes/ketones. Conventional gas chromatography and liquid chromatography methods were utilized to quantify the identified compounds. Inorganic species in the aqueous stream of hydrothermal liquefaction of algae were identified using ion chromatography and inductively coupled plasma optical emission spectrometer. The concentrations of organic chemical compounds and inorganic species are reported. The amount quantified carbon ranged from 45 to 72 % of total carbon in the aqueous fractions.

Kinetic Approach for the Adsorption of Organophosphorous Pesticides from Aqueous Solution Using “Waste” Jute Fiber Carbon

Directory of Open Access Journals (Sweden)

S. Senthilkumaar

2010-01-01

Full Text Available Chemically activated “Waste” Jute Fiber carbon has been effectively used for the removal of five organophosphorous pesticides (malathion, monocrotophos, methylparathion, phosphamidon and dimethoate from aqueous solutions. The prepared activated jute fiber carbon was characterized by using Elemental analyzer and proximate analysis methods. The adsorption equilibrium was examined at 28 ºC. Three different kinetic models, the pseudo first order, pseudo second order and Elovich kinetic models were selected to analyses the adsorption process. To compare the fitness of pseudo first order and pseudo second order, sum of the squares of the errors and correlation coefficient, r2 values were calculated. The Elovich model was used to confirm the chemisorptions.

Integrating the Wall Street Journal into AIS Courses

Science.gov (United States)

Kohlmeyer, James M., III

2008-01-01

While it is important for accounting information systems (AIS) students to understand computer technology, internal controls and business processes, such knowledge is of little use without reference to appropriate contexts. Integrating Wall Street Journal (WSJ) readings and discussions into AIS classes can enrich learning by stimulating…

Adsorptive removal of phenol from aqueous solutions on activated carbon prepared from tobacco residues: Equilibrium, kinetics and thermodynamics

Energy Technology Data Exchange (ETDEWEB)

Kilic, Murat; Apaydin-Varol, Esin [Department of Chemical Engineering, Anadolu University, Eskisehir 26470 (Turkey); Puetuen, Ayse E., E-mail: aeputun@anadolu.edu.tr [Department of Chemical Engineering, Anadolu University, Eskisehir 26470 (Turkey)

2011-05-15

This study consists of producing high surface area activated carbon from tobacco residues by chemical activation and its behavior of phenol removal from aqueous solutions. K{sub 2}CO{sub 3} and KOH were used as chemical activation agents and three impregnation ratios (50, 75 and 100 wt.%) were applied on biomass. Maximum BET surface areas of activated carbons were obtained from impregnation with 75 wt.% of K{sub 2}CO{sub 3} and 75 wt.% of KOH as 1635 and 1474 m{sup 2}/g, respectively. Optimum adsorption conditions were determined as a function of pH, adsorbent dosage, initial phenol concentration, contact time and temperature of solution for phenol removal. To describe the equilibrium isotherms the experimental data were analyzed by the Langmuir, Freundlich, Dubinin-Radushkevich (D-R) and Temkin isotherm models. Pseudo-first order, pseudo-second order and intraparticle diffusion kinetic models were used to find out the kinetic parameters and mechanism of adsorption process. The thermodynamic parameters such as {Delta}G{sup o}, {Delta}H{sup o} and {Delta}S{sup o} were calculated for predicting the nature of adsorption. According to the experimental results, activated carbon prepared from tobacco residue seems to be an effective, low-cost and alternative adsorbent precursor for the removal of phenol from aqueous solutions.

Reactive extraction of carboxylic acids from apolar hydrocarbons using aqueous solutions of sodium hydrogen carbonate with back-recovery using carbon dioxide under pressure

NARCIS (Netherlands)

Kuzmanovic, B.; Kuipers, N.J.M.; de Haan, A.B.; Kwant, Gerard

2005-01-01

A combination of using an aqueous solution of sodium hydrogen carbonate for forward-extraction of carboxylic acids from a dilute apolar organic solvent, and carbon dioxide under pressure for its back-recovery, is studied. Used in combination, these two steps might provide a technique for the

Quality Control of Boar Sperm Processing : Implications from European AI Centres and Two Spermatology Reference Laboratories

NARCIS (Netherlands)

Riesenbeck, A; Schulze, M; Rüdiger, K; Henning, H; Waberski, D

In recent years, increased automatization has resulted in a higher efficiency of boar semen processing in AI laboratories. Sophisticated laboratory management and efficient quality control programmes are needed for current tendencies in major pork-producing countries to reduce the sperm number per

Aqueous process for recovering sulfur from hydrogen sulfide-bearing gas

Science.gov (United States)

Basu, Arunabha

2015-05-05

A process for recovering sulfur from a hydrogen sulfide-bearing gas utilizes an aqueous reaction medium, a temperature of about 110-150.degree. C., and a high enough pressure to maintain the aqueous reaction medium in a liquid state. The process reduces material and equipment costs and addresses the environmental disadvantages associated with known processes that rely on high boiling point organic solvents.

4th June: AIS and NICE/MAIL unique authentication

CERN Multimedia

The AIS and NICE teams

2007-01-01

Over the past few years, the IT department has been in the process of streamlining CERN users' access to all central computing services. The long term goal is to converge on a unique computer account, which will increase computer security and simplify account maintenance. The next step of this process will occur on the 4th June 2007, as of when authenticating on the AIS applications (EDH, HRT, CET, APT, ERT, CRA, Foundation, ...) and on NICE (Windows) and MAIL will be done using the same username and password. As a reminder, this account can also be used on EDMS, INDICO, CDS and SIMBA. Thus starting on the 4th June 2007, authentication on the AIS applications must be done using your AIS username and your MAIL/NICE password. Thanks for your understanding, The AIS and NICE teams

Study of the processes of carbonization and oxidation of porous silicon by Raman and IR spectroscopy

International Nuclear Information System (INIS)

Vasin, A. V.; Okholin, P. N.; Verovsky, I. N.; Nazarov, A. N.; Lysenko, V. S.; Kholostov, K. I.; Bondarenko, V. P.; Ishikawa, Y.

2011-01-01

Porous silicon layers were produced by electrochemical etching of single-crystal silicon wafers with the resistivity 10 Ω cm in the aqueous-alcohol solution of hydrofluoric acid. Raman spectroscopy and infrared absorption spectroscopy are used to study the processes of interaction of porous silicon with undiluted acetylene at low temperatures and the processes of oxidation of carbonized porous silicon by water vapors. It is established that, even at the temperature 550°C, the silicon-carbon bonds are formed at the pore surface and the graphite-like carbon condensate emerges. It is shown that the carbon condensate inhibits oxidation of porous silicon by water vapors and contributes to quenching of white photoluminescence in the oxidized carbonized porous silicon nanocomposite layer.

Resorcinol adsorption from aqueous solution on activated carbon: Relation adsorption isotherm and immersion enthalpy

International Nuclear Information System (INIS)

Blanco, Diago A; Giraldo, Liliana; Moreno, Juan C.

2008-01-01

The resorcinol adsorption on a modified activated carbon, obtained from an activated commercial carbon Carbochem T M - PS30, CAG, modified by means of chemical treatment with HNO 3 7M oxidized activated carbon (CAO) and heat treatment under H 2 flow, reduced activated carbon (CAR) are studied. The influence of solution pH, the reduction and oxidation of the activated surface carbons in resorcinol aqueous solutions is determined. The interaction solid solution is characterized by adsorption isotherms analysis at 298 K and at pHs of 7.9 and 11 in order to evaluate the system on and below the value of resorcinol pKa. The adsorption capacity of carbons increases with diminishing solution pH. The amount retained increases in the reduced carbon at maximum adsorption pH and diminishes in the oxidized carbon. the experimental results of the adsorption isotherms are adjusted to the Freundlich and Langmuir models, obtaining values for the Q m ax parameter Langmuir model in the CAG of 179, 156 and 44 mgg - 1 For pH values of 7,9 and 11 respectively. In this case of modified carbons values of 233, 179 and 164 mgg - 1 Are obtained for CAR, CAG and CAO to pH 7 respectively, as general tendency the resorcinol adsorption increases in the following order CAR > CAG > CAO. Similar conclusions from immersion enthalpies are obtained, their values increase with the amount of solute retained. In the case of the CAG, immersion enthalpies between 25.8 to 40.9 Jg - 1, are obtained for resorcinol aqueous solutions in a range from 20 to 1500 mgL - 1

An Integrated, Low Temperature Process to Capture and Sequester Carbon Dioxide from Industrial Emissions

Science.gov (United States)

Wendlandt, R. F.; Foremski, J. J.

2013-12-01

Laboratory experiments show that it is possible to integrate (1) the chemistry of serpentine dissolution, (2) capture of CO2 gas from the combustion of natural gas and coal-fired power plants using aqueous amine-based solvents, (3) long-term CO2 sequestration via solid phase carbonate precipitation, and (4) capture solvent regeneration with acid recycling in a single, continuous process. In our process, magnesium is released from serpentine at 300°C via heat treatment with ammonium sulfate salts or at temperatures as low as 50°C via reaction with sulfuric acid. We have also demonstrated that various solid carbonate phases can be precipitated directly from aqueous amine-based (NH3, MEA, DMEA) CO2 capture solvent solutions at room temperature. Direct precipitation from the capture solvent enables regenerating CO2 capture solvent without the need for heat and without the need to compress the CO2 off gas. We propose that known low-temperature electrochemical methods can be integrated with this process to regenerate the aqueous amine capture solvent and recycle acid for dissolution of magnesium-bearing mineral feedstocks and magnesium release. Although the direct precipitation of magnesite at ambient conditions remains elusive, experimental results demonstrate that at temperatures ranging from 20°C to 60°C, either nesquehonite Mg(HCO3)(OH)●2H2O or a double salt with the formula [NH4]2Mg(CO3)2●4H2O or an amorphous magnesium carbonate precipitate directly from the capture solvent. These phases are less desirable for CO2 sequestration than magnesite because they potentially remove constituents (water, ammonia) from the reaction system, reducing the overall efficiency of the sequestration process. Accordingly, the integrated process can be accomplished with minimal energy consumption and loss of CO2 capture and acid solvents, and a net generation of 1 to 4 moles of H2O/6 moles of CO2 sequestered (depending on the solid carbonate precipitate and amount of produced H2

Immobilized nickel hexacyanoferrate on activated carbons for efficient attenuation of radio toxic Cs(I) from aqueous solutions

International Nuclear Information System (INIS)

Lalhmunsiama; Lalhriatpuia, C.; Tiwari, Diwakar; Lee, Seung-Mok

2014-01-01

Highlights: • Rice hulls and areca nut wastes are utilized to obtain activated carbons. • Nickel hexacyanoferrate is immobilized on activated carbon samples. • Materials are characterized by SEM–EDX and XRD data. • Materials are employed in attenuation of Cs(I) under batch and column studies. • Possible mechanism is deduced at solid/solution interface. - Abstract: The aim of this study is to immobilize nickel hexacyanoferrate onto the large surface of activated carbons (ACs) precursor to rice hulls and areca nut waste materials. These nickel hexacyanoferrate immobilized materials are then assessed in the effective attenuation of radio logically important cesium ions from aqueous solutions. The solid samples are characterized by the XRD analytical method and surface morphology is obtained from the SEM images. The batch reactor experiments show that an increase in sorptive pH (2.0–10.0) apparently not affecting the high percent uptake of Cs(I). Equilibrium modeling studies suggest that the data are reasonably and relatively fitted well to the Langmuir adsorption isotherm. Kinetic studies show that sorption process is fairly rapid and the kinetic data are fitted well to the pseudo-second order rate model. Increasing the background electrolyte concentration from 0.001 to 0.1 mol/L NaCl causes insignificant decrease in Cs(I) removal which infers the higher selectivity of these materials for Cs(I) from aqueous solutions. Further, the column reactor operations enable to obtain the breakthrough data which are then fitted to the Thomas non-linear equation as to obtain the loading capacity of column for Cs(I). The results show that the modified materials show potential applicability in the attenuation of radio toxic cesium from aqueous solution

Removal of mercury (II) from aqueous solution by activated carbon obtained from furfural.

Science.gov (United States)

Yardim, M F; Budinova, T; Ekinci, E; Petrov, N; Razvigorova, M; Minkova, V

2003-08-01

The adsorption of Hg(II) from aqueous solution at 293 K by activated carbon obtained from furfural is studied. The carbon is prepared by polymerization of furfural following carbonization and activation of the obtained polymer material with water vapor at 800 degrees C. Adsorption studies of Hg(II) are carried out varying some conditions: treatment time, metal ion concentration, adsorbent amount and pH. It is determined that Hg(II) adsorption follows both Langmuir and Freundlich isotherms. The adsorption capacity of the carbon is 174 mg/g. It is determined that Hg(II) uptake increases with increasing pH. Desorption studies are performed with hot water. The percent recovery of Hg(II) is 6%.

Removals of aqueous sulfur dioxide and hydrogen sulfide using CeO2-NiAl-LDHs coating activated carbon and its mix with carbon nano-tubes

KAUST Repository

Li, Jing; Chen, Fangping; Jin, Guanping; Feng, Xiaoshuang; Li, Xiaoxuan

2015-01-01

Ce-doped NiAl/layered double hydroxide was coated at activated carbon by urea hydrolysis method (CeO2-NiAl-LDHs/AC) in one pot, which was characterized by X-ray diffraction, infrared spectra, field emission scanning electron microscope and electrochemical techniques. CeO2-NiAl-LDHs/AC shows good uptake for aqueous sulfur dioxide (483.09mg/g) and hydrogen sulfide (181.15mg/g), respectively at 25°C. Meanwhile, the electrochemical removals of aqueous sulfur dioxide and hydrogen sulfide were respectively investigated at the mix of CeO2-NiAl-LDHs/AC and carbon nano-tubes modified homed paraffin-impregnated electrode. Both sulfur dioxide and hydrogen sulfide could be effectively oxidized to sulfuric acid at 1.0V in alkaline aqueous solution. © 2015 Elsevier B.V.

Removals of aqueous sulfur dioxide and hydrogen sulfide using CeO2-NiAl-LDHs coating activated carbon and its mix with carbon nano-tubes

KAUST Repository

Li, Jing

2015-07-01

Ce-doped NiAl/layered double hydroxide was coated at activated carbon by urea hydrolysis method (CeO2-NiAl-LDHs/AC) in one pot, which was characterized by X-ray diffraction, infrared spectra, field emission scanning electron microscope and electrochemical techniques. CeO2-NiAl-LDHs/AC shows good uptake for aqueous sulfur dioxide (483.09mg/g) and hydrogen sulfide (181.15mg/g), respectively at 25°C. Meanwhile, the electrochemical removals of aqueous sulfur dioxide and hydrogen sulfide were respectively investigated at the mix of CeO2-NiAl-LDHs/AC and carbon nano-tubes modified homed paraffin-impregnated electrode. Both sulfur dioxide and hydrogen sulfide could be effectively oxidized to sulfuric acid at 1.0V in alkaline aqueous solution. © 2015 Elsevier B.V.

Adsorption of Polycyclic Aromatic Hydrocarbons (PAHS from Aqueous Solutions on Different Sorbents

Directory of Open Access Journals (Sweden)

Smol Marzena

2014-12-01

Full Text Available This paper presents the results of the possibility and effectiveness of PAHs removal from a model aqueous solution, during the sorption on the selected sorbents. Six PAHs (naphthalene, acenaphthylene, acenaphthene, fluorene, phenanthrene, anthracene listed by EPA for the analysis in the environmental samples were determined. Model aqueous solution was prepared with RESTEK 610 mix PAHs standard. After the sorption process, decrease in the concentration of individual hydrocarbons was observed. The removal percentage was dependent on the type of sorbent (quartz sand, mineral sorbent, activated carbon. The highest efficiency (98.1% was observed for activated carbon.. The results shows that the sorption processes can be used in aqueous solutions treatment procedures.

Sodium to sodium carbonate conversion process

Science.gov (United States)

Herrmann, Steven D.

1997-01-01

A method of converting radioactive alkali metal into a low level disposable solid waste material. The radioactive alkali metal is atomized and introduced into an aqueous caustic solution having caustic present in the range of from about 20 wt % to about 70 wt % to convert the radioactive alkali metal to a radioactive alkali metal hydroxide. The aqueous caustic containing radioactive alkali metal hydroxide and CO.sub.2 are introduced into a thin film evaporator with the CO.sub.2 present in an amount greater than required to convert the alkali metal hydroxide to a radioactive alkali metal carbonate, and thereafter the radioactive alkali metal carbonate is separated from the thin film evaporator as a dry powder. Hydroxide solutions containing toxic metal hydroxide including one or more metal ions of Sb, As, Ba, Be, Cd, Cr, Pb, Hg, Ni, Se, Ag and T1 can be converted into a low level non-hazardous waste using the thin film evaporator of the invention.

A mean-density model of ionic surfactants for the dispersion of carbon nanotubes in aqueous solutions

Science.gov (United States)

Joung, Young Soo

2018-05-01

We propose a new analytical model of ionic surfactants used for the dispersion of carbon nanotubes (CNTs) in aqueous solutions. Although ionic surfactants are commonly used to facilitate the dispersion of CNTs in aqueous solutions, understanding the dispersion process is challenging and time-consuming owing to its complexity and nonlinearity. In this work, we develop a mean-density model of ionic surfactants to simplify the calculation of interaction forces between CNTs stabilized by ionic surfactants. Using this model, we can evaluate various interaction forces between the CNTs and ionic surfactants under different conditions. The dispersion mechanism is investigated by estimating the potential of mean force (PMF) as a function of van der Waals forces, electrostatic forces, interfacial tension, and osmotic pressure. To verify the proposed model, we compare the PMFs derived using our method with those derived from molecular dynamics simulations using comparable CNTs and ionic surfactants. Notably, for stable dispersions, the osmotic pressure and interfacial energy are important for long-range and short-range interactions, respectively, in comparison with the effect of electrostatic forces. Our model effectively prescribes specific surfactants and their concentrations to achieve stable aqueous suspensions of CNTs.

Electrochemical studies on nanometal oxide-activated carbon composite electrodes for aqueous supercapacitors

Science.gov (United States)

Ho, Mui Yen; Khiew, Poi Sim; Isa, Dino; Chiu, Wee Siong

2014-11-01

In present study, the electrochemical performance of eco-friendly and cost-effective titanium oxide (TiO2)-based and zinc oxide-based nanocomposite electrodes were studied in neutral aqueous Na2SO3 electrolyte, respectively. The electrochemical properties of these composite electrodes were studied using cyclic voltammetry (CV), galvanostatic charge-discharge (CD) and electrochemical impedance spectroscopy (EIS). The experimental results reveal that these two nanocomposite electrodes achieve the highest specific capacitance at fairly low oxide loading onto activated carbon (AC) electrodes, respectively. Considerable enhancement of the electrochemical properties of TiO2/AC and ZnO/AC nanocomposite electrodes is achieved via synergistic effects contributed from the nanostructured metal oxides and the high surface area mesoporous AC. Cations and anions from metal oxides and aqueous electrolyte such as Ti4+, Zn2+, Na+ and SO32- can occupy some pores within the high-surface-area AC electrodes, forming the electric double layer at the electrode-electrolyte interface. Additionally, both TiO2 and ZnO nanoparticles can provide favourable surface adsorption sites for SO32- anions which subsequently facilitate the faradaic processes for pseudocapacitive effect. These two systems provide the low cost material electrodes and the low environmental impact electrolyte which offer the increased charge storage without compromising charge storage kinetics.

Chromium (Ⅵ) removal from aqueous solutions through powdered activated carbon countercurrent two-stage adsorption.

Science.gov (United States)

Wang, Wenqiang

2018-01-01

To exploit the adsorption capacity of commercial powdered activated carbon (PAC) and to improve the efficiency of Cr(VI) removal from aqueous solutions, the adsorption of Cr(VI) by commercial PAC and the countercurrent two-stage adsorption (CTA) process was investigated. Different adsorption kinetics models and isotherms were compared, and the pseudo-second-order model and the Langmuir and Freundlich models fit the experimental data well. The Cr(VI) removal efficiency was >80% and was improved by 37% through the CTA process compared with the conventional single-stage adsorption process when the initial Cr(VI) concentration was 50 mg/L with a PAC dose of 1.250 g/L and a pH of 3. A calculation method for calculating the effluent Cr(VI) concentration and the PAC dose was developed for the CTA process, and the validity of the method was confirmed by a deviation of <5%. Copyright © 2017. Published by Elsevier Ltd.

Studies on removal of NH4+-N from aqueous solution by using the activated carbons derived from rice husk

International Nuclear Information System (INIS)

Zhu, Kairan; Fu, Hao; Zhang, Jinghui; Lv, Xiaoshu; Tang, Jie; Xu, Xinhua

2012-01-01

Water pollution caused by ammonia nitrogen has attracted a great attention as its toxicity affects both the environment and human health. The objective of this paper was to investigate the adsorption behavior of NH 4 + -N from aqueous solution by activated carbons prepared from rice husk. The physico-chemical properties of the activated carbon were characterized by Brunauer-Emmett-Teller (BET) test, Fourier transform infrared spectroscopy (FTIR) and scanning electron microscopy (SEM). It was found that the NH 4 + -N adsorption on the rice husk derived carbons was dependent on adsorbent dosage and solution pH. The adsorption kinetics and isotherms of NH 4 + -N by rice husk carbon were also investigated, and good correlation coefficients were obtained for the pseudo-second order kinetic equation. Dubinin-Radushkevitch (D-R) adsorption isotherm model could better describe the adsorption behavior of NH 4 + -N on the rice husk carbon. Calculated by D-R model, the adsorption course of NH 4 + -N on the rice husk carbon was favored chemical ion-exchange mechanism. Moreover, the activated carbon adsorbed NH 4 + -N was highly fertilizer conservation especially for the nitrogen element. It was proposed that the amount of removed NH 4 + -N from aqueous solutions would increase evidently treated by rice husk carbon if combined with biological method. -- Highlights: ► The dosage of rice husk carbon and pH affected the removal of NH 4 + -N from aqueous solution. ► D-R model could better describe the adsorption behavior of NH 4 + -N on the rice husk carbon. ► The removing of NH 4 + -N would be risen by rice husk carbon if combined with biological method.

Scavenging of priority organic pollutants from aqueous waste using granular activated carbon

Energy Technology Data Exchange (ETDEWEB)

Singh, S.; Yenkie, M.K.N. [Central Fuel Research Institute, Nagpur (India)

2006-04-15

Many organic compounds present in industrial and domestic wastewaters are carcinogenic in nature. Removal of these organic compounds from wastewater has become a great challenge to wastewater treatment technologies, as many of them are non-biodegradable in nature. Adsorption on granular activated carbon (GAC) has emerged an efficient and economically viable technology for removal of final traces of a broad spectrum of toxic organic compounds from domestic and industrial wastewater. In the present investigation adsorption of some priority organic pollutants, namely phenol, o-cresol, p-nitrophenol, m-methoxyphenol, benzoic acid and salicylic acid on granular activated carbon, was studied in a batch system at laboratory scale. Experiments were carried out to determine adsorption isotherms and kinetics for adsorbate when present in aqueous solutions as single, bi- and tri-solute systems. The commercially available bituminous coal based granular activated carbon Filtrasorb 300 (F-300) was used as adsorbent. The results indicate that p-nitrophenol is most strongly adsorbed as compared to other phenols studied. Aqueous phase solubility of the adsorbate plays a deciding role in multi-component systems as more hydrophobic p-nitrophenol adsorbs to a greater extent than less hydrophobic phenol, o-cresol and m-methoxyphenol. The preferential adsorption of strongly adsorbable solute over a weakly adsorbable one has been observed, as the solutes are competing for the available surface area of the adsorbent for adsorption.

AI Based Personal Learning Environments: Directions for Long Term Research. AI Memo 384.

Science.gov (United States)

Goldstein, Ira P.; Miller, Mark L.

The application of artificial intelligence (AI) techniques to the design of personal learning environments is an enterprise of both theoretical and practical interest. In the short term, the process of developing and testing intelligent tutoring programs serves as a new experimental vehicle for exploring alternative cognitive and pedagogical…

Is there an aerosol signature of aqueous processing?

Science.gov (United States)

Ervens, B.; Sorooshian, A.

2017-12-01

The formation of aerosol mass in cloud water has been recognized as a substantial source of atmospheric aerosol mass. While sulfate formation can be relatively well constrained, the formation of secondary organic aerosol mass in the aqueous phase (aqSOA) is much more complex due to the multitude of precursors and variety in chemical processes. Aqueous phase processing adds aerosol mass to the droplet mode, which is formed due to mass addition to activated particles in clouds. In addition, it has been shown that aqSOA mass has specific characteristics in terms of oxidation state and hygroscopicity that might help to distinguish it from other SOA sources. Many models do not include detailed chemical mechanisms of sulfate and aqSOA formation and also lack details on the mass distribution of newly formed mass. Mass addition inside and outside clouds modifies different parts of an aerosol population and consequently affects predictions of properties and lifetime of particles. Using a combination of field data analysis and model studies for a variety of air masses, we will show which chemical and physical aerosol properties can be used, in order to identify an `aqueous phase signature' in processed aerosol populations. We will discuss differences in this signature in clean (e.g., background), moderately polluted (e.g., urban) and highly polluted (e.g., biomass burning) air masses and suggest air-mass-specific chemical and/or physical properties that will help to quantify the aqueous-phase derived aerosol mass.

Process for preparing organoclays for aqueous and polar-organic systems

Science.gov (United States)

Chaiko, David J.

2001-01-01

A process for preparing organoclays as thixotropic agents to control the rheology of water-based paints and other aqueous and polar-organic systems. The process relates to treating low-grade clay ores to achieve highly purified organoclays and/or to incorporate surface modifying agents onto the clay by adsorption and/or to produce highly dispersed organoclays without excessive grinding or high shear dispersion. The process involves the treatment of impure, or run-of-mine, clay using an aqueous biphasic extraction system to produce a highly dispersed clay, free of mineral impurities and with modified surface properties brought about by adsorption of the water-soluble polymers used in generating the aqueous biphasic extraction system. This invention purifies the clay to greater than 95%.

Physical Alteration of Martian Dust Grains, Its Influence on Detection of Clays and Identification of Aqueous Processes on Mars

Science.gov (United States)

Bishop, Janice L.; Drief, Ahmed; Dyar, Darby

2003-01-01

Clays, if present on Mars, have been illusive. Determining whether or not clay minerals and other aqueous alteration species are present on Mars provides key information about the extent and duration of aqueous processes on Mars. The purpose of this study is to characterize in detail changes in the mineral grains resulting from grinding and to assess the influence of physical processes on clay minerals on the surface of Mars. Physical alteration through grinding was shown to greatly affect the structure and a number of properties of antigorite and kaolinite. This project builds on an initial study and includes a combination of SEM, HRTEM, reflectance and M ssbauer spectroscopies. Grain size was found to decrease, as expected, with grinding. In addition, nanophase carbonate, Si-OH and iron oxide species were formed.

Biosorption of formic and acetic acids from aqueous solution using activated carbon from shea butter seed shells

Science.gov (United States)

Adekola, Folahan A.; Oba, Ismaila A.

2017-10-01

The efficiency of prepared activated carbon from shea butter seed shells (SB-AC) for the adsorption of formic acid (FA) and acetic acid (AA) from aqueous solution was investigated. The effect of optimization parameters including initial concentration, agitation time, adsorbent dosage and temperature of adsorbate solution on the sorption capacity were studied. The SB-AC was characterized for the following parameters: bulk density, moisture content, ash content, pH, Fourier transform infrared spectroscopy (FTIR) and scanning electron microscopy (SEM). The optimal conditions for the adsorption were established and the adsorption data for AA fitted Dubinin-Radushkevich (D-R) isotherm well, whereas FA followed Langmuir isotherm. The kinetic data were examined. It was found that pseudo-second-order kinetic model was found to adequately explain the sorption kinetic of AA and FA from aqueous solution. It was again found that intraparticle diffusion was found to explain the adsorption mechanism. Adsorption thermodynamic parameters were estimated and the negative values of Δ G showed that the adsorption process was feasible and spontaneous in nature, while the negative values of Δ H indicate that the adsorption process was exothermic. It is therefore established that SB-AC has good potential for the removal of AA and FA from aqueous solution. Hence, it should find application in the regular treatment of polluted water in aquaculture and fish breeding system.

Absorption of Carbon Dioxide in Aqueous Solutions of N-methyldiethanolamine Mixtures

Science.gov (United States)

Ma’mun, S.; Svendsen, H. F.

2018-05-01

Carbon dioxide (CO2) is one of the greenhouse gases (GHG) that has contributed to the global warming problem. Carbon dioxide is produced in large quantity from coal-fired power plants, iron and steel production, cement production, chemical and petrochemical industries, natural gas purification, and transportation. Some efforts to reduce the CO2 emissions to the atmosphere are then required. Amine-based absorption may be an option for post-combustion capture. The objective of this study is to measure the effect of promoter addition as well as MDEA concentration for the CO2 absorption into the aqueous solutions of MDEA to improve its performances, i.e. increasing the absorption rate and the absorption capacity. Absorption of CO2 in aqueous solutions of MDEA mixtures were measured at 40 °C in a bubble tank reactor. The systems tested were the mixtures of 30 wt% MDEA with 5 and 10 wt% BEA and the mixtures of 40 and 50 wt% MDEA with 6 wt% AEEA. It was found that for MDEA-BEA-H2O mixtures, the higher the promoter concentraation the higher the CO2 absorption rate, while for the MDEA-AEEA-H2O mixtures, the higher the MDEA concentration the lower the CO2 absorption rate.

Thermodynamics and kinetics of adsorption of Cu(II from aqueous solutions onto multi-walled carbon nanotubes

Directory of Open Access Journals (Sweden)

Iman Mobasherpour

2014-12-01

Full Text Available Release of heavy metals into water as a result of industrial activities may pose a serious threat to the environment. The objective of this study is to assess the uptake of Cu2+ from aqueous solutions onto multi-walled carbon nanotubes (MWCNT. The potential of the t-MWCNT to remove Cu2+ cations from aqueous solutions was investigated in batch reactor under different experimental conditions. The processing parameters such as initial concentration of Cu2+ ions, temperature, and adsorbent mass were also investigated. Copper uptake was quantitatively evaluated using the Langmuir, Freundlich and Dubinin–Kaganer–Radushkevich (DKR models. In addition, the adsorption equilibrium was described well by the Langmuir isotherm model with maximum adsorption capacity of 12.34 mg/g of Cu2+ cations on t-MWCNT. Various thermodynamic parameters, such as ΔG0, ΔH0 and ΔS0 were calculated. The thermodynamics of Cu2+ cations adsorption onto t-MWCNT system pointed at spontaneous and endothermic nature of the process. Using the second-order kinetic constants, the activation energy of adsorption (Ea was determined as 27.187 kJ/mol according to the Arrhenius equation.

Assessment of Fenton's reagent and ozonation as pre-treatments for increasing the biodegradability of aqueous diethanolamine solutions from an oil refinery gas sweetening process.

Science.gov (United States)

Durán-Moreno, A; García-González, S A; Gutiérrez-Lara, M R; Rigas, F; Ramírez-Zamora, R M

2011-02-28

The aim of this work was to evaluate the efficiency of three chemical oxidation processes for increasing the biodegradability of aqueous diethanolamine solutions (aqueous DEA solutions), to be used as pre-treatments before a biological process. The raw aqueous DEA solution, sourced from a sour gas sweetening plant at a Mexican oil refinery, was first characterized by standardized physico-chemical methods. Then experiments were conducted on diluted aqueous DEA solutions to test the effects of Fenton's reagent, ozone and ozone-hydrogen peroxide on the removal of some physicochemical parameters of these solutions. Lastly, biodegradability tests based on Dissolved Organic Carbon Die Away OECD301-A, were carried out on a dilution of the raw aqueous DEA solution and on the treated aqueous DEA solutions, produced by applying the best experimental conditions determined during the aforementioned oxidation tests. Experimental results showed that for aqueous DEA solutions treated with Fenton's reagent, the best degradation rate (70%) was obtained at pH 2.8, with Fe(2+) and H(2)O(2) at doses of 1000 and 10,000 mg/L respectively. In the ozone process, the best degradation (60%) was observed in aqueous DEA solution (100 mg COD/L), using 100 mg O(3)/L at pH 5. In the ozone-hydrogen peroxide process, no COD or DOC removals were observed. The diluted spent diethanolamine solution showed its greatest increase in biodegradability after a reaction period of 28 days when treated with Fenton's reagent, but after only 15 days in the case of ozonation. Copyright © 2011 Elsevier B.V. All rights reserved.

Analysis of Solid and Aqueous Phase Products from Hydrothermal Carbonization of Whole and Lipid-Extracted Algae

Directory of Open Access Journals (Sweden)

Amber Broch

2013-12-01

Full Text Available Microalgae have tremendous potential as a feedstock for production of liquid biofuels, particularly biodiesel fuel via transesterification of algal lipids. However, biodiesel production results in significant amounts of algal residues, or “lipid extracted algae” (LEA. Suitable utilization of the LEA residue will improve the economics of algal biodiesel. In the present study, we evaluate the hydrothermal carbonization (HTC of whole and lipid extracted algal (Spirulina maxima feedstocks in order to produce a solid biofuel (hydrochar and value-added co-products in the aqueous phase. HTC experiments were performed using a 2-L Parr reactor (batch type at 175–215 °C with a 30-min holding time. Solid, aqueous and gaseous products were analyzed using various laboratory methods to evaluate the mass and carbon balances, and investigate the existence of high value chemicals in the aqueous phase. The HTC method is effective in creating an energy dense, solid hydrochar from both whole algae and LEA at lower temperatures as compared to lignocellulosic feedstocks, and is effective at reducing the ash content in the resulting hydrochar. However, under the treatment temperatures investigated, less than 1% of the starting dry algae mass was recovered as an identified high-value chemical in the aqueous phase.

Nitroimidazoles adsorption on activated carbon cloth from aqueous solution.

Science.gov (United States)

Ocampo-Pérez, R; Orellana-Garcia, F; Sánchez-Polo, M; Rivera-Utrilla, J; Velo-Gala, I; López-Ramón, M V; Alvarez-Merino, M A

2013-07-01

The objective of this study was to analyze the equilibrium and adsorption kinetics of nitroimidazoles on activated carbon cloth (ACC), determining the main interactions responsible for the adsorption process and the diffusion mechanism of these compounds on this material. The influence of the different operational variables, such as ionic strength, pH, temperature, and type of water (ultrapure, surface, and waste), was also studied. The results obtained show that the ACC has a high capacity to adsorb nitroimidazoles in aqueous solution. Electrostatic interactions play an important role at pHpH values. Modifications of the ACC with NH3, K2S2O8, and O3 demonstrated that its surface chemistry plays a predominant role in nitroimidazole adsorption on this material. The adsorption capacity of ACC is considerably high in surface waters and reduced in urban wastewater, due to the levels of alkalinity and dissolved organic matter present in the different types of water. Finally, the results of applying kinetic models revealed that the global adsorption rate of dimetridazole and metronidazole is controlled by intraparticle diffusion. Copyright © 2013 Elsevier Inc. All rights reserved.

Sorption of a mixture of phenols in aqueous solution with activated carbon

International Nuclear Information System (INIS)

Mejia M, D.; Lopez M, B.E.; Iturbe G, J.L.

2003-01-01

The main objective of this work is the sorption of an aqueous mixture of phenol-4 chloro phenol of different concentrations in a molar relationship 1:1 in activated carbon of mineral origin of different nets (10, 20 and 30) and to diminish with it its presence in water. The experimental results show that the removal capacity depends so much of the surface properties of the sorbent like of the physical and chemical properties of the sorbate. In all the cases it was observed that in the aqueous systems of low concentration the 4-chloro phenol are removed in an approximate proportion of 1.2-4 times greater to than phenol, however to concentrations but high both they are removed approximately in the same proportion. (Author)

Significant Performance Enhancement in Asymmetric Supercapacitors based on Metal Oxides, Carbon nanotubes and Neutral Aqueous Electrolyte

Science.gov (United States)

Singh, Arvinder; Chandra, Amreesh

2015-10-01

Amongst the materials being investigated for supercapacitor electrodes, carbon based materials are most investigated. However, pure carbon materials suffer from inherent physical processes which limit the maximum specific energy and power that can be achieved in an energy storage device. Therefore, use of carbon-based composites with suitable nano-materials is attaining prominence. The synergistic effect between the pseudocapacitive nanomaterials (high specific energy) and carbon (high specific power) is expected to deliver the desired improvements. We report the fabrication of high capacitance asymmetric supercapacitor based on electrodes of composites of SnO2 and V2O5 with multiwall carbon nanotubes and neutral 0.5 M Li2SO4 aqueous electrolyte. The advantages of the fabricated asymmetric supercapacitors are compared with the results published in the literature. The widened operating voltage window is due to the higher over-potential of electrolyte decomposition and a large difference in the work functions of the used metal oxides. The charge balanced device returns the specific capacitance of ~198 F g-1 with corresponding specific energy of ~89 Wh kg-1 at 1 A g-1. The proposed composite systems have shown great potential in fabricating high performance supercapacitors.

Adsorption Efficiency of Iron Modified Carbons for Removal of Pb(II Ions from Aqueous Solution

Directory of Open Access Journals (Sweden)

Mohammad Hossein Salmani

2016-06-01

Full Text Available Abstract Introduction: The Lead causes severe damage to several systems of the body, especially to bony tissues. Until now, several low-cost biosorbents have been studied for removal of heavy metal ions from aqueous solutions. In the present study, carbonized pomegranate peels modified with Fe2+ and Fe3+ ions and then it was investigated for removal of Pb(II ions from aqueous solution. Materials and methods: the washed granola of pomegranate peel was separately socked with FeCl3 and FeCl2 solutions for 24 h. Then, the granules were carbonized at 400 ºC for 3 h in a programmable furnace in the atmosphere of nitrogen. The adsorption experiments were carried out for two types of iron-modified carbons by batch adsorption using one variable at a time procedures. Results: The optimum conditions were found as contact time 90 min, initial concentration 50 mg/l, and adsorbent dose, 1.00 g/100 ml solution. Maximum removal efficiency was calculated as 84% and 89% for Fe3+ and Fe2+ impregnated pomegranate peel carbons respectively. Conclusion: The iron treatment pomegranate peel carbons modified their surfaces for adsorption of heavy metals. The results showed that chemical modification of the low-cost adsorbents originating from agricultural waste has stood out for metal removal capabilities.

Aqueous adsorption and removal of organic contaminants by carbon nanotubes

International Nuclear Information System (INIS)

Yu, Jin-Gang; Zhao, Xiu-Hui; Yang, Hua; Chen, Xiao-Hong; Yang, Qiaoqin; Yu, Lin-Yan; Jiang, Jian-Hui; Chen, Xiao-Qing

2014-01-01

Organic contaminants have become one of the most serious environmental problems, and the removal of organic contaminants (e.g., dyes, pesticides, and pharmaceuticals/drugs) and common industrial organic wastes (e.g., phenols and aromatic amines) from aqueous solutions is of special concern because they are recalcitrant and persistent in the environment. In recent years, carbon nanotubes (CNTs) have been gradually applied to the removal of organic contaminants from wastewater through adsorption processes. This paper reviews recent progress (145 studies published from 2010 to 2013) in the application of CNTs and their composites for the removal of toxic organic pollutants from contaminated water. The paper discusses removal efficiencies and adsorption mechanisms as well as thermodynamics and reaction kinetics. CNTs are predicted to have considerable prospects for wider application to wastewater treatment in the future. - Highlights: • We summarize the most recent research progress of CNTs for removal of organics. • Adsorption mechanisms between CNTs and organics were elucidated in detail. • The developing trends and prospects of CNTs for removal of organics were discussed

Aqueous adsorption and removal of organic contaminants by carbon nanotubes

Energy Technology Data Exchange (ETDEWEB)

Yu, Jin-Gang, E-mail: yujg@csu.edu.cn [College of Chemistry and Chemical Engineering, Central South University, Changsha, Hunan 410083 (China); College of Chemistry and Chemical Engineering, Hunan University, Changsha, Hunan 410082 (China); Key Laboratory of Resources Chemistry of Nonferrous Metals, Ministry of Education, Central South University, Changsha, Hunan 410083 (China); Zhao, Xiu-Hui; Yang, Hua [College of Chemistry and Chemical Engineering, Central South University, Changsha, Hunan 410083 (China); Key Laboratory of Resources Chemistry of Nonferrous Metals, Ministry of Education, Central South University, Changsha, Hunan 410083 (China); Chen, Xiao-Hong [Collaborative Innovation Center of Resource-conserving and Environment-friendly Society and Ecological Civilization, Changsha, Hunan 410083 (China); Yang, Qiaoqin [Department of Mechanical Engineering, University of Saskatchewan, Saskatoon, SK S7N 5A9 (Canada); Yu, Lin-Yan [College of Chemistry and Chemical Engineering, Central South University, Changsha, Hunan 410083 (China); Key Laboratory of Resources Chemistry of Nonferrous Metals, Ministry of Education, Central South University, Changsha, Hunan 410083 (China); Jiang, Jian-Hui [College of Chemistry and Chemical Engineering, Hunan University, Changsha, Hunan 410082 (China); Chen, Xiao-Qing, E-mail: xqchen@csu.edu.cn [College of Chemistry and Chemical Engineering, Central South University, Changsha, Hunan 410083 (China); Key Laboratory of Resources Chemistry of Nonferrous Metals, Ministry of Education, Central South University, Changsha, Hunan 410083 (China)

2014-06-01

Organic contaminants have become one of the most serious environmental problems, and the removal of organic contaminants (e.g., dyes, pesticides, and pharmaceuticals/drugs) and common industrial organic wastes (e.g., phenols and aromatic amines) from aqueous solutions is of special concern because they are recalcitrant and persistent in the environment. In recent years, carbon nanotubes (CNTs) have been gradually applied to the removal of organic contaminants from wastewater through adsorption processes. This paper reviews recent progress (145 studies published from 2010 to 2013) in the application of CNTs and their composites for the removal of toxic organic pollutants from contaminated water. The paper discusses removal efficiencies and adsorption mechanisms as well as thermodynamics and reaction kinetics. CNTs are predicted to have considerable prospects for wider application to wastewater treatment in the future. - Highlights: • We summarize the most recent research progress of CNTs for removal of organics. • Adsorption mechanisms between CNTs and organics were elucidated in detail. • The developing trends and prospects of CNTs for removal of organics were discussed.

On the influence of the processing conditions on the performance of electrically conductive carbon nanotube/polymer nanocomposites

NARCIS (Netherlands)

Grossiord, N.; Kivit, P.J.J.; Loos, J.; Meuldijk, J.; Kyrylyuk, A.V; Schoot, van der P.P.A.M.; Koning, C.E.

2008-01-01

We prepared multiwalled carbon nanotube/polystyrene (MWCNT/PS) nanocomposites using a latex-based process, the main step of which consists of directly mixing an aqueous suspension of exfoliated MWCNTs and a PS latex, both stabilized by an anionic surfactant. After freeze drying and compression

Kinetics of diuron and amitrole adsorption from aqueous solution on activated carbons.

Science.gov (United States)

Fontecha-Cámara, M A; López-Ramón, M V; Pastrana-Martínez, L M; Moreno-Castilla, C

2008-08-15

A study was conducted on the adsorption kinetics of diuron and amitrole from aqueous solutions on activated carbons of different particle sizes and on an activated carbon fiber. Different kinetic models were applied to the experimental results obtained. A pseudo-second-order rate equation fitted the adsorption kinetics data better than a pseudo-first-order rate equation. Amitrole showed faster adsorption kinetics compared with diuron because of the smaller size of the former herbicide, despite its lower driving force for adsorption. Both reaction rate constants increased when the particle size decreased. The activated carbon fiber and the activated carbon of smallest particle size (0.03 mm) showed similar adsorption kinetics. The intraparticle diffusion rate constant increased with higher initial concentration of herbicides in solution and with lower particle size of the adsorbent. This is because the rise in initial concentration increased the amount adsorbed at equilibrium, and the reduction in particle size increased the number of collisions between adsorbate and adsorbent particles. Demineralization of the activated carbon with particle size of 0.5mm had practically no effect on the adsorption kinetics.

Fly ash: An alternative to powdered activated carbon for the removal of eosin dye from aqueous solutions

Directory of Open Access Journals (Sweden)

V.O. Njoku

2013-05-01

Full Text Available This paper reports the use of powdered activated carbon (PAC and raw coal fly ash (RFA in the removal of eosin dye from aqueous solution in batch processes. Operational parameters such as contact time, initial dye concentration, pH and temperature were investigated. Adsorption equilibrium was established in 120 min for the two adsorbents. Langmuir and Freundlich isotherms were used to fit the adsorption data. Langmuir model gave the best fit in both cases. The adsorption capacities of PAC and RFA were found to be 62.28 mg/g and 43.48 mg/g, respectively. The highest percentage of eosin dye removal for both PAC (98% and RFA (90% was observed at pH 2. Pseudo first-order and pseudo second-order kinetic models were used to fit the adsorption data. Pseudo second-order kinetic model gave the best description of the adsorption of eosin dye onto the two adsorbents. Thermodynamic parameters, ΔH0, ΔS0 and ΔG0 confirmed the physical nature, spontaneity and the endothermic nature of the adsorption process. A regeneration technique and a process calculation for evaluating the adsorbent dose required were carried out. This study has shown that RFA is a good alternative adsorbent in the removal of eosin dye from aqueous solution.

Effect of textural and chemical characteristics of activated carbons on phenol adsorption in aqueous solutions

OpenAIRE

Vargas Diana P.; Giraldo Liliana; Moreno-Piraján Juan Carlos

2017-01-01

The effect of textural and chemical properties such as: surface area, pore volume and chemical groups content of the granular activated carbon and monoliths on phenol adsorption in aqueous solutions was studied. Granular activated carbon and monolith samples were produced by chemical activation. They were characterized by using N2 adsorption at 77 K, CO2 adsorption at 273 K, Boehm Titrations and immersion calorimetry in phenol solutions. Microporous materials with different pore size distribu...

Dissolution of barite for the analysis of strontium isotopes and other chemical and isotopic variations using aqueous sodium carbonate

Science.gov (United States)

Breit, G.N.; Simmons, E.C.; Goldhaber, M.B.

1985-01-01

A simple procedure for preparing barite samples for chemical and isotopic analysis is described. Sulfate ion, in barite, in the presence of high concentrations of aqueous sodium carbonate, is replaced by carbonate. This replacement forms insoluble carbonates with the cations commonly in barite: Ba, Sr, Ca and Pb. Sulfate is released into the solution by the carbonate replacement and is separated by filtration. The aqueous sulfate can then be reprecipitated for analysis of the sulfur and oxygen isotopes. The cations in the carbonate phase can be dissolved by acidifying the solid residue. Sr can be separated from the solution for Sr isotope analysis by ion-exchange chromatography. The sodium carbonate used contains amounts of Sr which will affect almost all barite 87Sr 86Sr ratios by less than 0.00001 at 1.95?? of the mean. The procedure is preferred over other techniques used for preparing barite samples for the determination of 87Sr 86Sr ratios because it is simple, rapid and enables simultaneous determination of many compositional parameters on the same material. ?? 1985.

Aqueous processing of organic compounds in carbonaceous asteroids

Science.gov (United States)

Trigo-Rodríguez, Josep Maria; Rimola, Albert; Martins, Zita

2015-04-01

There is growing evidence pointing towards a prebiotic synthesis of complex organic species in water-rich undifferentiated bodies. For instance, clays have been found to be associated with complex organic compounds (Pearson et al. 2002; Garvie & Buseck 2007; Arteaga et al. 2010), whereas theoretical calculations have studied the interaction between the organic species and surface minerals (Rimola et al., 2013) as well as surface-induced reactions (Rimola at al. 2007). Now, we are using more detailed analytical techniques to study the possible processing of organic molecules associated with the mild aqueous alteration in CR, CM and CI chondrites. To learn more about these processes we are studying carbonaceous chondrites at Ultra High-Resolution Transmission Electron Microscopy (UHR-TEM). We are particularly interested in the relationship between organics and clay minerals in carbonaceous chondrites (CCs) matrixes (Trigo-Rodríguez et al. 2014, 2015).We want to address two goals: i) identifying the chemical steps in which the organic molecules could have increased their complexity (i.e., surface interaction and catalysis); and ii) studying if the organic matter present in CCs experienced significant processing concomitant to the formation of clays and other minerals at the time in which these planetary bodies experienced aqueous alteration. Here, these two points are preliminarily explored combing experimental results with theoretical calculations based on accurate quantum mechanical methods. References Arteaga O, Canillas A, Crusats J, El-Hachemi Z, Jellison GE, Llorca J, Ribó JM (2010) Chiral biases in solids by effect of shear gradients: a speculation on the deterministic origin of biological homochirality. Orig Life Evol Biosph 40:27-40. Garvie LAJ, Buseck PR (2007) Prebiotic carbon in clays from Orgueil and Ivuna (CI) and Tagish lake (C2 ungrouped) meteorites. Meteorit Planet Sci 42:2111-2117. Pearson VK, Sephton MA, Kearsley AT, Bland AP, Franchi IA, Gilmour

Non-aqueous heavy oil extraction from oil sand

Energy Technology Data Exchange (ETDEWEB)

Bohnert, George [National Nuclear Security Administration (United States)

2011-07-01

The Kansas City plant operated by Honeywell has a long history of working with DOE NNSA on engineering and manufacturing services supporting national security requirements. The plant has developed a non-aqueous method for heavy oil extraction from oil sands. This method is environmentally friendly as it does not use any external body of water, which would normally be contaminated in the conventional method. It is a 2 phase process consisting of terpene, limonene or alpha pinene, and carbon dioxide. The CO2 and terpene phases are both closed loop systems which minimizes material loss. The limonene and alpha pinene are both naturally derived solvents that come from citrus sources or pine trees respectively. Carbon dioxide is an excellent co-solvent with terpene. There is also a possibility for heat loss recovery during the distillation phase. This process produces clean dry sand. Laboratory tests have concluded that this using non-aqueous liquids process works effectively.

Artificial Intelligence Study (AIS).

Science.gov (United States)

1987-02-01

ARTIFICIAL INTELLIGNECE HARDWARE ....... 2-50 AI Architecture ................................... 2-49 AI Hardware ....................................... 2...ftf1 829 ARTIFICIAL INTELLIGENCE STUDY (RIS)(U) MAY CONCEPTS 1/3 A~NLYSIS AGENCY BETHESA RD R B NOJESKI FED 6? CM-RP-97-1 NCASIFIED /01/6 M |K 1.0...p/ - - ., e -- CAA- RP- 87-1 SAOFŔ)11 I ARTIFICIAL INTELLIGENCE STUDY (AIS) tNo DTICFEBRUARY 1987 LECT 00 I PREPARED BY RESEARCH AND ANALYSIS

AIS ASM Operational Integration Plan

Science.gov (United States)

2013-08-01

Rack mount computer AIS Radio Interface Ethernet Switch 192.168.0.x Firewall Cable Modem 192.168.0.1 VTS Accred. Boundary AIS ASM Operational... AIS ASM Operational Integration Plan Distribution Statement A: Approved for public release; distribution is unlimited. August 2013 Report No...CD-D-07-15 AIS ASM Operational Integration Plan ii UNCLAS//Public | CG-926 R&DC | I. Gonin, et al. | Public August 2013 N O T I C

Formation and composition of adsorbates on hydrophobic carbon surfaces from aqueous laccase-maltodextrin mixture suspension

Energy Technology Data Exchange (ETDEWEB)

Corrales Ureña, Yendry Regina, E-mail: yendry386@hotmail.com [UNESP São Paulo State University, Av. Eng. Luiz Edmundo Carrijo Coube, 14-01, Bauru, São Paulo (Brazil); Fraunhofer Institute for Manufacturing Technology and Advanced Materials IFAM, Wiener Strasse 12, 28359 Bremen (Germany); Lisboa-Filho, Paulo Noronha [UNESP São Paulo State University, Av. Eng. Luiz Edmundo Carrijo Coube, 14-01, Bauru, São Paulo (Brazil); Szardenings, Michael [Fraunhofer Institute for Cell Therapy and Immunology IZI, Perlickstrasse 1, 04103 Leipzig (Germany); Gätjen, Linda; Noeske, Paul-Ludwig Michael; Rischka, Klaus [Fraunhofer Institute for Manufacturing Technology and Advanced Materials IFAM, Wiener Strasse 12, 28359 Bremen (Germany)

2016-11-01

Highlights: • Less than 10 nm layer formed on carbon based materials composed by laccase and maltodextrin. • Improvement of the wettability of carbon based materials. • A protein-polysaccharide biofilm layer formation at solid liquid interface. • Stable layers formed under buffer and water rinsing. - Abstract: A robust procedure for the surface bio-functionalization of carbon surfaces was developed. It consists on the modification of carbon materials in contact with an aqueous suspension of the enzyme laccase from Trametes versicolor and the lyophilization agent maltodextrin, with the pH value adjusted close to the isoelectric point of the enzyme. We report in-situ investigations applying Quartz Crystal Microbalance with Dissipation (QCM-D) for carbon-coated sensor surfaces and, moreover, ex-situ measurements with static contact angle measurements, X-ray Photoelectron Spectroscopy (XPS) and Scanning Force Microscopy (SFM) for smooth Highly Oriented Pyrolytic Graphite (HOPG) substrates, for contact times between the enzyme formulation and the carbon material surface ranging from 20 s to 24 h. QCM-D studies reveals the formation of rigid layer of biomaterial, a few nanometers thin, which shows a strongly improved wettability of the substrate surface upon contact angle measurements. Following spectroscopic characterization, these layers are composed of mixtures of laccase and maltodextrin. The formation of these adsorbates is attributed to attractive interactions between laccase, the maltodextrin-based lyophilization agent and the hydrophobic carbon surfaces; a short-term contact between the aqueous laccase mixture suspension and HOPG surfaces is shown to merely result in de-wetting patterns influencing the results of contact angle measurements. The new enzyme-based surface modification of carbon-based materials is suggested to be applicable for the improvement of not only the wettability of low energy substrate surfaces with fluid formulations like coatings

Use of AI-1024 and AI-4096 analyzers in multiple regimes

International Nuclear Information System (INIS)

Zaika, N.D.; Kovtunenko, I.S.; Savchuk, O.G.

1975-01-01

The operation of pulse multichannel analyzers in the following multidimensional modes: AI-1024-4 - amplitude mode from several transducers; amplitude mode from several transducers at different time intervals; AI-4096-3M - amplitude mode at different time intervals in each of four groups with unit BVI-1

Study on AI-2 signaling molecules activity and the effect of matrine on AI-2 in Staphylococcus epidermidis LuxS/AI-2 quorum sensing%产膜表皮葡萄球菌LuxS/AI-2型密度感应系统AI-2的活性及苦参碱对其的影响

Institute of Scientific and Technical Information of China (English)

李雪; 何芳; 卢金霞; 管翠萍; 周学章

2017-01-01

[Objective] This study investigated the activity of AI-2 signaling molecules in Staphylococcus epidermidis planktonic bacteria and biofilm bacteria and the effect of matrine.[Method] The growth curve of Staphylococcus epidermidis planktonic bacteria and biofilm bacteria was drawn and AI-2 concentration was measured using the V.harveyi bioluminescence assay.The transcription level of luxS gene was analyzed using real-time PCR.The AI-2 signaling molecules of Staphylococcus epidermidis ATCC35984 were treated with matrine and the changes of AI-2 signaling molecules activity were determined.[Result] In Staphylococcus epidermidis planktonic bacteria growth process,AI-2 signaling molecule activity and the relative expression quantity of luxS gene reached the maximum in the logarithmic phase before decreasing gradually.Their change curves were similar with planktonic growth curve.However,in the growth process of Staphylococcus epidermidis biofilm bacteria,the activity trend was similar with the biofilm growth.The relative expression quantity of luxS gene had an opposite trend to biofilm growth.Matrine had inhibitory effect on AI-2 signaling molecule activity in planktonic and biofilm bacteria,and the inhibitory effect was stronger to planktonic bacteria.[Conclusion] AI-2 signaling molecule activity and relative expression quantity of luxS gene highly correlated with the growth of Staphylococcus epidermidis and its biofilm formation.Matrine significantly reduced the AI-2 signaling molecule activity of Staphylococcus epidermidis.%[目的]研究产膜表皮葡萄球菌生物被膜菌和液相浮游菌LuxS/AI-2型密度感应系统中AI-2信号分子的活性及苦参碱对其的影响.[方法]绘制产膜表皮葡萄球菌ATCC35984液相浮游菌及生物被膜菌的生长曲线;利用哈维氏弧菌BB170(Vibrio harveyi BB170)作为报告菌株检测表皮葡萄球菌AI-2�

Molecular dynamics study of interfacial confinement effects of aqueous NaCl brines in nanoporous carbon

Energy Technology Data Exchange (ETDEWEB)

Wander, M. C. F.; Shuford, K. L.

2010-12-09

In this paper, studies of aqueous electrolyte solutions in contact with a family of porous carbon geometries using classical molecular dynamics simulations are presented. These simulations provide an atomic scale depiction of ion transport dynamics in different environments to elucidate power of aqueous electrolyte supercapacitors. The electrolyte contains alkali metal and halide ions, which allow for the examination of size trends within specific geometries as well as trends in concentration. The electrode pores are modeled as planar graphite sheets and carbon nanotubes with interstices ranging from one to four nanometers. Ordered layers form parallel to the carbon surface, which facilitates focused ion motion under slightly confining conditions. As a result, the ion’s diffusivities are enhanced in the direction of the slit or pore. Further confining the system leads to decreased ion diffusivities. The ions are fully hydrated in all but the smallest slits and pores with those sizes showing increased ion pairing. There is strong evidence of charge separation perpendicular to the surface at all size scales, concentrations, and ion types, providing a useful baseline for examining differential capacitance behavior and future studies on energy storage. These systems show promise as high-power electrical energy storage devices.

MassAI

DEFF Research Database (Denmark)

2011-01-01

A software tool for general analysis and data-mining of mass-spectrometric datasets. The program features a strong emphasis on scan-by-scan identification and results-transparency. MassAI also accommodates residue level analysis of labelled runs, e.g. HDX.......A software tool for general analysis and data-mining of mass-spectrometric datasets. The program features a strong emphasis on scan-by-scan identification and results-transparency. MassAI also accommodates residue level analysis of labelled runs, e.g. HDX....

Kinetics and Thermodynamics of Sorption of 4-Nitrophenol on Activated Kaolinitic Clay and Jatropha Curcas Activated Carbon from Aqueous Solution

Directory of Open Access Journals (Sweden)

Samsudeen Olanrewaju Azeez

2016-06-01

Full Text Available Adsorption behaviour of 4-nitrophenol (4-NP on activated kaolinitic clay and Jatropha curcas activated carbon was investigated. The kaolinitic clay and Jatropha curcas were activated with 1 M HNO3 and 0.5 M NaOH respectively and were characterized by XRF, XRD, BET, SEM and FTIR techniques. The effects of processing parameters, such as initial 4-NP concentration, temperature, pH, contact time and adsorbent dosage on the adsorption process were investigated. The results obtained showed that Jatropha curcas activated carbon exhibited higher performance than activated kaolinitic clay for the removal of 4-nitrophenol from aqueous solution. Langmuir, Freundlich, Temkin and Dubinin-Radushkevich models were used to describe the adsorption isotherms. The adsorption data were best fitted with Freundlich model. The experimental data of the two adsorbate-adsorbent systems fitted very well with the pseudo-second order kinetic model with r2 values of 0.999 respectively. Adsorption thermodynamic parameters were also estimated. The results revealed that the adsorption of 4-nitrophenol onto both adsorbents were exothermic processes and spontaneous for Jatropha curcas activated carbon but non spontaneous for activated kaolinitic clay.

Kinetics and thermodynamics of sorption of 4-nitrophenol on activated kaolinitic clay and jatropha curcas activated carbon from aqueous solution

International Nuclear Information System (INIS)

Azeez, S.O.; Adekola, F.A.

2016-01-01

Adsorption behaviour of 4-nitrophenol (4-NP) on activated kaolinitic clay and Jatropha curcas activated carbon was investigated. The kaolinitic clay and Jatropha curcas were activated with 1 M HNO/sub 3/ and 0.5 M NaOH respectively and were characterized by XRF, XRD, BET, SEM and FTIR techniques. The effects of processing parameters, such as initial 4-NP concentration, temperature, pH, contact time and adsorbent dosage on the adsorption process were investigated. The results obtained showed that Jatropha curcas activated carbon exhibited higher performance than activated kaolinitic clay for the removal of 4-nitrophenol from aqueous solution. Langmuir, Freundlich, Temkin and Dubinin-Radushkevich models were used to describe the adsorption isotherms. The adsorption data were best fitted with Freundlich model. The experimental data of the two adsorbate-adsorbent systems fitted very well with the pseudosecond order kinetic model with r2 values of 0.999 respectively. Adsorption thermodynamic parameters were also estimated. The results revealed that the adsorption of 4-nitrophenol onto both adsorbents were exothermic processes and spontaneous for Jatropha curcas activated carbon but non spontaneous for activated kaolinitic clay. (author)

Bioreversible Derivatives of Phenol. 2. Reactivity of Carbonate Esters with Fatty Acid-like Structures Towards Hydrolysis in Aqueous Solutions

Directory of Open Access Journals (Sweden)

Claus Larsen

2007-10-01

Full Text Available A series of model phenol carbonate ester prodrugs encompassing derivatives with fatty acid-like structures were synthesized and their stability as a function of pH (range 0.4 – 12.5 at 37°C in aqueous buffer solutions investigated. The hydrolysis rates in aqueous solutions differed widely, depending on the selected pro-moieties (alkyl and aryl substituents. The observed reactivity differences could be rationalized by the inductive and steric properties of the substituent groups when taking into account that the mechanism of hydrolysis may change when the type of pro-moiety is altered, e.g. n-alkyl vs. t-butyl. Hydrolysis of the phenolic carbonate ester 2-(phenoxycarbonyloxy-acetic acid was increased due to intramolecular catalysis, as compared to the derivatives synthesized from ω-hydroxy carboxylic acids with longer alkyl chains. The carbonate esters appear to be less reactive towards specific acid and base catalyzed hydrolysis than phenyl acetate. The results underline that it is unrealistic to expect that phenolic carbonate ester prodrugs can be utilized in ready to use aqueous formulations. The stability of the carbonate ester derivatives with fatty acid-like structures, expected to interact with the plasma protein human serum albumin, proved sufficient for further in vitro and in vivo evaluation of the potential of utilizing HSA binding in combination with the prodrug approach for optimization of drug pharmacokinetics.

Proceedings of conference on AI applications in physical sciences

International Nuclear Information System (INIS)

1993-01-01

A Conference cum workshop on AI applications in Physical Sciences was organised by the Indian Physics Association at Bhabha Atomic Research Centre, Bombay during January 15-17, 1992. It was held in memory of Late Shri S.N. Seshadri, who was the moving spirit behind self reliance in instrumentation development for research and industry. The two day conference which was followed by one day workshop covered the following broad spectrum of topics in Artificial Intelligence: AI Tools and Techniques, Neural Networks, Robotics and Machine Vision, Fuzzy Control and Applications, Natural Language and Speech Processing, Knowledge based Systems, and AI and Allied applications. The conference dealt with recent advances and achievements in AI. It provided a forum for the exchange of valuable information and expertise in this fast emerging field. Over 200 scientists, engineers and computer professionals from various universities, R and D institutes and industries actively participated. 45 contributed papers and 8 invited talks were presented in the symposium. The volume contains selected papers which were contributed by the participants. Some of them dealt with AI applications in nuclear science and technology. (original)

Present status of application of AI in nuclear industry

International Nuclear Information System (INIS)

Kitamura, Masaharu

1989-01-01

Artificial intelligence (AL) techniques have been introduced actively in the nuclear industry in pursuit of increased safety and efficiency. The present report outlines some AI techniques currently used in nuclear facilities. This type of techniques have increasingly been introduced to such areas as design, construction, operation, maintenance, quality control and analysis. Most of them use knowledge engineering techniques including expert systems. Positive efforts at research and application of various more advance AI techniaues have started recently. For application of AI techniques, activities in nuclear power plants can be divided into two groups. One includes 'analytical' activities such as operation, maintenance and analysis, while the other includes 'synthetic' activities such as design, construction and fuel control. The most important AI technology for the analytical activities is diagnosis. Thus the report outlines major processes to which diagnostic techniques are applicable, and knowledge description and inference methods used for diagnosis. For AI techniques for synthetic activities, some problems and possible solutions are addressed. Development efforts in and outside Japan are also outlined. (Nogami, K.)

Boron removal from aqueous solutions by activated carbon impregnated with salicylic acid

International Nuclear Information System (INIS)

Celik, Z. Ceylan; Can, B.Z.; Kocakerim, M. Muhtar

2008-01-01

In this study, the removal of boric acid from aqueous solution by activated carbon impregnated with salicylic acid was studied in batch system. pH, adsorbent amount, initial boron concentration, temperature, shaking rate and salicylic acid film thickness were chosen as parameters. Boron removal efficiencies increased with increasing adsorbent amount, temperature and pH, decreasing initial boron concentration. As thickness of salicylic acid film on activated carbon becomes thin up to 0.088 nm, the efficiency increased, and then, the efficiency decreased with becoming thinner than 0.088 nm of salicylic acid film. Shaking rate was no effect on removal efficiency. In result, it was determined that the use of salicylic acid as an impregnant for activated carbon led to the increase of the amount of boron adsorbed. A lactone ring, being the most appropriate conformation, forms between boric acid and -COOH and -OH groups of salicylic acid

Boron removal from aqueous solutions by activated carbon impregnated with salicylic acid

Energy Technology Data Exchange (ETDEWEB)

Celik, Z. Ceylan [Department of Environmental Engineering, Atatuerk University, Faculty of Engineering, Erzurum (Turkey)], E-mail: zcelik@atauni.edu.tr; Can, B.Z. [Department of Environmental Engineering, Atatuerk University, Faculty of Engineering, Erzurum (Turkey); Kocakerim, M. Muhtar [Department of Chemical Engineering, Atatuerk University, Faculty of Engineering, 25240 Erzurum (Turkey)

2008-03-21

In this study, the removal of boric acid from aqueous solution by activated carbon impregnated with salicylic acid was studied in batch system. pH, adsorbent amount, initial boron concentration, temperature, shaking rate and salicylic acid film thickness were chosen as parameters. Boron removal efficiencies increased with increasing adsorbent amount, temperature and pH, decreasing initial boron concentration. As thickness of salicylic acid film on activated carbon becomes thin up to 0.088 nm, the efficiency increased, and then, the efficiency decreased with becoming thinner than 0.088 nm of salicylic acid film. Shaking rate was no effect on removal efficiency. In result, it was determined that the use of salicylic acid as an impregnant for activated carbon led to the increase of the amount of boron adsorbed. A lactone ring, being the most appropriate conformation, forms between boric acid and -COOH and -OH groups of salicylic acid.

Carbon Mineralization by Aqueous Precipitation for Beneficial Use of CO2 from Flue Gas

Energy Technology Data Exchange (ETDEWEB)

Brent Constantz; Randy Seeker; Martin Devenney

2010-06-30

Calera's innovative Mineralization via Aqueous Precipitation (MAP) technology for the capture and conversion of CO{sub 2} to useful materials for use in the built environment was further developed and proven in the Phase 1 Department of Energy Grant. The process was scaled to 300 gallon batch reactors and subsequently to Pilot Plant scale for the continuous production of product with the production of reactive calcium carbonate material that was evaluated as a supplementary cementitious material (SCM). The Calera SCM{trademark} was evaluated as a 20% replacement for ordinary portland cement and demonstrated to meet the industry specification ASTM 1157 which is a standard performance specification for hydraulic cement. The performance of the 20% replacement material was comparable to the 100% ordinary portland cement control in terms of compressive strength and workability as measured by a variety of ASTM standard tests. In addition to the performance metrics, detailed characterization of the Calera SCM was performed using advanced analytical techniques to better understand the material interaction with the phases of ordinary portland cement. X-ray synchrotron diffraction studies at the Advanced Photon Source in Argonne National Lab confirmed the presence of an amorphous phase(s) in addition to the crystalline calcium carbonate phases in the reactive carbonate material. The presence of carboaluminate phases as a result of the interaction of the reactive carbonate materials with ordinary portland cement was also confirmed. A Life Cycle Assessment was completed for several cases based on different Calera process configurations and compared against the life cycle of ordinary portland cement. In addition to the materials development efforts, the Calera technology for the production of product using an innovative building materials demonstration plant was developed beyond conceptual engineering to a detailed design with a construction schedule and cost estimate.

Novel Carbon Materials in the Cathode Formulation for High Rate Rechargeable Hybrid Aqueous Batteries

Directory of Open Access Journals (Sweden)

Xiao Zhu

2017-11-01

Full Text Available Novel carbon materials, carbon nanotubes (CNTs and porous graphene (PG, were exploited and used as conductive additives to improve the rate performance of LiMn2O4 cathode for the rechargeable aqueous Zn/LiMn2O4 battery, namely the rechargeable hybrid aqueous battery (ReHAB. Thanks to the long-range conductivity and stable conductive network provided by CNTs, the rate and cycling performances of LiMn2O4 cathode in ReHAB are highly improved—up to about 100 mAh·g−1 capacity is observed at 10 C (1 C = 120 mAh·g−1. Except for CNTs, porous graphene (PG with a high surface area, an abundant porous structure, and an excellent electrical conductivity facilitates the transportation of Li ions and electrons, which can also obviously enhance the rate capability of the ReHAB. This is important because the ReHAB could be charged/discharged in a few minutes, and this leads to potential application of the ReHAB in automobile industry.

Biosorption Studies for the Removal of Malachite Green from its Aqueous Solution by Activated Carbon Prepared from Cassava Peel

Directory of Open Access Journals (Sweden)

C. Parvathi

2011-01-01

Full Text Available The association of dyes with health related problems is not a new phenomenon. The effectiveness of carbon adsorption for dye removal from textile effluent has made it an ideal alternative to other expensive treatment methods. The preparation of activated carbon from agricultural waste could increase economic return and reduce pollution. Cassava peel has been used as a raw material to produce activated carbon. The study investigates the removal of malachite green dye from its aqueous solution. The effects of condition such as adsorbent dosage, initial dye concentration, pH and contact time were studied. The adsorption capacity was demonstrated as a function of time for malachite green from aqueous solution by the prepared activated carbon. The results showed that as the amount of the adsorbent was increased, the percentage of dye removal increased accordingly. Higher adsorption percentages were observed at lower concentrations of malachite green dye. Silver nitrate treated cassava peel showed a better performance compared to Sulphuric acid treated and raw carbons, thus making it an interesting option for dye removal textile effluent.

Metal adsorption process in activated carbon fiber from textile PAN fiber aim electrode production

International Nuclear Information System (INIS)

Rodrigues, Aline Castilho; Goncalves, Emerson Sarmento; Silva, Elen Leal da; Marcuzzo, Jossano Saldanha; Baldan, Mauricio Ribeiro; Cuna, Andres

2016-01-01

Full text: Carbon fibers have a variety of applications in industry and have been increasingly studied to explore their various characteristics. Studies show that the activated carbon fiber has been effective in removing small contaminants as well as activated carbon, because of its characteristic porosity. Other studies relate carbonaceous materials to the electrical conductivity devices application. This work is based on the use of an activated carbon fiber from textile polyacrylonitrile (PAN) for metallic ion adsorption from aqueous solution. Consequently, it improves the electrical characteristics and this fact show the possibility to use this material as electrode. The work was performed by adsorption process in saline solution (NO 3 Ag and ClPd) and activated carbon fiber in felt form as adsorbent. The metal adsorption on activated carbon fiber was characterized by textural analysis, x-ray diffraction (XRD), scanning electron microscopy equipped with energy dispersive x-ray (SEM-EDX), Raman spectroscopy and x-ray photoelectron spectroscopy (XPS). It was observed that activated carbon fiber showed good adsorption capacity for the metals used. At the end of the process, the activated carbon fiber samples gained about 15% by weight, related to metallic fraction incorporated into the fiber and the process of adsorption does not changed the structural, morphological and chemistry inertness of the samples. The results indicate the feasibility of this metal incorporation techniques activated carbon fiber for the production of electrodes facing the electrochemical area. (author)

Metal adsorption process in activated carbon fiber from textile PAN fiber aim electrode production

Energy Technology Data Exchange (ETDEWEB)

Rodrigues, Aline Castilho; Goncalves, Emerson Sarmento, E-mail: alinerodrigues_1@msn.com [Instituto Tecnologico Aeroespacial (ITA), Sao Jose dos Campos, SP (Brazil); Silva, Elen Leal da; Marcuzzo, Jossano Saldanha; Baldan, Mauricio Ribeiro [Instituto Nacional de Pesquisas Espaciais (INPE), Sao Jose dos Campos, SP (Brazil); Cuna, Andres [Faculdade de Quimica, Universidad de la Republica (Uruguay)

2016-07-01

Full text: Carbon fibers have a variety of applications in industry and have been increasingly studied to explore their various characteristics. Studies show that the activated carbon fiber has been effective in removing small contaminants as well as activated carbon, because of its characteristic porosity. Other studies relate carbonaceous materials to the electrical conductivity devices application. This work is based on the use of an activated carbon fiber from textile polyacrylonitrile (PAN) for metallic ion adsorption from aqueous solution. Consequently, it improves the electrical characteristics and this fact show the possibility to use this material as electrode. The work was performed by adsorption process in saline solution (NO{sub 3}Ag and ClPd) and activated carbon fiber in felt form as adsorbent. The metal adsorption on activated carbon fiber was characterized by textural analysis, x-ray diffraction (XRD), scanning electron microscopy equipped with energy dispersive x-ray (SEM-EDX), Raman spectroscopy and x-ray photoelectron spectroscopy (XPS). It was observed that activated carbon fiber showed good adsorption capacity for the metals used. At the end of the process, the activated carbon fiber samples gained about 15% by weight, related to metallic fraction incorporated into the fiber and the process of adsorption does not changed the structural, morphological and chemistry inertness of the samples. The results indicate the feasibility of this metal incorporation techniques activated carbon fiber for the production of electrodes facing the electrochemical area. (author)

Passivation behavior of Type 304 stainless steel in a non-aqueous alkyl carbonate solution containing LiPF6 salt

International Nuclear Information System (INIS)

Myung, Seung-Taek; Sasaki, Yusuke; Saito, Takamitsu; Sun, Yang-Kook; Yashiro, Hitoshi

2009-01-01

Passivation behavior of type 304 stainless steel in a non-aqueous alkyl carbonate solution containing LiPF 6 salt was studied using electrochemical polarization, X-ray photoelectron spectroscopy (XPS) and time of flight-secondary ion mass spectroscopy (ToF-SIMS). Cathodic polarization to 0 V vs. Li/Li + resulted in most but not complete reduction of the air-formed film from oxides to metal on the stainless steel, as confirmed by XPS. For complete elimination of the air-formed film, the surface of the stainless steel was scratched under anodic polarization conditions. At 3 V vs. Li/Li + where an anodic current peak appeared, only an indistinct layer was recognized on the newly scratched surface, according to ToF-SIMS analysis. Above 4 V vs. Li/Li + , substantial passive films were formed, which were composed of oxides and fluorides of iron and chromium. The origin of oxide was due to water contained in the non-aqueous alkyl carbonate solution, and that of fluorides were the result of the decomposition of electrolytic salt, LiPF 6 , especially at higher potential. The resultant passive films were stable in the non-aqueous alkyl carbonate solution containing LiPF 6 salt.

Oxidizing attack process of uranium ore by a carbonated liquor

International Nuclear Information System (INIS)

Maurel, Pierre; Nicolas, Francois.

1981-01-01

A continuous process for digesting a uraniferous ore by oxidation with a recycling aqueous liquor containing alkaline carbonates and bicarbonates in solution as well as uranium in a concentration close to its solubility limit at digestion temperature, and of recuperation of the precipitated uranium within the solid phase remaining after digestion. The digestion is carried out by spraying oxygen into the hot reactional medium in order not only to permit oxidation of the uranium and its solubilization but also to ensure that the sulphides of impurities and organic substances present in the ore are oxidized [fr

Kinetics of adsorption of dyes from aqueous solution using activated carbon prepared from waste apricot

International Nuclear Information System (INIS)

Onal, Yunus

2006-01-01

Adsorbent (WA11Zn5) has been prepared from waste apricot by chemical activation with ZnCl 2 . Pore properties of the activated carbon such as BET surface area, pore volume, pore size distribution, and pore diameter were characterized by N 2 adsorption and DFT plus software. Adsorption of three dyes, namely, Methylene Blue (MB), Malachite Green (MG), Crystal Violet (CV), onto activated carbon in aqueous solution was studied in a batch system with respect to contact time, temperature. The kinetics of adsorption of MB, MG and CV have been discussed using six kinetic models, i.e., the pseudo-first-order model, the pseudo-second-order model, the Elovich equation, the intraparticle diffusion model, the Bangham equation, the modified Freundlich equation. Kinetic parameters and correlation coefficients were determined. It was shown that the second-order kinetic equation could describe the adsorption kinetics for three dyes. The dyes uptake process was found to be controlled by external mass transfer at earlier stages (before 5 min) and by intraparticle diffusion at later stages (after 5 min). Thermodynamic parameters, such as ΔG, ΔH and ΔS, have been calculated by using the thermodynamic equilibrium coefficient obtained at different temperatures and concentrations. The thermodynamics of dyes-WA11Zn5 system indicates endothermic process

UTILIZATION OF AQUEOUS-TAR CONDENSATES FORMED DURING GASIFICATION

Directory of Open Access Journals (Sweden)

Anna Kwiecińska

2016-11-01

Full Text Available Gasification of solid fuels is an alternative process for energy production using conventional and renewable fuels. Apart from desired compounds, i.e. carbon oxide, hydrogen and methane, the produced gas contains complex organic (tars and inorganic (carbonizate, ammonia contaminants. Those substances, together with water vapor, condensate during cooling of the process gas, what results in the formation of aqueous-tar condensate, which requires proper methods of utilization. The management of this stream is crucial for commercialization and application of the gasification technology. In the paper the treatment of aqueous-tar condensates formed during biomass gasification process is discussed. The removal of tars from the stream was based on their spontaneous separation. The aqueous stream was subjected to ultrafiltration operated at different pressures. Such a treatment configuration enabled to obtain highly concentrated retentate, which could be recycled to the gasifier, and filtrate, which could be subjected to further treatment.

Synthesis of high-purity precipitated calcium carbonate during the process of recovery of elemental sulphur from gypsum waste

CSIR Research Space (South Africa)

De Beer, Morris

2015-08-01

Full Text Available (PCC). The process used an acid gas (H2S) to improve the aqueous dissolution of CaS, which is otherwise poorly soluble. The carbonate product was primarily calcite (99.5%) with traces of quartz (0.5%). Calcite was the only CaCO3 polymorph obtained...

Controlling wear failure of graphite-like carbon film in aqueous environment: Two feasible approaches

International Nuclear Information System (INIS)

Wang Yongxin; Wang Liping; Xue Qunji

2011-01-01

Friction and wear behaviors of graphite-like carbon (GLC) films in aqueous environment were investigated by a reciprocating sliding tribo-meter with ball-on-disc contact. Film structures and wear scars were studied by scanning electron microscope (SEM), energy dispersive spectroscopy (EDS) and a non-contact 3D surface profiler. A comprehensive wear model of the GLC film in aqueous environment was established, and two feasible approaches to control critical factor to the corresponding wear failure were discussed. Results showed that wear loss of GLC films in aqueous environment was characterized by micro-plough and local delamination. Due to the significant material loss, local delamination of films was critical to wear failure of GLC film in aqueous environment if the film was not prepared properly. The initiation and propagation of micro-cracks within whole films closely related to the occurrence of the films delamination from the interface between interlayer and substrate. The increase of film density by adjusting the deposition condition would significantly reduce the film delamination from substrate, meanwhile, fabricating a proper interlayer between substrate and GLC films to prevent the penetration of water molecules into the interface between interlayer and substrate could effectively eliminate the delamination.

Ai

African Journals Online (AJOL)

:=g=~!Ai~~~~~g~~ ~~~~~~. Jim Taylor, Rob O'Donoghue and Alistair Clacherty. INTRODUCTION. The Department of Environment Affairs, in cooperation with ...

Adsorptive removal of congo red dye from aqueous solution using bael shell carbon

International Nuclear Information System (INIS)

Ahmad, Rais; Kumar, Rajeev

2010-01-01

This study investigates the potential use of bael shell carbon (BSC) as an adsorbent for the removal of congo red (CR) dye from aqueous solution. The effect of various operational parameters such as contact time, temperature, pH, and dye concentration were studied. The adsorption kinetics was modeled by first-order reversible kinetics, pseudo-first-order kinetics, and pseudo-second-order kinetics. The dye uptake process obeyed the pseudo-second-order kinetic expression at pH 5.7, 7 and 8 whereas the pseudo-first-order kinetic model was fitted well at pH 9. Langmuir, Freundlich and Temkin adsorption models were applied to fit adsorption equilibrium data. The best-fitted data was obtained with the Freundlich model. Thermodynamic study showed that adsorption of CR onto BSC was endothermic in nature and favorable with the positive ΔH o value of 13.613 kJ/mol.

A framework for AI-based nuclear design support system

International Nuclear Information System (INIS)

Furuta, Kazuo; Kondo, Shunsuke

1991-01-01

Nowadays many computer programs are being developed and used for the analytic tasks in nuclear reactor design, but experienced designers are still responsible for most of the synthetic tasks which are not amenable to algorithmic computer processes. Artificial intelligence (AI) is a promising technology to deal with these intractable tasks in design. In development of AI-based design support systems, it is desirable to choose a comprehensive framework based on the scientific theory of design. In this work a framework for AI-based design support systems for nuclear reactor design will be proposed based on an exploration model of design. The fundamental architectures of this framework will be described especially on knowledge representation, context management and design planning. (author)

Aqueous suspensions of carbon nanotubes: surface oxidation, colloidal stability and uranium sorption.

Science.gov (United States)

Schierz, A; Zänker, H

2009-04-01

The objective of this study is to obtain information on the behaviour of carbon nanotubes (CNTs) as potential carriers of pollutants in the case of accidental CNT release to the environment and on the properties of CNTs as a potential adsorbent material in water purification. The effects of acid treatment of CNTs on (i) the surface properties, (ii) the colloidal stability and (iii) heavy metal sorption are investigated, the latter being exemplified by uranium(VI) sorption. There is a pronounced influence of surface treatment on the behaviour of the CNTs in aqueous suspension. Results showed that acid treatment increases the amount of acidic surface groups on the CNTs. Therefore, acid treatment has an increasing effect on the colloidal stability of the CNTs and on their adsorption capacity for U(VI). Another way to stabilise colloids of pristine CNTs in aqueous suspension is the addition of humic acid.

A conductance study of guanidinium chloride, thiocyanate, sulfate, and carbonate in dilute aqueous solutions: ion-association and carbonate hydrolysis effects.

Science.gov (United States)

Hunger, Johannes; Neueder, Roland; Buchner, Richard; Apelblat, Alexander

2013-01-17

We study the conductance of dilute aqueous solutions for a series of guandinium salts at 298.15 K. The experimental molar conductivities were analyzed within the framework of the Quint-Viallard theory in combination with Debye-Hückel activity coefficients. From this analysis, we find no evidence for significant ion association in aqueous solutions of guanidinium chloride (GdmCl) and guanidinium thiocyanate (GdmSCN), and the molar conductivity of these electrolytes can be modeled assuming a complete dissociation. The limiting ionic conductivity of the guanidinium ion (Gdm(+)) is accurately determined to λ(Gdm(+)) = 51.45 ± 0.10 S cm(2) mol(-1). For the bivalent salts guanidinium sulfate (Gdm(2)SO(4)) and guanidinium carbonate (Gdm(2)CO(3)), the molar conductivities show small deviations from ideal (fully dissociated electrolyte) behavior, which are related to weak ion association in solution. Furthermore, for solutions of Gdm(2)CO(3), the hydrolysis of the carbonate anion leads to distinctively increased molar conductivities at high dilutions. The observed ion association is rather weak for all studied electrolytes and cannot explain the different protein denaturing activities of the studied guanidinium salts, as has been proposed previously.

Dicty_cDB: FC-AI01 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available FC (Link to library) FC-AI01 (Link to dictyBase) - - - Contig-U15592-1 FC-AI01E (Li...nk to Original site) - - - - - - FC-AI01E 307 Show FC-AI01 Library FC (Link to library) Clone ID FC-AI01 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AI/FC-AI01Q.Seq.d/ Representative seq. ID FC-AI...01E (Link to Original site) Representative DNA sequence >FC-AI01 (FC-AI01Q) /CSM/FC/FC-AI/FC-AI01Q.Seq....uences producing significant alignments: (bits) Value FC-AI01 (FC-AI01Q) /CSM/FC/FC-AI/FC-AI01Q.Seq.d/ 68 8e

Carbon dioxide assist for non-aqueous sodium–oxygen batteries

KAUST Repository

Das, Shyamal K.

2013-02-01

We report a novel non-aqueous Na-air battery that utilizes a gas mixture of CO2 and O2. The battery exhibits a high specific energy of 6500-7000 Whkg- 1 (based on the carbon mass) over a range of CO2 feed compositions. The energy density achieved is higher, by 200% to 300%, than that obtained in pure oxygen. Ex-situ FTIR and XRD analysis reveal that Na2O2, Na2C2O 4 and Na2CO3 are the principal discharge products. The Na-CO2/O2 and Mg-CO2/O 2 battery platforms provide a promising, new approach for CO 2 capture and generation of electrical energy. © 2012 Elsevier B.V. All rights reserved.

Molybdenum recovery from aqueous residual solutions resulted in uranium ores processing

International Nuclear Information System (INIS)

Stoica, L.; Jitaru, I.; Razvan, A.; Georgescu, D.; Petrescu, S.; Filip, D.

1998-01-01

The paper represents a comparative study regarding the Mo(VI) separation from residual aqueous systems, applying two methods adsorption of Mo(VI) on ferric hydroxide support followed by the flotation of insoluble species in dissolved air flotation variant (DAF); Mo (VI) adsorption on activated carbon. The Mo(VI) ions separation by dissolved air flotation followed the main factors which influence the separation yield such as: the adsorbent nature, pH, the nature and the collector concentration, initial Mo(VI) concentration and the Mo(VI)-adsorbent support-collector interaction The Mo(VI) adsorption on activated carbon was made following the influence of different factors such as: pH, initial Mo(VI), concentration, contact time and specific inflow. (orig.)

Dicty_cDB: FC-AI13 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available FC (Link to library) FC-AI13 (Link to dictyBase) - - - Contig-U16263-1 FC-AI13F (Li...nk to Original site) FC-AI13F 507 - - - - - - Show FC-AI13 Library FC (Link to library) Clone ID FC-AI13 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AI/FC-AI13Q.Seq.d/ Representative seq. ID FC-AI...13F (Link to Original site) Representative DNA sequence >FC-AI13 (FC-AI13Q) /CSM/FC/FC-AI/FC-AI13Q.Seq....nificant alignments: (bits) Value FC-AI13 (FC-AI13Q) /CSM/FC/FC-AI/FC-AI13Q.Seq.d/ 963 0.0 VSA730 (VSA730Q)

Hybrid capacitors utilizing halogen-based redox reactions at interface between carbon positive electrode and aqueous electrolytes

Science.gov (United States)

Yamazaki, Shigeaki; Ito, Tatsuya; Murakumo, Yuka; Naitou, Masashi; Shimooka, Toshiharu; Yamagata, Masaki; Ishikawa, Masashi

2016-09-01

We propose novel hybrid capacitors (HCs) with electrolyte-involved redox reactions of bromide or iodide species by pretreatment of an activated carbon positive electrode. The treatment is simple; impregnation of pores at an activated carbon fiber cloth (ACFC) as a positive electrode with bromine- or iodine-containing water before cell assembly. The treated positive electrode is applied to a HC cell with a non-treated negative electrode of ACFC and its electrochemical performance is investigated by galvanostatic cycling and leakage current tests. Few studies on such "electrolytic" charge storage systems have provided acceptable capacitor performance because of inevitable self-discharge caused by diffusion of charged species form an electrode to the other one through an electrolyte. Nevertheless, our electrolyte-redox-based HCs show excellent performance without undesirable diffusion of charged species. Moreover, the present HC utilizing a bromide redox system fulfills a practical cell voltage of 1.8 V in spite of an aqueous electrolyte system. This high voltage provides excellent energy density, which is 5 times higher than that in a conventional aqueous electric double-layer capacitor (EDLC), and 1.2 times higher even than that in a 2.7 V-class non-aqueous EDLC, while keeping high charge-discharge rate capability.

Optimizing the surfactant for the aqueous processing of LiFePO{sub 4} composite electrodes

Energy Technology Data Exchange (ETDEWEB)

Porcher, W.; Jouanneau, S. [Commissariat a l' Energie Atomique, 38054 Grenoble Cedex 9 (France); Lestriez, B.; Guyomard, D. [Institut des Materiaux Jean Rouxel (IMN), Universite de Nantes, CNRS, 44322 Nantes Cedex 3 (France)

2010-05-01

Aqueous processing would reduce the costs associated with the making of the composite electrode. To achieve the incorporation and the dispersion of the carbon black (CB) conductive agent in aqueous slurries, a surfactant is needed. In this paper, three surfactants are compared, an anionic one, the sodium dodecyle sulphate (SDS), a non-ionic one, the isooctylphenylether of polyoxyethylene called commercially Triton X-100 and a cationic one, the hexadecyltrimethylammonium bromide (CTAB), by using rheology and laser granulometry measurements on electrode slurries on one hand, and SEM observations, porosity and adhesion measurements and electrochemical testing on composite electrodes on the other hand. Ionic surfactants were found to be not suitable because a corrosion of the aluminium current collector occurred. The utilization of Triton X-100 favoured a more homogeneous CB distribution, resulted in a better electronic wiring of the active material particles and higher rate behavior of the electrode. Optimal electrochemical performances are obtained for an optimal surfactant concentration which depends on the BET surface area of the CB powder. (author)

Carbon-coated ceramic membrane reactor for production of hydrogen via aqueous phase reforming of sorbitol

NARCIS (Netherlands)

Neira d'Angelo, M.F.; Ordomskiy, V.; Schouten, J.C.; Schaaf, van der J.; Nijhuis, T.A.

2014-01-01

Hydrogen was produced by aqueous-phase reforming (APR) of sorbitol in a carbon-on-alumina tubular membrane reactor (4 nm pore size, 7 cm long, 3 mm internal diameter) that allows the hydrogen gas to permeate to the shell side, whereas the liquid remains in the tube side. The hydrophobic nature of

Aqueous organic chemistry in the atmosphere: sources and chemical processing of organic aerosols.

Science.gov (United States)

McNeill, V Faye

2015-02-03

Over the past decade, it has become clear that aqueous chemical processes occurring in cloud droplets and wet atmospheric particles are an important source of organic atmospheric particulate matter. Reactions of water-soluble volatile (or semivolatile) organic gases (VOCs or SVOCs) in these aqueous media lead to the formation of highly oxidized organic particulate matter (secondary organic aerosol; SOA) and key tracer species, such as organosulfates. These processes are often driven by a combination of anthropogenic and biogenic emissions, and therefore their accurate representation in models is important for effective air quality management. Despite considerable progress, mechanistic understanding of some key aqueous processes is still lacking, and these pathways are incompletely represented in 3D atmospheric chemistry and air quality models. In this article, the concepts, historical context, and current state of the science of aqueous pathways of SOA formation are discussed.

Dicty_cDB: FC-AI17 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available FC (Link to library) FC-AI17 (Link to dictyBase) - - - Contig-U15690-1 FC-AI17P (Li...nk to Original site) FC-AI17F 587 FC-AI17Z 626 FC-AI17P 1212 - - Show FC-AI17 Library FC (Link to library) Clone ID FC-AI...nal site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AI/FC-AI17Q.Seq.d/ Representative seq. ID FC-AI...17P (Link to Original site) Representative DNA sequence >FC-AI17 (FC-AI17Q) /CSM/FC/FC-AI/FC-AI...slated Amino Acid sequence ANIATVGDFLKADTVVPKMIITYNKRKQGTDYLKAVIGPILSNVIKQELNLELKPNLVYA AIISEQEIRTGEKSTLDRNV

Dicty_cDB: FC-AI18 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available FC (Link to library) FC-AI18 (Link to dictyBase) - - - Contig-U15590-1 FC-AI18P (Li...nk to Original site) FC-AI18F 621 FC-AI18Z 703 FC-AI18P 1324 - - Show FC-AI18 Library FC (Link to library) Clone ID FC-AI...nal site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AI/FC-AI18Q.Seq.d/ Representative seq. ID FC-AI...18P (Link to Original site) Representative DNA sequence >FC-AI18 (FC-AI18Q) /CSM/FC/FC-AI/FC-AI...AVWPLIPGYERA DGEKQYPVAAMLCNFTKPTPTTPSLLTHDEVVTFFHEFGHVMHNMSTKVHYSMFSGTSVE RDFVECPSQLFEFWCWNKDVLVNKLSGHXKDHSKKLPTDLVERMIAAKNLNVAI

The removal of uranium (VI) from aqueous solutions onto activated carbon developed from grinded used tire.

Science.gov (United States)

Belgacem, Ahmed; Rebiai, Rachid; Hadoun, Hocine; Khemaissia, Sihem; Belmedani, Mohamed

2014-01-01

In this study, activated carbon was prepared from waste tire by KOH chemical activation. The pore properties including the BET surface area, pore volume, pore size distribution, and average pore diameter were characterized. BET surface area of the activated carbon was determined as 558 m(2)/g. The adsorption of uranium ions from the aqueous solution using this activated carbon has been investigated. Various physico-chemical parameters such as pH, initial metal ion concentration, and adsorbent dosage level and equilibrium contact time were studied by a batch method. The optimum pH for adsorption was found to be 3. The removal efficiency has also been determined for the adsorption system as a function of initial concentration. The experimental results were fitted to Langmuir, Freundlich, and Dubinin-Radushkevich (D-R) isotherm models. A comparison of best-fitting was performed using the coefficient of correlation and the Langmuir isotherm was found to well represent the measured sorption data. According to the evaluation using the Langmuir equation, the saturated monolayer sorption capacity of uranium ions onto waste tire activated carbon was 158.73 mg/g. The thermodynamic equilibrium constant and the Gibbs free energy were determined and results indicated the spontaneous nature of the adsorption process. Kinetics data were best described by pseudo-second-order model.

Solubility and viscosity for CO_2 capture process using MEA promoted DEAE aqueous solution

International Nuclear Information System (INIS)

Fu, Dong; Wang, LeMeng; Zhang, Pan; Mi, ChenLu

2016-01-01

Highlights: • Solubility of CO_2 in MEA promoted DEAE aqueous solution was measured. • Mass fraction and temperature dependences of solubility were illustrated. • Viscosities of carbonated MEA–DEAE solutions were measured and calculated. • Temperature, mass fraction and CO_2 loading dependences of viscosity were illustrated. - Abstract: The saturated solubility of CO_2 in monoethanolamine (MEA) promoted 2-diethylaminoethanol (DEAE) aqueous solution was investigated at temperatures ranging from (303.2 to 323.2) K. The mass fraction and temperature dependences of the saturated solubility and CO_2 loading are illustrated. The viscosities of both CO_2-unloaded and CO_2-loaded DEAE–MEA aqueous solutions were measured and then calculated by using the Weiland equation. The effects of temperature, mass fraction and CO_2 loading on viscosities are demonstrated.

Mars Aqueous Processing System

Science.gov (United States)

Berggren, Mark; Wilson, Cherie; Carrera, Stacy; Rose, Heather; Muscatello, Anthony; Kilgore, James; Zubrin, Robert

2012-01-01

The goal of the Mars Aqueous Processing System (MAPS) is to establish a flexible process that generates multiple products that are useful for human habitation. Selectively extracting useful components into an aqueous solution, and then sequentially recovering individual constituents, can obtain a suite of refined or semi-refined products. Similarities in the bulk composition (although not necessarily of the mineralogy) of Martian and Lunar soils potentially make MAPS widely applicable. Similar process steps can be conducted on both Mars and Lunar soils while tailoring the reaction extents and recoveries to the specifics of each location. The MAPS closed-loop process selectively extracts, and then recovers, constituents from soils using acids and bases. The emphasis on Mars involves the production of useful materials such as iron, silica, alumina, magnesia, and concrete with recovery of oxygen as a byproduct. On the Moon, similar chemistry is applied with emphasis on oxygen production. This innovation has been demonstrated to produce high-grade materials, such as metallic iron, aluminum oxide, magnesium oxide, and calcium oxide, from lunar and Martian soil simulants. Most of the target products exhibited purities of 80 to 90 percent or more, allowing direct use for many potential applications. Up to one-fourth of the feed soil mass was converted to metal, metal oxide, and oxygen products. The soil residue contained elevated silica content, allowing for potential additional refining and extraction for recovery of materials needed for photovoltaic, semiconductor, and glass applications. A high-grade iron oxide concentrate derived from lunar soil simulant was used to produce a metallic iron component using a novel, combined hydrogen reduction/metal sintering technique. The part was subsequently machined and found to be structurally sound. The behavior of the lunar-simulant-derived iron product was very similar to that produced using the same methods on a Michigan iron

Dicty_cDB: FC-AI03 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available FC (Link to library) FC-AI03 (Link to dictyBase) - - - Contig-U15833-1 FC-AI03P (Li...nk to Original site) FC-AI03F 690 FC-AI03Z 651 FC-AI03P 1341 - - Show FC-AI03 Library FC (Link to library) Clone ID FC-AI...nal site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AI/FC-AI03Q.Seq.d/ Representative seq. ID FC-AI...03P (Link to Original site) Representative DNA sequence >FC-AI03 (FC-AI03Q) /CSM/FC/FC-AI/FC-AI...li*l*ivtlskv*qswyqvfcslmrftcwi*nv fht*ivhwsqhwhql*flqpivaiv*skapitifnlhmaslwif*ivl*sfvpfhiitmk sfkfspfvpqlki

Dicty_cDB: FC-AI04 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available FC (Link to library) FC-AI04 (Link to dictyBase) - - - Contig-U15121-1 FC-AI04E (Li...nk to Original site) - - - - - - FC-AI04E 772 Show FC-AI04 Library FC (Link to library) Clone ID FC-AI04 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AI/FC-AI04Q.Seq.d/ Representative seq. ID FC-AI...04E (Link to Original site) Representative DNA sequence >FC-AI04 (FC-AI04Q) /CSM/FC/FC-AI/FC-AI04Q.Seq....qvnkhqqvvtktvsd vlvphqvhnqvfphipqqmtlvnkhqpvvtktvsdvlvphqvhnqvfphtpqlkiqvylq vfqvvvvtiisai

Dicty_cDB: FC-AI10 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available FC (Link to library) FC-AI10 (Link to dictyBase) - - - Contig-U16270-1 FC-AI10F (Li...nk to Original site) FC-AI10F 405 - - - - - - Show FC-AI10 Library FC (Link to library) Clone ID FC-AI10 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AI/FC-AI10Q.Seq.d/ Representative seq. ID FC-AI...10F (Link to Original site) Representative DNA sequence >FC-AI10 (FC-AI10Q) /CSM/FC/FC-AI/FC-AI10Q.Seq.... sequence RKKRKSDYTSFSTYIHKLLKQITPPTNAKSNEKGDRKFTISSKAMSVMNSFVHDIFDRIA TEASGLAKKKKRQTLHSRDIQVAVRIILTGELAXHAI

Dicty_cDB: FC-AI23 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available FC (Link to library) FC-AI23 (Link to dictyBase) - - - Contig-U15308-1 FC-AI23Z (Li...nk to Original site) - - FC-AI23Z 603 - - - - Show FC-AI23 Library FC (Link to library) Clone ID FC-AI23 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AI/FC-AI23Q.Seq.d/ Representative seq. ID FC-AI...23Z (Link to Original site) Representative DNA sequence >FC-AI23 (FC-AI23Q) /CSM/FC/FC-AI/FC-AI23Q.Seq....LNTLAKKNEQVVEGEILAKQLTGVTAEELSEFKACFSHFDKDN DNKLNRLEFSSCLKSIGDELTEEQLNQVISKIDTDGNGTISFEEFIDYMVSSRKGTDSVE STKAAFKVMAEDKDFITEAQIRAAI

Dicty_cDB: FC-AI05 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available FC (Link to library) FC-AI05 (Link to dictyBase) - - - Contig-U15516-1 FC-AI05E (Li...nk to Original site) - - - - - - FC-AI05E 1189 Show FC-AI05 Library FC (Link to library) Clone ID FC-AI05 (L...//dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AI/FC-AI05Q.Seq.d/ Representative seq. ID FC-AI...05E (Link to Original site) Representative DNA sequence >FC-AI05 (FC-AI05Q) /CSM/FC/FC-AI/FC-AI05Q.Seq...KIVGEASLKNKGKMSRVLAAKAALSARFD ALCEVSDTSYGIAYKGAVDRRAAAIEGREVRKSLNAVKPEKSGNVAKYDHTKSATTNTTR DVATKSSKESSIKQEKQ

Dicty_cDB: FC-AI21 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available FC (Link to library) FC-AI21 (Link to dictyBase) - - - Contig-U16254-1 FC-AI21Z (Li...nk to Original site) - - FC-AI21Z 696 - - - - Show FC-AI21 Library FC (Link to library) Clone ID FC-AI21 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AI/FC-AI21Q.Seq.d/ Representative seq. ID FC-AI...21Z (Link to Original site) Representative DNA sequence >FC-AI21 (FC-AI21Q) /CSM/FC/FC-AI/FC-AI21Q.Seq....YPGYMYTDLSTIYERAGRIQGRNGSITQI PILTMPNDDITHPIPDLTGYITEGQIFIDRQINNRQIYPPINVLPSLSRLMKSAI

The leachability of carbon-14-labelled 3,4-benzopyrene from coal ash into aqueous systems

NARCIS (Netherlands)

Besemer, A.C.; Kanij, J.

1984-01-01

The leachability of polycyclic aromatic hydrocarbons from coal ash into aqueous systems was studied. Carbon-14-labeled 3,4-Benzopyrene (BaP) was deposited on coal fly ash by adsorption from the liquid phase in quantities of about 10 ??g/g ash. After a thermal treatment in air at 120??C for 2 hours

Process for the recovery of alkali metal salts from aqueous solutions thereof

International Nuclear Information System (INIS)

Vitner, J.

1984-01-01

In an integrated process for the recovery of alkakli metal phenates and carboxylates from aqueous solutions thereof, the aqueous solution is spray dried and the drying gas stream is contacted with an aqueous alkali metal salt solution which dissolves the particles of the alkali metal salt that were entrained in the drying gas stream. The salt-free inert gas stream is then dried, heated, and returned to the spray dryer

Desalination of aqueous media using ionic liquids

NARCIS (Netherlands)

2014-01-01

The present invention relates to a method for extracting metal and/or metalloid ions from an aqueous medium, comprising the steps of: a) mixing the aqueous medium with an ionic liquid comprising an aliphatic carboxylate anion having at least one unsaturated carbon-carbon bond, or and/or with a

Comparison of activated carbon and bottom ash removal of reactive dye from aqueous solution

Energy Technology Data Exchange (ETDEWEB)

Dincer, A.R.; Gunes, Y.; Karakaya, N.; Gunes, E. [Trakya University, Tekirdag (Turkey). Dept. of Environmental Engineering

2007-03-15

The adsorption of reactive dye from synthetic aqueous solution onto granular activated carbon (GAC) and coal-based bottom ash (CBBA) were studied under the same experimental conditions. As an alternative to GAC CBBA was used as adsorbent for dye removal from aqueous solution. The amount of Vertigo Navy Marine (VNM) adsorbed onto CBBA was lower compared with GAC at equilibrium and dye adsorption capacity increased from 0.71 to 3.82 mg g{sup -1}, and 0.73 to 6.35 mg g{sup -1} with the initial concentration of dye from 25 to 300 mg l{sup -1} respectively. The initial dye uptake of CBBA was not so rapid as in the case of GAC and the dye uptake was slow and gradually attained equilibrium.

Dicty_cDB: FC-AI12 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available FC (Link to library) FC-AI12 (Link to dictyBase) - - - Contig-U15484-1 FC-AI12Z (Li...nk to Original site) - - FC-AI12Z 614 - - - - Show FC-AI12 Library FC (Link to library) Clone ID FC-AI12 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AI/FC-AI12Q.Seq.d/ Representative seq. ID FC-AI...12Z (Link to Original site) Representative DNA sequence >FC-AI12 (FC-AI12Q) /CSM/FC/FC-AI/FC-AI12Q.Seq....EKIVRRI ELLDGITCYRNEKAKDEIVLTGNSLELLSQSCATIQLRSAIKYKDVRKFLDGIYVSERNV LESN*in*riys

Dicty_cDB: FC-AI19 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available FC (Link to library) FC-AI19 (Link to dictyBase) - - - Contig-U15115-1 FC-AI19Z (Li...nk to Original site) - - FC-AI19Z 661 - - - - Show FC-AI19 Library FC (Link to library) Clone ID FC-AI19 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AI/FC-AI19Q.Seq.d/ Representative seq. ID FC-AI...19Z (Link to Original site) Representative DNA sequence >FC-AI19 (FC-AI19Q) /CSM/FC/FC-AI/FC-AI19Q.Seq....lmrqswvkkiesi*lvl krrkkkknnkkkkkkkkkkklfn*lvnkkn*ik*kkllcnqkk Frame B: ---*ekaieilsklfsin*kfn**ysiiigkkstkyq

Dicty_cDB: FC-AI14 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available FC (Link to library) FC-AI14 (Link to dictyBase) - - - Contig-U16280-1 FC-AI14Z (Li...nk to Original site) - - FC-AI14Z 671 - - - - Show FC-AI14 Library FC (Link to library) Clone ID FC-AI14 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AI/FC-AI14Q.Seq.d/ Representative seq. ID FC-AI...14Z (Link to Original site) Representative DNA sequence >FC-AI14 (FC-AI14Q) /CSM/FC/FC-AI/FC-AI14Q.Seq....nqrllv*lvvlskklqllnsnqsfkfkkvq rmkknsvkntkn*rfvllt*nlkslkrmpksknsptkliifilkly Frame B: ---lkdl*krtphl*stcfhhptlcssrrfclwslnai

Dicty_cDB: FC-AI06 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available FC (Link to library) FC-AI06 (Link to dictyBase) - - - Contig-U16465-1 FC-AI06E (Li...nk to Original site) - - - - - - FC-AI06E 1138 Show FC-AI06 Library FC (Link to library) Clone ID FC-AI06 (L...//dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AI/FC-AI06Q.Seq.d/ Representative seq. ID FC-AI...06E (Link to Original site) Representative DNA sequence >FC-AI06 (FC-AI06Q) /CSM/FC/FC-AI/FC-AI06Q.Seq...FGRGIDIERVNVVINYDMAESADTYLHRVGRAGRFGTK GLAISFVPSKEDPVLEQVQSKFVVSIKELVATPDPSTYMSG*kkkkkkkknlfvlksikk k*kkk*in

Dicty_cDB: FC-AI09 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available FC (Link to library) FC-AI09 (Link to dictyBase) - - - Contig-U16149-1 FC-AI09Z (Li...nk to Original site) - - FC-AI09Z 591 - - - - Show FC-AI09 Library FC (Link to library) Clone ID FC-AI09 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AI/FC-AI09Q.Seq.d/ Representative seq. ID FC-AI...09Z (Link to Original site) Representative DNA sequence >FC-AI09 (FC-AI09Q) /CSM/FC/FC-AI/FC-AI09Q.Seq....*tkl ik*ilifykiknnkkkkkk Frame B: ---gt*kvpeflailfkrmasrsvlwy*rcltkakkglkapqtltik

Framework for AI-based nuclear reactor design support system

International Nuclear Information System (INIS)

Furuta, Kazuo; Kondo, Shunsuke

1992-01-01

Nowadays many computer programs are being developed and used for the analytic tasks in nuclear reactor design, but experienced designers are still responsible for most of the synthetic tasks which are not amenable to algorithmic computer processes. Artificial intelligence (AI) is a promising technology to deal with these intractable tasks in design. In development of AI-based design support systems, it is desirable to choose a comprehensive framework based on the scientific theory of design. In this work a framework for AI-based design support systems for nuclear reactor design will be proposed based on an explorative abduction model of design. The fundamental architectures of this framework will be described especially on knowledge representation, context management and design planning. (author)

AI 3D Cybug Gaming

OpenAIRE

Ahmed, Zeeshan

2010-01-01

In this short paper I briefly discuss 3D war Game based on artificial intelligence concepts called AI WAR. Going in to the details, I present the importance of CAICL language and how this language is used in AI WAR. Moreover I also present a designed and implemented 3D War Cybug for AI WAR using CAICL and discus the implemented strategy to defeat its enemies during the game life.

First steps in translating human cognitive processes of cane pruning grapevines into AI rules for automated robotic pruning

Directory of Open Access Journals (Sweden)

Saxton Valerie

2014-01-01

Full Text Available Cane pruning of grapevines is a skilled task for which, internationally, there is a dire shortage of human pruners. As part of a larger project developing an automated robotic pruner, we have used artificial intelligence (AI algorithms to create an expert system for selecting new canes and cutting off unwanted canes. A domain and ontology has been created for AI, which reflects the expertise of expert human pruners. The first step in the creation of an expert system was to generate virtual vines, which were then ‘pruned’ by human pruners and also by the expert system in its infancy. Here we examined the decisions of 12 human pruners, for consistency of decision, on 60 virtual vines. 96.7% of the 12 pruners agreed on at least one cane choice after which there was diminishing agreement on which further canes to select for laying. Our results indicate that techniques developed in computational intelligence can be used to co-ordinate and synthesise the expertise of human pruners into a best practice format. This paper describes first steps in this knowledge elicitation process, and discusses the fit between cane pruning expertise and the expertise that can be elicited using AI based expert system techniques.

Adsorption of low concentration ceftazidime from aqueous solutions using impregnated activated carbon promoted by Iron, Copper and Aluminum

Energy Technology Data Exchange (ETDEWEB)

Hu, Xiang, E-mail: huxiang@mail.buct.edu.cn [College of Chemical Engineering, Beijing University of Chemical Technology, Beijing 100029 (China); Research Centre for Environmental Pollution Control and Resource Reuse Engineering of Beijing City, Beijing 100029 (China); Zhang, Hua [College of Chemical Engineering, Beijing University of Chemical Technology, Beijing 100029 (China); Research Centre for Environmental Pollution Control and Resource Reuse Engineering of Beijing City, Beijing 100029 (China); Sun, Zhirong, E-mail: zrsun@bjut.edu.cn [College of Environmental & Energy Engineering, Beijing University of Technology, Beijing 100124 (China)

2017-01-15

Graphical abstract: The graphic abstract describes the research that we used modified activated carbons impregnated with iron nitrate, copper nitrate and aluminium nitrate to adsorb ceftazidime from aqueous solution. The surface functional groups of the modified activated carbons were different, and thus resulted in the big difference in the adsorption performance of the modified activated carbons. The theory and the experiments both showed the preferable adsorption of ceftazidime could be achieved on modified activated carbons. - Highlights: • Three modified activated carbons were prepared by impregnating metal nitrate. • Characteristics of the modified activated carbons were analyzed. • Adsorption capacity of ceftazidime on modified activated carbons was improved. • The adsorption behavior of ceftazidime on modified activated carbons were revealed. • The nature of ceftazidime adsorption on modified activated carbons was elucidated. - Abstract: In this paper, three impregnated activated carbon IAC (AC-Cu, AC-Fe, and AC-Al) promoted by Iron, Copper and Aluminum were used for adsorption of ceftazidime. Iron(III), Copper(II) and Aluminum(III) nitrate were used as an impregnant. The IACs were characterized by scanning electron microscope (SEM), Brunauer-Emmett-Teller (BET) surface area analyzer, Fourier transform infrared spectroscopy (FTIR) and X-ray Photoelectron Spectroscopy (XPS).The influence of factors, such as ion strength, pH, temperature, initial concentration, and concentration of natural organic matter organic matter on the adsorption process were studied. The adsorption kinetics and isotherms of ceftazidime were studied for the three IACs. The results showed that the adsorption was accurately represented by pseudo-second order model. Under different temperature, the maximum adsorption quantity of ceftazidime on AC-Cu calculated by pseudo-second order kinetic model were 200.0 mg g{sup −1} (298 K), 196.1 mg g{sup −1} (303 K) and 185.2 mg g

Adsorption of low concentration ceftazidime from aqueous solutions using impregnated activated carbon promoted by Iron, Copper and Aluminum

International Nuclear Information System (INIS)

Hu, Xiang; Zhang, Hua; Sun, Zhirong

2017-01-01

Graphical abstract: The graphic abstract describes the research that we used modified activated carbons impregnated with iron nitrate, copper nitrate and aluminium nitrate to adsorb ceftazidime from aqueous solution. The surface functional groups of the modified activated carbons were different, and thus resulted in the big difference in the adsorption performance of the modified activated carbons. The theory and the experiments both showed the preferable adsorption of ceftazidime could be achieved on modified activated carbons. - Highlights: • Three modified activated carbons were prepared by impregnating metal nitrate. • Characteristics of the modified activated carbons were analyzed. • Adsorption capacity of ceftazidime on modified activated carbons was improved. • The adsorption behavior of ceftazidime on modified activated carbons were revealed. • The nature of ceftazidime adsorption on modified activated carbons was elucidated. - Abstract: In this paper, three impregnated activated carbon IAC (AC-Cu, AC-Fe, and AC-Al) promoted by Iron, Copper and Aluminum were used for adsorption of ceftazidime. Iron(III), Copper(II) and Aluminum(III) nitrate were used as an impregnant. The IACs were characterized by scanning electron microscope (SEM), Brunauer-Emmett-Teller (BET) surface area analyzer, Fourier transform infrared spectroscopy (FTIR) and X-ray Photoelectron Spectroscopy (XPS).The influence of factors, such as ion strength, pH, temperature, initial concentration, and concentration of natural organic matter organic matter on the adsorption process were studied. The adsorption kinetics and isotherms of ceftazidime were studied for the three IACs. The results showed that the adsorption was accurately represented by pseudo-second order model. Under different temperature, the maximum adsorption quantity of ceftazidime on AC-Cu calculated by pseudo-second order kinetic model were 200.0 mg g"−"1 (298 K), 196.1 mg g"−"1 (303 K) and 185.2 mg g"−"1 (308 K

The reformation of liquid hydrocarbons in an aqueous discharge reactor

KAUST Repository

Zhang, Xuming

2015-04-21

We present an aqueous discharge reactor for the reformation of liquid hydrocarbons. To increase a dielectric constant of a liquid medium, we added distilled water to iso-octane and n-dodecane. As expected, we found decreased discharge onset voltage and increased discharge power with increased water content. Results using optical emission spectroscopy identified OH radicals and O atoms as the predominant oxidative reactive species with the addition of water. Enriched CH radicals were also visualized, evidencing the existence of cascade carbon-carbon cleavage and dehydrogenation processes in the aqueous discharge. The gaseous product consisted primarily of hydrogen, carbon monoxide, and unsaturated hydrocarbons. The composition of the product was readily adjustable by varying the volume of water added, which demonstrated a significant difference in composition with respect to the tested liquid hydrocarbon. In this study, we found no presence of CO2 emissions or the contamination of the reactor by solid carbon deposition. These findings offer a new approach to the reforming processes of liquid hydrocarbons and provide a novel concept for the design of a practical and compact plasma reformer. © 2015 IOP Publishing Ltd.

Zero-valent iron particles embedded on the mesoporous silica–carbon for chromium (VI) removal from aqueous solution

Energy Technology Data Exchange (ETDEWEB)

Xiong, Kun, E-mail: kunxiong312@gmail.com; Gao, Yuan [Chongqing Technology and Business University, Engineering Research Center for Waste Oil Recovery Technology and Equipment of Ministry of Education, Chongqing Key Laboratory of Catalysis & Environmental New Materials (China); Zhou, Lin [Chengdu Radio and TV University (China); Zhang, Xianming [Chongqing Technology and Business University, Engineering Research Center for Waste Oil Recovery Technology and Equipment of Ministry of Education, Chongqing Key Laboratory of Catalysis & Environmental New Materials (China)

2016-09-15

Nanoscale zero-valent iron (nZVI) particles were embedded on the walls of mesoporous silica–carbon (MSC) under the conditions of high-temperature carbonization and reduction and used to remove chromium (VI) from aqueous solution. The structure and textural properties of nZVI–MSC were characterized by the powder X-ray diffraction, transmission electron microscopy and N{sub 2} adsorption and desorption. The results show that nZVI–MSC has highly ordered mesoporous structure and large surface area, indistinguishable with that of MSC. Compared with the support MSC and iron particles supported on the activated carbon (nZVI/AC), nZVI–MSC exhibited much higher Cr(VI) removal efficiency with about 98 %. The removal process obeys a pseudo first-order model. Such excellent performance of nZVI–MSC could be ascribed to the large surface and iron particles embedded on the walls of the MSC, forming an intimate contact with the MSC. It is proposed that this feature might create certain micro-electrode on the interface of iron particles and MSC, which prevented the formation of metal oxide on the surface and provided fresh Fe surface for Cr(VI) removal.

LuxS-independent formation of AI-2 from ribulose-5-phosphate

Directory of Open Access Journals (Sweden)

Hardie Kim R

2008-06-01

Full Text Available Abstract Background In many bacteria, the signal molecule AI-2 is generated from its precursor S-ribosyl-L-homocysteine in a reaction catalysed by the enzyme LuxS. However, generation of AI-2-like activity has also been reported for organisms lacking the luxS gene and the existence of alternative pathways for AI-2 formation in Escherichia coli has recently been predicted by stochastic modelling. Here, we investigate the possibility that spontaneous conversion of ribulose-5-phosphate could be responsible for AI-2 generation in the absence of luxS. Results Buffered solutions of ribulose-5-phosphate, but not ribose-5-phosphate, were found to contain high levels of AI-2 activity following incubation at concentrations similar to those reported in vivo. To test whether this process contributes to AI-2 formation by bacterial cells in vivo, an improved Vibrio harveyi bioassay was used. In agreement with previous studies, culture supernatants of E. coli and Staphylococcus aureus luxS mutants were found not to contain detectable levels of AI-2 activity. However, low activities were detected in an E. coli pgi-eda-edd-luxS mutant, a strain which degrades glucose entirely via the oxidative pentose phosphate pathway, with ribulose-5-phosphate as an obligatory intermediate. Conclusion Our results suggest that LuxS-independent formation of AI-2, via spontaneous conversion of ribulose-5-phosphate, may indeed occur in vivo. It does not contribute to AI-2 formation in wildtype E. coli and S. aureus under the conditions tested, but may be responsible for the AI-2-like activities reported for other organisms lacking the luxS gene.

Dicty_cDB: FC-AI15 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available FC (Link to library) FC-AI15 (Link to dictyBase) - G01730 DDB0214993 Contig-U15123-1 FC-AI...15E (Link to Original site) - - - - - - FC-AI15E 856 Show FC-AI15 Library FC (Link to library) Clone ID FC-AI...3-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AI/FC-AI15Q.Se...q.d/ Representative seq. ID FC-AI15E (Link to Original site) Representative DNA sequence >FC-AI15 (FC-AI15Q) /CSM/FC/FC-AI/FC-AI...AAAAAAAATA sequence update 1996.12.24 Translated Amino Acid sequence kt*riyi*KMMIKYITIAILFIASLVKADLQFSLCPTCV

Dicty_cDB: FC-AI24 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available FC (Link to library) FC-AI24 (Link to dictyBase) - - - - FC-AI24Z (Link to Original site) - - FC-AI...24Z 693 - - - - Show FC-AI24 Library FC (Link to library) Clone ID FC-AI24 (Link to dictyBas...e) Atlas ID - NBRP ID - dictyBase ID - Link to Contig - Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AI/FC-AI...24Q.Seq.d/ Representative seq. ID FC-AI24Z (Link to Original s...ite) Representative DNA sequence >FC-AI24 (FC-AI24Q) /CSM/FC/FC-AI/FC-AI24Q.Seq.d/ XXXXXXXXXXAAATTAGAAAACAAA

Highlights on artificial insemination (AI technology in the pig

Directory of Open Access Journals (Sweden)

Tarek Khalifa

2014-03-01

Full Text Available Over the past decade, there has been a tremendous increase in the development of field AI services in the majority of countries concerned with pig production. The objective of this paper is to review: (a the current status of swine AI in the world, (b significance and limitation of AI with liquid and frozen semen, (c the biological traits of porcine semen in relation to in-vitro sperm storage, (d the criteria used for selection of a boar stud as a semen supplier, (e how to process boar semen for liquid and frozen storage in the commercial settings and (f how to improve fertility and prolificacy of boar semen. More than 99% of the inseminations conducted worldwide are made with liquid-stored semen. AI with frozen semen is used only for upgrading the genetic base in a particular country or herd. Determining the initial quality of semen ejaculates along with the selection of the optimum storage extender has a profound effect on the quality and fertility of AI doses. Different procedures have been used for improving the fertility of preserved spermatozoa including colloidal centrifugation of the semen, intrauterine insemination and modulation of the uterine defense mechanism after AI. Development of an efficient protocol for synchronizing the time of ovulation in sows and gilts coupled with improving uterine horn insemination technique will make a breakthrough in the commercial use of frozen boar semen.

Processing of thermo-structural carbon-fiber reinforced carbon composites

Directory of Open Access Journals (Sweden)

Luiz Cláudio Pardini

2009-06-01

Full Text Available The present work describes the processes used to obtain thermostructural Carbon/Carbon composites. The processing of these materials begins with the definition of the architecture of the carbon fiber reinforcement, in the form of stacked plies or in the form of fabrics or multidirectional reinforcement. Incorporating fiber reinforcement into the carbon matrix, by filling the voids and interstices, leads to the densification of the material and a continuous increase in density. There are two principal processing routes for obtaining these materials: liquid phase processing and gas phase processing. In both cases, thermal processes lead to the formation of a carbon matrix with specific properties related to their precursor. These processes also differ in terms of yield. With liquid phase impregnation the yield is around 45 per cent, while gas phase processing yields around 15 per cent.

Computing Facilities for AI: A Survey of Present and Near-Future Options

OpenAIRE

Fahlman, Scott

1981-01-01

At the recent AAAI conference at Stanford, it became apparent that many new AI research centers are being established around the country in industrial and governmental settings and in universities that have not paid much attention to AI in the past. At the same time, many of the established AI centers are in the process of converting from older facilities, primarily based on Decsystem-10 and Decsystem-20 machines, to a variety of newer options. At present, unfortunately, there is no simple an...

Dicty_cDB: FC-AI08 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available FC (Link to library) FC-AI08 (Link to dictyBase) - G01729 DDB0233148 Contig-U14939-1 FC-AI...08P (Link to Original site) FC-AI08F 654 FC-AI08Z 563 FC-AI08P 1217 - - Show FC-AI08 Library FC (Link... to library) Clone ID FC-AI08 (Link to dictyBase) Atlas ID - NBRP ID G01729 dictyBase ID DDB0233148 Link to ...Contig Contig-U14939-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AI/FC-AI...08Q.Seq.d/ Representative seq. ID FC-AI08P (Link to Original site) Representative DNA sequence >FC-AI08 (FC-AI

Adsorption of U(VI) ions from aqueous solutions by activated carbon prepared from Antep pistachio (Pistacia vera L.) shells

Energy Technology Data Exchange (ETDEWEB)

Donat, Ramazan [Pamukkale Univ., Denizli (Turkey). Dept. of Chemistry; Erden, Kadriye Esen [Pamukkale Univ., Kinikli-Denizli (Turkey). Denizli Vocational School of Technical Sciences

2017-08-01

Antep pistachio (Pistacia vera L.) shells an abundant and low cost natural resource in Turkey was used to prepare activated carbon by physiochemical activation and carbon dioxide (CO{sub 2}) atmosphere as the activating agents at 700 C for 2 h. The adsorption equilibrium of U(VI) from aqueous solutions on such carbon has been studied using a batch system. The parameters that affect the U(VI) adsorption, such as particle size of adsorbent, contact time, of pH of the solution, and temperature, have been investigated and conditions have also been optimized. The equilibrium data for U(VI) ions' adsorption onto activated carbon well fitted to the Langmuir equation, with a maximum monolayer adsorption capacity of 8.68 mg/g, The Freundlich and Dubinin-Radushkevich (D-R) isotherms have been applied and the data correlated well with Freundlich model and that the adsorption is physical in nature (E{sub a}=15.46 kJ/mol). Thermodynamic parameters [ΔH{sub s}=11.33 kJ/mol, ΔS=0.084 kJ/molK, ΔG (293.15 K)=-13.29 kJ/mol] showed the endothermic heat of adsorption and the feasibility of the process.

Adsorption of U(VI) ions from aqueous solutions by activated carbon prepared from Antep pistachio (Pistacia vera L.) shells

International Nuclear Information System (INIS)

Donat, Ramazan; Erden, Kadriye Esen

2017-01-01

Antep pistachio (Pistacia vera L.) shells an abundant and low cost natural resource in Turkey was used to prepare activated carbon by physiochemical activation and carbon dioxide (CO_2) atmosphere as the activating agents at 700 C for 2 h. The adsorption equilibrium of U(VI) from aqueous solutions on such carbon has been studied using a batch system. The parameters that affect the U(VI) adsorption, such as particle size of adsorbent, contact time, of pH of the solution, and temperature, have been investigated and conditions have also been optimized. The equilibrium data for U(VI) ions' adsorption onto activated carbon well fitted to the Langmuir equation, with a maximum monolayer adsorption capacity of 8.68 mg/g, The Freundlich and Dubinin-Radushkevich (D-R) isotherms have been applied and the data correlated well with Freundlich model and that the adsorption is physical in nature (E_a=15.46 kJ/mol). Thermodynamic parameters [ΔH_s=11.33 kJ/mol, ΔS=0.084 kJ/molK, ΔG (293.15 K)=-13.29 kJ/mol] showed the endothermic heat of adsorption and the feasibility of the process.

IUPAC-NIST Solubility Data Series. 95. Alkaline Earth Carbonates in Aqueous Systems. Part 2. Ca

Science.gov (United States)

Vanderdeelen, Jan

2012-06-01

The alkaline earth carbonates are an important class of minerals. This article is part of a volume in the IUPAC-NIST Solubility Data Series that compiles and critically evaluates solubility data of the alkaline earth carbonates in water and in simple aqueous electrolyte solutions. Part 1 outlined the procedure adopted in this volume, and presented the beryllium and magnesium carbonates. Part 2, the current paper, compiles and critically evaluates the solubility data of calcium carbonate. The chemical forms included are the anhydrous CaCO3 types calcite, aragonite, and vaterite, the monohydrate monohydrocalcite (CaCO3. H2O), the hexahydrate ikaite (CaCO3.6H2O), and an amorphous form. The data were analyzed with two model variants, and thermodynamic data of each form consistent with each of the models and with the CODATA key values for thermodynamics are presented.

The reformation of liquid hydrocarbons in an aqueous discharge reactor

International Nuclear Information System (INIS)

Zhang, Xuming; Cha, Min Suk

2015-01-01

We present an aqueous discharge reactor for the reformation of liquid hydrocarbons. To increase a dielectric constant of a liquid medium, we added distilled water to iso-octane and n-dodecane. As expected, we found decreased discharge onset voltage and increased discharge power with increased water content. Results using optical emission spectroscopy identified OH radicals and O atoms as the predominant oxidative reactive species with the addition of water. Enriched CH radicals were also visualized, evidencing the existence of cascade carbon–carbon cleavage and dehydrogenation processes in the aqueous discharge. The gaseous product consisted primarily of hydrogen, carbon monoxide, and unsaturated hydrocarbons. The composition of the product was readily adjustable by varying the volume of water added, which demonstrated a significant difference in composition with respect to the tested liquid hydrocarbon. In this study, we found no presence of CO 2 emissions or the contamination of the reactor by solid carbon deposition. These findings offer a new approach to the reforming processes of liquid hydrocarbons and provide a novel concept for the design of a practical and compact plasma reformer. (paper)

Adsorption of uranium from aqueous solution using biochar produced by hydrothermal carbonization

International Nuclear Information System (INIS)

Zhi-bin Zhang; East China Institute of Technology, Fuzhou; China University of Geosciences, Wuhan; China University of Geosciences, Wuhan; Xiao-hong Cao; Yun-hai Liu; East China Institute of Technology, Fuzhou; Ping Liang; East China Institute of Technology, Fuzhou; China University of Geosciences, Wuhan

2013-01-01

The ability of biochar produced by hydrothermal carbonization (HTC) has been explored for the removal and recovery of uranium from aqueous solutions. The micro-morphology and structure of HTC were characterized by Fourier transform infrared spectroscopy and scanning electron microscopy. The influences of different experimental parameters such as solution pH, initial concentration, contact time, ionic strength and temperature on adsorption were investigated. The HTC showed the highest uranium sorption capacity at initial pH of 6.0 and contact time of 50 min. Adsorption kinetics was better described by the pseudo-second-order model and adsorption process could be well defined by the Langmuir isotherm. The thermodynamic parameters, ΔGdeg(298 K), ΔHdeg and ΔSdeg were determined to be -14.4, 36.1 kJ mol -1 and 169.7 J mol -1 K -1 , respectively, which demonstrated the sorption process of HTC towards U(VI) was feasible, spontaneous and endothermic in nature. The adsorbed HTC could be effectively regenerated by 0.05 mol/L HCl solution for the removal and recovery of U(VI). Complete removal (99.9 %) of U(VI) from 1.0 L industry wastewater containing 15.0 mg U(VI) ions was possible with 2.0 g HTC. (author)

Enhanced defluoridation capacity from aqueous media via hydroxyapatite decorated with carbon nanotube

Science.gov (United States)

Tang, Qingzi; Duan, Tongdan; Li, Peng; Zhang, Ping; Wu, Daishe

2018-04-01

In this work, the potential of a novel carbon nanotube-doped hydroxyapatite composite (CNT-HAP) for fluoride removal was investigated. The synthesized CNT-HAP composite was systematically characterized by X-ray diffraction(XRD), Fourier Transform infrared spectroscopy(FTIR), scanning electron microscope (SEM) and Brunauer–Emmett–Teller(BET). Batch adsorption experiments were conducted to investigate the defluorination capacity of CNT-HAP. The CNT-HAP composite has a maximum adsorption capacity of 11.05 mg·g-1 for fluoride, and the isothermal adsorption data were fitted by the Freundlich model to calculate the thermodynamic parameters. Thermodynamic analysis implies that the adsorption of fluoride on CNT-HAP is a spontaneous process. Furthermore, the adsorption of fluoride follows pseudo-second-order model. The effects of solution pH, co-existing anions and reaction temperature on defluorination efficiency were examined to optimize the operation conditions for fluoride adsorption. It is found that the optimized pH value for fluoride removal by CNT-HAP composite is 6. In addition, among five common anions studied in this work, the presence of HCO3- and PO43- could considerably affect the fluoride removal by CNT-HPA in aqueous media. Finally, the underlying mechanism for the fluoride removal by CNT-HAP is analysed, and an anion exchange process is proposed.

The BSM-AI project: SUSY-AI-generalizing LHC limits on supersymmetry with machine learning

Energy Technology Data Exchange (ETDEWEB)

Caron, Sascha [Radboud Universiteit, Institute for Mathematics, Astro- and Particle Physics IMAPP, Nijmegen (Netherlands); Nikhef, Amsterdam (Netherlands); Kim, Jong Soo [UAM/CSIC, Instituto de Fisica Teorica, Madrid (Spain); Rolbiecki, Krzysztof [UAM/CSIC, Instituto de Fisica Teorica, Madrid (Spain); University of Warsaw, Faculty of Physics, Warsaw (Poland); Ruiz de Austri, Roberto [IFIC-UV/CSIC, Instituto de Fisica Corpuscular, Valencia (Spain); Stienen, Bob [Radboud Universiteit, Institute for Mathematics, Astro- and Particle Physics IMAPP, Nijmegen (Netherlands)

2017-04-15

A key research question at the Large Hadron Collider is the test of models of new physics. Testing if a particular parameter set of such a model is excluded by LHC data is a challenge: it requires time consuming generation of scattering events, simulation of the detector response, event reconstruction, cross section calculations and analysis code to test against several hundred signal regions defined by the ATLAS and CMS experiments. In the BSM-AI project we approach this challenge with a new idea. A machine learning tool is devised to predict within a fraction of a millisecond if a model is excluded or not directly from the model parameters. A first example is SUSY-AI, trained on the phenomenological supersymmetric standard model (pMSSM). About 300, 000 pMSSM model sets - each tested against 200 signal regions by ATLAS - have been used to train and validate SUSY-AI. The code is currently able to reproduce the ATLAS exclusion regions in 19 dimensions with an accuracy of at least 93%. It has been validated further within the constrained MSSM and the minimal natural supersymmetric model, again showing high accuracy. SUSY-AI and its future BSM derivatives will help to solve the problem of recasting LHC results for any model of new physics. SUSY-AI can be downloaded from http://susyai.hepforge.org/. An on-line interface to the program for quick testing purposes can be found at http://www.susy-ai.org/. (orig.)

The BSM-AI project: SUSY-AI-generalizing LHC limits on supersymmetry with machine learning

International Nuclear Information System (INIS)

Caron, Sascha; Kim, Jong Soo; Rolbiecki, Krzysztof; Ruiz de Austri, Roberto; Stienen, Bob

2017-01-01

A key research question at the Large Hadron Collider is the test of models of new physics. Testing if a particular parameter set of such a model is excluded by LHC data is a challenge: it requires time consuming generation of scattering events, simulation of the detector response, event reconstruction, cross section calculations and analysis code to test against several hundred signal regions defined by the ATLAS and CMS experiments. In the BSM-AI project we approach this challenge with a new idea. A machine learning tool is devised to predict within a fraction of a millisecond if a model is excluded or not directly from the model parameters. A first example is SUSY-AI, trained on the phenomenological supersymmetric standard model (pMSSM). About 300, 000 pMSSM model sets - each tested against 200 signal regions by ATLAS - have been used to train and validate SUSY-AI. The code is currently able to reproduce the ATLAS exclusion regions in 19 dimensions with an accuracy of at least 93%. It has been validated further within the constrained MSSM and the minimal natural supersymmetric model, again showing high accuracy. SUSY-AI and its future BSM derivatives will help to solve the problem of recasting LHC results for any model of new physics. SUSY-AI can be downloaded from http://susyai.hepforge.org/. An on-line interface to the program for quick testing purposes can be found at http://www.susy-ai.org/. (orig.)

Artificial Intelligence (AI), Operations Research (OR), and Decision Support Systems (DSS): A conceptual framework

Science.gov (United States)

Parnell, Gregory S.; Rowell, William F.; Valusek, John R.

1987-01-01

In recent years there has been increasing interest in applying the computer based problem solving techniques of Artificial Intelligence (AI), Operations Research (OR), and Decision Support Systems (DSS) to analyze extremely complex problems. A conceptual framework is developed for successfully integrating these three techniques. First, the fields of AI, OR, and DSS are defined and the relationships among the three fields are explored. Next, a comprehensive adaptive design methodology for AI and OR modeling within the context of a DSS is described. These observations are made: (1) the solution of extremely complex knowledge problems with ill-defined, changing requirements can benefit greatly from the use of the adaptive design process, (2) the field of DSS provides the focus on the decision making process essential for tailoring solutions to these complex problems, (3) the characteristics of AI, OR, and DSS tools appears to be converging rapidly, and (4) there is a growing need for an interdisciplinary AI/OR/DSS education.

Dicty_cDB: FC-AI07 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available FC (Link to library) FC-AI07 (Link to dictyBase) - - - Contig-U15296-1 | Contig-U15756-1 FC-AI...07P (Link to Original site) FC-AI07F 580 FC-AI07Z 723 FC-AI07P 1303 - - Show FC-AI07 Library FC (...Link to library) Clone ID FC-AI07 (Link to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Con...tig-U15296-1 | Contig-U15756-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AI/FC-AI...07Q.Seq.d/ Representative seq. ID FC-AI07P (Link to Original site) Representative DNA sequence >FC-AI07 (FC-AI

Dicty_cDB: FC-AI22 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available FC (Link to library) FC-AI22 (Link to dictyBase) - - - Contig-U15369-1 | Contig-U15732-1 FC-AI...22P (Link to Original site) FC-AI22F 583 FC-AI22Z 683 FC-AI22P 1266 - - Show FC-AI22 Library FC (...Link to library) Clone ID FC-AI22 (Link to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Con...tig-U15369-1 | Contig-U15732-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AI/FC-AI...22Q.Seq.d/ Representative seq. ID FC-AI22P (Link to Original site) Representative DNA sequence >FC-AI22 (FC-AI

Optimization of aqueous extraction process to enhance the ...

African Journals Online (AJOL)

Kumar Sudhir

2014-02-12

Feb 12, 2014 ... Aqueous extraction process was optimized to reduce endotoxins from mixed ... management and minimizes the initial capital costs for ... of about 40%, was suggested to be an economic ... industry and as the nutraceutical food for human due to ... economical production of industrial enzymes and as feed.

Dissolution of carbon dioxide in aqueous electrolyte solutions, in the context of geological storage: A thermodynamic approach

International Nuclear Information System (INIS)

Liborio, Barbara

2017-01-01

This thesis studies the enthalpy of solution of carbon dioxide in electrolyte aqueous solutions. To develop theoretical models describing the systems (CO 2 -water-salt) under the geological storage conditions of carbon dioxide, it is necessary to have experimental data, namely solubility and enthalpy. In this study, a customized flow mixing unit was adapted to a SETARAM C-80 calorimeter to measure the enthalpy of CO 2 solution in aqueous electrolyte solutions (NaCl, CaCl 2 and Na 2 SO 4 ) at the ionic strengths between 2 and 6 and at temperatures between 323.1 K and 372.9 K and pressures ranging from 2 to 16 MPa. Data from the literature were used to adjust the thermodynamic phase equilibrium model in the Y-φ approach. The thermodynamic model reproduces the experimental enthalpies to plus or minus 10%. The calculation of the enthalpy in the rigorous model is strongly dependent on the data of the literature. An experimental device has been set up for the determination of the molar volume of CO 2 at infinite dilution, which is necessary for thermodynamic modeling. The carbon dioxide to be stored may contain impurities such as annexes (O 2 , N 2 , SO x , H 2 S, N y O x , H 2 , CO and Ar). Under the objective of studying the influence of these impurities, an experimental apparatus has been set up for the measurement of enthalpies of solution of SO 2 in water and aqueous solutions of NaCl and the first results are promising. (author)

Health Information in French (français)

Science.gov (United States)

... Biopsy - français (French) Bilingual PDF Health Information Translations Breast Biopsy - français (French) Bilingual PDF Health Information Translations Colposcopy - français (French) Bilingual PDF ...

Toward stable nickel catalysts for aqueous phase reforming of biomass-derived feedstock under reducing and alkaline conditions

NARCIS (Netherlands)

Haasterecht, van T.; Ludding, C.C.I.; Jong, de K.P.; Bitter, J.H.

2014-01-01

Nickel nanoparticles supported on carbon nanofibers (CNF) can be stabilized in aqueous phase processes at elevated temperatures and pressures by tuning the reaction conditions to control Ni oxidation and leaching. As a showcase, Ni/CNF was used for the production of hydrogen via aqueous phase

Two new Oxalis species (Oxalidaceae) from the Ai-Ais / Richtersveld Transfrontier Park, South Africa

NARCIS (Netherlands)

Roets, F.; Oberlander, K.C.; Dreyer, L.L.

2012-01-01

South Africa has a rich, but scantily surveyed, desert flora. Documenting annual and geophytic species in this biome is challenging, as they usually only flower after adequate precipitation, which is characteristically erratic and infrequent. Recent floristic surveys in the Ai-Ais / Richtersveld

Phase equilibria of hydrogen sulfide and carbon dioxide simple hydrates in the presence of methanol, (methanol + NaCl) and (ethylene glycol + NaCl) aqueous solutions

International Nuclear Information System (INIS)

Mohammadi, Amir H.; Richon, Dominique

2012-01-01

Highlights: → Dissociation conditions of H 2 S or CO 2 hydrate + inhibitor aqueous solution are reported. → Methanol, methanol + NaCl and EG + NaCl aqueous solutions are considered as inhibitors. → Comparisons are made between our experimental data and the corresponding literature data. - Abstract: This work aims at reporting the dissociation pressures of hydrogen sulfide and carbon dioxide simple hydrates in the presence of methanol, (methanol + NaCl) and (ethylene glycol + NaCl) aqueous solutions at different temperatures and various concentrations of inhibitor in aqueous solution. The equilibrium results were generated using an isochoric pressure-search method. These values are compared with some selected experimental data from the literature on the dissociation conditions of hydrogen sulfide and carbon dioxide simple hydrates in the presence of pure water to show the inhibition effects of the above mentioned aqueous solutions. Comparisons are finally made between our experimental values and the corresponding literature data. Some disagreements among the literature data and our data are found.

An SDR based AIS receiver for satellites

DEFF Research Database (Denmark)

Larsen, Jesper Abildgaard; Mortensen, Hans Peter; Nielsen, Jens Frederik Dalsgaard

2011-01-01

For a few years now, there has been a high interest in monitoring the global ship traffic from space. A few satellite, capable of listening for ship borne AIS transponders have already been launched, and soon the AAUSAT3, carrying two different types of AIS receivers will also be launched. One...... of the AIS receivers onboard AAUSAT3 is an SDR based AIS receiver. This paper serves to describe the background of the AIS system, and how the SDR based receiver has been integrated into the AAUSAT3 satellite. Amongst some of the benefits of using an SDR based receiver is, that due to its versatility, new...... detection algorithms are easily deployed, and it is easily adapted the new proposed AIS transmission channels....

DEVELOPMENT OF A CO2 SEQUESTRATION MODULE BY INTEGRATING MINERAL ACTIVATION AND AQUEOUS CARBONATION. ANNUAL TECHNICAL PROGRESS REPORT

International Nuclear Information System (INIS)

George Alexander; M. Mercedes Maroto-Valer; Parvana Aksoy; Harold Schobert

2006-01-01

Mineral carbonation provides a potential option for the long-term storage of carbon dioxide. Serpentine has been chosen as the feedstock mineral, due to its abundance and availability. However, the relatively low reactivity of serpentine has warranted research into physical and chemical treatments that have been shown to greatly increase its reactivity. The use of sulfuric acid as an accelerating medium for the removal of magnesium from serpentine has recently been investigated. In addition to the challenges presented by the dissolution of serpentine, another challenge is the subsequent carbonation of the magnesium ions. A stable hydration sphere for the magnesium ion reduces the carbonation kinetics by obstructing the formation of the carbonation products. Accordingly, this research has evaluated the solubility of carbon dioxide in aqueous solution, the interaction between the dissociation products of carbon dioxide, and the carbonation potential of the magnesium ion

IUPAC-NIST Solubility Data Series. 95. Alkaline Earth Carbonates in Aqueous Systems. Part 2. Ca

International Nuclear Information System (INIS)

De Visscher, Alex; Vanderdeelen, Jan

2012-01-01

The alkaline earth carbonates are an important class of minerals. This article is part of a volume in the IUPAC-NIST Solubility Data Series that compiles and critically evaluates solubility data of the alkaline earth carbonates in water and in simple aqueous electrolyte solutions. Part 1 outlined the procedure adopted in this volume, and presented the beryllium and magnesium carbonates. Part 2, the current paper, compiles and critically evaluates the solubility data of calcium carbonate. The chemical forms included are the anhydrous CaCO 3 types calcite, aragonite, and vaterite, the monohydrate monohydrocalcite (CaCO 3 · H 2 O), the hexahydrate ikaite (CaCO 3 ·6H 2 O), and an amorphous form. The data were analyzed with two model variants, and thermodynamic data of each form consistent with each of the models and with the CODATA key values for thermodynamics are presented.

Up-scaling mineral-aqueous interfacial processes that govern isotope and trace element partitioning during calcite growth

Science.gov (United States)

Lammers, L. N.

2014-12-01

The dependence of the isotopic and trace element composition of calcium carbonate minerals on growth conditions including temperature, pH, and salinity is widely used to infer paleoclimate conditions. These inferences rely heavily on phenomenological observations of biogenic and inorganic precipitation both in and ex situ, where only limited variability in solution conditions can be explored. Ionic fluxes between the mineral surface and aqueous growth solution govern the net uptake of both stoichiometric and trace species during calcification, so developing a mechanistic understanding of the reactions governing these fluxes is critical to refine existing proxies and to develop new ones. The micro-scale mechanisms of calcite precipitation from aqueous solution have been extensively studied, and net ionic uptake post-nucleation is known to occur primarily at monomolecular kink sites along step edges at the mineral surface. In this talk, I will present a theoretical framework that uses the quasi-elementary ion attachment and detachment reactions governing ion uptake at kink sites to simultaneously model bulk mineral growth kinetics and tracer partitioning during calcite precipitation. Several distinct processes occur during ion uptake at kink sites that can influence the distribution of trace species, directly impacting the composition of various carbonate paleoproxies including δ44Ca, δ18O, Sr/Ca and Mg/Ca. The distribution of these trace species will be shown to depend on (1) the relative rates of ion desolvation during attachment to kink sites, (2) the relative rates of bond breaking during detachment from kink sites, and (3) the equilibrium partitioning of trace aqueous species. This model accounts for the impact of solution conditions on net ion fluxes and surface speciation, which in turn controls the population of kink sites available for direct ion exchange with the aqueous phase. The impacts of solution variables including pH, temperature and salinity can

Nanocomposites of manganese oxides and carbon nanotubes for aqueous supercapacitor stacks

Energy Technology Data Exchange (ETDEWEB)

Zhang Shengwen; Peng Chuang; Ng, Kok C. [Department of Chemical and Environmental Engineering, Faculty of Engineering, University of Nottingham, University Park, Nottingham NG7 2RD (United Kingdom); Chen, George Z., E-mail: george.chen@nottingham.ac.u [Department of Chemical and Environmental Engineering, Faculty of Engineering, University of Nottingham, University Park, Nottingham NG7 2RD (United Kingdom)

2010-10-30

Symmetrical supercapacitors and their serially connected two-cell stacks via a bipolar electrode were constructed with nanocomposites of manganese oxides and carbon nanotubes (MnO{sub x}/CNTs) as the electrode materials. Nanocomposites with different contents of MnO{sub x} were synthesised through the redox reaction between KMnO{sub 4} and CNTs in aqueous solutions. The nanocomposites were characterised by scanning and transmission electron microscopy, BET nitrogen adsorption and X-ray diffraction before being examined in a three-electrode cell with a novel trenched graphite disc electrode by electrochemical means, including cyclic voltammetry, galvanostatic charging-discharging, and electrochemical impedance spectroscopy. The nanocomposites demonstrated capacitive behaviour in the potential range of 0-0.85 V (vs Ag/AgCl) in aqueous KCl electrolytes with less than 9% capacitance decrease after 9000 charging-discharging cycles. Symmetrical supercapacitors of identical positive and negative MnO{sub x}/CNTs electrodes showed capacitive performance in good agreement with the individual electrodes (e.g. 0.90 V, 0.53 F, 1.3 cm{sup 2}). The bipolarly connected two-cell stacks of the symmetrical cells exhibited characteristics in accordance with expectation, including a doubled stack voltage and reduced internal resistance per cell.

COMPARATIVE EVALUATION OF COMMERCIAL AND SEWAGE SLUDGE BASED ACTIVATED CARBONS FOR THE REMOVAL OF TEXTILE DYES FROM AQUEOUS SOLUTIONS

Directory of Open Access Journals (Sweden)

S. Sreedhar Reddy, B. Kotaiah

2006-10-01

Full Text Available The sorption of dyes from aqueous solutions on to sludge-based activated carbon have been studied and compared with commercial activated carbon. Adsorption parameters for the Langmuir and Freundlich isotherms were determined and the effects of effluent pH, adsorbent dosage, contact time and initial dye concentration were studied. A pseudo-second order kinetic model has been proposed to correlate the experimental data.

Resorcinol adsorption from aqueous solution over activated carbon

International Nuclear Information System (INIS)

Blanco, Diego A; Giraldo, Liliana; Moreno, Juan C

2007-01-01

In this paper, the adsorption behavior of Resorcinol a monohydroxylated phenol, poorly acid to 298 K, over activated carbon is analyzed by studying the solution's pH influence and the surface reduction in the adsorption process. To do this, an activated carbon of lignocellulose origin and a reduced activated carbon was used. The interaction solid solution is characterized by the analyses of adsorption in the isotherms to 298 K and pH values of 7. 00, 9.00 and 11.00 for a period of 48 hours. The capacity adsorption of activated carbons increases when the solution's pH decreases and the retained amount increases in the reduced coal to the pH of maximum adsorption.

Continuous Fixed-Bed Column Study and Adsorption Modeling: Removal of Lead Ion from Aqueous Solution by Charcoal Originated from Chemical Carbonization of Rubber Wood Sawdust

Directory of Open Access Journals (Sweden)

Swarup Biswas

2015-01-01

Full Text Available The efficiency of chemically carbonized rubber wood sawdust for the removal of lead ion from the aqueous stream was investigated by column process. Chemically carbonized rubber wood sawdust was prepared by treating the sawdust with H2SO4 and HNO3. Maximum removal of lead ion in column process was found as 38.56 mg/g. The effects of operating parameters such as flow rate, bed depth, concentration, and pH were studied in column mode. Experimental data confirmed that the adsorption capacity increased with the increasing inlet concentration and bed depth and decreased with increasing flow rate. Thomas, Yoon-Nelson, and Adams-Bohart models were used to analyze the column experimental data and the relationship between operating parameters. Chemically carbonized rubber wood sawdust was characterized by using Fourier transform infrared spectroscopy. Scanning electron microscope was also utilized for morphological analysis of the adsorbent. Furthermore X-ray fluorescence spectrum analysis and energy dispersive X-ray spectroscopy were also used for the confirmation of lead adsorption process.

Removal of insecticide carbofuran from aqueous solutions by banana stalks activated carbon

International Nuclear Information System (INIS)

Salman, J.M.; Hameed, B.H.

2010-01-01

In this work, activated carbon was prepared from banana stalks (BSAC) waste to remove the insecticide carbofuran from aqueous solutions. The effects of contact time, initial carbofuran concentration, solution pH and temperature (30, 40 and 50 deg. C) were investigated. Adsorption isotherm, kinetics and thermodynamics of carbofuran on BSAC were studied. Equilibrium data were fitted to the Langmuir, Freundlich and Temkin isotherm models and the data best represented by the Langmuir isotherm. Thermodynamic parameters such as standard enthalpy (ΔH o ), standard entropy (ΔS o ) and standard free energy (ΔG o ) were evaluated. Regeneration efficiency of spent BSAC was studied using ethanol as a solvent. The efficiency was found to be in the range of 96.97-97.35%. The results indicated that the BSAC has good regeneration and reusability characteristics and can be used as alternative to present commercial activated carbon.

Adsorption of Zn(II) in aqueous solution by activated carbons prepared from evergreen oak (Quercus rotundifolia L.).

Science.gov (United States)

Gómez-Tamayo, M del Mar; Macías-García, Antonio; Díaz Díez, M Angeles; Cuerda-Correa, Eduardo M

2008-05-01

In the present work activated carbons have been prepared from evergreen oak wood. Different samples have been prepared varying the concentration of the activating agent (H(3)PO(4)) and the treatment temperature. The yield of the process decreases with increasing phosphoric acid concentrations. Furthermore, high concentrations of activating agent lead to mainly mesoporous activated carbons to the detriment of the microporous texture. Treatment temperatures up to 450 degrees C lead to a progressive increase of the micro- and mesopore volumes. Values of specific surface area (S(BET)) as high as 1723 m(2) g(-1)have been obtained using appropriate phosphoric acid concentrations and treatment temperatures. The samples prepared have been successfully used in the removal of Zn(II) from aqueous solutions. From the adsorption kinetic data it may be stated that the equilibrium time is, in all cases, below 170 h. The adsorption process as a rule becomes faster as the mesopore volume and specific surface area of the samples increase. The adsorption isotherms in liquid phase point out that the adsorption capacity (n(0)(s)) and the affinity towards the solute (K(ci)) are higher for the sample showing the most developed mesoporous texture and surface area as well.

Functionalized hydrothermal carbon derived from waste pomelo peel as solid-phase extractant for the removal of uranyl from aqueous solution.

Science.gov (United States)

Li, Feize; Tang, Yu; Wang, Huilin; Yang, Jijun; Li, Shoujian; Liu, Jun; Tu, Hong; Liao, Jiali; Yang, Yuanyou; Liu, Ning

2017-10-01

To develop a high-performance solid-phase extractant for the separation of uranyl f, pomelo peel, a kind of waste biomass, has been employed as carbon source to prepare carbonaceous matrix through low-temperature hydrothermal carbonization (200 °C, 24 h). After being oxidized by Hummers method, the prepared hydrothermal carbon matrix was functionalized with carboxyl and phenolic hydroxyl groups (1.75 mmol g -1 ). The relevant characterizations and batch studies had demonstrated that the obtained carbon material possessed excellent affinity toward uranyl (436.4 mg g -1 ) and the sorption process was a spontaneous, endothermic and rapid chemisorption. The selective sorption of U(VI) from the simulated nuclear effluent demonstrated that the sorbent displayed a desirable selectivity (56.14% at pH = 4.5) for the U(VI) ions over the other 11 competitive cations from the simulated industrial nuclear effluent. The proposed synthetic strategy in the present work had turned out to be effective and practical, which provides a novel approach to prepare functional materials for the recovery and separation of uranyl or other heavy metals from aqueous environment.

Microtribology of aqueous carbon nanotube dispersions

KAUST Repository

Kristiansen, Kai De Lange; Zeng, Hongbo; Wang, Peng; Israelachvili, Jacob N.

2011-01-01

The tribological behavior of carbon nanotubes (CNTs) in aqueous humic acid (HA) solutions was studied using a surface forces apparatus (SFA) and shows promising lubricant additive properties. Adding CNTs to the solution changes the friction forces between two mica surfaces from "adhesion controlled" to "load controlled" friction. The coefficient of friction with either single-walled (SW) or multi-walled (MW) CNT dispersions is in the range 0.30-0.55 and is independent of the load and sliding velocity. More importantly, lateral sliding promotes a redistribution or accumulation, rather than squeezing out, of nanotubes between the surfaces. This accumulation reduced the adhesion between the surfaces (which generally causes wear/damage of the surfaces), and no wear or damage was observed during continuous shearing experiments that lasted several hours even under high loads (pressures â∼10 MPa). The frictional properties can be understood in terms of the Cobblestone Model where the friction force is related to the fraction of the adhesion energy dissipated during impacts of the nanoparticles. We also develop a simple generic model based on the van der Waals interactions between particles and surfaces to determine the relation between the dimensions of nanoparticles and their tribological properties when used as additives in oil- or water-based lubricants. © 2011 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

Microtribology of aqueous carbon nanotube dispersions

KAUST Repository

Kristiansen, Kai De Lange

2011-09-23

The tribological behavior of carbon nanotubes (CNTs) in aqueous humic acid (HA) solutions was studied using a surface forces apparatus (SFA) and shows promising lubricant additive properties. Adding CNTs to the solution changes the friction forces between two mica surfaces from "adhesion controlled" to "load controlled" friction. The coefficient of friction with either single-walled (SW) or multi-walled (MW) CNT dispersions is in the range 0.30-0.55 and is independent of the load and sliding velocity. More importantly, lateral sliding promotes a redistribution or accumulation, rather than squeezing out, of nanotubes between the surfaces. This accumulation reduced the adhesion between the surfaces (which generally causes wear/damage of the surfaces), and no wear or damage was observed during continuous shearing experiments that lasted several hours even under high loads (pressures â∼10 MPa). The frictional properties can be understood in terms of the Cobblestone Model where the friction force is related to the fraction of the adhesion energy dissipated during impacts of the nanoparticles. We also develop a simple generic model based on the van der Waals interactions between particles and surfaces to determine the relation between the dimensions of nanoparticles and their tribological properties when used as additives in oil- or water-based lubricants. © 2011 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

Basic design of alpha aqueous waste treatment process in NUCEF

Energy Technology Data Exchange (ETDEWEB)

Mineo, Hideaki; Matsumura, Tatsuro; Nishizawa, Ichio; Mitsui, Takeshi; Ueki, Hiroyuki; Wada, Atsushi; Sakai, Ichita; Takeshita, Isao [Japan Atomic Energy Research Inst., Tokai, Ibaraki (Japan). Tokai Research Establishment; Nishimura, Kenji

1996-11-01

This paper described the basic design of Alpha Aqueous Waste Treatment Process in NUCEF. Since various experiments using the TRU (transuranium) elements are carried out in NUCEF, wastes containing TRU elements arise. The liquid wastes in NUCEF are categorized into three types. Decontamination and volume reduction of the liquid waste mainly of recovery water from acid recovery process which has lowest radioactive concentration is the most important task, because the arising rate of the waste is large. The major function of the Alpha Aqueous Waste Treatment Process is to decontaminate the radioactive concentration below the level which is allowed to discharge into sea. Prior the process design of this facility, the followings are evaluated:property and arising rate of the liquid waste, room space to install and licensing condition. Considering varieties of liquid wastes and their large volume, the very high decontamination factor was proposed by a process of multiple evaporation supported with filtration and adsorption in the head end part and reverse osmosis in the distillate part. (author)

AI its nature and future

CERN Document Server

Boden, Margaret A

2016-01-01

least - on the Internet. Margaret Boden considers the realistic and unrealistic expectations we have placed on AI, analyses its progress, and considers the value of its byproducts. ations we have placed on AI, analyses its progress, and considers the value of its byproducts.

Adsorption of crystal violet with diatomite earth&carbon by a modification of hydrothermal carbonization process.

Science.gov (United States)

Zhang, Yanzhuo; Li, Jun; Chen, Guanghui; Bian, Wei; Lu, Yun; Li, Wenjing; Zheng, Zhaoming; Cheng, Xiaojie

2016-01-01

The high colority and difficulty of decolorization are the most important tasks on printing and dyeing wastewater. This study investigates the ability of diatomite earth&carbon (DE&C) as an adsorbent to removal crystal violet (CV) from aqueous solutions. Fourier transform infrared spectroscopy results indicate the importance of functional groups during the adsorption of CV. The obtained N2 adsorption-desorption isotherm values accord with well IUPAC type II. Our calculations determined a surface area of 73.15 m(2) g(-1) for DE&C and an average pore diameter of 10.56 nm. Equilibrium data of the adsorption process fitted very well to the Langmuir model (R(2) > 0.99). The results of kinetics study showed that the pseudo-second-order model fitted to the experimental data well. The thermodynamic parameters were also evaluated. ΔH° 0 and ΔG° < 0 demonstrated that the adsorption process was spontaneous and exothermic for dye. Furthermore the positive value of ΔS° reflected good affinity of the CV dye.

Room-temperature aqueous plasma electrolyzing Al2O3 nano-coating on carbon fiber

Science.gov (United States)

Zhang, Yuping; Meng, Yang; Shen, Yonghua; Chen, Weiwei; Cheng, Huanwu; Wang, Lu

2017-10-01

A novel room-temperature aqueous plasma electrolysis technique has been developed in order to prepared Al2O3 nano-coating on each fiber within a carbon fiber bundle. The microstructure and formation mechanism of the Al2O3 nano-coating were systematically investigated. The oxidation resistance and tensile strength of the Al2O3-coated carbon fiber was measured at elevated temperatures. It showed that the dense Al2O3 nano-coating was relatively uniformly deposited with 80-120 nm in thickness. The Al2O3 nano-coating effectively protected the carbon fiber, evidenced by the slower oxidation rate and significant increase of the burn-out temperature from 800 °C to 950 °C. Although the bare carbon fiber remained ∼25 wt.% after oxidation at 700 °C for 20 min, a full destruction was observed, evidenced by the ∼0 GPa of the tensile strength, compared to ∼1.3 GPa of the Al2O3-coated carbon fiber due to the effective protection from the Al2O3 nano-coating. The formation mechanism of the Al2O3 nano-coating on carbon fiber was schematically established mainly based on the physic-chemical effect in the cathodic plasma arc zone.

EIS study of the redox reaction of Fe(CN)63-/4- at glassy carbon electrode via diazonium reduction in aqueous and acetonitrile solutions

Energy Technology Data Exchange (ETDEWEB)

Khoshroo, M.; Rostami, A. [Mazandaran Univ., Babolsar (Iran, Islamic Republic of). Dept. of Physical Chemistry

2008-07-01

This paper reported on a study that characterized soluble electroactive species by cyclic voltammetry to investigate the presence of grafted films and their blocking properties. In particular, the authority of the glassy carbon electrode modification conditions on the cyclic voltammetric response of Fe(CN)63-/4- oxido-reduction was examined for 2 layers grafted by electrochemical reduction of diazonium salts in acetonitrile and aqueous solutions. PAA and Fast Black K modified glassy carbon electrodes exhibited a significant blocking behaviour for oxidation and reduction reactions of the Fe(CN)63-/4- redox system in aqueous and acetonitrile solutions. The study showed that the blocking effect increased which changes in time and concentration of diazonium salts in acetonitrile solution. Electrochemical impedance spectroscopy (EIS) measurements showed that the physical barrier of grafted layers prevent the access of Fe(CN)63-/4- to the underlying glassy carbon electrode. Therefore the RCT resistance increases during the modification treatment. The substituted phenyl layers are much more compact and less permeable in a nonaqueous solvent than with an aqueous solvent. Electrochemical impedance measurements indicate that the kinetics of electron transfer slow down when the time and the concentration used to modify the glassy carbon electrode increase. 4 refs., 1 fig.

IUPAC-NIST Solubility Data Series. 95. Alkaline Earth Carbonates in Aqueous Systems. Part 2. Ca

Energy Technology Data Exchange (ETDEWEB)

De Visscher, Alex; Vanderdeelen, Jan [Department of Chemical and Petroleum Engineering, and Centre for Environmental Engineering Research and Education (CEERE), Schulich School of Engineering, University of Calgary, Calgary, Alberta, T2N 1N4 (Canada); Department of Applied Analytical and Physical Chemistry, Faculty of Bioscience Engineering, Ghent University, B-9000 Ghent (Belgium)

2012-06-15

The alkaline earth carbonates are an important class of minerals. This article is part of a volume in the IUPAC-NIST Solubility Data Series that compiles and critically evaluates solubility data of the alkaline earth carbonates in water and in simple aqueous electrolyte solutions. Part 1 outlined the procedure adopted in this volume, and presented the beryllium and magnesium carbonates. Part 2, the current paper, compiles and critically evaluates the solubility data of calcium carbonate. The chemical forms included are the anhydrous CaCO{sub 3} types calcite, aragonite, and vaterite, the monohydrate monohydrocalcite (CaCO{sub 3}{center_dot} H{sub 2}O), the hexahydrate ikaite (CaCO{sub 3}{center_dot}6H{sub 2}O), and an amorphous form. The data were analyzed with two model variants, and thermodynamic data of each form consistent with each of the models and with the CODATA key values for thermodynamics are presented.

Modeling Progress in AI

OpenAIRE

Brundage, Miles

2015-01-01

Participants in recent discussions of AI-related issues ranging from intelligence explosion to technological unemployment have made diverse claims about the nature, pace, and drivers of progress in AI. However, these theories are rarely specified in enough detail to enable systematic evaluation of their assumptions or to extrapolate progress quantitatively, as is often done with some success in other technological domains. After reviewing relevant literatures and justifying the need for more ...

The implementation of AI technologies in computer wargames

Science.gov (United States)

Tiller, John A.

2004-08-01

Computer wargames involve the most in-depth analysis of general game theory. The enumerated turns of a game like chess are dwarfed by the exponentially larger possibilities of even a simple computer wargame. Implementing challenging AI is computer wargames is an important goal in both the commercial and military environments. In the commercial marketplace, customers demand a challenging AI opponent when they play a computer wargame and are frustrated by a lack of competence on the part of the AI. In the military environment, challenging AI opponents are important for several reasons. A challenging AI opponent will force the military professional to avoid routine or set-piece approaches to situations and cause them to think much deeper about military situations before taking action. A good AI opponent would also include national characteristics of the opponent being simulated, thus providing the military professional with even more of a challenge in planning and approach. Implementing current AI technologies in computer wargames is a technological challenge. The goal is to join the needs of AI in computer wargames with the solutions of current AI technologies. This talk will address several of those issues, possible solutions, and currently unsolved problems.

Tweeting AI: Perceptions of Lay vs Expert Twitterati

OpenAIRE

Manikonda, Lydia; Kambhampati, Subbarao

2017-01-01

With the recent advancements in Artificial Intelligence (AI), various organizations and individuals are debating about the progress of AI as a blessing or a curse for the future of the society. This paper conducts an investigation on how the public perceives the progress of AI by utilizing the data shared on Twitter. Specifically, this paper performs a comparative analysis on the understanding of users belonging to two categories -- general AI-Tweeters (AIT) and expert AI-Tweeters (EAIT) who ...

Effective Remediation of Lead Ions from Aqueous Solution by Chemically Carbonized Rubber Wood Sawdust: Equilibrium, Kinetics, and Thermodynamic Study

Directory of Open Access Journals (Sweden)

Swarup Biswas

2015-01-01

Full Text Available Rubber wood sawdust was carbonized into charcoal by chemical treatment which was used for removal of lead ion from aqueous solution. The work involves batch experiments to investigate the pH effect, initial concentration of adsorbate, contact time, and adsorbent dose. Experimental data confirmed that the adsorption capacities increased with increasing inlet concentration and bed height and decreased with increasing flow rate. Adsorption results showed a maximum adsorption capacity of 37 mg/g at 308 K. Langmuir, Freundlich, and Temkin model adsorption isotherm models were applied to analyze the process where Temkin was found as a best fitted model for present study. Simultaneously kinetics of adsorption like pseudo-first-order, pseudo-second-order, and intraparticle diffusion models were investigated. Thermodynamic parameters were used to analyze the adsorption experiment. Fourier transform infrared spectroscopy, scanning electron microscope, and energy dispersive X-ray spectroscopy confirmed the batch adsorption of lead ion onto chemically carbonized rubber wood sawdust.

On the vibrational behavior of single- and double-walled carbon nanotubes under the physical adsorption of biomolecules in the aqueous environment: a molecular dynamics study.

Science.gov (United States)

Ajori, S; Ansari, R; Darvizeh, M

2016-03-01

The adsorption of biomolecules on the walls of carbon nanotubes (CNTs) in an aqueous environment is of great importance in the field of nanobiotechnology. In this study, molecular dynamics (MD) simulations were performed to understand the mechanical vibrational behavior of single- and double-walled carbon nanotubes (SWCNTs and DWCNTs) under the physical adsorption of four important biomolecules (L-alanine, guanine, thymine, and uracil) in vacuum and an aqueous environment. It was observed that the natural frequencies of these CNTs in vacuum reduce under the physical adsorption of biomolecules. In the aqueous environment, the natural frequency of each pure CNT decreased as compared to its natural frequency in vacuum. It was also found that the frequency shift for functionalized CNTs as compared to pure CNTs in the aqueous environment was dependent on the radius and the number of walls of the CNT, and could be positive or negative.

Efficiency of Dry (Psidium guava) Leaves for The Removal of Cesium-137 from Aqueous Solutions

International Nuclear Information System (INIS)

Omar, H.A.; Abu-Kharda, S.A.; Abd El -Baset, L.A.; Abu-Shohba, R.M.

2012-01-01

Batch experiments for the removal of cesium-137 from aqueous solution onto guava leaves (psidium guava) and carbonized guava leaves were studied as a function of contact time, dosage, ph value and initial concentration ion. The sorption process was described by pseudo first-order, pseudo second-order, Morris and Elovich kinetic models. Cesium concentrations were ranged between 2x10 -5 - 1x10 -3 M. Sorption data have been interpreted in terms of Langmuir, Freundlich and Dubinin-Radushkevich isotherms. The maximum sorption capacity of carbonized guava leaves adsorbent for cesium removal was 8.02 mgg -1 . The results of the present study suggest that carbonized guava leaves can be used beneficially for cesium removal from aqueous solution.

Carbon dioxide sequestration by mineral carbonation. Feasibility of enhanced natural weathering as a CO2 emission reduction technology

International Nuclear Information System (INIS)

Huijgen, W.J.J.

2007-01-01

/or thermal activation). The only available pre-treatment option that has proven to be energetically and potentially economically feasible is conventional grinding. In Chapter 2 the mechanisms of aqueous steel slag carbonation are studied experimentally. Process variables, such as particle size, temperature, and carbon dioxide pressure are systematically varied and their influence on the carbonation rate is investigated. In Chapter 3 the mechanisms of aqueous steel slag carbonation are further investigated, together with the environmental properties of the (carbonated) steel slag. In Chapter 4, the mechanisms of aqueous wollastonite carbonation as a possible carbon dioxide sequestration process are investigated experimentally by systematic variation of the reaction temperature, CO2 pressure, particle size, reaction time, liquid-to-solid ratio, and agitation power. The obtained insight in the reaction mechanisms in Chapter 2 - 4 is used as the (experimental) basis for the energetic and economic assessment of CO2 sequestration by mineral carbonation in Chapters 5 and 6. The energy consumption of a mineral carbonation plant causes extra CO2 emissions and, thereby, reduces the net amount of CO2 sequestered by the process. Chapter 5 studies the energetic CO2 sequestration efficiency of the aqueous mineral carbonation in dependence of various process variables using either wollastonite or steel slag as feedstock. A flowsheet of a mineral carbonation plant is designed and the process is simulated to determine the properties of streams as well as the power and heat consumption of the process equipment. In Chapter 6 a cost evaluation of CO2 sequestration by aqueous mineral carbonation is presented, using either wollastonite or steel slag as feedstock. On the basis of a basic design of the major process equipment, the total investment costs are estimated with the help of publicly available literature and a factorial cost estimation method. Subsequently, the sequestration costs are

Areal Informations Systemet - AIS

DEFF Research Database (Denmark)

Nielsen, K.; Stjernholm, M.; Olsen, B. Ø.

Forord: Denne rapport giver en kort beskrivelse af Areal Informations Systemet (AIS), som er et databasesystem med natur- og miljødata, som kan stedfæstes geografisk. Projektet er gennemført i perioden 1996-2000 som et samarbejdsprojekt mellem Danmarks Miljøundersøgelser (DMU), Danmarks og...... og enkeltpersoner med interesse for natur- og miljøforhold i Danmark. Yderligere oplysninger om Areal Informations Systemet, herunder adgangsforhold, kan fås på DMU's hjemmeside med følgende adresse: http://ais.dmu.dk/ Projektet er finansieret af Miljø- og Energiministeriet, mens en række...... (planlægning, beskyttelse), geologi (overfladegeologi og marin geologi), samt marin dybdemodel. # Etablering af dataadgang for Miljø- og Energiministeriets institutioner til AIS-data. # Afprøvning af systemet i forhold til konkrete projekter. # Formidling af produkterne til brugerkredsen....

Electrocoagulation-Adsorption to Remove Anionic and Cationic Dyes from Aqueous Solution by PV-Energy

OpenAIRE

Castañeda-Díaz, J.; Pavón-Silva, T.; Gutiérrez-Segura, E.; Colín-Cruz, A.

2017-01-01

The cationic dye malachite green (MG) and the anionic dye Remazol yellow (RY) were removed from aqueous solutions using electrocoagulation-adsorption processes. Batch and continuous electrocoagulation procedures were performed and compared. Carbonaceous materials obtained from industrial sewage sludge and commercial activated carbons were used to adsorb dyes from aqueous solutions in column systems with a 96–98% removal efficiency. The continuous electrocoagulation-adsorption system was more ...

Aqueous colloidal processing of fluorapatite bodies

International Nuclear Information System (INIS)

Albano, Maria P.; Garrido, Liliana B.

2011-01-01

In order to produce stable aqueous fluorapatite (FA) suspensions, its surface reactivity in an aqueous solution having two initial pH values with a concentration of ammonium polyacrylate (NH_4PA) was investigated as a function of time. The influence of the slip viscosity on the casting rate and the microstructure of the resultant green slip cast compacts was determined. Upon the FA introduction in the aqueous solutions, an initial release of F anions located at the surface was found, which was not dependent of the pH and the presence of dispersant. The increase in the initial pH of the solution above 7 and/or the addition of NH_4PA markedly reduced the Ca"+"+/ H"+ exchange reaction rate. As a result, well-stabilized concentrated aqueous suspensions could be obtained at pH close to 9. The greater permeability of cakes produced from slips with high viscosity values (0.5 wt% PVA) increased the casting rate. (author)

Kinetics of carbonate dissolution in CO2-saturated aqueous system at reservoir conditions

Science.gov (United States)

Peng, Cheng; Crawshaw, John P.; Maitland, Geoffrey; Trusler, J. P. Martin

2014-05-01

In recent years, carbon capture and storage (CCS) has emerged as a key technology for limiting anthropogenic CO2 emissions while allowing the continued utilisation of fossil fuels. The most promising geological storage sites are deep saline aquifers because the capacity, integrity and injection economics are most favourable, and the environmental impact can be minimal. Many rock-fluid chemical reactions are known to occur both during and after CO2 injection in saline aquifers. The importance of rock-fluid reactions in the (CO2 + H2O) system can be understood in terms of their impact on the integrity and stability of both the formation rocks and cap rocks. The chemical interactions between CO2-acidified brines and the reservoir minerals can influence the porosity and permeability of the formations, resulting in changes in the transport processes occurring during CO2 storage. Since carbonate minerals are abundant in sedimentary rocks, one of the requirements to safely implement CO2 storage in saline aquifers is to characterise the reactivity of carbonate minerals in aqueous solutions at reservoir conditions. In this work, we reported measurements of the intrinsic rate of carbonate dissolution in CO2-saturated water under high-temperature high-pressure reservoir conditions extending up to 373 K and 14 MPa. The rate of carbonate dissolution in CO2-free HCl(aq) was also measured at ambient pressure at temperatures up to 353 K. Various pure minerals and reservoir rocks were investigated in this study, including single-crystals of calcite and magnesite, and samples of dolomite, chalks and sandstones. A specially-designed batch reactor system, implementing the rotating disc technique, was used to obtain the intrinsic reaction rate at the solid/liquid interface, free of mass transfer effects. The effective area and mineralogy of the exposed surface was determined by a combination of surface characterisation techniques including XRD, SEM, EDX and optical microscopy. The

Hazelnut shell activated carbon. A potential adsorbent material for the decontamination of uranium(VI) from aqueous solutions

International Nuclear Information System (INIS)

Mijia Zhu; Hankui Chai; Jun Yao; China University of Geosciences; Yunpeng Chen; Zhengji Yi

2016-01-01

Batch experiments were conducted to study the ability of hazelnut shell activated carbon (HSAC) to remove uranium(VI) ions from aqueous solutions. The effects of various operational parameters, such as contact time (0-200 min), pH (2.0-7.0), initial U(VI) concentration (20-240 mg/L) and adsorbent dosage (4.0-50 g/L) were examined. Results showed that the adsorption process was rapid within the first 100 min and then achieved equilibrium at 140 min. The kinetics followed a pseudo-second-order rate equation, and the adsorption process was well fit with the Langmuir model. HSAC exhibited good uranium adsorption capacity (16.3 mg/g) at pH 6.0, 140 min contact time and 8.0 g/L adsorbent dosage. Furthermore, the regeneration efficiency was 96.3 % over five cycles under the optimum operational conditions. These properties revealed that HSAC can be a suitable adsorbent for the fast and convenient removal of U(VI) from contaminated water. (author)

Adaptive Motion Gaming AI for Health Promotion

OpenAIRE

Paliyawan, Pujana; Kusano, Takahiro; Nakagawa, Yuto; Harada, Tomohiro; Thawonmas, Ruck

2017-01-01

This paper presents a design of a non-player character (AI) for promoting balancedness in use of body segments when engaging in full-body motion gaming. In our experiment, we settle a battle between the proposed AI and a player by using FightingICE, a fighting game platform for AI development. A middleware called UKI is used to allow the player to control the game by using body motion instead of the keyboard and mouse. During gameplay, the proposed AI analyze health states of the player; it d...

Modification process optimization, characterization and adsorption property of granular fir-based activated carbon

International Nuclear Information System (INIS)

Chen, Congjin; Li, Xin; Tong, Zhangfa; Li, Yue; Li, Mingfei

2014-01-01

Highlights: • Granular fir-based activated carbon (GFAC) was modified with H 2 O 2 . • Orthogonal array design method was used to optimize the modification process. • Optimized parameters were: aqueous H 2 O 2 concentration 1.0 mol l −1 , modification temperature and time 30.0 °C and 4.0 h. • Adsorption capacity of the modified GFAC increased by 500.0% (caramel), 59.7% (methylene blue), 32.5% (phenol), and 15.1% (I 2 ). • The pore structure parameters and surface oxygen groups changed in the modified GFAC. - Abstract: Granular fir-based activated carbon (GFAC) was modified with H 2 O 2 , and orthogonal array experimental design method was used to optimize the process. The properties of the original and modified GFAC were characterized by N 2 adsorption–desorption isotherms, Brunauer–Emmett–Teller (BET) equation, Barett–Joyner–Halenda (BJH) equation, field emission scanning electron microscopy (FESEM), and Fourier transform infrared spectroscopy (FT-IR) analysis, etc. When 10.00 g of GFAC with particle size of 0.25–0.85 mm was modified by 150.0 ml of aqueous H 2 O 2 solution, the optimized conditions were found to be as follows: aqueous H 2 O 2 solution concentration 1.0 mol·l −1 , modification temperature 30.0 °C, modification time 4.0 h. Modified under the optimized conditions, decolonization of caramel, methylene blue adsorption, phenol adsorption and iodine number of the modified GFAC increased by 500.0%, 59.7%, 32.5%, and 15.1%, respectively. The original and optimally modified GFAC exhibited adsorption isotherms of hybrid Type I–IV isotherms with H4 hysteresis. BET surface area, micropore area, total pore volume, micropore volume, and microporosity of the modified GFAC increased by 7.33%, 11.25%, 3.89%, 14.23%, 9.91%, respectively. Whereas the average pore width decreased by 3.16%. In addition, the amount of surface oxygen groups (such as carbonyl or carboxyl) increased in the modified GFAC

Artificial intelligence. Fears of an AI pioneer.

Science.gov (United States)

Russell, Stuart; Bohannon, John

2015-07-17

From the enraged robots in the 1920 play R.U.R. to the homicidal computer H.A.L. in 2001: A Space Odyssey, science fiction writers have embraced the dark side of artificial intelligence (AI) ever since the concept entered our collective imagination. Sluggish progress in AI research, especially during the “AI winter” of the 1970s and 1980s, made such worries seem far-fetched. But recent breakthroughs in machine learning and vast improvements in computational power have brought a flood of research funding— and fresh concerns about where AI may lead us. One researcher now speaking up is Stuart Russell, a computer scientist at the University of California, Berkeley, who with Peter Norvig, director of research at Google, wrote the premier AI textbook, Artificial Intelligence: A Modern Approach, now in its third edition. Last year, Russell joined the Centre for the Study of Existential Risk at Cambridge University in the United Kingdom as an AI expert focusing on “risks that could lead to human extinction.” Among his chief concerns, which he aired at an April meeting in Geneva, Switzerland, run by the United Nations, is the danger of putting military drones and weaponry under the full control of AI systems. This interview has been edited for clarity and brevity.

Why Don't Accounting Students like AIS?

Science.gov (United States)

Vatanasakdakul, Savanid; Aoun, Chadi

2011-01-01

Purpose: The demand for Accounting Information Systems (AIS) knowledge has increased exponentially over the past two decades, but studying AIS has not proved easy for many accounting students. The aim of the study is to understand the challenges accounting students face in studying AIS through investigation of the factors which may be contributing…

Nanoscale carbon materials from hydrocarbons pyrolysis: Structure, chemical behavior, utilisation for non-aqueous supercapacitors

International Nuclear Information System (INIS)

Savilov, Serguei V.; Strokova, Natalia E.; Ivanov, Anton S.; Arkhipova, Ekaterina A.; Desyatov, Andrey V.; Hui, Xia; Aldoshin, Serguei M.; Lunin, Valery V.

2015-01-01

Highlights: • N-doped and regular carbon nanomaterials were obtained by pyrolitic technique. • Dynamic vapor sorption of different solvents reveals smaller S BET values. • Steric hindrance and specific chemical interactions are the reasons for this. • Nitrogen doping leads to raise of capacitance and coulombic efficiency with non-aqueous N-containing electrolyte. - Abstract: This work systematically studies adsorption properties of carbon nanomaterials that are synthesized through hydrocarbons that is a powerful technique to fabricate different kinds of carbon materials, e.g., nanotubes, nanoshells, onions, including nitrogen substituted. The adsorption properties of the as-synthesized carbons are achieved by low temperature nitrogen adsorption and organic vapors sorption. Heptane, acetonitrile, water, ethanol, benzene and 1-methylimidazole, which are of great importance for development of supercapacitors, are used as substrates. It is discovered that while nitrogen adsorption reveals a high specific surface area, this parameter for most of organic compounds is rather small depending not only on the size of its molecule but also on chemical interactions for a pair adsorbent–adsorbate. The experimental values of heat of adsorption for carbon and N-substituted structures, when Coulomb cross-coupling of nitrogen atoms in adsorbent and adsorbate takes place, confirms this supposition

Nanoscale carbon materials from hydrocarbons pyrolysis: Structure, chemical behavior, utilisation for non-aqueous supercapacitors

Energy Technology Data Exchange (ETDEWEB)

Savilov, Serguei V., E-mail: savilov@chem.msu.ru [Lomonosov Moscow State University, Chemistry Department (Russian Federation); Strokova, Natalia E.; Ivanov, Anton S.; Arkhipova, Ekaterina A. [Lomonosov Moscow State University, Chemistry Department (Russian Federation); Desyatov, Andrey V. [D. Mendeleyev University of Chemical Technology of Russia (Russian Federation); Hui, Xia [Herbert Gleiter Institute of Nanoscience, School of Materials Science and Engineering, Nanjing University of Science and Technology (China); Aldoshin, Serguei M. [Lomonosov Moscow State University, Faculty of Fundamental Physical and Chemical Engineering (Russian Federation); Lunin, Valery V. [Lomonosov Moscow State University, Chemistry Department (Russian Federation)

2015-09-15

Highlights: • N-doped and regular carbon nanomaterials were obtained by pyrolitic technique. • Dynamic vapor sorption of different solvents reveals smaller S{sub BET} values. • Steric hindrance and specific chemical interactions are the reasons for this. • Nitrogen doping leads to raise of capacitance and coulombic efficiency with non-aqueous N-containing electrolyte. - Abstract: This work systematically studies adsorption properties of carbon nanomaterials that are synthesized through hydrocarbons that is a powerful technique to fabricate different kinds of carbon materials, e.g., nanotubes, nanoshells, onions, including nitrogen substituted. The adsorption properties of the as-synthesized carbons are achieved by low temperature nitrogen adsorption and organic vapors sorption. Heptane, acetonitrile, water, ethanol, benzene and 1-methylimidazole, which are of great importance for development of supercapacitors, are used as substrates. It is discovered that while nitrogen adsorption reveals a high specific surface area, this parameter for most of organic compounds is rather small depending not only on the size of its molecule but also on chemical interactions for a pair adsorbent–adsorbate. The experimental values of heat of adsorption for carbon and N-substituted structures, when Coulomb cross-coupling of nitrogen atoms in adsorbent and adsorbate takes place, confirms this supposition.

Statistical optimization of adsorption processes for removal of 2,4-dichlorophenol by activated carbon derived from oil palm empty fruit bunches

Institute of Scientific and Technical Information of China (English)

Md. Zahangir ALAM; Suleyman A. MUYIBI; Juria TORAMAE

2007-01-01

The adsorption capacity of activated carbon produced from oil palm empty fruit bunches through removal of 2,4-dichlorophenol from aqueous solution was carried out in the laboratory. The activated carbon was produced by thermal activation at 800℃ with 30 min of activation time. The adsorption process conditions were determined with the statistical optimization followed by central composite design. A developed polynomial model for operating conditions of adsorption process indicated that the optimum conditions for maximum adsorption of phenolic compound were: agitation rate of 100 r/min, contact time of 8 h, initial adsorbate concentration of 250 mg/L and pH 4. Adsorption isotherms were conducted to evaluate biosorption process. Langmuir isotherm was more favorable (R2=0.93) for removal of 2,4-dichlorophenol by the activated carbon produced rather than the Freundlich isotherm (R2=0.88).

Evaluation of removal efficiency of residual diclofenac in aqueous solution by nanocomposite tungsten-carbon using design of experiment.

Science.gov (United States)

Salmani, M H; Mokhtari, M; Raeisi, Z; Ehrampoush, M H; Sadeghian, H A

2017-09-01

Wastewater containing pharmaceutical residual components must be treated before being discharged to the environment. This study was conducted to investigate the efficiency of tungsten-carbon nanocomposite in diclofenac removal using design of experiment (DOE). The 27 batch adsorption experiments were done by choosing three effective parameters (pH, adsorbent dose, and initial concentration) at three levels. The nanocomposite was prepared by tungsten oxide and activated carbon powder in a ratio of 1 to 4 mass. The remaining concentration of diclofenac was measured by a spectrometer with adding reagents of 2, 2'-bipyridine, and ferric chloride. Analysis of variance (ANOVA) was applied to determine the main and interaction effects. The equilibrium time for removal process was determined as 30 min. It was observed that the pH had the lowest influence on the removal efficiency of diclofenac. Nanocomposite gave a high removal at low concentration of 5.0 mg/L. The maximum removal for an initial concentration of 5.0 mg/L was 88.0% at contact time of 30 min. The results of ANOVA showed that adsorbent mass was among the most effective variables. Using DOE as an efficient method revealed that tungsten-carbon nanocomposite has high efficiency in the removal of residual diclofenac from the aqueous solution.

Photosonic digestion of aqueous organics

International Nuclear Information System (INIS)

Toy, M.S.

1993-02-01

The objective of the program discussed in this report has been to develop an on-line aqueous organic digestion process that decomposes the organic compounds in water to ionic species, which can then be removed by the plant's demineralizers. At the Susquehanna Steam Electric Plant (SSES) of Pennsylvania Power and Light Company (PP ampersand L), the sonolysis process was tested by application to standard water streams to which ethylene glycol and urea were added. There were a substantial number of ionic species generated from both compounds as determined by ion chromatography. The sonolysis process and another organic destruction method, the General Electric ozone/UV process, were compared for their ability to remove the total organic carbon (TOC) and total inorganic carbon (TIC) from streams from the collection tanks of the plant's radwaste system. The sonolysis process efficiency, evaluated after the effluent from sonolysis was passed through a demineralizer, was estimated to be 55 + 17% for TOC removal as compared to a 93% removal by ozone/UV. Sonolysis led to the removal of 93% of the TIC as compared to 100% by the UV/ozone process

Effect of textural and chemical characteristics of activated carbons on phenol adsorption in aqueous solutions

Directory of Open Access Journals (Sweden)

Vargas Diana P.

2017-12-01

Full Text Available The effect of textural and chemical properties such as: surface area, pore volume and chemical groups content of the granular activated carbon and monoliths on phenol adsorption in aqueous solutions was studied. Granular activated carbon and monolith samples were produced by chemical activation. They were characterized by using N2 adsorption at 77 K, CO2 adsorption at 273 K, Boehm Titrations and immersion calorimetry in phenol solutions. Microporous materials with different pore size distribution, surface area between 516 and 1685 m2 g−1 and pore volumes between 0.24 and 0.58 cm3 g−1 were obtained. Phenol adsorption capacity of the activated carbon materials increased with increasing BET surface area and pore volume, and is favored by their surface functional groups that act as electron donors. Phenol adsorption capacities are in ranged between 73.5 and 389.4 mg · g−1.

Comparison of particle sizes between ²³⁸PuO₂ before aqueous processing, after aqueous processing, and after ball milling

Energy Technology Data Exchange (ETDEWEB)

Mulford, Roberta Nancy [Los Alamos National Lab. (LANL), Los Alamos, NM (United States)

2017-02-06

Particle sizes determined for a single lot of incoming Russian fuel and for a lot of fuel after aqueous processing are compared with particle sizes measured on fuel after ball-milling. The single samples of each type are believed to have particle size distributions typical of oxide from similar lots, as the processing of fuel lots is fairly uniform. Variation between lots is, as yet, uncharacterized. Sampling and particle size measurement methods are discussed elsewhere.

Humic Acid Degradation via Solar Photo-Fenton Process in Aqueous Environment

Directory of Open Access Journals (Sweden)

Seyed Ali Sajjadi

2015-08-01

Full Text Available Control of mutagenic and carcinogenic disinfection by-products, particularly Trihalomethanes (THMs and Halo Acetic Acids (HAAs in water treatment process is critical, due to their adverse effects on human health. Generally, reducing the toxicity of these by-products hinges on prior removal of the precursor materials, such as Humic Acid (HA in drinking water. This study was conducted to investigate the role of some parameters that could affect the removal of HA, including HA (5 and 10 ppm and H2O2 (20, 40, 60, and 80 ppm initial concentrations, Iron (II, sulfate heptahydrate dosage (4, 8, 12, and 16 ppm, pH (2, 3, 4 and 5, Oxidation time (5, 10, 15 and 30 min, and Sunlight levels (322±13 kWm-2. To accelerate the process of HA removal, the Solar Photo-Fenton (SPF process was employed by direct irradiation of converged sunlight in a Parabolic Trough Collectors (PTC, with 3m2 effective area. HA levels were measured via quantifying Dissolved Organic Carbon (DOC concentrations by means of a TOC Analyzer method. The results showed that the SPF process is under control of the Fe & H2O2 ratio, the Fe2+ dosage and especially the pH quantity. In optimal condition, (pH: 4, oxidation time: 30min, initial HA levels: 50 ppm, H2O2 concentrations: 20 ppm Fe+2 levels: 4 ppm, the study found more than 98% DOC removal. In conclusion, the SPF, as an economically effective technique, could be applied for the removal of HA in aqueous environments.

Viscoelastic behavior of multiwalled carbon nanotubes into phenolic resin

Energy Technology Data Exchange (ETDEWEB)

Botelho, Edson Cocchieri; Costa, Michelle Leali; Braga, Carlos Isidoro, E-mail: ebotelho@feg.unesp.br [Universidade Estadual Paulista Julio de Mesquita Filho (UNESP), Guaratingueta, SP (Brazil). Dept. de Materiais e Tecnologia; Burkhart, Thomas [Institut fuer Verbundwerkstoffe GmbH, Kaiserslautern, (Germany); Lauke, Bernd [Leibniz-Institut fuer Polymerforschung, Dresden (Germany)

2013-11-01

Nanostructured polymer composites have opened up new perspectives for multi-functional materials. In particular, carbon nanotubes (CNTs) have the potential applications in order to improve mechanical and electrical performance in composites with aerospace application. This study focuses on the viscoelastic evaluation of phenolic resin reinforced carbon nanotubes, processed by using two techniques: aqueous-surfactant solution and three roll calender (TRC) process. According to our results a relative small amount of CNTs in a phenolic resin matrix is capable of enhancing the viscoelastic properties significantly and to modify the thermal stability. Also has been observed that when is used TRC process, the incorporation and distribution of CNT into phenolic resin is more effective when compared with aqueous solution dispersion process. (author)

Processing of high performance composites based on peek by aqueous suspension prepregging

Directory of Open Access Journals (Sweden)

Liliana Burakowski Nohara

2010-06-01

Full Text Available The use of polyamic acid (PAA precursor as interphase in polymer composites is one of the many applications of polyimides (PIs. In this work, composites based on poly(ether-ether-ketone (PEEK and carbon fibers were prepared using two manufacturing techniques for thermoplastic composites: hot compression molding, and aqueous polymeric suspension prepregging using PIs as interphase. Two PAAs were synthesized and used as interphases: 3,3'-4,4'-benzophenonetetracarboxylic dianhydride/oxydianiline (BTDA/ODA and pyromellitic dianhydride/oxydianiline (PMDA/ODA. The PAA/PI systems were analyzed by differential scanning calorimetry (DSC, thermogravimetry (TGA, Fourier transform infrared spectroscopy (FTIR and nuclear magnetic resonance (NMR. Results from these analyses confirmed the synthesis of these compounds. Aqueous polymeric suspension prepregging was more efficient than hot compression molding when the PMDA/ODA PAA/PI interphase was used; also, the interlaminar shear strength of composites produced using this technique was 14.5% higher than the one produced using hot compression molding.

AI and Mathematical Education

Directory of Open Access Journals (Sweden)

Angel Garrido

2012-01-01

Full Text Available From ancient times, the history of human beings has developed by a succession of steps and sometimes jumps, until reaching the relative sophistication of the modern brain and culture. Researchers are attempting to create systems that mimic human thinking, understand speech, or beat the best human chess player. Understanding the mechanisms of intelligence, and creating intelligent artifacts are the twin goals of Artificial Intelligence (AI. Great mathematical minds have played a key role in AI in recent years; to name only a few: Janos Neumann (also known as John von Neumann, Konrad Zuse, Norbert Wiener, Claude E. Shannon, Alan M. Turing, Grigore Moisil, Lofti A. Zadeh, Ronald R. Yager, Michio Sugeno, Solomon Marcus, or Lászlo A. Barabási. Introducing the study of AI is not merely useful because of its capability for solving difficult problems, but also because of its mathematical nature. It prepares us to understand the current world, enabling us to act on the challenges of the future.

Short Range-Ordered Minerals: Insight into Aqueous Alteration Processes on Mars

Science.gov (United States)

Ming, Douglas W.; Morris, R. V.; Golden, D. C.

2011-01-01

involved. The style of aqueous alteration (hydrolytic vs. acid sulfate) impacts which phases will form (e.g., oxides, oxysulfates, and oxyhydroxides). Knowledge on the formation processes of SRO phases in basaltic materials on Earth has allowed significant enhancement in our understanding of the aqueous processes at work on Mars. The 2011 Mars Science Laboratory (MSL) will provide an instrument suite that should improve our understanding of the mineralogical and chemical compositions of SRO phases. CheMin is an X-ray diffraction instrument that may provide broad X-ray diffraction peaks for SRO phases; e.g., broad peaks around 0.33 and 0.23 nm for allophane. Sample Analysis at Mars (SAM) heats samples and detects evolved gases of volatile-bearing phases including SRO phases (i.e., carbonates, sulfates, hydrated minerals). The Alpha Particle X-ray Spectrometer (APXS) and ChemCam element analyzers will provide chemical characterization of samples. The identification of SRO phases in surface materials on MSL will be challenging due to their nanocrystalline properties; their detection and identification will require utilizing the MSL instrument suite in concert. Ultimately, sample return missions will be required to definitively identify and fully characterize SRO minerals with state-of-the-art laboratory instrumentation back on Earth.

Integration of AI-2 Based Cell-Cell Signaling with Metabolic Cues in Escherichia coli.

Directory of Open Access Journals (Sweden)

Arindam Mitra

Full Text Available The quorum sensing molecule Autoinducer-2 (AI-2 is generated as a byproduct of activated methyl cycle by the action of LuxS in Escherichia coli. AI-2 is synthesized, released and later internalized in a cell-density dependent manner. Here, by mutational analysis of the genes, uvrY and csrA, we describe a regulatory circuit of accumulation and uptake of AI-2. We constructed a single-copy chromosomal luxS-lacZ fusion in a luxS + merodiploid strain and evaluated its relative expression in uvrY and csrA mutants. At the entry of stationary phase, the expression of the fusion and AI-2 accumulation was positively regulated by uvrY and negatively regulated by csrA respectively. A deletion of csrA altered message stability of the luxS transcript and CsrA protein exhibited weak binding to 5' luxS regulatory region. DNA protein interaction and chromatin immunoprecipitation analysis confirmed direct interaction of UvrY with the luxS promoter. Additionally, reduced expression of the fusion in hfq deletion mutant suggested involvement of small RNA interactions in luxS regulation. In contrast, the expression of lsrA operon involved in AI-2 uptake, is negatively regulated by uvrY and positively by csrA in a cell-density dependent manner. The dual role of csrA in AI-2 synthesis and uptake suggested a regulatory crosstalk of cell signaling with carbon regulation in Escherichia coli. We found that the cAMP-CRP mediated catabolite repression of luxS expression was uvrY dependent. This study suggests that luxS expression is complex and regulated at the level of transcription and translation. The multifactorial regulation supports the notion that cell-cell communication requires interaction and integration of multiple metabolic signals.

Dynamic simulation of the carbon-in-pulp and carbon-in-leach processes

Directory of Open Access Journals (Sweden)

L. R. P. de Andrade Lima

2007-12-01

Full Text Available Carbon-in-leach and carbon-in-pulp are continuous processes that use activated carbon in a cascade of large agitated tanks, which have been widely used to recover or concentrate precious metals in gold extraction plants. In the carbon-in-pulp process adsorption occurs after the leaching cascade section of the plant, and in the carbon-in-leach process leaching and adsorption occur simultaneously. In both processes the activated carbon is moved from one tank to another in countercurrent with the ore pulp until the recovery of the loaded carbon in the first tank. This paper presents a dynamic model that describes, with minor changes, the carbon-in-leach, the carbon-in-pulp, and the gold leaching processes. The model is numerically solved and calibrated with experimental data from a plant and used to perform a study of the effect of the activated carbon transfer strategy on the performance of the adsorption section of the plant. Based on the calculated values of the gold loss in the liquid and of the gold recovered in the loaded activated carbon that leaves the circuit, the results indicate that strategies in which a significant amount of activated carbon is held in the first tank and the contact time between the carbon and the pulp is longer are the best carbon transfer strategies for these processes.

"All-In-One Test" (AI1)

DEFF Research Database (Denmark)

Giacalone, Davide; Bredie, Wender Laurentius Petrus; Frøst, Michael Bom

2013-01-01

by the Check-All-That-Apply (CATA) technique is reported. In this exploratory "All-In-One Test"(AI1), subjects (N = 160) filled out a questionnaire with demographic and psychographic variables, and appropriateness ratings for specific sensory descriptors of beer. Subsequently, subjects gave hedonic ratings...... between appropriateness and actual hedonic response. Overall, the AI1 test provided interpretable results concerning consumer perception (sensory/hedonic) of the beers, and revealed relations with consumers' background information. Initial results with AI1 test show that it is an efficient and versatile...

Sorption of a mixture of phenols in aqueous solution with activated carbon; Sorcion de una mezcla de fenoles en solucion acuosa con carbon activado

Energy Technology Data Exchange (ETDEWEB)

Mejia M, D.; Lopez M, B.E.; Iturbe G, J.L. [ININ, 52045 Ocoyoacac, Estado de Mexico (Mexico)

2003-07-01

The main objective of this work is the sorption of an aqueous mixture of phenol-4 chloro phenol of different concentrations in a molar relationship 1:1 in activated carbon of mineral origin of different nets (10, 20 and 30) and to diminish with it its presence in water. The experimental results show that the removal capacity depends so much of the surface properties of the sorbent like of the physical and chemical properties of the sorbate. In all the cases it was observed that in the aqueous systems of low concentration the 4-chloro phenol are removed in an approximate proportion of 1.2-4 times greater to than phenol, however to concentrations but high both they are removed approximately in the same proportion. (Author)

Single walled carbon nanotube reactivity and cytotoxicity following extended aqueous exposure

International Nuclear Information System (INIS)

Panessa-Warren, Barbara J.; Maye, Mathew M.; Warren, John B.; Crosson, Kenya M.

2009-01-01

Globally carbon nanoparticles are increasingly utilized, yet it is not known if these nanoparticles pose a threat to the environment or human health. This investigation examined 'as-prepared', and acid cleaned carbon nanoparticle physicochemical characteristics (by FTIR, TEM, FESEM, UV-VIS and X-ray microanalysis), and whether these characteristics changed following 2.5-7 yr exposure to pH neutral saline or fresh water. To determine if these aqueous aged nanotubes were cytotoxic, these nanotubes were incubated with human epithelial monolayers and analyzed for cell viability (vital staining) and ultrastructural nanoparticle binding/localization (TEM, FESEM). The presence of Ni and Y catalyst, was less damaging to cells than CNT lattice surface oxidation. Extended fresh water storage of oxidized CNTs did not reduce surface reactive groups, nor lessen cell membrane destruction or cell death. However storing oxidized CNTs in saline or NOM significantly reduced CNT-induced cell membrane damage and increased cell survival to control levels. - Oxidized SWCNTs in pH neutral fresh and saline water showed no reduction in surface oxidation with time, yet exposure of these nanotubes to saline and NOM reduced human cell toxicity markedly

Removal of uranium(VI) from aqueous solutions by new phosphorus-containing carbon spheres synthesized via one-step hydrothermal carbonization of glucose in the presence of phosphoric acid

International Nuclear Information System (INIS)

Zhi-bin Zhang; East China Institute of Technology, Fuzhou; China University of Geosciences, Wuhan; Zhi-wei Zhou; Xiao-hong Cao; Yun-hai Liu; Guo-xuan Xiong; East China Institute of Technology, Fuzhou; Ping Liang; East China Institute of Technology, Fuzhou; China University of Geosciences, Wuhan

2014-01-01

The novel phosphorus-rich hydrothermal carbon spheres (HCSs-PO 4 ) have been synthesized via one-step hydrothermal carbonization of glucose in the presence of phosphoric acid. The textural and surface chemistry properties were characterized using Boehm titrations, scanning electron microscopy and Fourier transform infrared spectrometer. The content of oxygen-containing functional groups on the surface of HCSs increased from 0.053 to 1.009 mmol g -1 by phosphate group modification. The adsorption ability of HCSsPO 4 has been explored for the removal of uranium from aqueous solutions. The adsorption kinetic data were best described by the pseudo-second-order equation. Adsorption process could be well defined by the Langmuir isotherm, the adsorption capacity of HCSs increased from 80.00 to 285.70 mg g -1 after phosphate group modification. And thermodynamic parameters indicated the adsorption process was feasible,endothermic and spontaneous. Selective adsorption studies showed that the HCSs-PO 4 could selectively remove U(VI), and the selectivity coefficients had been improved in the presence of co-existing ions, Na(I), Ni(II), Sr(II), Mn(II), Mg(II) and Zn(II). Complete removal (99.9 %) of U(VI) from 1.0 L industry wastewater containing 15.0 mg U(VI) ions was possible with 12.0 g HCSs-PO 4 . (author)

Dissolved organic carbon enhances the mass transfer of hydrophobic organic compounds from Nonaqueous Phase Liquids (NAPLs) into the aqueous phase

NARCIS (Netherlands)

Smith, K.E.C.; Thullner, M.; Wick, L.Y.; Harms, H.

2011-01-01

The hypothesis that dissolved organic carbon (DOC) enhances the mass transfer of hydrophobic organic compounds from nonaqueous phase liquids (NAPLs) into the aqueous phase above that attributable to dissolved molecular diffusion alone was tested. In controlled experiments, mass transfer rates of

Conversion electron Moessbauer study of low carbon steel polarized in aqueous sulfate solution containing sulfite in low concentration

International Nuclear Information System (INIS)

Vertes, Cs.; Lakatos-Varsanyi, M.; Vertes, A.; Kuzmann, E.; Meisel, W.; Guetlich, P.

1992-01-01

The passivation of low carbon steel was studied in aqueous solution of 0.5 M Na 2 SO 4 +0.001 M NaHSO 3 at pH=3.5 and 6.5. The found major components at pH=3.5 were: γ-FeOOH and Fe 3 C, and also FeSO 4 .H 2 O could be identified on the surface of the low carbon steel as a minor component. At pH=6.5, the passive film contained only amorphous iron(III)-oxide or oxyhydroxide. (orig.)

Waste Treatment of Chrome Residue of Chromium Recovery Process Using Calcium Carbonate

International Nuclear Information System (INIS)

Endro Kismolo; Prayitno; Nurimaniwathy

2002-01-01

The aim of the research was to apply the precipitation technology for the treatment of aqueous wastes of leather tanning industries. The chrome liquid wastes taken was the effluent from the residue of the chromium recovery process using magnesium oxide. The precipitant used was calcium carbonate. The experiments was performed by adjusting the concentration of calcium carbonate from 50 ppm, 100 ppm, 150 ppm, 200 ppm, 250 ppm, 300 ppm, 350 ppm to 400 ppm. The stirring speed was varied from 50 rpm, 75 rpm, 100 rpm, 125 rpm, 150 rpm, 175 rpm to 200 rpm. The time of mixing was varied from 30 minutes, 60 minutes, 90 minutes, 120 minutes, 150 minutes, 175 minutes and 200 minutes. The result from the experiments lead to the best condition obtained were the concentration of precipitant was 300 ppm, flow rates of mixing was 125 rpm and time of mixing was 60 minutes. At this condition the separations efficiency of chrome obtained was 99.985%. (author)

Intravenous injection of unfunctionalized carbon-based nanomaterials confirms the minimal toxicity observed in aqueous and dietary exposures in juvenile rainbow trout (Oncorhynchus mykiss).

Science.gov (United States)

Boyle, David; Sutton, Paul A; Handy, Richard D; Henry, Theodore B

2018-01-01

Numerous ecotoxicology studies of carbon-based nanomaterials (CNMs) have been conducted in fishes; however, different approaches have been used to make CNM dispersions and dose tanks for aqueous exposures, and to prepare food containing CNMs for dietary studies. This diversity of experimental methods has led to conflicting results and difficulties in comparing studies. The objective of the present study was to evaluate intravenous injection of unfunctionalized CNMs in rainbow trout (Oncorhynchus mykiss), as a means of delivering a known internal dose, on tissue biochemistry and histopathological lesions; then, subsequently, to compare the results with our previous work on aqueous and dietary exposures of rainbow trout to CNMs. Rainbow trout were injected in the caudal vein with corn oil dispersions of 200 μg (approximately 1 μg g -1 ) of either the fullerene C 60 , single-walled carbon nanotubes (SWCNTs), or amorphous carbon black. After 96 h, injected fish were euthanized and tissue samples collected for biochemistry and histology. Histological examination of the kidney of fish injected intravenously indicated the presence of black material consistent with the injected carbon treatments. However, there were no additional lesions associated with CNM exposure compared to controls. There were also no significant changes in haematology, or ionoregulatory disturbance in blood plasma among the intravenously injected fish. Significant elevation in lipid peroxidation (thiobarbituric acid reactive substances TBARS) was detected only in kidney and spleen of fish injected with SWCNTs, but not the other carbon treatments. The elevated TBARS following injection contrasted with CNMs delivered via aqueous or dietary routes in our previous studies, suggesting that the latter exposure routes may not lead to absorption and toxicity in the internal tissues. Comparison of the effects of injected CNMs with aqueous and dietary CNMs exposures indicates that these materials are of

AI in space: Past, present, and possible futures

Science.gov (United States)

Rose, Donald D.; Post, Jonathan V.

1992-01-01

While artificial intelligence (AI) has become increasingly present in recent space applications, new missions being planned will require even more incorporation of AI techniques. In this paper, we survey some of the progress made to date in implementing such programs, some current directions and issues, and speculate about the future of AI in space scenarios. We also provide examples of how thinkers from the realm of science fiction have envisioned AI's role in various aspects of space exploration.

Radioimmunoassay of apolipoprotein A-I of rat serum

International Nuclear Information System (INIS)

Fainaru, M.; Havel, R.J.; Felker, T.E.

1976-01-01

A double antibody radioimmunoassay technique was developed for quantification of apolipoprotein A-I, the major apoprotein of rat high density lipoprotein. Apo A-I was labelled with 125 I by the chloramine-T method. 125 I-labeled apo A-I had the same electrophoretic mobility as unlabeled apo A-I and more than 80% of the 125 I was precipitated by rabbit anti apo A-I antibodies. The assay is sensitive at the level of 0.5-5 ng, and has intraassay and interassay coefficients of variation of 4.5 and 6.5% respectively. The specificity of the assay was established by competitive displacement of 125 I-labeled apo A-I from its antibody by apo A-I and lipoproteins containing apo A-I, but not by rat albumin and other apoproteins. Immunoreactivity of high density lipoprotein and serum was only about 35% of that of their delipidated forms when Veronal buffer was used as a diluent. Inclusion of 5 mM sodium decyl sulfate in the incubation mixture brought out reactivity equivalent to that found after delipidation. Completeness of the reaction was verified by comparison with the amount of apo A-I in chromatographic fractions of the total apoprotein of high density lipoprotein. Content (weight %, mean values +- S.D.) of immunoassayable apo A-I was: 62.3 +- 5.9 in high density lipoprotein; 1.7 +- 0.3 in low density lipoprotein; 0.09 +- 0.03 in very low density lipoprotein and 25.0 +- 5.0 in lymph chylomicrons. Concentration in whole serum was 51.4 +- 8.9 mg/dl and 33.6 +- 4.1 mg/dl for female and male rats, respectively (p 1.21 g/ml and <1% in lipoproteins of d<1.063 g/ml

Study of assessing aqueous reprocessing process for the pipeless reprocessing plant

International Nuclear Information System (INIS)

Hanzawa, Masatoshi; Morioka, Nobuo; Fumoto, Hiromichi; Nishimura, Kenji; Chikazawa, Takahiro

2000-02-01

The purpose of this study is to investigate the possibility of new reprocessing process for the purpose of introducing pipeless plant concept, where aqueous separation methods other than solvent extraction method are adopted in order to develop more economical FBR fuel (MOX fuel) reprocessing process. At it's first stage, literature survey on precipitation method, crystallization method and ion-exchange method was performed. Based on the results, following processes were candidated for pipeless reprocessing plant. (1) The process adopting crystallization method and peroxide precipitation method (2) The process adopting oxalate precipitation method (3) The process under mild aqueous conditions (crystallization method and precipitation method) (4) The process adopting crystallization method and ion-exchange method (5) The process adopting crystallization method and solvent extraction method. The processes (1)-(5) were compared with each others in terms of competitiveness to the conventional reference process, and merits and demerits were evaluated from the viewpoint of applicability to pipeless reprocessing plant, safety, economy, Efficiencies in consumption of Resources, non-proliferation, and, Operation and Maintenance. As a result, (1) The process adopting crystallization method and peroxide precipitation method was selected as the most reasonable process to pipeless plant. Preliminary criticality safety analyses, main process chemical flowsheet, main equipment list and layout of mobile vessels and stations were reported for the (1) process. (author)

Bioremediation of zirconium from aqueous solution by coriolus versicolor: process optimization

International Nuclear Information System (INIS)

Amin, M.; Bhatti, H. N.; Sadaf, S.

2013-01-01

In the present study the potential of live mycelia of Coriolus versicolor was explored for the removal of zirconium from simulated aqueous solution. Optimum experimental parameters for the bioremediation of zirconium using C. versicolor biomass have been investigated by studying the effect of mycelia dose, concentration of zirconium, contact time and temperature. The isothermal studies indicated that the ongoing bioremediation process was exothermic in nature and obeyed Langmuir adsorption isotherm model. The Gibbs free energy (ΔG), entropy (ΔS) and enthalpy (ΔH) of bioremediation were also determined. The result showed that bioremediation of zirconium by live C. versicolor was feasible and spontaneous at room temperature. The equilibrium data verified the involvement of chemisorption during the bioremediation. The kinetic data indicated the operation of pseudo-second order process during the biosorption of zirconium from aqueous solution. Maximum bioremediation capacity (110.75 mg/g) of C. versicolor was observed under optimum operational conditions: pH 4.5, biomass dose 0.05 mg/100 mL, contact time 6 h and temperature 30 degree C. The results showed that C. versicolor could be used for bioremediation of heavy metal ions from aqueous systems. (author)

Comparative removal of emerging contaminants from aqueous solution by adsorption on an activated carbon.

Science.gov (United States)

Gil, A; Taoufik, N; García, A M; Korili, S A

2018-04-19

Batch sorption experiments were performed to study the adsorption of six emerging pollutants from aqueous solutions using a commercial granular activated carbon as adsorbent. Caffeine, clofibric acid, diclofenac, gallic acid, ibuprofen and salicylic acid were selected as representative contaminants. The activated carbon was characterized by nitrogen adsorption at 77 K, and through the determination of point of zero charge. The effects of several operational parameters, such as pH, initial concentration of organic molecules, mass of adsorbent and contact time, on the sorption behaviour were evaluated. The contact time to attain equilibrium for maximum adsorption was found to be 40 min. The kinetic data were correlated to several adsorption models, and the adsorption mechanism found to follow pseudo-second-order and intraparticle-diffusion models with external mass transfer predominating in the first 15 min of the experiment. The equilibrium adsorption data were analysed using the Freundlich, Langmuir and Toth isotherm equation models. The similar chemical structure and molecular weight of the organic pollutants studied to make the adsorption capacity of the activated carbon used very similar for all the molecules.

A nuclear decision support system built with a real-time process control AI shell

International Nuclear Information System (INIS)

Nevins, M.A.

1990-01-01

Managing large nuclear power plants is generally approached by creating separate management teams to handle major functional areas such as operations, maintenance, training and engineering. While this approach facilitates a general understanding of the specific functions and problem areas of a nuclear plant, such broad definitions diminish the integration of information needed to understand the overall problem domain. One solution utilizes a decision support system that integrates a real-time process control AI shell, relational database manager, graphic depiction of the real-time events, and distributed knowledge bases that reside within each of the departments. The goal is to create a living model between plant components, procedures, tech specs, specific functions, maintenance and training requirements. This paper describes such a model, called Engineering Model and Simulation System (EMASS)

Beyond AI: Interdisciplinary Aspects of Artificial Intelligence

CERN Document Server

Romportl, Jan; Zackova, Eva; Beyond Artificial Intelligence : Contemplations, Expectations, Applications

2013-01-01

Products of modern artificial intelligence (AI) have mostly been formed by the views, opinions and goals of the “insiders”, i.e. people usually with engineering background who are driven by the force that can be metaphorically described as the pursuit of the craft of Hephaestus. However, since the present-day technology allows for tighter and tighter mergence of the “natural” everyday human life with machines of immense complexity, the responsible reaction of the scientific community should be based on cautious reflection of what really lies beyond AI, i.e. on the frontiers where the tumultuous ever-growing and ever-changing cloud of AI touches the rest of the world.   The chapters of this boo are based on the selected subset of the presentations that were delivered by their respective authors at the conference “Beyond AI: Interdisciplinary Aspects of Artificial Intelligence” held in Pilsen in December 2011.   From its very definition, the reflection of the phenomena that lie beyond AI must be i...

Emerging trends in geospatial artificial intelligence (geoAI): potential applications for environmental epidemiology.

Science.gov (United States)

VoPham, Trang; Hart, Jaime E; Laden, Francine; Chiang, Yao-Yi

2018-04-17

Geospatial artificial intelligence (geoAI) is an emerging scientific discipline that combines innovations in spatial science, artificial intelligence methods in machine learning (e.g., deep learning), data mining, and high-performance computing to extract knowledge from spatial big data. In environmental epidemiology, exposure modeling is a commonly used approach to conduct exposure assessment to determine the distribution of exposures in study populations. geoAI technologies provide important advantages for exposure modeling in environmental epidemiology, including the ability to incorporate large amounts of big spatial and temporal data in a variety of formats; computational efficiency; flexibility in algorithms and workflows to accommodate relevant characteristics of spatial (environmental) processes including spatial nonstationarity; and scalability to model other environmental exposures across different geographic areas. The objectives of this commentary are to provide an overview of key concepts surrounding the evolving and interdisciplinary field of geoAI including spatial data science, machine learning, deep learning, and data mining; recent geoAI applications in research; and potential future directions for geoAI in environmental epidemiology.

Simultaneous reduction and adsorption for immobilization of uranium from aqueous solution by nano-flake Fe-SC

Energy Technology Data Exchange (ETDEWEB)

Kong, Lingjun, E-mail: kongl_jun@163.com [School of Environmental Science and Engineering, Guangzhou University, Guangzhou, 510275 (China); Guangdong Provincial Key Laboratory of radioactive contamination control and resources, Guangzhou University, Guangzhou, 510275 (China); Guangdong Provincial Key Laboratory of Environmental Pollution Control and Remediation Technology, Sun Yat-sen University, Guangzhou, 510275 (China); Zhu, Yuting; Wang, Min; Li, Zhixuan; Tan, Zhicong; Xu, Ruibin; Tang, Hongmei; Chang, Xiangyang [School of Environmental Science and Engineering, Guangzhou University, Guangzhou, 510275 (China); Guangdong Provincial Key Laboratory of radioactive contamination control and resources, Guangzhou University, Guangzhou, 510275 (China); Xiong, Ya [Guangdong Provincial Key Laboratory of Environmental Pollution Control and Remediation Technology, Sun Yat-sen University, Guangzhou, 510275 (China); Chen, Diyun, E-mail: cdy@gzhu.edu.cn [School of Environmental Science and Engineering, Guangzhou University, Guangzhou, 510275 (China); Guangdong Provincial Key Laboratory of radioactive contamination control and resources, Guangzhou University, Guangzhou, 510275 (China)

2016-12-15

Uranium containing radioactive wastewater is seriously hazardous to the natural environment if it is being discharged directly. Herein, nano-flake like Fe loaded sludge carbon (Fe-SC) is synthesized by carbothermal process from Fe-rich sludge waste and applied in the immobilization of uranium in aqueous. Batch isotherm and kinetic adsorption experiments are adopted to investigate the adsorption behavior of Fe-SC to uranium in aqueous. XPS analyses were conducted to evaluate the immobilized mechanism. It was found that the carbonized temperature played significant role in the characteristics and immobilization ability of the resulted Fe-SC. The Fe-SC-800 carbonized at 800 °C takes more advantageous ability in immobilization of uranium from aqueous than the commercial available AC and powder zero valent iron. The adsorption behavior could be fitted well with the Langmuir isotherm adsorption model and pseudo-second order model. The equilibrium adsorption amount and rate for Fe-SC-800 is high to 148.99 mg g{sup -1} and 0.015 g mg{sup -1} min{sup -1}, respectively. Both reductive precipitation and physical adsorption are the main mechanisms of immobilization of uranium from aqueous by Fe-SC-800.

USACE AIS Transmit Technical Support Summary Report

Science.gov (United States)

2014-09-01

the TAG block for the correct transmitters, and then send to the USACE AIS network. B. Outbound openings in the USCG firewall for the USCG Message...USACE AIS Transmit Technical Support Summary Report Distribution Statement A: Approved for public release; distribution is unlimited...September 2014 Report No. CD-D-09-15 USACE AIS Transmit Technical Support Summary Report ii UNCLAS//Public | CG-926 RDC | I. Gonin et al. Public

Aqueous biphasic extraction of uranium and thorium from contaminated soils. Final report

International Nuclear Information System (INIS)

Chaiko, D.J.; Gartelmann, J.; Henriksen, J.L.; Krause, T.R.; Deepak; Vojta, Y.; Thuillet, E.; Mertz, C.J.

1995-07-01

The aqueous biphasic extraction (ABE) process for soil decontamination involves the selective partitioning of solutes and fine particulates between two immiscible aqueous phases. The biphase system is generated by the appropriate combination of a water-soluble polymer (e.g., polyethlene glycol) with an inorganic salt (e.g., sodium carbonate). Selective partitioning results in 99 to 99.5% of the soil being recovered in the cleaned-soil fraction, while only 0.5 to 1% is recovered in the contaminant concentrate. The ABE process is best suited to the recovery of ultrafine, refractory material from the silt and clay fractions of soils. During continuous countercurrent extraction tests with soil samples from the Fernald Environmental Management Project site (Fernald, OH), particulate thorium was extracted and concentrated between 6- and 16-fold, while the uranium concentration was reduced from about 500 mg/kg to about 77 mg/kg. Carbonate leaching alone was able to reduce the uranium concentration only to 146 mg/kg. Preliminary estimates for treatment costs are approximately $160 per ton of dry soil. A detailed flowsheet of the ABE process is provided

OPTICAL PROPERTIES OF CARBAMIDE AQUEOUS SOLUTIONS

Directory of Open Access Journals (Sweden)

E. V. Avramenko

2016-03-01

Full Text Available Subject of Research. The paper presents the results of measurements of refractometric properties (refractive index n, its temperature factor dn/dt and the ultraviolet spectral absorption in carbonic acid diamide aqueous solutions (carbamide depending on solid residue mass fraction md = 0-50 % and on temperaturet = 10-70 °C.Method of Research. Laboratory methods ofliquid-phase medium refractometry and ultraviolet spectrophotometry were applied for the research. We carried out computational modeling of electronic states spectrum for the carbonic acid diamide molecule and theoretical calculation of the fundamental electronic absorption of the molecule in the ultraviolet wavelenght region.Main Results. We have established that the solution concentration md has a nonlinear character and may be represented by the quadratic polynomial with the error Δn= ± 0,0005. We have shown the refractive indexdependence on temperature n(t changes in linear fashion att = 10-70 °C.At that, the inclination of lines n(t increases at the increase of md; so, the temperature factor dn/dt may be approximated by the quadratic polynomial. Transmission spectra of solutions in the spectral region λ= 225-760 nm have no special features except for the sharp edge in the short-wavelength region; the fundamental electronic absorptionis responsible for it. We have established that dispersion dependences of the refraction index n(λ;md in aqueous solutions of carbamide at λ= 360-760 nm and at md = 0-50 % may be calculated with the satisfactory error without additional adjustable parameters from the ultraviolet absorption data in terms of the one-dimentional oscillator Lorentz model.PracticalRelevance. Representedmeasurements of carbonic acid diamide aqueous solutions optical properties may be applied for the adjustment and calibration of commercial refractometers at processing lines of the AdBlue reagent manufacture for the selective catalytic reduction (SCR of motor transport

Aqueous supercapacitors on conductive cotton

KAUST Repository

Pasta, Mauro; La Mantia, Fabio; Hu, Liangbing; Deshazer, Heather Dawn; Cui, Yi

2010-01-01

Wearable electronics offer the combined advantages of both electronics and fabrics. In this article, we report the fabrication of wearable supercapacitors using cotton fabric as an essential component. Carbon nanotubes are conformally coated onto the cotton fibers, leading to a highly electrically conductive interconnecting network. The porous carbon nanotube coating functions as both active material and current collector in the supercapacitor. Aqueous lithium sulfate is used as the electrolyte in the devices, because it presents no safety concerns for human use. The supercapacitor shows high specific capacitance (~70-80 F·g-1 at 0.1 A·g-1) and cycling stability (negligible decay after 35,000 cycles). The extremely simple design and fabrication process make it applicable for providing power in practical electronic devices. © 2010 Tsinghua University Press and Springer-Verlag Berlin Heidelberg.

Aqueous supercapacitors on conductive cotton

KAUST Repository

Pasta, Mauro

2010-06-01

Wearable electronics offer the combined advantages of both electronics and fabrics. In this article, we report the fabrication of wearable supercapacitors using cotton fabric as an essential component. Carbon nanotubes are conformally coated onto the cotton fibers, leading to a highly electrically conductive interconnecting network. The porous carbon nanotube coating functions as both active material and current collector in the supercapacitor. Aqueous lithium sulfate is used as the electrolyte in the devices, because it presents no safety concerns for human use. The supercapacitor shows high specific capacitance (~70-80 F·g-1 at 0.1 A·g-1) and cycling stability (negligible decay after 35,000 cycles). The extremely simple design and fabrication process make it applicable for providing power in practical electronic devices. © 2010 Tsinghua University Press and Springer-Verlag Berlin Heidelberg.

Efficient and Stable Carbon-coated Nickel Foam Cathodes for the Electro-Fenton Process

International Nuclear Information System (INIS)

Song, Shuqin; Wu, Mingmei; Liu, Yuhui; Zhu, Qiping; Tsiakaras, Panagiotis; Wang, Yi

2015-01-01

Highlights: • Carbon-coated nickel foam (C@NF) was prepared by cycle coating carbon process. • Ni leaching can be effectively controlled at C@NF4 (4 cycle coating times) cathode. • C@NF4 exhibits excellent electro-Fenton performance with desirable stability. • C@NF4 exhibits low energy consumption for DMP degradation. - Abstract: Carbon-coated nickel foam (C@NF) electrodes are prepared via a simple and effective method, hydrothermal-carbonization cycle coating process, characterized by scanning electron microscopy (SEM) with energy dispersive spectrometer (EDS) and employed as the electro-Fenton (E-Fenton) cathode for degrading dimethyl phthalate (DMP) in aqueous solution. For the sake of comparison, nickel foam (NF) electrode and the conventional E-Fenton cathode (graphite gas diffusion electrode (GDE)) are also tested and compared. Experimental results indicate that nickel leaching can be effectively controlled at C@NF4 cathode (4 times cycle coating process), having great significance for promoting the application of NF in E-Fenton system. Moreover, C@NF4 cathode still presents excellent and effective performance on DMP degradation. DMP can be completely degraded within 2 h at −0.5 V and the total organic carbon (TOC) removal reaches as high as 82.1 %, which is almost 3 times as high as that at graphite GDE. Futhermore, the current efficiency for H 2 O 2 generation at C@NF4 is enhanced by 12 times compared to that at NF, and consequently the energy consumption during DMP degradation at C@NF4 is obvious lower than that at both NF cathode and graphite GDE. From the obtained results it can be deduced that C@NF4 is promising to be an attractive alternative E-Fenton cathode for removing organic pollutants in wastewater

Feasibility study of a solar reactor for phenol treatment by the Photo-Fenton process in aqueous solution

Energy Technology Data Exchange (ETDEWEB)

Nogueira, K.R.B.; Nascimento, C.A.O.; Guardani, R.; Teixeira, A.C.S.C. [University of Sao Paulo, Chemical Engineering Department, Sao Paulo (Brazil)

2012-12-15

Solar reactors can be attractive in photodegradation processes due to lower electrical energy demand. The performance of a solar reactor for two flow configurations, i.e., plug flow and mixed flow, is compared based on experimental results with a pilot-scale solar reactor. Aqueous solutions of phenol were used as a model for industrial wastewater containing organic contaminants. Batch experiments were carried out under clear sky, resulting in removal rates in the range of 96-100 %. The dissolved organic carbon removal rate was simulated by an empirical model based on neural networks, which was adjusted to the experimental data, resulting in a correlation coefficient of 0.9856. This approach enabled to estimate effects of process variables which could not be evaluated from the experiments. Simulations with different reactor configurations indicated relevant aspects for the design of solar reactors. (Copyright copyright 2012 WILEY-VCH Verlag GmbH and Co. KGaA, Weinheim)

Removal of copper (II) from aqueous solutions by flotation using polyaluminum chloride silicate (PAX-XL60 S) as coagulant and carbonate ion as activator.

Science.gov (United States)

Ghazy, S E; Mahmoud, I A; Ragab, A H

2006-01-01

Flotation is a separation technology for removing toxic heavy metal ions from aqueous solutions. Here a simple and rapid flotation procedure is presented for the removal of copper(II) from aqueous solutions. It is based on the use of polyaluminum chloride silicate (PAX-XL60 S) as coagulant and flocculent, carbonate ion as activator and oleic acid (HOL) as surfactant. Both ion and precipitate flotation are included depending on the solution pH. Ion and precipitate flotation in the aqueous HOL-PAX-XL60 S-Cu2+-CO3(2-) system gave powerful preferential removal of Cu2+ (F -100%) over the HOL-PAX-XL60 S-Cu2+ system containing no CO3(2+) ion (F approximately 86%). The role of CO3(2-) ion is also evident from decreasing the dose of PAX-XL60 S from 700 mg l(-1) to 200 mg l(-1). The other parameters, influencing the flotation process, namely: metal ion, surfactant and PAX-XL60 S concentrations, ionic strength, temperature and foreign ions were examined. Moreover, the procedure was successfully applied to recover Cu2+ ions from different volumes up to 11 and from natural water samples.

Analysis of raw AIS spectrum recordings from a LEO satellite

DEFF Research Database (Denmark)

Larsen, Jesper Abildgaard; Mortensen, Hans Peter

2014-01-01

The AAUSAT3 satellite is a 1U cubesat, which has been developed by students at Aalborg University, Denmark in collaboration with the Danish Maritime Authority. The satellite was launched in February 2013 on a mission to monitor ships from space using their AIS broadcast signals as an indication...... of position. The SDR receiver developed to listen for these AIS signals also allows for sampling and storing of the raw intermediate frequency spectrum, which has been used in order to map channel utilization over the areas of interest for the mission, which is mainly the arctic regions. The SDR based...... receiver used onboard the satellite is using a single chip front-end solution, which down converts the AIS signal located around 162 MHz into an intermediate frequency, with a up to 200 kHz bandwidth. This I/F signal is sampled with a 750 kSPS A/D converter and further processed by an Analog Devices DSP...

l-Tryptophan-capped carbon quantum dots for the sensitive and selective fluorescence detection of mercury ion in aqueous solution

Energy Technology Data Exchange (ETDEWEB)

Wan, Xuejuan; Li, Shifeng; Zhuang, Lulu; Tang, Jiaoning, E-mail: tjn@szu.edu.cn [Shenzhen University, Shenzhen Key Laboratory of Special Functional Materials, College of Materials Science and Engineering (China)

2016-07-15

l-Tryptophan-capped carbon quantum dots (l-CQDs) were facilely synthesized through “green” methodology, and the obtained material was utilized as a sensitive and selective fluorescence sensor for mercury ion (Hg{sup 2+}) in pure aqueous solutions. Carboxyl-functionalized CQDs were first green synthesized by a one-step hydrothermal route, and l-tryptophan was then attached to CQDs via direct surface condensation reaction in aqueous solution at room temperature. The as-synthesized l-CQDs had an average size of ca. 5 nm with a good dispersity in water, and exhibited a favorable selectivity for Hg{sup 2+} ions over a range of other common metal cations in aqueous solution (10 mM PBS buffer, pH 6.0). Upon the addition of Hg{sup 2+}, a complete fluorescence quenching (ON–OFF switching) of l-CQDs was evident from the fluorescence titration experiment, and the fluorescence detection limit of Hg{sup 2+} was calculated to be 11 nM, which indicated that the obtained environmentally friendly l-CQDs had sensitive detection capacity for Hg{sup 2+} in aqueous solution.

Suzuki-Miyaura cross-coupling reactions in aqueous media: green and sustainable syntheses of biaryls.

Science.gov (United States)

Polshettiwar, Vivek; Decottignies, Audrey; Len, Christophe; Fihri, Aziz

2010-05-25

Carbon-carbon cross-coupling reactions are among the most important processes in organic chemistry, and Suzuki-Miyaura reactions are among the most widely used protocols for the formation of carbon-carbon bonds. These reactions are generally catalyzed by soluble palladium complexes with various ligands. However, the use of toxic organic solvents remains a scientific challenge and an aspect of economical and ecological relevance. This Review will summarize various recently developed significant methods by which the Suzuki-Miyaura coupling was conducted in aqueous media, and analyzes if they are "real green" protocols.

Functional polyaniline/multiwalled carbon nanotube composite as an efficient adsorbent material for removing pharmaceuticals from aqueous media.

Science.gov (United States)

Dutra, Flávia Viana Avelar; Pires, Bruna Carneiro; Nascimento, Tienne Aparecida; Borges, Keyller Bastos

2018-09-01

The composite polyaniline/multiwalled carbon nanotube (PAni/MWCNT, 1:0.1 w/w) was developed with the intention of binding the adsorbent properties of two materials and using it to adsorb pharmaceuticals from aqueous media. PAni/MWCNT was characterized by scanning electron microscopy, thermogravimetry, infrared spectroscopy, pH at the point of zero charge, and the effect on the surface wettability of the material. As proof of concept, adsorption studies were carried out using meloxicam (MLX) as the pharmaceutical and it was evaluated as a function of pH, temperature, ionic strength, contact time and variation in concentration. Kinetics and isothermal models were applied to evaluate the mechanism of the adsorption process. The best MLX adsorption result was at pH 2 with 6 min of contact with PAni/MWCNT. The kinetics models that fitted the experimental data were pseudo-second order and Elovich and the kinetics model was the dual-site Langmuir-Freundlich. Both models suggest that the adsorption occurs by the chemical nature of the surface and in the pores of the energetically heterogeneous composite. The PAni/MWCNT presented an adsorption capacity of 221.2 mg g -1 , a very good value when compared with the literature and can be used to remove pharmaceuticals from aqueous environments. Copyright © 2018 Elsevier Ltd. All rights reserved.

Synthesized and characterization of AI and Gd substitute ferrite for microwave

International Nuclear Information System (INIS)

Sudjono, Hans K.; Muljadi; Soepriyanto, Syony

2000-01-01

Ferrite for microwave components has been synthesized from garnet ceramics (YIG)substituted by AI and Gd. Magnetic permeability and magnetic polarization changes according to the AI 3+ ion addition. XRD is performed to determined the sintering products at various temperatures. For some samples the magnetic property and performance in microwave region was tested. The testing is conducted in the form of completely assembled circulator which gives data on isolation, insertion loss when microwave circuit analyzer was employed. Due to high level of porosity insertion lost is still to large, improved process is necessary

Photoreduction of carbon dioxide and water into formaldehyde and methanol on semiconductor materials

Energy Technology Data Exchange (ETDEWEB)

Aurian-Blajeni, B; Halmann, M; Manassen, J

1980-01-01

Heterogeneous photoassisted reduction of aqueous carbon dioxide was achieved using semiconductor powders, with either high-pressure Hg-lamps or sunlight as energy sources. The products were methanol, formaldehyde and methane. The reaction was carried out either as a gas-solid process, by passing carbon dioxide and water vapor over illuminated semiconductor surfaces, or as a liquid-solid reaction, by illuminating aqueous suspensions of semiconductor powders through which carbon dioxide was bubbled. Best results, under illumination by Hg-lamps, were obtained with aqueous suspensions of strontium titanate, SrTiO3, tungsten oxide, WO3, and titanium oxide, TiO2, resulting in absorbed energy conversion efficiencies of 6, 5.9 and 1.2 per cent, respectively.

AI based HealthCare Platform for Real Time, Predictive and Prescriptive Analytics using Reactive Programming

Science.gov (United States)

Kaur, Jagreet; Singh Mann, Kulwinder, Dr.

2018-01-01

AI in Healthcare needed to bring real, actionable insights and Individualized insights in real time for patients and Doctors to support treatment decisions., We need a Patient Centred Platform for integrating EHR Data, Patient Data, Prescriptions, Monitoring, Clinical research and Data. This paper proposes a generic architecture for enabling AI based healthcare analytics Platform by using open sources Technologies Apache beam, Apache Flink Apache Spark, Apache NiFi, Kafka, Tachyon, Gluster FS, NoSQL- Elasticsearch, Cassandra. This paper will show the importance of applying AI based predictive and prescriptive analytics techniques in Health sector. The system will be able to extract useful knowledge that helps in decision making and medical monitoring in real-time through an intelligent process analysis and big data processing.

Adolescent idiopathic scoliosis (AIS, environment, exposome and epigenetics: a molecular perspective of postnatal normal spinal growth and the etiopathogenesis of AIS with consideration of a network approach and possible implications for medical therapy

Directory of Open Access Journals (Sweden)

Burwell R Geoffrey

2011-12-01

Full Text Available Abstract Genetic factors are believed to play an important role in the etiology of adolescent idiopathic scoliosis (AIS. Discordant findings for monozygotic (MZ twins with AIS show that environmental factors including different intrauterine environments are important in etiology, but what these environmental factors may be is unknown. Recent evidence for common chronic non-communicable diseases suggests epigenetic differences may underlie MZ twin discordance, and be the link between environmental factors and phenotypic differences. DNA methylation is one important epigenetic mechanism operating at the interface between genome and environment to regulate phenotypic plasticity with a complex regulation across the genome during the first decade of life. The word exposome refers to the totality of environmental exposures from conception onwards, comprising factors in external and internal environments. The word exposome is used here also in relation to physiologic and etiopathogenetic factors that affect normal spinal growth and may induce the deformity of AIS. In normal postnatal spinal growth we propose a new term and concept, physiologic growth-plate exposome for the normal processes particularly of the internal environments that may have epigenetic effects on growth plates of vertebrae. In AIS, we propose a new term and concept pathophysiologic scoliogenic exposome for the abnormal processes in molecular pathways particularly of the internal environment currently expressed as etiopathogenetic hypotheses; these are suggested to have deforming effects on the growth plates of vertebrae at cell, tissue, structure and/or organ levels that are considered to be epigenetic. New research is required for chromatin modifications including DNA methylation in AIS subjects and vertebral growth plates excised at surgery. In addition, consideration is needed for a possible network approach to etiopathogenesis by constructing AIS diseasomes. These approaches may

Preparation of Activated and Non-Activated Carbon from Conocarpus Pruning Waste as Low-Cost Adsorbent for Removal of Heavy Metal Ions from Aqueous Solution

Directory of Open Access Journals (Sweden)

Ahmed H. El-Naggar

2015-12-01

Full Text Available Conocarpus pruning waste, an agricultural byproduct, was converted into low-cost activated and non-activated carbons and used for the remediation of Cd2+, Cu2+, and Pb2+ from aqueous solutions. The carbonization was carried out at 400 °C, while the activation was carried out in the presence of KOH and ZnCl2. Batch single-solute and multi-solute equilibrium and kinetic experiments were carried out to determine the adsorption capacities of the prepared activated and non-activated carbons, and these were further compared with commercially available activated carbon. The results showed that KOH-activated carbon (CK outperformed the other activated and non-activated carbons in terms of adsorption efficiency. CK removed >50% of the applied Cd2+ and Cu2+ and 100% of Pb2+ at the initial concentration of 40 mg L-1. Interestingly, the performance of Conocarpus-derived non-activated carbon was better than that of the commercial activated carbon, as observed from the Langmuir maximum adsorption capacities of 65.61, 66.12, and 223.05 µmol g-1 for Cd2+, Cu2+, and Pb2+, respectively. The Pb2+ was the metal most easily removed from aqueous solution because of its large ionic radius. The kinetic dynamics were well described by the pseudo-second order and Elovich models.

Influence of activated carbon surface acidity on adsorption of heavy metal ions and aromatics from aqueous solution

International Nuclear Information System (INIS)

Sato, Sanae; Yoshihara, Kazuya; Moriyama, Koji; Machida, Motoi; Tatsumoto, Hideki

2007-01-01

Adsorption of toxic heavy metal ions and aromatic compounds onto activated carbons of various amount of surface C-O complexes were examined to study the optimum surface conditions for adsorption in aqueous phase. Cadmium(II) and zinc(II) were used as heavy metal ions, and phenol and nitrobenzene as aromatic compounds, respectively. Activated carbon was de-ashed followed by oxidation with nitric acid, and then it was stepwise out-gassed in helium flow up to 1273 K to gradually remove C-O complexes introduced by the oxidation. The oxidized activated carbon exhibited superior adsorption for heavy metal ions but poor performance for aromatic compounds. Both heavy metal ions and aromatics can be removed to much extent by the out-gassed activated carbon at 1273 K. Removing C-O complexes, the adsorption mechanisms would be switched from ion exchange to Cπ-cation interaction for the heavy metals adsorption, and from some kind of oxygen-aromatics interaction to π-π dispersion for the aromatics

T'ai Chi

Science.gov (United States)

... are different styles of t'ai chi, including: Chen style Hao (or Wu Shi) style Hu Lei ... medical advice, diagnoses, and treatment, consult your doctor. © 1995- The Nemours Foundation. All rights reserved. Images provided ...

Optimization of process parameters during carbonization for improved carbon fibre strength

Science.gov (United States)

Köhler, T.; Pursche, F.; Burscheidt, P.; Seide, G.; Gries, T.

2017-10-01

Based on their extraordinary properties, carbon fibres nowadays play a significant role in modern industries. In the last years carbon fibres are increasingly used for lightweight constructions in the energy or the transportation industry. However, a bigger market penetration of carbon fibres is still hindered by high prices (~ 22 /kg) [3]. One crucial step in carbon fibre production is the process of carbonization of stabilized fibres. However, the cause effect relationships of carbonization are nowadays not fully understood. Therefore, the main goal of this research work is the quantification of the cause-effect relationships of process parameters like temperature and residence time on carbon fibre strength.

Adaptive game AI with dynamic scripting

NARCIS (Netherlands)

Spronck, P.; Ponsen, M.J.V.; Sprinkhuizen-Kuyper, I.G.; Postma, E.O.

2006-01-01

Online learning in commercial computer games allows computer-controlled opponents to adapt to the way the game is being played. As such it provides a mechanism to deal with weaknesses in the game AI, and to respond to changes in human player tactics.We argue that online learning of game AI should

Core-shell N-doped active carbon fiber@graphene composites for aqueous symmetric supercapacitors with high-energy and high-power density

Science.gov (United States)

Xie, Qinxing; Bao, Rongrong; Xie, Chao; Zheng, Anran; Wu, Shihua; Zhang, Yufeng; Zhang, Renwei; Zhao, Peng

2016-06-01

Graphene wrapped nitrogen-doped active carbon fibers (ACF@GR) of a core-shell structure were successfully prepared by a simple dip-coating method using natural silk as template. Compared to pure silk active carbon, the as-prepared ACF@GR composites exhibit high specific surface area in a range of 1628-2035 m2 g-1, as well as superior energy storage capability, an extremely high single-electrode capacitance of 552.8 F g-1 was achieved at a current density of 0.1 A g-1 in 6 M KOH aqueous electrolyte. The assembled aqueous symmetric supercapacitors are capable of deliver both high energy density and high power density, for instance, 17.1 Wh kg-1 at a power density of 50.0 W kg-1, and 12.2 Wh kg-1 at 4.7 kW kg-1 with a retention rate of 71.3% for ACF@GR1-based supercapacitor.

Batch sorption dynamics and equilibrium for the removal of lead ions from aqueous phase using activated carbon developed from coffee residue activated with zinc chloride.

Science.gov (United States)

Boudrahem, F; Aissani-Benissad, F; Aït-Amar, H

2009-07-01

Lignocellulosic materials are good precursors for the production of activated carbon. In this work, coffee residue has been used as raw material in the preparation of powder activated carbon by the method of chemical activation with zinc chloride for the sorption of Pb(II) from dilute aqueous solutions. The influence of impregnation ratio (ZnCl2/coffee residue) on the physical and chemical properties of the prepared carbons was studied in order to optimize this parameter. The optimum experimental condition for preparing predominantly microporous activated carbons with high pore surface area (890 m2/g) and micropore volume (0.772 cm3/g) is an impregnation ratio of 100%. The developed activated carbon shows substantial capability to sorb lead(II) ions from aqueous solutions and for relative impregnation ratios of 75 and 100%, the maximum uptake is practically the same. Thus, 75% represents the optimal impregnation ratio. Batch experiments were conducted to study the effects of the main parameters such as contact time, initial concentration of Pb(II), solution pH, ionic strength and temperature. The maximum uptake of lead(II) at 25 degrees C was about 63 mg/g of adsorbent at pH 5.8, initial Pb(II) concentration of 10 mg/L, agitation speed of 200 rpm and ionic strength of 0.005 M. The kinetic data were fitted to the models of pseudo-first order and pseudo-second order, and follow closely the pseudo-second order model. Equilibrium sorption isotherms of Pb(II) were analyzed by the Langmuir, Freundlich and Temkin isotherm models. The Freundlich model gives a better fit than the others. Results from this study suggest that activated carbon produced from coffee residue is an effective adsorbent for the removal of lead from aqueous solutions and that ZnCl2 is a suitable activating agent for the preparation of high-porosity carbons.

Modification process optimization, characterization and adsorption property of granular fir-based activated carbon

Energy Technology Data Exchange (ETDEWEB)

Chen, Congjin, E-mail: gxdxccj@163.com [School of Chemistry and Chemical Engineering, Guangxi University, Nanning 530004 (China); Guangxi Key Laboratory of Petrochemical Resource Processing and Process Intensification Technology, Guangxi University, Nanning 530004 (China); Li, Xin [School of Chemistry and Chemical Engineering, Guangxi University, Nanning 530004 (China); Tong, Zhangfa [School of Chemistry and Chemical Engineering, Guangxi University, Nanning 530004 (China); Guangxi Key Laboratory of Petrochemical Resource Processing and Process Intensification Technology, Guangxi University, Nanning 530004 (China); Li, Yue [School of Chemistry and Chemical Engineering, Guangxi University, Nanning 530004 (China); Li, Mingfei [Beijing Key Laboratory of Lignocellulosic Chemistry, Beijing Forestry University, Beijing 100083 (China)

2014-10-01

Highlights: • Granular fir-based activated carbon (GFAC) was modified with H{sub 2}O{sub 2}. • Orthogonal array design method was used to optimize the modification process. • Optimized parameters were: aqueous H{sub 2}O{sub 2} concentration 1.0 mol l{sup −1}, modification temperature and time 30.0 °C and 4.0 h. • Adsorption capacity of the modified GFAC increased by 500.0% (caramel), 59.7% (methylene blue), 32.5% (phenol), and 15.1% (I{sub 2}). • The pore structure parameters and surface oxygen groups changed in the modified GFAC. - Abstract: Granular fir-based activated carbon (GFAC) was modified with H{sub 2}O{sub 2}, and orthogonal array experimental design method was used to optimize the process. The properties of the original and modified GFAC were characterized by N{sub 2} adsorption–desorption isotherms, Brunauer–Emmett–Teller (BET) equation, Barett–Joyner–Halenda (BJH) equation, field emission scanning electron microscopy (FESEM), and Fourier transform infrared spectroscopy (FT-IR) analysis, etc. When 10.00 g of GFAC with particle size of 0.25–0.85 mm was modified by 150.0 ml of aqueous H{sub 2}O{sub 2} solution, the optimized conditions were found to be as follows: aqueous H{sub 2}O{sub 2} solution concentration 1.0 mol·l{sup −1}, modification temperature 30.0 °C, modification time 4.0 h. Modified under the optimized conditions, decolonization of caramel, methylene blue adsorption, phenol adsorption and iodine number of the modified GFAC increased by 500.0%, 59.7%, 32.5%, and 15.1%, respectively. The original and optimally modified GFAC exhibited adsorption isotherms of hybrid Type I–IV isotherms with H4 hysteresis. BET surface area, micropore area, total pore volume, micropore volume, and microporosity of the modified GFAC increased by 7.33%, 11.25%, 3.89%, 14.23%, 9.91%, respectively. Whereas the average pore width decreased by 3.16%. In addition, the amount of surface oxygen groups (such as carbonyl or carboxyl) increased

Ru decorated carbon nanotubes - a promising catalyst for reforming bio-based acetic acid in the aqueous phase

NARCIS (Netherlands)

de Vlieger, Dennis; Lefferts, Leonardus; Seshan, Kulathuiyer

2014-01-01

Catalytic reforming of biomass derived waste streams in the aqueous phase is a promising process for the production of sustainable hydrogen. Acetic acid will be a major component (up to 20 wt%) in many anticipated gasification feed streams (e.g. the aqueous fraction of pyrolysis oil). Conventional

AIS as key component in modern vessel traffic management and information systems

Energy Technology Data Exchange (ETDEWEB)

Lamers, W. [DaimlerChrysler Aerospace AG (DASA), Ulm (Germany)

1999-07-01

The objective of this paper is to provide information in respect to universal shipborne identification system (UAIS) as main sensor in various vessel traffic applications. The presented paper will give general information concerning AIS functionality and the standardisation process. Based on experience from recent projects and various IALA working group activities, a typical future VTMIS architectures is also presented being based on AIS as key sensor. The required key performance of AIS associated with the HW components will be described. The results from European technology study Indris are presented and discussed. Finally, a summary and conclusion from the presented material will complete the technical paper. The elaboration of this presentation has been carried out as a joint task between Mr. Andre van Berg, MDS Suedafrika und Mr. Walter Lamers, DASA Ulm. (orig.)

Carbon Mineralization by Aqueous Precipitation for Beneficial Use of CO2 from Flue Gas. Phase I. Final Topical Report

International Nuclear Information System (INIS)

Constantz, Brent; Seeker, Randy; Devenney, Martin

2010-01-01

Calera's innovative Mineralization via Aqueous Precipitation (MAP) technology for the capture and conversion of CO 2 to useful materials for use in the built environment was further developed and proven in the Phase 1 Department of Energy Grant. The process was scaled to 300 gallon batch reactors and subsequently to Pilot Plant scale for the continuous production of product with the production of reactive calcium carbonate material that was evaluated as a supplementary cementitious material (SCM). The Calera SCM(trademark) was evaluated as a 20% replacement for ordinary portland cement and demonstrated to meet the industry specification ASTM 1157 which is a standard performance specification for hydraulic cement. The performance of the 20% replacement material was comparable to the 100% ordinary portland cement control in terms of compressive strength and workability as measured by a variety of ASTM standard tests. In addition to the performance metrics, detailed characterization of the Calera SCM was performed using advanced analytical techniques to better understand the material interaction with the phases of ordinary portland cement. X-ray synchrotron diffraction studies at the Advanced Photon Source in Argonne National Lab confirmed the presence of an amorphous phase(s) in addition to the crystalline calcium carbonate phases in the reactive carbonate material. The presence of carboaluminate phases as a result of the interaction of the reactive carbonate materials with ordinary portland cement was also confirmed. A Life Cycle Assessment was completed for several cases based on different Calera process configurations and compared against the life cycle of ordinary portland cement. In addition to the materials development efforts, the Calera technology for the production of product using an innovative building materials demonstration plant was developed beyond conceptual engineering to a detailed design with a construction schedule and cost estimate.

Method for aqueous gold thiosulfate extraction using copper-cyanide pretreated carbon adsorption

Science.gov (United States)

Young, Courtney; Melashvili, Mariam; Gow, Nicholas V

2013-08-06

A gold thiosulfate leaching process uses carbon to remove gold from the leach liquor. The activated carbon is pretreated with copper cyanide. A copper (on the carbon) to gold (in solution) ratio of at least 1.5 optimizes gold recovery from solution. To recover the gold from the carbon, conventional elution technology works but is dependent on the copper to gold ratio on the carbon.

Nature of Reduced Carbon in Martian Meteorites

Science.gov (United States)

Gibson, Everett K., Jr.; McKay, D. S.; Thomas-Keprta, K. L.; Clemett, S. J.; White, L. M.

2012-01-01

Martian meteorites provide important information on the nature of reduced carbon components present on Mars throughout its history. The first in situ analyses for carbon on the surface of Mars by the Viking landers yielded disappointing results. With the recognition of Martian meteorites on Earth, investigations have shown carbon-bearing phases exist on Mars. Studies have yielded presence of reduced carbon, carbonates and inferred graphitic carbon phases. Samples ranging in age from the first approximately 4 Ga of Mars history [e.g. ALH84001] to nakhlites with a crystallization age of 1.3 Ga [e.g. Nakhla] with aqueous alteration processes occurring 0.5-0.7 Ga after crystallizaton. Shergottites demonstrate formation ages around 165-500 Ma with younger aqueous alterations events. Only a limited number of the Martian meteorites do not show evidence of significance terrestrial alterations. Selected areas within ALH84001, Nakhla, Yamato 000593 and possibly Tissint are suitable for study of their indigenous reduced carbon bearing phases. Nakhla possesses discrete, well-defined carbonaceous phases present within iddingsite alteration zones. Based upon both isotopic measurements and analysis of Nakhla's organic phases the presence of pre-terrestrial organics is now recognized. The reduced carbon-bearing phases appear to have been deposited during preterrestrial aqueous alteration events that produced clays. In addition, the microcrystalline layers of Nakhla's iddingsite have discrete units of salt crystals suggestive of evaporation processes. While we can only speculate on the origin of these unique carbonaceous structures, we note that the significance of such observations is that it may allow us to understand the role of Martian carbon as seen in the Martian meteorites with obvious implications for astrobiology and the pre-biotic evolution of Mars. In any case, our observations strongly suggest that reduced organic carbon exists as micrometer- size, discrete structures

Risk Reducing Effect of AIS Implementation on Collision Risk

DEFF Research Database (Denmark)

Lützen, Marie; Friis-Hansen, Peter

2003-01-01

AIS (Automatic Identification System) is a transponder system developed for sea traffic purposes. The system sends and receives important ship information and other safety-related information between other ships and shore-based AIS stations. The implementation of AIS has now been initiated and......, as a result, the community will undoubtedly observe an increase in navigational safety. However, to the authors? knowledge, no study has so far rigorously quantified the risk reducing effect of using AIS as an integrated part of the navigational system. The objective of this study is to fill this gap....... The risk reducing effect of AIS is quantified by building a Bayesian network facilitating an evaluation of the effect of AIS on the navigational officer?s reaction ability in a potential, critical collision situation. The time-dependent change in the risk reducing effect on ship collisions is analysed...

Molecular dynamics investigation of carbon nanotube junctions in non-aqueous solutions

KAUST Repository

Gkionis, Konstantinos

2014-07-23

The properties of liquids in a confined environment are known to differ from those in the bulk. Extending this knowledge to geometries defined by two metallic layers in contact with the ends of a carbon nanotube is important for describing a large class of nanodevices that operate in non-aqueous environments. Here we report a series of classical molecular dynamics simulations for gold-electrode junctions in acetone, cyclohexane and N,N-dimethylformamide solutions and analyze the structure and the dynamics of the solvents in different regions of the nanojunction. The presence of the nanotube has little effect on the ordering of the solvents along its axis, while in the transversal direction deviations are observed. Importantly, the orientational dynamics of the solvents at the electrode-nanotube interface differ dramatically from that found when only the electrodes are present.

Adsorption of a textile dye from aqueous solutions by carbon nanotubes

Energy Technology Data Exchange (ETDEWEB)

Machado, Fernando M.; Bergmann, Carlos P., E-mail: fernando.machado@hotmail.com.br [Universidade Federal do Rio Grande do Sul (UFRS), Porto Alegre, RS (Brazil). Dept. de Materiais; Lima, Eder C.; Adebayo, Matthew A. [Universidade Federal do Rio Grande do Sul (UFRS), Porto Alegre, RS (Brazil). Inst. de Quimica; Fagan, Solange B. [Centro Universitario Franciscano (UNIFRA), Santa Maria, RS (Brazil). Area de Ciencias Tecnologicas

2014-08-15

Multi-walled and single-walled carbon nanotubes were used as adsorbents for the removal of Reactive Blue 4 textile dye from aqueous solutions. The adsorbents were characterised using Raman spectroscopy, N{sub 2} adsorption/desorption isotherms and scanning and transmission electron microscopy. The effects of pH, agitation time and temperature on adsorption capacity were studied. In the acidic pH region, the adsorption of the dye was favourable using both adsorbents. The contact time to obtain equilibrium isotherms at 298-323 K was fixed at 4 hours for both adsorbents. For Reactive Blue 4 dye, Liu isotherm model gave the best fit for the equilibrium data. The maximum sorption capacity for adsorption of the dye occurred at 323 K, attaining values of 502.5 and 567.7 mg g{sup -1} for MWCNT and SWCNT, respectively. (author)

Advanced LiTi2(PO4)3@N-doped carbon anode for aqueous lithium ion batteries

International Nuclear Information System (INIS)

He, Zhangxing; Jiang, Yingqiao; Meng, Wei; Zhu, Jing; Liu, Yang; Dai, Lei; Wang, Ling

2016-01-01

Highlights: • LiTi 2 (PO 4 ) 3 @N-doped carbon anode was prepared by in-situ coating approach for aqueous lithium ion batteries. • The well-proportioned N-doped carbon layer and loose nanoporous structure was obtained using urea as nitrogen source and pore former. • LiTi 2 (PO 4 ) 3 @N-doped carbon demonstrates excellent rate performance and good cycling stability. - Abstract: In this paper, LiTi 2 (PO 4 ) 3 @N-doped carbon anode has been synthesized by in situ carbon coating approach. The well-proportioned N-doped carbon layer and loose nanoporous structure was obtained by using urea as nitrogen source and pore former. LiTi 2 (PO 4 ) 3 @N-doped carbon as anode demonstrates much better rate capability than LiTi 2 (PO 4 ) 3 @carbon in ALIBs. The optimized anode delivers the discharge capacity of 93.7 mAh g −1 and 74.2 mAh g −1 at rates of 10C and 20C, 22.5 mAh g −1 and 50.0 mAh g −1 larger than that of LiTi 2 (PO 4 ) 3 @carbon. Moreover, LiTi 2 (PO 4 ) 3 @N-doped carbon exhibits excellent cycling performance with capacity retention of 84.3% at 5C after 1000 cycles. As verified, the well-proportioned N-doped carbon layer could reduce charge transfer resistance and improve electrical conductivity. The loose nanoporous structure could shorten pathway and facilitate diffusion for Li ion. Therefore, LiTi 2 (PO 4 ) 3 @N-doped carbon gets the superior electrochemical properties benefiting from those two characteristics.

JGOMAS: New Approach to AI Teaching

Science.gov (United States)

Barella, A.; Valero, S.; Carrascosa, C.

2009-01-01

This paper presents a new environment for teaching practical work in AI subjects. The main purpose of this environment is to make AI techniques more appealing to students and to facilitate the use of the toolkits which are currently widely used in research and development. This new environment has a toolkit for developing and executing agents,…

Degradation of di-2-ethylhexyl phthalate in aqueous solution by advanced oxidation process

Directory of Open Access Journals (Sweden)

Maryam Zarean

2015-01-01

Conclusion: It could be found that the UV/O3 process is a method for DEHP degradation in aqueous solution and may be recommended as a supplement with other processes for treatment of solutions containing low DEHP concentrations.

Separation of Th from aqueous solutions using activated carbon

International Nuclear Information System (INIS)

Kutahyali, C.; Eral, M.

2005-01-01

Since the last century, thorium has been extensively used in a variety of applications. These applications produce various gaseous, liquid and solid wastes containing isotopes of thorium. Liquid wastes are freed into the surface or the underground waters of mines. Solid and liquid wastes are also produced during nuclear fuel production. Direct toxicity of thorium is low due to its stability at ambient temperatures; however thorium fine powder is self-ignitable to thorium oxide. When thorium nitrate enters living organisms it is mainly localized in liver, spleen and marrow and it precipitates in a hydroxide form. Investigations concerning the removal or minimization of the thorium concentration in the waste waters are of considerable importance environmental point of view. Adsorption is an important technique in separation and purification processes. Among many types of adsorbent materials, activated carbons are the most widely used, because of their large adsorptive capacity and low cost. Activated carbons are unique adsorbents because of their extended surface area, microporous structure, high adsorption capacity and high degree of surface reactivity. Separation and purification processes based on adsorption technique are also important in nuclear industry where activated carbon is often used for the separation of metal ions from solutions, due to its selective adsorption, high radiation stability and high purity. The activated carbons used in this study were prepared by the chemical activation of acrylic fiber. The chemical composition of acrylic fiber is a copolymer of acrylonitrile-vinyl acetate is called also poliacrylonitryl fiber. The effects of carbonization conditions resulting activated carbon were examined. Precursor/activating agent (KOH and ZnCl 2 ) ratio and carbonization temperature were investigated for the preparation of adsorbent. Adsorption experiments were carried out by a batch technique. The adsorption of thorium was studied as a function of

Artificial Intelligence Safety and Cybersecurity: a Timeline of AI Failures

OpenAIRE

Yampolskiy, Roman V.; Spellchecker, M. S.

2016-01-01

In this work, we present and analyze reported failures of artificially intelligent systems and extrapolate our analysis to future AIs. We suggest that both the frequency and the seriousness of future AI failures will steadily increase. AI Safety can be improved based on ideas developed by cybersecurity experts. For narrow AIs safety failures are at the same, moderate, level of criticality as in cybersecurity, however for general AI, failures have a fundamentally different impact. A single fai...

Removal of methylene blue from aqueous solution with magnetite loaded multi-wall carbon nanotube: Kinetic, isotherm and mechanism analysis

International Nuclear Information System (INIS)

Ai, Lunhong; Zhang, Chunying; Liao, Fang; Wang, Yao; Li, Ming; Meng, Lanying; Jiang, Jing

2011-01-01

Highlights: ► M-MWCNTs were synthesized by a facile one-pot solvothermal method and used as an efficient adsorbent for removing toxic dye from aqueous solution. ► The adsorption process was characterized by kinetics and isotherm analysis. ► FTIR analysis was employed to investigate the interactions between M-MWCNTs and dye. - Abstract: In this study, we have demonstrated the efficient removal of cationic dye, methylene blue (MB), from aqueous solution with the one-pot solvothermal synthesized magnetite-loaded multi-walled carbon nanotubes (M-MWCNTs). The as-prepared M-MWCNTs were characterized by X-ray diffraction (XRD), scanning electron microscopy (SEM), and Fourier transform infrared (FTIR) spectroscopy. The effects of contact time, initial dye concentration, and solution pH on the adsorption of MB onto M-MWCNTs were systematically studied. It was shown that the MB adsorption was pH-dependent. Adsorption kinetics was best described by the pseudo-second-order model. Equilibrium data were well fitted to the Langmuir isotherm model, yielding maximum monolayer adsorption capacity of 48.06 mg g −1 . FTIR analysis suggested that the adsorption mechanism was possibly attributed to the electrostatic attraction and π–π stacking interactions between MWCNTs and MB.

Artificial Intelligence (AI) Based Tactical Guidance for Fighter Aircraft

Science.gov (United States)

McManus, John W.; Goodrich, Kenneth H.

1990-01-01

A research program investigating the use of Artificial Intelligence (AI) techniques to aid in the development of a Tactical Decision Generator (TDG) for Within Visual Range (WVR) air combat engagements is discussed. The application of AI programming and problem solving methods in the development and implementation of the Computerized Logic For Air-to-Air Warfare Simulations (CLAWS), a second generation TDG, is presented. The Knowledge-Based Systems used by CLAWS to aid in the tactical decision-making process are outlined in detail, and the results of tests to evaluate the performance of CLAWS versus a baseline TDG developed in FORTRAN to run in real-time in the Langley Differential Maneuvering Simulator (DMS), are presented. To date, these test results have shown significant performance gains with respect to the TDG baseline in one-versus-one air combat engagements, and the AI-based TDG software has proven to be much easier to modify and maintain than the baseline FORTRAN TDG programs. Alternate computing environments and programming approaches, including the use of parallel algorithms and heterogeneous computer networks are discussed, and the design and performance of a prototype concurrent TDG system are presented.

Liquid-liquid electro-organo-synthetic processes in a carbon nanofibre membrane microreactor: Triple phase boundary effects in the absence of intentionally added electrolyte

International Nuclear Information System (INIS)

Watkins, John D.; Ahn, Sunyhik D.; Taylor, James E.; Bull, Steven D.; Bulman-Page, Philip C.; Marken, Frank

2011-01-01

Graphical abstract: Display Omitted Highlights: → Amphiphilic carbon nanofiber membrane employed in electro-synthesis. → Triple phase boundary process within a carbon membrane. → Electrochemical deuteration in a liquid|liquid micro-reactor system. → Triple phase boundary reaction zone effects in electro-synthesis. - Abstract: An amphiphilic carbon nanofibre membrane electrode (ca. 50 nm fibre diameter, 50-100 μm membrane thickness) is employed as an active working electrode and separator between an aqueous electrolyte phase (with reference and counter electrode) and an immiscible organic acetonitrile phase (containing only the redox active material). Potential control is achieved with a reference and counter electrode located in the aqueous electrolyte phase, but the electrolysis is conducted in the organic acetonitrile phase in the absence of intentionally added supporting electrolyte. For the one-electron oxidation of n-butylferrocene coupled to perchlorate anion transfer from aqueous to organic phase effective electrolysis is demonstrated with an apparent mass transfer coefficient of m = 4 x 10 -5 m s -1 and electrolysis of typically 1 mg n-butylferrocene in a 100 μL volume. For the two-electron reduction of tetraethyl-ethylenetetracarboxylate the apparent mass transfer coefficient m = 4 x 10 -6 m s -1 is lower due to a less extended triple phase boundary reaction zone in the carbon nanofibre membrane. Nevertheless, effective electrolysis of up to 6 mg tetraethyl-ethylenetetracarboxylate in a 100 μL volume is demonstrated. Deuterated products are formed in the presence of D 2 O electrolyte media. The triple phase boundary dominated mechanism and future microreactor design improvements are discussed.

Error analysis of equilibrium studies for the almond shell activated carbon adsorption of Cr(VI) from aqueous solutions

International Nuclear Information System (INIS)

Demirbas, E.; Kobya, M.; Konukman, A.E.S.

2008-01-01

In this study, the preparation of activated carbon from almond shell with H 2 SO 4 activation and its ability to remove toxic hexavalent chromium from aqueous solutions are reported. The influences of several operating parameters such as pH, particle size and temperature on the adsorption capacity were investigated. Adsorption of Cr(VI) is found to be highly pH, particle size and temperature dependent. Four adsorption isotherm models namely, Langmuir, Freundlich, Tempkin and Dubinin-Radushkevich were used to analyze the equilibrium data. The Langmuir isotherm provided the best correlation for Cr(VI) onto the almond shell activated carbon (ASC). Adsorption capacity was calculated from the Langmuir isotherm as 190.3 mg/g at 323 K. Thermodynamic parameters were evaluated and the adsorption was endothermic showing monolayer adsorption of Cr(VI). Five error functions were used to treat the equilibrium data using non-linear optimization techniques for evaluating the fit of the isotherm equations. The highest correlation for the isotherm equations in this system was obtained for the Freundlich isotherm. ASC is found to be inexpensive and effective adsorbent for removal of Cr(VI) from aqueous solutions

AUSTRALIAN PINE CONES-BASED ACTIVATED CARBON FOR ADSORPTION OF COPPER IN AQUEOUS SOLUTION

Directory of Open Access Journals (Sweden)

MUSLIM A.

2017-02-01

Full Text Available The Australian Pine cones (APCs was utilised as adsorbent material by physical and chemical activation for the adsorption Cu(II in aqueous solution. FTIR and SEM analysis were conducted to obtain the active site and to characterise the surface morphology of the APCs activated carbon (APCs AC prepared through pyrolysis at 1073.15 K and alkaline activation of NaOH. The independent variables effect such as contact time, Cu(II initial concentration and the activator ratio in the ranges of 0-150 min, 84.88-370.21 mg/l and 0.2-0.6 (NaOH:APCs AC, respectively on the Cu(II adsorption capacity were investigated in the APCs activated carbon-solution (APCs ACS system with 1 g the APCs AC in 100 mL Cu(II aqueous solution with magnetic stirring at 75 rpm, room temperature of 298.15 K (± 2 K, 1 atm and pH 5 (±0.25. As the results, Cu(II adsorption capacity dramatically increased with increasing contact time and Cu(II initial concentration. The optimal Cu(II adsorption capacity of 26.71 mg/g was obtained in the APCs ACS system with 120-min contact time, 340.81 m/l initial Cu(II and 0.6 activator ratio. The kinetics study showed the Cu(II adsorption kinetics followed the pseudo-second-order kinetics with 27.03 mg/g of adsorption capacity, 0.09 g/mg.min of rate constant and 0.985-R2. In addition, the Cu(II adsorption isotherm followed the Langmuir model with 12.82 mg/g of the mono-layer adsorption capacity, 42.93 l/g of the over-all adsorption capacity and 0.954-R2.

In Situ Packaging FeFx into Sack-like Carbon Nanoreactors: A Smart Way To Make Soluble Fluorides Applicable to Aqueous Batteries.

Science.gov (United States)

Jiang, Jian; Li, Linpo; Xu, Maowen; Zhu, Jianhui; Li, Chang Ming

2016-02-17

Ferruginous materials have long attracted great interest in aqueous batteries since Fe is an earth-abundant and low toxic element. However, their practical application is severely hindered by their poor structural stability during deep cycling. To maximize their cyclability, we herein propose a simple and effective method, by in situ packaging Fe-based materials into carbon nanosacks via a facile CVD approach. To verify our strategy, we purposely choose water-soluble Fe2F5 as a study paradigm. The in situ formed Fe2F5@C nanosacks product exhibits prominent anodic performance with high electrochemical activity and capacity, obviously prolonged cyclic lifetime, and outstanding rate capabilities. Besides, by pairing with the cathode of α-Co(OH)2 nanowire arrays@carbon cloth, a full device of rechargeable aqueous batteries has been developed, capable to deliver both high specific energy and power densities (Max. values reaching up to ∼163 Wh kg(-1) and ∼14.2 kW kg(-1)), which shows great potential in practical usage. Our present work may not only demonstrate the feasibility of using soluble fluorides as anodes for aqueous batteries but also provide a smart way to upgrade cyclic behaviors of Fe-based anodes.

Carbonizing process

Energy Technology Data Exchange (ETDEWEB)

1923-11-22

In the downward distillation of coal, shale, lignite, or the like, the heat is generated by the combustion of liquid or gaseous fuel above the charge the zone of carbonization thus initiated travelling downwards through the charge. The combustible gases employed are preferably those resulting from the process but gases such as natural gas may be employed. The charge is in a moistened and pervious state the lower parts being maintained at a temperature not above 212/sup 0/F until influenced by contact with the carbonization zone and steam may be admitted to increase the yield of ammonia. The combustible gases may be supplied with insufficient air so as to impart to them a reducing effect.

High energy density supercapacitors from lignin derived submicron activated carbon fibers in aqueous electrolytes

Science.gov (United States)

Hu, Sixiao; Zhang, Sanliang; Pan, Ning; Hsieh, You-Lo

2014-12-01

Highly porous submicron activated carbon fibers (ACFs) were robustly generated from low sulfonated alkali lignin and fabricated into supercapacitors for capacitive energy storage. The hydrophilic and high specific surface ACFs exhibited large-size nanographites and good electrical conductivity to demonstrate outstanding electrochemical performance. ACFs from KOH activation, in particular, showed very high 344 F g-1 specific capacitance at low 1.8 mg cm-2 mass loading and 10 mV s-1 scan rate in aqueous electrolytes. Even at relatively high scan rate of 50 mV s-1 and mass loading of 10 mg cm-2, a decent specific capacitance of 196 F g-1 and a remarkable areal capacitance of 0.55 F cm-2 was obtained, leading to high energy density of 8.1 Wh kg-1 based on averaged electrodes mass. Furthermore, over 96% capacitance retention rates were achieved after 5000 charge/discharge cycles. Such excellent performance demonstrated great potential of lignin derived carbons for electrical energy storage.

Suzuki-Miyaura cross-coupling reactions in aqueous media: Green and sustainable syntheses of biaryls

KAUST Repository

Polshettiwar, Vivek

2010-02-28

Carbon-carbon cross-coupling reactions are among the most important processes in organic chemistry, and Suzuki-Miyaura reactions are among the most widely used protocols for the formation of carbon-carbon bonds. These reactions are generally catalyzed by soluble palladium complexes with various ligands. However, the use of toxic organic solvents remains a scientific challenge and an aspect of economical and ecological relevance. This Review will summarize various recently developed significant methods by which the Suzuki-Miyaura coupling was conducted in aqueous media, and analyzes if they are "real green" protocols. © 2010 Wiley-VCH Verlag GmbH & Co. KGaA, Weinheim.

Squeeze Casting Method Of AI-Si Alloy For Piston Material

International Nuclear Information System (INIS)

Wagiyo, H.; Dani, Muhammad; Sulistioso, G.S.; Pardede, Elman; Handayani, Ari; Teguh, Yulius S.P.P.

2001-01-01

The AI-Si alloy is an alloy used as piston material. This alloys could be as AI-Si hypereutectic alloy (Si content more than 12.5 % wt.), as AI-Si eutectic alloy (Si cuntent 12.5 % wt, and as AI-Si hypoeutectic alloy (Si content less than 12.5 % wt.). The synthesize of AI-Si alloy piston generally using the technique of gravity casting in a dies. This method is causing high porousity. By using the squeeze technique, amount ofporousity in AI-Si alloy is possibly reduced and the density of this alloy should be higher. The other factors such as alloying elements of AI-Si alloy (Mg. Cu, Zn) would increase the mechanical properties especially the hardness. The focuses of this research are the microstructure and the maximum hardness during the heat treatment of AI-Si alloy which was added by alloying elments. The result of hardness at test shows the maximum hardness at 94.7 kg/mm 2 obtained at aging temperature of 210 o C for hours with homogenous dendritic microstructure

Process for disposal of aqueous solutions containing radioactive isotopes

Science.gov (United States)

Colombo, Peter; Neilson, Jr., Robert M.; Becker, Walter W.

1979-01-01

A process for disposing of radioactive aqueous waste solutions whereby the waste solution is utilized as the water of hydration to hydrate densified powdered portland cement in a leakproof container; said waste solution being dispersed without mechanical inter-mixing in situ in said bulk cement, thereafter the hydrated cement body is impregnated with a mixture of a monomer and polymerization catalyst to form polymer throughout the cement body. The entire process being carried out while maintaining the temperature of the components during the process at a temperature below 99.degree. C. The container containing the solid polymer-impregnated body is thereafter stored at a radioactive waste storage dump such as an underground storage dump.

Process for disposal of aqueous solutions containing radioactive isotopes

International Nuclear Information System (INIS)

Colombo, P.; Neilson, R.M. Jr.; Becker, W.W.

1979-01-01

A process for disposing of radioactive aqueous waste solutions whereby the waste solution is utilized as the water of hydration to hydrate densified powdered portland cement in a leakproof container; said waste solution being dispersed without mechanical inter-mixing in situ in said bulk cement, thereafter the hydrated cement body is impregnated with a mixture of a monomer and polymerization catalyst to form polymer throughout the cement body. The entire process being carried out while maintaining the temperature of the components during the process at a temperature below 99 0 C. The container containing the solid polymer-impregnated body is thereafter stored at a radioactive waste storage dump such as an underground storage dump

Removal of 2,4-Dichlorophenolyxacetic acid (2,4-D) herbicide in the aqueous phase using modified granular activated carbon.

Science.gov (United States)

Dehghani, Mansooreh; Nasseri, Simin; Karamimanesh, Mojtaba

2014-01-10

Low cost 2,4-Dichlorophenolyxacetic acid (2,4-D) widely used in controlling broad-leafed weeds is frequently detected in water resources. The main objectives of this research were focused on evaluating the feasibility of using granular activated carbon modified with acid to remove 2,4-D from aqueous phase, determining its removal efficiency and assessing the adsorption kinetics. The present study was conducted at bench-scale method. The influence of different pH (3-9), the effect of contact time (3-90 min), the amount of adsorbent (0.1-0.4 g), and herbicide initial concentration (0.5-3 ppm) on 2,4-D removal efficiency by the granular activated carbon were investigated. Based on the data obtained in the present study, pH of 3 and contact time of 60 min is optimal for 2,4-D removal. 2,4-D reduction rate increased rapidly by the addition of the adsorbent and decreased by herbicide initial concentration (63%). The percent of 2,4-D reduction were significantly enhanced by decreasing pH and increasing the contact time. The adsorption of 2,4-D onto the granular activated carbon conformed to Langmuir and Freundlich models, but was best fitted to type II Langmuir model (R2 = 0.999). The second order kinetics was the best for the adsorption of 2,4-D by modified granular activated carbon with R2 > 0.99. Regression analysis showed that all of the variables in the process have been statistically significant effect (p granular activated carbon modified with acid is an appropriate method for reducing the herbicide in the polluted water resources.

High-Energy-Density Aqueous Magnesium-Ion Battery Based on a Carbon-Coated FeVO4 Anode and a Mg-OMS-1 Cathode.

Science.gov (United States)

Zhang, Hongyu; Ye, Ke; Zhu, Kai; Cang, Ruibai; Yan, Jun; Cheng, Kui; Wang, Guiling; Cao, Dianxue

2017-12-01

Porous FeVO 4 is prepared by hydrothermal method and further modified by coating with carbon to obtain FeVO 4 /C with a hierarchical pore structure. FeVO 4 /C is used as an anodic electrode in aqueous rechargeable magnesium-ion batteries. The FeVO 4 /C material not only has improved electrical conductivity as a result of the carbon coating layer, but also has an increased specific surface area as a result of the hierarchical pore structure, which is beneficial for magnesium-ion insertion/deinsertion. Therefore, an aqueous rechargeable magnesium-ion full battery is successfully constructed with FeVO 4 /C as the anode, Mg-OMS-1 (OMS=octahedral molecular sieves) as the cathode, and 1.0 mol L -1 MgSO 4 as the electrolyte. The discharge capacity of the Mg-OMS-1//FeVO 4 /C aqueous battery is 58.9 mAh g -1 at a current density of 100 mA g -1 ; this value is obtained by calculating the total mass of two electrodes and the capacity retention rate of this device is 97.7 % after 100 cycles, with almost 100 % coulombic efficiency, which indicates that the system has a good electrochemical reversibility. Additionally, this system can achieve a high energy density of 70.4 Wh kg -1 , which provides powerful evidence that an aqueous magnesium-ion battery is possible. © 2017 Wiley-VCH Verlag GmbH & Co. KGaA, Weinheim.

PREPARATION AND CHARACTERIZATION OF IRON THIN FILM ELECTRODEPOSED ON A VITREOUS CARBON ELECTRODE IN AQUEOUS AND ORGANIC MEDIA: A COMPARATIVE STUDY

Directory of Open Access Journals (Sweden)

A LOUNAS

2010-06-01

studied on a vitreous carbon electrode in various aqueous and organic media. The deposit of iron was studied by cyclic voltammetry; the quantity of iron deposited was determined by integration of the cathodic and anodic peaks of Fe (0 and Fe (II of the various media.

Chlorinated phenol removal from aqueous media by tea (Camellia sinensis) leaf waste tailored activated carbon

Science.gov (United States)

Joseph, C. G.; Anisuzzaman, S. M.; Daud, W. M. A. W.; Krishnaiah, D.; Ng, K. A.

2017-06-01

In this study, activated carbons (ACs) wereprepared from tea leaves by using a two-stage self-generated atmosphere method. The process was done by semi-carbonizing the precursor at 300 °C for 1 h, followed by the impregnation of the resulting char at 85 °C for 4 h and finally activation at 500 °C for 2 h. The semi-carbonised samples were impregnated with different ratios of zinc chloride (ZnCl2) and their physicochemical effect was studied. The prepared ACs underwent several aspects of both, chemical and physical characterizations, such as the percentage of yield, moisture content, ash content, pH, porosity, adsorption capacity of 2,4-dichlorophenol (2,4-DCP), surface area, porosity, morphology and surface chemistry studies. It was found that sample AC2, with an impregnation ratio of 2:1 was the best AC produced in this study. The maximum Brunauer, Emmett and Teller surface area of AC2 was found to be 695 m2/g. Langmuir, Freundlich and Temkin isotherm models were used to examine the experimental isotherms while the kinetic data was analyzed using the pseudo-first-order, pseudo-second-order and intraparticle diffusion kinetic models. The 2,4-DCP adsorption isotherm results complied well to the Langmuir isotherm for the equilibrium data while the adsorption kinetic data fitted well to the pseudo-second order model, indicating that chemisorption by valency forces via the sharing (covalent bond) or exchanging of electrons between the AC and the 2,4-DCP molecules were mainly responsible for the adsorption process. From these findings, it is concluded that tea leaves can be used as a low cost precursor for the removal of 2,4-DCP in aqueous medium.

A study on the applications of AI in finishing of additive manufacturing parts

Science.gov (United States)

Fathima Patham, K.

2017-06-01

Artificial intelligent and computer simulation are the technological powerful tools for solving complex problems in the manufacturing industries. Additive Manufacturing is one of the powerful manufacturing techniques that provide design flexibilities to the products. The products with complex shapes are directly manufactured without the need of any machining and tooling using Additive Manufacturing. However, the main drawback of the components produced using the Additive Manufacturing processes is the quality of the surfaces. This study aims to minimize the defects caused during Additive Manufacturing with the aid of Artificial Intelligence. The developed AI system has three layers, each layer is trying to eliminate or minimize the production errors. The first layer of the AI system optimizes the digitization of the 3D CAD model of the product and hence reduces the stair case errors. The second layer of the AI system optimizes the 3D printing machine parameters in order to eliminate the warping effect. The third layer of AI system helps to choose the surface finishing technique suitable for the printed component based on the Degree of Complexity of the product and the material. The efficiency of the developed AI system was examined on the functional parts such as gears.

Towards a science of integrated AI and Robotics

OpenAIRE

Rajan, Kanna; Saffiotti, Alessandro

2017-01-01

The early promise of the impact of machine intelligence did not involve the partitioning of the nascent field of Artificial Intelligence. The founders of AI envisioned the notion of embedded intelligence as being conjoined between perception, reasoning and actuation. Yet over the years the fields of AI and Robotics drifted apart. Practitioners of AI focused on problems and algorithms abstracted from the real world. Roboticists, generally with a background in mechanical and electrical engineer...

Adsorption onto activated carbons in environmental engineering: some trends in water and air treatment processes

Energy Technology Data Exchange (ETDEWEB)

Le Cloirec, P. [Ecole des Mines de Nantes, UMR CNRS 6144 GEPEA, 44 (France)

2005-07-01

Full text of publication follows: Adsorption is commonly used in environmental protection processes and particularly in water and air treatment systems. Organic pollutants in aqueous or gaseous phases are transferred and adsorbed onto porous materials. Activated carbon (powder, grains) treatment is usually carried out and filters are used to eliminate volatile organic compounds (VOC), odors or micropollutants. The main objectives of this paper are to present examples of classical or new activated carbon processes used in drinking water production, wastewater purification or in air treatment in terms of processes, performances and modeling. - Water treatment: Micropollutants such as pesticides, herbicides... are classically removed by activated carbon granular systems in drinking water treatment plants. In order to get a good water quality and to safe money, the breakthrough time has to be accurately determined. Models with mass balance and transfer equations are proposed. However, some difficulties are found especially for complex solutions to get good agreement between experimental data and calculated values. A statistical approach using neural networks is proposed to simulate breakthrough curves. Examples are presented and compared to deterministic models. In order to intensify processes, a combination of ultrafiltration and activated carbon fiber cloth (ACFC) is presented to remove the large spectra of particles and organic molecules present in water. Systems (UF/ACFC) for surface water and industrial colored wastewater are applied and performances are determined as a function of operating conditions. - Air treatment: Activated carbon grain filters are used to control VOC emissions. Due to an exothermic reaction, an increase of local temperature in the reactor is noted and some fire accidents have been reported. For safety technologies, this temperature has to be previously determined. A model is proposed to simulate the breakthrough curves and temperatures

Adsorption onto activated carbons in environmental engineering: some trends in water and air treatment processes

International Nuclear Information System (INIS)

Le Cloirec, P.

2005-01-01

Full text of publication follows: Adsorption is commonly used in environmental protection processes and particularly in water and air treatment systems. Organic pollutants in aqueous or gaseous phases are transferred and adsorbed onto porous materials. Activated carbon (powder, grains) treatment is usually carried out and filters are used to eliminate volatile organic compounds (VOC), odors or micropollutants. The main objectives of this paper are to present examples of classical or new activated carbon processes used in drinking water production, wastewater purification or in air treatment in terms of processes, performances and modeling. - Water treatment: Micropollutants such as pesticides, herbicides... are classically removed by activated carbon granular systems in drinking water treatment plants. In order to get a good water quality and to safe money, the breakthrough time has to be accurately determined. Models with mass balance and transfer equations are proposed. However, some difficulties are found especially for complex solutions to get good agreement between experimental data and calculated values. A statistical approach using neural networks is proposed to simulate breakthrough curves. Examples are presented and compared to deterministic models. In order to intensify processes, a combination of ultrafiltration and activated carbon fiber cloth (ACFC) is presented to remove the large spectra of particles and organic molecules present in water. Systems (UF/ACFC) for surface water and industrial colored wastewater are applied and performances are determined as a function of operating conditions. - Air treatment: Activated carbon grain filters are used to control VOC emissions. Due to an exothermic reaction, an increase of local temperature in the reactor is noted and some fire accidents have been reported. For safety technologies, this temperature has to be previously determined. A model is proposed to simulate the breakthrough curves and temperatures

Mineral Carbonation Potential of CO2 from Natural and Industrial-based Alkalinity Sources

Science.gov (United States)

Wilcox, J.; Kirchofer, A.

2014-12-01

Mineral carbonation is a Carbon Capture and Storage (CSS) technology where gaseous CO2 is reacted with alkaline materials (such as silicate minerals and alkaline industrial wastes) and converted into stable and environmentally benign carbonate minerals (Metz et al., 2005). Here, we present a holistic, transparent life cycle assessment model of aqueous mineral carbonation built using a hybrid process model and economic input-output life cycle assessment approach. We compared the energy efficiency and the net CO2 storage potential of various mineral carbonation processes based on different feedstock material and process schemes on a consistent basis by determining the energy and material balance of each implementation (Kirchofer et al., 2011). In particular, we evaluated the net CO2 storage potential of aqueous mineral carbonation for serpentine, olivine, cement kiln dust, fly ash, and steel slag across a range of reaction conditions and process parameters. A preliminary systematic investigation of the tradeoffs inherent in mineral carbonation processes was conducted and guidelines for the optimization of the life-cycle energy efficiency are provided. The life-cycle assessment of aqueous mineral carbonation suggests that a variety of alkalinity sources and process configurations are capable of net CO2 reductions. The maximum carbonation efficiency, defined as mass percent of CO2 mitigated per CO2 input, was 83% for CKD at ambient temperature and pressure conditions. In order of decreasing efficiency, the maximum carbonation efficiencies for the other alkalinity sources investigated were: olivine, 66%; SS, 64%; FA, 36%; and serpentine, 13%. For natural alkalinity sources, availability is estimated based on U.S. production rates of a) lime (18 Mt/yr) or b) sand and gravel (760 Mt/yr) (USGS, 2011). The low estimate assumes the maximum sequestration efficiency of the alkalinity source obtained in the current work and the high estimate assumes a sequestration efficiency

Guidelines for the scale-up of an aqueous ceramic process: a case study of statistical process control

OpenAIRE

Mortara, L.; Alcock, Jeffrey R.

2011-01-01

Process-scale up is the change from a feasibility study in a laboratory to a full-scale prototype production process. It is an important issue for the ceramics industry, but has been the subject of relatively little systematic research. This paper will show how certain manufacturing concepts used in a number of industries - can be applied to the scale up of a feasibility study level, aqueous tape casting process. In particular, it examines the elements of process standardisa...

Processing and Structure of Carbon Nanofiber Paper

Directory of Open Access Journals (Sweden)

Zhongfu Zhao

2009-01-01

Full Text Available A unique concept of making nanocomposites from carbon nanofiber paper was explored in this study. The essential element of this method was to design and manufacture carbon nanofiber paper with well-controlled and optimized network structure of carbon nanofibers. In this study, carbon nanofiber paper was prepared under various processing conditions, including different types of carbon nanofibers, solvents, dispersants, and acid treatment. The morphologies of carbon nanofibers within the nanofiber paper were characterized with scanning electron microscopy (SEM. In addition, the bulk densities of carbon nanofiber papers were measured. It was found that the densities and network structures of carbon nanofiber paper correlated to the dispersion quality of carbon nanofibers within the paper, which was significantly affected by papermaking process conditions.

Thermodynamics of calcium-isotope-exchange reactions. 1. Exchange between isotopic calcium carbonates and aqueous calcium ions

International Nuclear Information System (INIS)

Zhang, R.S.; Nash, C.P.; Rock, P.A.

1988-01-01

This paper reports the authors results for the direct experimental determination of the equilibrium constant for the calcium-isotope-exchange reaction 40 CaCO 3 (s) + 44 CaCl 2 (aq) reversible 44 CaCO 2 (s) + 40 CaCl 2 (aq). The reaction was studied in electrochemical double cells without liquid junction of the type shown in eq 2. The experimental value of the equilibrium constant at 295 +/- 2 K is K = 1.08 +/- 0.02. The experimental value for K is compared with the values of K calculated for various model reactions according to the statistical thermodynamic theory of isotope effects. The isotopic solid carbonates were modeled according to both the Debye and Kieffer theories. No structured models of solvated isotopic aqueous calcium ions yield calculated equilibrium constants in agreement with their experimental results. This conclusion is in agreement with published molecular dynamics calculations which show that the aqueous solvation of Ca 2 =(aq) is essentially unstructured

Ada in AI or AI in Ada. On developing a rationale for integration

Science.gov (United States)

Collard, Philippe E.; Goforth, Andre

1988-01-01

The use of Ada as an Artificial Intelligence (AI) language is gaining interest in the NASA Community, i.e., by parties who have a need to deploy Knowledge Based-Systems (KBS) compatible with the use of Ada as the software standard for the Space Station. A fair number of KBS and pseudo-KBS implementations in Ada exist today. Currently, no widely used guidelines exist to compare and evaluate these with one another. The lack of guidelines illustrates a fundamental problem inherent in trying to compare and evaluate implementations of any sort in languages that are procedural or imperative in style, such as Ada, with those in languages that are functional in style, such as Lisp. Discussed are the strengths and weakness of using Ada as an AI language and a preliminary analysis provided of factors needed for the development of criteria for the integration of these two families of languages and the environments in which they are implemented. The intent for developing such criteria is to have a logical rationale that may be used to guide the development of Ada tools and methodology to support KBS requirements, and to identify those AI technology components that may most readily and effectively be deployed in Ada.

[Enhancement effect of double-beam laser processed aqueous solution on ICP emission spectrum].

Science.gov (United States)

Chen, Jin-zhong; Xu, Li-jing; Su, Hong-xin; Li, Xu; Wang, Shu-fang

2015-01-01

In order to change the physical properties of aqueous solution and improve the radiation intensity of the ICP emission spectrum, the effects of different laser power density and irradiation time on the surface tension and viscosity of aqueous solution were investigated by using near infrared laser at 976 nm and CO2 laser at 10. 6 µm to irradiate aqueous solution orthogonally, then the enhancement of ICP spectral intensity with processed solution was discussed. The results showed that the surface tension and viscosity of aqueous solution reduced by 42. 13% and 14. 03% compared with the untreated, and the atomization efficiency increased by 51.26% at the laser power density 0. 265 7 W . cm-2 of 976 nm and 0. 206 9 W . cm-2 of CO2 laser with 40 min irradiation time. With the optimized aqueous solution introduced into the ICP source, the spectral line intensity of sample elements As, Cd, Cr, Hg and Pb was enhanced by 46.29%, 94. 65%, 30. 76%, 33.07% and 94. 58% compared to the untreated aqueous solution, while the signal-to-background ratio increased by 43. 84%, 85. 35%, 28. 71%, 34. 37% and 90. 91%, respectively. Plasma temperature and electron density also increased by 5. 94% and 1. 18% respectively. It is obvious that the method of double-beam laser orthogonal irradiation on solution can reduce the surface tension and viscosity of aqueous solution significantly, and raise the radiationintensity of ICP source, and will provide a better condition for detecting the trace heavy metal elements in water samples.

The Relevance of AI Research to CAI.

Science.gov (United States)

Kearsley, Greg P.

This article provides a tutorial introduction to Artificial Intelligence (AI) research for those involved in Computer Assisted Instruction (CAI). The general theme is that much of the current work in AI, particularly in the areas of natural language understanding systems, rule induction, programming languages, and socratic systems, has important…

Learning game AI programming with Lua

CERN Document Server

Young, David

2014-01-01

If you are a game developer or a general programmer who wishes to focus on programming systems and techniques to build your game AI without creating low-level interfaces in a game engine, then this book is for you. Knowledge of C++ will come in handy to debug the entirety of the AI sandbox and expand on the features present within the book, but it is not required.

Application of AI methods to aircraft guidance and control

Science.gov (United States)

Hueschen, Richard M.; Mcmanus, John W.

1988-01-01

A research program for integrating artificial intelligence (AI) techniques with tools and methods used for aircraft flight control system design, development, and implementation is discussed. The application of the AI methods for the development and implementation of the logic software which operates with the control mode panel (CMP) of an aircraft is presented. The CMP is the pilot control panel for the automatic flight control system of a commercial-type research aircraft of Langley Research Center's Advanced Transport Operating Systems (ATOPS) program. A mouse-driven color-display emulation of the CMP, which was developed with AI methods and used to test the AI software logic implementation, is discussed. The operation of the CMP was enhanced with the addition of a display which was quickly developed with AI methods. The display advises the pilot of conditions not satisfied when a mode does not arm or engage. The implementation of the CMP software logic has shown that the time required to develop, implement, and modify software systems can be significantly reduced with the use of the AI methods.

Process for recovery of uranium from wet process phosphoric acid

International Nuclear Information System (INIS)

Wiewiorowski, T.K.; Thornsberry, W.L. Jr.

1978-01-01

Process is claimed for the recovery of uranium from wet process phosphoric acid solution in which an organic extractant, containing uranium values and dissolved iron impurities and comprising a dialkylphosphoric acid and a trialkylphosphine oxide dissolved in a water immiscible organic solvent, is contacted with a substantially iron-free dilute aqueous phosphoric acid to remove said iron impurities. The removed impurities are bled from the system by feeding the resulting iron-loaded phosphoric acid to a secondary countercurrent uranium extraction operation from which they leave as part of the uranium-depleted acid raffinate. Also, process for recovering uranium in which the extractant, after it has been stripped of uranium values by aqueous ammonium carbonate, is contacted with a dilute aqueous acid selected from the group consisting of H 2 SO 4 , HCl, HNO 3 and iron-free H 3 PO 4 to improve the extraction efficiency of the organic extractant

Adsorption of ammonium ion by coconut shell-activated carbon from aqueous solution: kinetic, isotherm, and thermodynamic studies.

Science.gov (United States)

Boopathy, Ramasamy; Karthikeyan, Sekar; Mandal, Asit Baran; Sekaran, Ganesan

2013-01-01

Ammonium ions are one of the most encountered nitrogen species in polluted water bodies. High level of ammonium ion in aqueous solution imparts unpleasant taste and odor problems, which can interfere with the life of aquatics and human population when discharged. Many chemical methods are developed and being used for removal of ammonium ion from aqueous solution. Among various techniques, adsorption was found to be the most feasible and environmentally friendly with the use of natural-activated adsorbents. Hence, in this study, coconut shell-activated carbon (CSAC) was prepared and used for the removal of ammonium ion by adsorption techniques. Ammonium chloride (analytical grade) was purchased from Merck Chemicals for adsorption studies. The CSAC was used to adsorb ammonium ions under stirring at 100 rpm, using orbital shaker in batch experiments. The concentration of ammonium ion was estimated by ammonia distillate, using a Buchi distillation unit. The influence of process parameters such as pH, temperature, and contact time was studied for adsorption of ammonium ion, and kinetic, isotherm models were validated to understand the mechanism of adsorption of ammonium ion by CSAC. Thermodynamic properties such as ∆G, ∆H, and ∆S were determined for the ammonium adsorption, using van't Hoff equation. Further, the adsorption of ammonium ion was confirmed through instrumental analyses such as SEM, XRD, and FTIR. The optimum conditions for the effective adsorption of ammonium ion onto CSAC were found to be pH 9.0, temperature 283 K, and contact time 120 min. The experimental data was best followed by pseudosecond order equation, and the adsorption isotherm model obeyed the Freundlich isotherm. This explains the ammonium ion adsorption onto CSAC which was a multilayer adsorption with intraparticle diffusion. Negative enthalpy confirmed that this adsorption process was exothermic. The instrumental analyses confirmed the adsorption of ammonium ion onto CSAC.

Extended UNIQUAC model for thermodynamic modeling of CO2 absorption in aqueous alkanolamine solutions

DEFF Research Database (Denmark)

Faramarzi, Leila; Kontogeorgis, Georgios; Thomsen, Kaj

2009-01-01

The extended UNIQUAC model [K. Thomsen, R Rasmussen, Chem. Eng. Sci. 54 (1999) 1787-1802] was applied to the thermodynamic representation of carbon dioxide absorption in aqueous monoethanolamine (MEA), methyldiethanolamine (MDEA) and varied strength mixtures of the two alkanolamines (MEA-MDEA). F......The extended UNIQUAC model [K. Thomsen, R Rasmussen, Chem. Eng. Sci. 54 (1999) 1787-1802] was applied to the thermodynamic representation of carbon dioxide absorption in aqueous monoethanolamine (MEA), methyldiethanolamine (MDEA) and varied strength mixtures of the two alkanolamines (MEA......) are included in the parameter estimation process. The previously unavailable standard state properties of the alkanolamine ions appearing in this work, i.e. MEA protonate, MEA carbamate and MDEA protonate are determined. The concentration of the species in both MEA and MDEA solutions containing CO2...

Adsorption of malachite green from aqueous solution onto carbon prepared from Arundo donax root

International Nuclear Information System (INIS)

Zhang Jian; Li Yan; Zhang Chenglu; Jing Yuming

2008-01-01

Arundo donax root carbon (ADRC), a new adsorbent, was prepared from Arundo donax root by carbonization. The surface area of the adsorbent was determined 158 m 2 /g by N 2 adsorption isotherm. Batch adsorption experiments were carried out for the removal of malachite green (MG) from aqueous solution using ADRC as adsorbent. The effects of various parameters such as solution pH (3-10), carbon dose (0.15-1.0 g/100 ml) and initial MG concentration (10-100 mg/l) on the adsorption system were investigated. The effective pH was 5-7 and the optimum adsorbent dose was found to be 0.6 g/100 ml. Equilibrium experimental data at 293, 303 and 313 K were better represented by Langmuir isotherm than Freundlich isotherm using linear and non-linear methods. Thermodynamic parameters such as ΔG, ΔH and ΔS were also calculated. The negative Gibbs free energy change and the positive enthalpy change indicated the spontaneous and endothermic nature of the adsorption. The adsorption equilibrium time was 180 min. Adsorption kinetics was determined using pseudo-first-order model, pseudo-second-order model and intraparticle diffusion model. The results showed that the adsorption of MG onto ADRC followed pseudo-second-order model

Discussion on AI Technology in Information Library Design

OpenAIRE

日比野, 省三; Shozo, HIBINO; 中京大学社会学部

1987-01-01

This paper deals with the discussion on the importance of AI (Artificial Intelligence) Technology in planning and designing a library information system in the near future. First of all, the history of Library and Information Science is reviewed and it is identified that the key technology in the future library will be AI as a mega-trend. After reviewing the concepts of AI technology, a model of a Knowledge-Base system is discussed as a case study, using micro-PROLOG.

Expanding the Possibilities of AIS Data with Heuristics

Directory of Open Access Journals (Sweden)

Bjørnar Brende Smestad

2017-06-01

Full Text Available Automatic Identification System (AIS is primarily used as a tracking system for ships, but with the launch of satellites to collect these data, new and previously untested possibilities are emerging. This paper presents the development of heuristics for establishing the specific ship type using information retrieved from AIS data alone. These heuristics expand the possibilities of AIS data, as the specific ship type is vital for several transportation research cases, such as emission analyses of ship traffic and studies on slow steaming. The presented method for developing heuristics can be used for a wider range of vessels. These heuristics may form the basis of large-scale studies on ship traffic using AIS data when it is not feasible or desirable to use commercial ship data registers.

Synthesis of sub-millimeter calcite from aqueous solution

Science.gov (United States)

Reimi, M. A.; Morrison, J. M.; Burns, P. C.

2011-12-01

A novel aqueous synthesis that leads to the formation of calcite (CaCO3) crystals, up to 500μm in diameter, will be used to facilitate the study of contaminant transport in aqueous environmental systems. Existing processes tend to be complicated and often yield nanometer-sized or amorphous CaCO3. The synthesis method presented here, which involves slow mixing of concentrated solutions of CaCl2 ¬and (NH4)2CO3, produces single crystals of rhombohedral calcite in 2 to 4 days. Variations on the experimental method, including changes in pH and solution concentration, were explored to optimize the synthesis. Scanning Electron Microscope images show the differences in size and purity observed when the crystals are grown at pH values ranging from 2 to 6. The crystals grown from solutions of pH 2 were large (up to 500 micrometers in diameter) with minimal polycrystalline calcium carbonate, while crystals grown from solutions with pH values beyond 4 were smaller (up to 100 micrometers in diameter) with significant polycrystalline calcium carbonate. The synthesis method, materials characterization, and use in future actinide contaminant studies will be discussed.

Electrochemical characterization of single-walled carbon nanotubes for electrochemical double layer capacitors using non-aqueous electrolyte

International Nuclear Information System (INIS)

Ruch, P.W.; Koetz, R.; Wokaun, A.

2009-01-01

Single-walled carbon nanotubes (SWCNTs) were investigated by cyclic voltammetry and electrochemical impedance spectroscopy in a non-aqueous electrolyte, 1 M Et 4 NBF 4 in acetonitrile, suitable for supercapacitors. Further, in situ dilatometry and in situ conductance measurements were performed on single electrodes and the results compared to an activated carbon, YP17. Both materials show capacitive behavior characteristic of high surface area electrodes for supercapacitors, with the maximum full cell gravimetric capacitance being 34 F/g for YP17 and 20 F/g for SWCNTs at 2.5 V with respect to the total active electrode mass. The electronic resistance of SWCNTs and activated carbon decreases significantly during charging, showing similarities of the two materials during electrochemical doping. The SWCNT electrode expands irreversibly during the first electrochemical potential sweep as verified by in situ dilatometry, indicative of at least partial debundling of the SWCNTs. A reversible periodic swelling and shrinking during cycling is observed for both materials, with the magnitude of expansion depending on the type of ions forming the double layer.

Current status on advanced aqueous reprocessing process (next) in FaCT project

International Nuclear Information System (INIS)

Washiya, Tadahiro; Myochin, Munetaka; Koyama, Tomozo

2009-01-01

Japan Atomic Energy Agency (JAEA) launched the Fast Reactor Cycle Technology Development (FaCT) project in cooperation with the Japanese electric utilities in 2006. An integration of the advanced aqueous reprocessing concept and the simplified pelletizing fuel fabrication was selected as the most promising fuel cycle system. In order to accomplish the integration, R and D tasks were launched as FaCT Project in 2006 by Japanese joint team. The New Extraction System for TRU Recovery (NEXT) system is an advanced aqueous reprocessing concept which was based on the well established aqueous reprocessing for LWR spent fuel and newly applied processes such as uranium crystallization and extraction chromatography for MAs recovery. Main task of the NEXT process is to develop the TRU recovery process and equipments with high reliability, criticality safety, high durability and remote maintainability. In the FaCT project, all innovative technologies are planned to be developed within the next decade focusing on the future commercialization of FBR cycle systems. The judgment of the adoption of each innovative technology will be made by 2010 based on the results of R and Ds. The development of each technology is to be completed by around 2015. By the same time, it is scheduled to present the conceptual design of commercial and demonstrative fast reactor cycle facilities. The six items (Disassembling and shearing, Fuel dissolution, Uranium Crystallization, Single cycle co-extraction of U, Pu and Np, MA recovery by extraction chromatography and Waste treatment) have been identified as the issues to be developed corresponding to each process step. Current R and D status and prospects of this system until around 2015 is reported. (author)

Exploration of the Role of Heat Activation in Enhancing Serpentine Carbon Sequestration Reactions

International Nuclear Information System (INIS)

McKelvy, M.J.; Chizmeshya, A.V.G.; Diefenbacher, J.; Bearat, H.; Wolf, G.

2005-01-01

As compared with other candidate carbon sequestration technologies, mineral carbonation offers the unique advantage of permanent disposal via geologically stable and environmentally benign carbonates. The primary challenge is the development of an economically viable process. Enhancing feedstock carbonation reactivity is key. Heat activation dramatically enhances aqueous serpentine carbonation reactivity. Although the present process is too expensive to implement, the materials characteristics and mechanisms that enhance carbonation are of keen interest for further reducing cost. Simultaneous thermogravimetric and differential thermal analysis (TGA/DTA) of the serpentine mineral lizardite was used to isolate a series of heat-activated materials as a function of residual hydroxide content at progressively higher temperatures. Their structure and composition are evaluated via TGA/DTA, X-ray powder diffraction (including phase analysis), and infrared analysis. The meta-serpentine materials that were observed to form ranged from those with longer range ordering, consistent with diffuse stage-2 like interlamellar order, to an amorphous component that preferentially forms at higher temperatures. The aqueous carbonation reaction process was investigated for representative materials via in situ synchrotron X-ray diffraction. Magnesite was observed to form directly at 15 MPa CO 2 and at temperatures ranging from 100 to 125 C. Carbonation reactivity is generally correlated with the extent of meta-serpentine formation and structural disorder.

Humid-air and aqueous corrosion models for corrosion-allowance barrier material

International Nuclear Information System (INIS)

Lee, J.H.; Atkins, J.E.; Andrews, R.W.

1995-01-01

Humid-air and aqueous general and pitting corrosion models (including their uncertainties) for the carbon steel outer containment barrier were developed using the corrosion data from literature for a suite of cast irons and carbon steels which have similar corrosion behaviors to the outer barrier material. The corrosion data include the potential effects of various chemical species present in the testing environments. The atmospheric corrosion data also embed any effects of cyclic wetting and drying and salts that may form on the corroding specimen surface. The humid-air and aqueous general corrosion models are consistent in that the predicted humid-air general corrosion rates at relative humidities between 85 and 100% RH are close to the predicted aqueous general corrosion rates. Using the expected values of the model parameters, the model predicts that aqueous pitting corrosion is the most likely failure mode for the carbon steel outer barrier, and an earliest failure (or initial pit penetration) of the 100-mm thick barrier may occur as early as about 500 years if it is exposed continuously to an aqueous condition at between 60 and 70 degrees C

Applicability of Activated Carbon to Treatment of Waste Containing Iodine-Labeled Compounds

International Nuclear Information System (INIS)

Gad, H.M.H.; El-Mouhty, N.R.A.; Aly, H.F.

2008-01-01

The applicability of activated carbon prepared from sawdust (SD) by one-step chemical activation process using H 3 PO 4 (H) to treatment of aqueous waste contaminated with iodine-labeled prolactin (I-PRL) has been investigated. Treatment processes were performed under the varying conditions; contact time, temperature, carbon type, carbon dosage, and different particle size of activated carbon (SDH). Effect of aqueous waste volume has been investigated to calculate the batch factor (V/M) and the distribution coefficient (K d ). The used activated carbon (SDH) was characterized by N 2 adsorption, FTIR, density, ph, point of zero charge ph p zc, moisture and ash content. Methylene blue (MB) and iodine number was calculated by adsorption from solution. In order to investigate the mechanism of sorption and potential rate controlling steps, pseudo first- and second-order equations, intra particle diffusion equation and the Elovich equation have been used to test experimental data. Kinetic analysis of the four models has been carried out for system variables in order to assess which model provides the best fit predicted data with experimental results. 7 M NaOH can be used for regeneration of spent SDH activated carbon with the efficiency of 99.6% and the regenerated carbon can be reused for five cycles effectively. The prospect of applying the SDH activated carbon prepared from agricultural by-product, sawdust, to treatment of aqueous waste contaminated with I-PRL appears promising and is considered highly applicable because of its high adsorption capacity, available at low cost, easily regenerated and reused

Base hydrolysis and hydrothermal processing of PBX-9404

International Nuclear Information System (INIS)

Flesner, R.L.; Spontarelli, T.; Dell'Orco, P.C.; Sanchez, J.A.

1994-01-01

Base hydrolysis in combination with hydrothermal processing has been proposed as an environmentally acceptable alternative to open burning/open detonation for degradation and destruction of high explosives. In this report, the authors examine gaseous and aqueous products of base hydrolysis of the HMX-based plastic bonded explosive, PBX-9404. They also examined products from the subsequent hydrothermal treatment of the base hydrolysate. The gases produced from hydrolysis of PBX-9404 are ammonia, nitrous oxide, and nitrogen. Major aqueous products are sodium formate, acetate, nitrate, and nitrite, but not all carbon products have been identified. Hydrothermal processing of base hydrolysate destroyed up to 98% of the organic carbon in solution, and higher destruction efficiencies are possible. Major gas products detected from hydrothermal processing were nitrogen and nitrous oxide

Calibrating AIS images using the surface as a reference

Science.gov (United States)

Smith, M. O.; Roberts, D. A.; Shipman, H. M.; Adams, J. B.; Willis, S. C.; Gillespie, A. R.

1987-01-01

A method of evaluating the initial assumptions and uncertainties of the physical connection between Airborne Imaging Spectrometer (AIS) image data and laboratory/field spectrometer data was tested. The Tuscon AIS-2 image connects to lab reference spectra by an alignment to the image spectral endmembers through a system gain and offset for each band. Images were calibrated to reflectance so as to transform the image into a measure that is independent of the solar radiant flux. This transformation also makes the image spectra directly comparable to data from lab and field spectrometers. A method was tested for calibrating AIS images using the surface as a reference. The surface heterogeneity is defined by lab/field spectral measurements. It was found that the Tuscon AIS-2 image is consistent with each of the initial hypotheses: (1) that the AIS-2 instrument calibration is nearly linear; (2) the spectral variance is caused by sub-pixel mixtures of spectrally distinct materials and shade, and (3) that sub-pixel mixtures can be treated as linear mixtures of pure endmembers. It was also found that the image can be characterized by relatively few endmembers using the AIS-2 spectra.

Carbon nanofibers obtained from electrospinning process

Science.gov (United States)

Bovi de Oliveira, Juliana; Müller Guerrini, Lília; Sizuka Oishi, Silvia; Rogerio de Oliveira Hein, Luis; dos Santos Conejo, Luíza; Cerqueira Rezende, Mirabel; Cocchieri Botelho, Edson

2018-02-01

In recent years, reinforcements consisting of carbon nanostructures, such as carbon nanotubes, fullerenes, graphenes, and carbon nanofibers have received significant attention due mainly to their chemical inertness and good mechanical, electrical and thermal properties. Since carbon nanofibers comprise a continuous reinforcing with high specific surface area, associated with the fact that they can be obtained at a low cost and in a large amount, they have shown to be advantageous compared to traditional carbon nanotubes. The main objective of this work is the processing of carbon nanofibers, using polyacrylonitrile (PAN) as a precursor, obtained by the electrospinning process via polymer solution, with subsequent use for airspace applications as reinforcement in polymer composites. In this work, firstly PAN nanofibers were produced by electrospinning with diameters in the range of (375 ± 85) nm, using a dimethylformamide solution. Using a furnace, the PAN nanofiber was converted into carbon nanofiber. Morphologies and structures of PAN and carbon nanofibers were investigated by scanning electron microscopy, Raman Spectroscopy, thermogravimetric analyses and differential scanning calorimeter. The resulting residual weight after carbonization was approximately 38% in weight, with a diameters reduction of 50%, and the same showed a carbon yield of 25%. From the analysis of the crystalline structure of the carbonized material, it was found that the material presented a disordered structure.

Hydrogen Generation from Sugars via Aqueous-Phase Reforming

International Nuclear Information System (INIS)

Randy D Cortright

2006-01-01

Virent Energy Systems, Inc. is commercializing the Aqueous Phase Reforming (APR) process that allows the generation of hydrogen-rich gas streams from biomass-derived compounds such as glycerol, sugars, and sugar alcohols. The APR process is a unique method that generates hydrogen from aqueous solutions of these oxygenated compounds in a single step reactor process compared to the three or more reaction steps required for hydrogen generation via conventional processes that utilize non-renewable fossil fuels. The key breakthrough of the APR process is that the reforming of these aqueous solutions is done in the liquid phase. The patented APR process occurs at temperatures (150 C to 270 C) where the water-gas shift reaction is favorable, making it possible to generate hydrogen with low amounts of CO in a single chemical reactor. Furthermore, the APR process occurs at pressures (typically 15 to 50 bar) where the hydrogen-rich effluent can be effectively purified using either membrane technology or pressure swing adsorption technology. The utilization of biomass-based compounds allows the APR process to be a carbon neutral method to generate hydrogen. In the near term, the feed-stock of interest is waste glycerol that is being generated in large quantities as a byproduct in the production of bio-diesel. Virent has developed the APR system for on-demand generation of hydrogen-rich fuel gas from either glycerol or sorbitol (the sugar alcohol formed by hydrogenation of glucose) to fuel a stationary internal combustion engine driven generator (10 kW). Under a USDOE funded project, Virent is currently developing the APR process to generate high yields of hydrogen from corn-derived glucose. This project objective is to achieve the DOE 2010 cost target for distributed production from renewable liquid fuels of 3.60 dollars/gge (gasoline gallon equivalent) delivered. (authors)

Low-cost, solution processable carbon nanotube supercapacitors and their characterization

Science.gov (United States)

Lehtimäki, Suvi; Tuukkanen, Sampo; Pörhönen, Juho; Moilanen, Pasi; Virtanen, Jorma; Honkanen, Mari; Lupo, Donald

2014-06-01

We report ecological and low-cost carbon nanotube (CNT) supercapacitors fabricated using a simple, scalable solution processing method, where the use of a highly porous and electrically conductive active material eliminates the need for a current collector. Electrodes were fabricated on a poly(ethylene terephthalate) substrate from a printable multi-wall CNT ink, where the CNTs are solubilized in water using xylan as a dispersion agent. The dispersion method facilitates a very high concentration of CNTs in the ink. Supercapacitors were assembled using a paper separator and an aqueous NaCl electrolyte and the devices were characterized with a galvanostatic discharge method defined by an industrial standard. The capacitance of the 2 cm^2 devices was 6 mF/cm^2 (2.3 F/g) and equivalent series resistance 80 Ω . Low-cost supercapacitors fabricated from safe and environmentally friendly materials have potential applications as energy storage devices in ubiquitous and autonomous intelligence as well as in disposable low-end products.

Visualization data on the freezing process of micrometer-scaled aqueous citric acid drops

Directory of Open Access Journals (Sweden)

Anatoli Bogdan

2017-02-01

Full Text Available The visualization data (8 movies presented in this article are related to the research article entitled “Freezing and glass transitions upon cooling and warming and ice/freeze-concentration-solution morphology of emulsified aqueous citric acid” (A. Bogdan, M.J. Molina, H. Tenhu, 2016 [1]. The movies recorded in-situ with optical cryo-miscroscopy (OC-M demonstrate for the first time freezing processes that occur during the cooling and subsequent warming of emulsified micrometer-scaled aqueous citric acid (CA drops. The movies are made publicly available to enable critical or extended analyzes.

Adaptive game AI with dynamic scripting

OpenAIRE

Spronck, P.; Ponsen, M.J.V.; Sprinkhuizen-Kuyper, I.G.; Postma, E.O.

2006-01-01

Online learning in commercial computer games allows computer-controlled opponents to adapt to the way the game is being played. As such it provides a mechanism to deal with weaknesses in the game AI, and to respond to changes in human player tactics.We argue that online learning of game AI should meet four computational and four functional requirements. The computational requirements are speed, effectiveness, robustness and ef- ficiency. The functional requirements are clarity, variety, consi...

the Lexique kikongo–français by

African Journals Online (AJOL)

Gilles-Maurice de Schryver

français by the Jesuit missionary Charles Polis, is analysed in great detail. Section 1 expounds on the goal and ... dictionary manuscript for Kikongo: the Lexique kikongo–français by Charles Polis. s.j. (1885–†1943). .... Inkisi River, and all but one (Leverville, the present Lusanga) are close to that river, which thus strongly ...

Utilization of Pine Nut Shell derived carbon as an efficient alternate for the sequestration of phthalates from aqueous system

Directory of Open Access Journals (Sweden)

Umair A. Qureshi

2014-12-01

Full Text Available This study highlights the importance of a cheap bio waste; Pine Nut Shell (PNS, from which a carbon is synthesized that can efficiently remove toxic phthalates from an aqueous system. PNS derived carbon shows high affinity toward phthalates in descending order along with adsorption capacity i.e., dibutyl phthalate (DBP 5.65 mg/g > diallyl phthalate (DAP 3.64 mg/g > diethyl phthalate (DEP and 2.87 mg/g > dimethyl phthalate (DMP 2.48 mg/g. Different characterization techniques such as FTIR, elemental analysis, point of zero electric charge (PZC, SEM, EDX and BET were employed to investigate the binding sites and surface area of the adsorbent. Adsorption experiments were performed both in batch and column modes. Equilibrium studies showed that the Langmuir isotherm fits best to experimental data. Kinetically, adsorption phenomena obeyed pseudo second order. Furthermore, thermodynamic results expressed the exothermic nature of adsorption on the basis of negative value of enthalpy change. Column sorption method was also adapted to check the feasibility of the adsorption process through the investigation of flow rate, breakthrough curve and pre-concentration factor which is found to be 13 for DMP and DEP and 16 for DAP and DBP. Methanol was found to be best solvent for the recovery of phthalates. Application in real water samples also showed good efficiency of PNS derived carbon for the removal of phthalates.

Removal of direct blue-106 dye from aqueous solution using new activated carbons developed from pomegranate peel: Adsorption equilibrium and kinetics

International Nuclear Information System (INIS)

Amin, Nevine Kamal

2009-01-01

The use of cheap, high efficiency and ecofriendly adsorbent has been studied as an alternative source of activated carbon for the removal of dyes from wastewater. This study investigates the use of activated carbons prepared from pomegranate peel for the removal of direct blue dye from aqueous solution. A series of experiments were conducted in a batch system to assess the effect of the system variables, i.e. initial pH, temperature, initial dye concentration adsorbent dosage and contact time. The results showed that the adsorption of direct blue dye was maximal at pH 2, as the amount of adsorbent increased, the percentage of dye removal increased accordingly but it decreased with the increase in initial dye concentration and solution temperature. The adsorption kinetics was found to follow pseudo-second-order rate kinetic model, with a good correlation (R 2 > 0.99) and intra-particle diffusion as one of the rate determining steps. Langmuir, Freundlich, Temkin, Dubinin-RadushKevich (D-R) and Harkins-Jura isotherms were used to analyze the equilibrium data at different temperatures. In addition, various thermodynamic parameters, such as standard Gibbs free energy (ΔG o ), standard enthalpy (ΔH o ), standard entropy (ΔS o ), and the activation energy (E a ) have been calculated. The adsorption process of direct blue dye onto different activated carbons prepared from pomegranate peel was found to be spontaneous and exothermic process. The findings of this investigation suggest that the physical sorption plays a role in controlling the sorption rate.

Removal of direct blue-106 dye from aqueous solution using new activated carbons developed from pomegranate peel: Adsorption equilibrium and kinetics

Energy Technology Data Exchange (ETDEWEB)

Amin, Nevine Kamal, E-mail: nkamalamin@yahoo.com [Chemical Engineering Department, Faculty of Engineering, Alexandria University, Alexandria (Egypt)

2009-06-15

The use of cheap, high efficiency and ecofriendly adsorbent has been studied as an alternative source of activated carbon for the removal of dyes from wastewater. This study investigates the use of activated carbons prepared from pomegranate peel for the removal of direct blue dye from aqueous solution. A series of experiments were conducted in a batch system to assess the effect of the system variables, i.e. initial pH, temperature, initial dye concentration adsorbent dosage and contact time. The results showed that the adsorption of direct blue dye was maximal at pH 2, as the amount of adsorbent increased, the percentage of dye removal increased accordingly but it decreased with the increase in initial dye concentration and solution temperature. The adsorption kinetics was found to follow pseudo-second-order rate kinetic model, with a good correlation (R{sup 2} > 0.99) and intra-particle diffusion as one of the rate determining steps. Langmuir, Freundlich, Temkin, Dubinin-RadushKevich (D-R) and Harkins-Jura isotherms were used to analyze the equilibrium data at different temperatures. In addition, various thermodynamic parameters, such as standard Gibbs free energy ({Delta}G{sup o}), standard enthalpy ({Delta}H{sup o}), standard entropy ({Delta}S{sup o}), and the activation energy (E{sub a}) have been calculated. The adsorption process of direct blue dye onto different activated carbons prepared from pomegranate peel was found to be spontaneous and exothermic process. The findings of this investigation suggest that the physical sorption plays a role in controlling the sorption rate.

The concentration of apolipoprotein A-I decreases during experimentally induced acute-phase processes in pigs

DEFF Research Database (Denmark)

Carpintero, R.; Pineiro, M.; Andres, M.

2005-01-01

In this work, apolipoprotein A-I (ApoA-I) was purified from pig sera. The responses of this protein after sterile inflammation and in animals infected with Actinobacillus pleuropneumoniae or Streptococcus suis were investigated. Decreases in the concentrations of ApoA-I, two to five times lower...

Effective Degradation of Aqueous Tetracycline Using a Nano-TiO2/Carbon Electrocatalytic Membrane

Directory of Open Access Journals (Sweden)

Zhimeng Liu

2016-05-01

Full Text Available In this work, an electrocatalytic membrane was prepared to degrade aqueous tetracycline (TC using a carbon membrane coated with nano-TiO2 via a sol-gel process. SEM, XRD, EDS, and XPS were used to characterize the composition and structure of the electrocatalytic membrane. The effect of operating conditions on the removal rate of tetracycline was investigated systematically. The results show that the chemical oxygen demand (COD removal rate increased with increasing residence time while it decreased with increasing the initial concentration of tetracycline. Moreover, pH had little effect on the removal of tetracycline, and the electrocatalytic membrane could effectively remove tetracycline with initial concentration of 50 mg·L−1 (pH, 3.8–9.6. The 100% tetracycline and 87.8% COD removal rate could be achieved under the following operating conditions: tetracycline concentration of 50 mg·L−1, current density of 1 mA·cm−2, temperature of 25 °C, and residence time of 4.4 min. This study provides a new and feasible method for removing antibiotics in water with the synergistic effect of electrocatalytic oxidation and membrane separation. It is evident that there will be a broad market for the application of electrocatalytic membrane in the field of antibiotic wastewater treatment.

Dry-cleaning with high-pressure carbon dioxide

NARCIS (Netherlands)

Van Roosmalen, M.J.E.

2003-01-01

Dry-cleaning is a process for removing soils and stains from fabrics and garments which uses a non-aqueous solvent with detergent added. The currently most used dry-cleaning solvent is perchloroethylene (PER), which is toxic, environmentally harmful and suspected to be carcinogenic. Carbon dioxide

Aqueous recovery of plutonium from pyrochemical processing residues

International Nuclear Information System (INIS)

Gray, L.W.; Gray, J.H.

1984-01-01

Pyrochemical processes provide rapid methods to reclaim plutonium from scrap residues. Frequently, however, these processes yield an impure plutonium product and waste residues that are contaminated with actinides and are therefore nondiscardable. The Savannah River Laboratory and Plant and the Rocky Flats Plant are jointly developing new processes using both pyrochemistry and aqueous chemistry to generate pure product and discardable waste. An example of residue being treated is that from the molten salt extraction (MSE), a mixture of NaCl, KCl, MgCl 2 , PuCl 3 , AmCl 3 , PuO 2 , and Pu 0 . This mixture is scrubbed with molten aluminum containing a small amount of magnesium to produce a nonhomogeneous Al-Pu-Am-Mg alloy. This process, which rejects most of the NaCl-KCl-MgCl 2 salts, results in a product easily dissolved in 6M HNO 3 -0.1M HF. Any residual chloride in the product is removed by precipitation with Hg(I) followed by centrifuging. Plutonium and americium are then separated by the standard Purex process. The americium, initially diverted to the solvent extraction waste stream, can either be recovered or sent to waste

Development of Spectrophotometric Process Monitors for Aqueous Reprocessing Facilities

International Nuclear Information System (INIS)

Smith, N.; Krebs, J.; Hebden, A.

2015-01-01

The safeguards envelope of an aqueous reprocessing plant can be extended beyond traditional measures to include surveillance of the process chemistry itself. By observing the concentration of accountable species in solution directly, a measure of real time accountancy can be applied. Of equal importance, select information on the process chemistry can be determined that will allow the operator and inspectors to verify that the process is operating as intended. One of the process monitors that can be incorporated is molecular spectroscopy, such as UV-Visible absorption spectroscopy. Argonne National Laboratory has developed a process monitoring system that can be tailored to meet the specific chemistry requirements of a variety of processes. The Argonne Spectroscopic Process monitoring system (ASP) is composed of commercial-off-the-shelf (COTS) spectroscopic hardware, custom manufactured sample handling components (to meet end user requirements) and the custom Plutonium and Uranium Measurement and Acquisition System (PUMAS) software. Two versions of the system have been deployed at the Savannah River Site's H-Canyon facility, tailored for high and low concentration streams. (author)

Explicit modeling of volatile organic compounds partitioning in the atmospheric aqueous phase

Directory of Open Access Journals (Sweden)

C. Mouchel-Vallon

2013-01-01

Full Text Available The gas phase oxidation of organic species is a multigenerational process involving a large number of secondary compounds. Most secondary organic species are water-soluble multifunctional oxygenated molecules. The fully explicit chemical mechanism GECKO-A (Generator of Explicit Chemistry and Kinetics of Organics in the Atmosphere is used to describe the oxidation of organics in the gas phase and their mass transfer to the aqueous phase. The oxidation of three hydrocarbons of atmospheric interest (isoprene, octane and α-pinene is investigated for various NO_x conditions. The simulated oxidative trajectories are examined in a new two dimensional space defined by the mean oxidation state and the solubility. The amount of dissolved organic matter was found to be very low (yield less than 2% on carbon atom basis under a water content typical of deliquescent aerosols. For cloud water content, 50% (isoprene oxidation to 70% (octane oxidation of the carbon atoms are found in the aqueous phase after the removal of the parent hydrocarbons for low NO_x conditions. For high NO_x conditions, this ratio is only 5% in the isoprene oxidation case, but remains large for α-pinene and octane oxidation cases (40% and 60%, respectively. Although the model does not yet include chemical reactions in the aqueous phase, much of this dissolved organic matter should be processed in cloud drops and modify both oxidation rates and the speciation of organic species.

Dissolution of metal and metal oxide nanoparticles in aqueous media

International Nuclear Information System (INIS)

Odzak, Niksa; Kistler, David; Behra, Renata; Sigg, Laura

2014-01-01

The dissolution of Ag (citrate, gelatin, polyvinylpyrrolidone and chitosan coated), ZnO, CuO and carbon coated Cu nanoparticles (with two nominal sizes each) has been studied in artificial aqueous media, similar in chemistry to environmental waters, for up to 19 days. The dissolved fraction was determined using DGT (Diffusion Gradients in Thin films), dialysis membrane (DM) and ultrafiltration (UF). Relatively small fractions of Ag nanoparticles dissolved, whereas ZnO dissolved nearly completely within few hours. Cu and CuO dissolved as a function of pH. Using DGT, less dissolved Ag was measured compared to UF and DM, likely due to differences in diffusion of organic complexes. Similar dissolved metal concentrations of ZnO, Cu and CuO nanoparticles were determined using DGT and UF, but lower using DM. The results indicate that there is a need to apply complementary techniques to precisely determine dissolution of nanoparticles in aqueous media. - Highlights: • Three different techniques used simultaneously to measure NPs dissolution. • ZnO-NPs are the most soluble, followed by CuO-NPs, carbon coated Cu-NPs and Ag-NPs. • Dissolution is an important process affecting the fate of nanoparticles. • Complementary techniques are needed to precisely determine dissolution of NPs. - Dissolution of several types of nanoparticles was examined in aqueous media using three complementary techniques

Extraction of actinide and lanthanide complexonates in two-phase aqueous system potassium carbonate-polyethylene glycol-water

International Nuclear Information System (INIS)

Molochnikova, N.P.; Shkinev, V.M.; Spivakov, B.Ya.; Zolotov, Yu.A.; Myasoedov, B.F.

1988-01-01

Extraction system on the basis of polyethylene glycol for the concentration, isolation and separation of actinides is suggested. Extraction of actinides and lanthanides in two-phase aqueous system: potassium carbonate - polyethylene glycol - water in the presence of different complexones is investigated. Trivalent actinides are extracted quantitatively by polyethylene glycol from potassium carbonate solutions in the system with xylenol orange and alizarin-complexone. Under the conditions uranium (6) and plutonium (4) are extracted into the phase, enriched by polyethylene glycol, quite insignificantly, which permits to separate them from trivalent actinides with the separation factor of 10 2 - 10 3 . For actinide and lanthanide separation two complexones were introduced into the system, one of them being extractant, the other one - camouflaging reactant. The best results are obtained for the mixture of xylenol orange and hydroxyethylenediphosphonic acid. Separation coefficients for americium and europium constitute 4.5 - 5.6

Purification process for aqueous solutions of rare earths by liquid-liquid extraction

International Nuclear Information System (INIS)

Rollat, A.; Sabot, J.L.; Burgard, M.; Delloye, T.

1986-01-01

Alkaline earth metals are removed by liquid-liquid extraction between on aqueous nitric phase of impure rare earth compounds and an organic phase of polyether (crown ether). This process is particularly suited to removal of Ca, Ba and Ra contained in nitric solutions of rare earths [fr

Data of evolutionary structure change: 1AIFB-2AI0K [Confc[Archive

Lifescience Database Archive (English)

Full Text Available ignment> 0 n> 1AIF n>B 1AI... CA 272 n> 2AI0 n>K ...n>2AI0Kn> VAHPASSTKVD EEE EEEE...1AIFB-2AI0K 1AIF 2AI0 B K EVKLQESGGGLVQPGGSMKLSCVASGFTFNNYWMSWVRQ...SCAASGFTFRNYGMSWVRQTPEKRLEWVAAIS--GNSLYTSYPDSVKGRFTISRDNAKNNLYLQMSSLRSEDTALYFCARH

Optimizing the electrochemical performance of aqueous symmetric supercapacitors based on an activated carbon xerogel

Science.gov (United States)

Calvo, E. G.; Lufrano, F.; Staiti, P.; Brigandì, A.; Arenillas, A.; Menéndez, J. A.

2013-11-01

A highly porous carbon xerogel was synthesized by means of physical activation. The activated carbon xerogel, which displayed a well-developed porous texture (micro- and meso-porosity), was employed as electrode material in different supercapacitors. In assessing the performance of the supercapacitors, special attention was paid to their dimensions and the type of electrolyte used. Both the method of electrode manufacture (rolling and punching of 1 cm2 pellets vs. casting by means of a film applicator to produce 4 cm2 electrodes) and the type of supercapacitor (Swagelok (R) system vs. cell with graphite plate current collectors) were evaluated. The results reveal that the cells with larger electrodes were able to store higher amounts of energy. In addition to the cells, the electrochemical characteristics in aqueous electrolytes with a different pH were studied (H2SO4, Na2SO4 and KOH, 1 M). The highest capacitance values were achieved with sulphuric acid (196 F g-1 as opposed to 140 and 106 F g-1 for Na2SO4 and KOH, respectively), probably due to its higher ionic conductivity and the basic nature of the oxygen functionalities found on the surface of the carbon xerogel. Nevertheless, because of the corrosive character of sulphuric acid, Na2SO4 would be a more suitable electrolyte.

Filtration aids in uranium ore processing

International Nuclear Information System (INIS)

Ford, H.L.; Levine, N.M.; Risdon, A.L.

1975-01-01

The patent describes a process whereby improved flocculation efficiency and filtration of carbonate leached uranium ore pulps are obtained by treating the filter feed slurry with an aqueous solution of hydroxyalkyl guar. (J.R.)

Kinetics of absorption of carbon dioxide into aqueous potassium salt of proline

DEFF Research Database (Denmark)

Paul, Subham; Thomsen, Kaj

2012-01-01

rate parameters are determined from the kinetic measurements and presented at each experimental condition. The reaction order is found to be in between 1.36 and 1.40 with respect to KPr for the above mentioned concentration range. The second-order rate constants, k2, are obtained as 118,914, 203......,851, and 317,625m3kmol−1s−1 at 303, 313, and 323K, respectively with activation energy of 36.5kJmol−1. The second-order rate constants are much higher than for alkanolamines and some other salt of amino acids.......The absorption of carbon dioxide (CO2) into aqueous solution of potassium prolinate (KPr) are studied at 303, 313, and 323K within the salt concentration range of 0.5–3.0kmolm−3 using a wetted wall column absorber. The experimental results are used to interpret the kinetics of the reaction of CO2...

Removal of Pb2+,Cd2+, Fe3+ and Sr2+ from Aqueous Solution by Selected Activated Carbons Derived from Date Pits

International Nuclear Information System (INIS)

Awwad, N.S.; Daifuallah, A.A.M.; Ali, M.M.S.

2008-01-01

Date pits (DP) as a huge solid waste in Egypt is of little or no economic value and in fact present a disposal problem. The quantity of DP has been estimated to million tons per year. DP was used for preparation of physically and chemically activated carbons. The raw materials were physically activated with pure steam, steam with flow of nitrogen gas or steam with current of air, while the chemically activated samples were prepared by impregnation of 10% ferric chloride or 10% calcium acetate. The effect of various factors, e.g., carbon type, carbon dosage, ph, initial concentration, temperature, and various inorganic ions on the adsorption capacity, were quantitatively determined. The two-parameters equilibrium models Langmuir and Freundlich equations were discussed. In this work, analyses and batch adsorption experiments have been carried out to characterize and to understand adsorption mechanism by modeling the adsorption kinetics. The present study deals with the factors affecting the uptake of Pb 2+ , Cd 2+ , Fe 3+ , and Sr 2+ ions from aqueous solution using activated carbon developed from locally available material DP, by one-step steam pyrolysis in a batch mode. Concurrently removal of these cations from aqueous medium are affected by the presence of other ions e.g. NO 3 - , CO 3 - , SO 4 - and masking agents e.g. oxalic acid and EDTA in solution. Uptake values are decreased with increasing the concentration of these ions in solution heavy metals

Fast densification processes for carbon and ceramic composites

International Nuclear Information System (INIS)

Delhaes, P.; Robin-Brosse, C.; David, P.

2006-01-01

A general introduction of the different vapour infiltration processes developed to prepare carbon-carbon composites is presented. Then a novel method with a liquid precursor, called film boiling or calefaction technique is described and compared with the usual ones. It is shown how this technique is very attractive to prepare carbon and ceramic composites within a short processing time together with a higher carbon yield. Finally the pertinent parameters of this process to evaluate its advantages and drawbacks for a further industrial development are analysed. (authors)

Continuous-flow ultrasound assisted oxidative desulfurization (UAOD) process: An efficient diesel treatment by injection of the aqueous phase.

Science.gov (United States)

Rahimi, Masoud; Shahhosseini, Shahrokh; Movahedirad, Salman

2017-11-01

A new continuous-flow ultrasound assisted oxidative desulfurization (UAOD) process was developed in order to decrease energy and aqueous phase consumption. In this process the aqueous phase is injected below the horn tip leading to enhanced mixing of the phases. Diesel fuel as the oil phase with sulfur content of 1550ppmw and an appropriate mixture of hydrogen peroxide and formic acid as the aqueous phase were used. At the first step, the optimized condition for the sulfur removal has been obtained in the batch mode operation. Hence, the effect of more important oxidation parameters; oxidant-to-sulfur molar ratio, acid-to-sulfur molar ratio and sonication time were investigated. Then the optimized conditions were obtained using Response Surface Methodology (RSM) technique. Afterwards, some experiments corresponding to the best batch condition and also with objective of minimizing the residence time and aqueous phase to fuel volume ratio have been conducted in a newly designed double-compartment reactor with injection of the aqueous phase to evaluate the process in a continuous flow operation. In addition, the effect of nozzle diameter has been examined. Significant improvement on the sulfur removal was observed specially in lower sonication time in the case of dispersion method in comparison with the conventional contact between two phases. Ultimately, the flow pattern induced by ultrasonic device, and also injection of the aqueous phase were analyzed quantitatively and qualitatively by capturing the sequential images. Copyright © 2017 Elsevier B.V. All rights reserved.

Recent progresses on AI-2 bacterial quorum sensing inhibitors.

Science.gov (United States)

Zhu, Peng; Li, Minyong

2012-01-01

Quorum sensing (QS) is a communication procedure that predominates gene expression in response to cell density and fluctuations in the neighboring environment as a result of discerning molecules termed autoinducers (AIs). It has been embroiled that QS can govern bacterial behaviors such as the secretion of virulence factors, biofilm formation, bioluminescence production, conjugation, sporulation and swarming motility. Autoinducer 2 (AI-2), a QS signaling molecule brought up to be involved in interspecies communication, exists in both gram-negative and -positive bacteria. Therefore, novel approaches to interrupt AI-2 quorum sensing are being recognized as next generation antimicrobials. In the present review article, we summarized recent progresses on AI-2 bacterial quorum sensing inhibitors and discussed their potential as the antibacterial agents.

On the homotopy equivalence of simple AI-algebras

International Nuclear Information System (INIS)

Aristov, O Yu

1999-01-01

Let A and B be simple unital AI-algebras (an AI-algebra is an inductive limit of C*-algebras of the form BigOplus i k C([0,1],M N i ). It is proved that two arbitrary unital homomorphisms from A into B such that the corresponding maps K 0 A→K 0 B coincide are homotopic. Necessary and sufficient conditions on the Elliott invariant for A and B to be homotopy equivalent are indicated. Moreover, two algebras in the above class having the same K-theory but not homotopy equivalent are constructed. A theorem on the homotopy of approximately unitarily equivalent homomorphisms between AI-algebras is used in the proof, which is deduced in its turn from a generalization to the case of AI-algebras of a theorem of Manuilov stating that a unitary matrix almost commuting with a self-adjoint matrix h can be joined to 1 by a continuous path consisting of unitary matrices almost commuting with h

AIS reception from a CubeSat in LEO

DEFF Research Database (Denmark)

Larsen, Jesper Abildgaard; Mortensen, Hans Peter; Nielsen, Jens Frederik Dalsgaard

2013-01-01

The primary payloads on board the AAUSAT3 satellite are two different AIS receivers, one is a traditional hardware-based receiver, the other one is a software-defined radio receiver. The hardware-based receiver has been developed around an ADF-7020 transceiver, with an appropriate LNA in front...... into a low-Earth orbit with a semi-major axis of 7156 km, i.e. 800 km altitude, near circular, dusk-dawn Sun-synchronous orbit. From this orbit the AIS antenna system, which consists of a dipole antenna, has a foot print diameter of approximately 6000 km. During the first pass over the primary ground station...... at Aalborg University, basic telemetry and the first few AIS messages were downloaded. During the first 14 days of the mission, the two receivers managed to detect more than 100,000 different AIS messages from ships all around the world, and more than 35,000 of these messages have been successfully...

Mesopore- and Macropore-Dominant Nitrogen-Doped Hierarchically Porous Carbons for High-Energy and Ultrafast Supercapacitors in Non-Aqueous Electrolytes.

Science.gov (United States)

Shao, Rong; Niu, Jin; Liang, Jingjing; Liu, Mengyue; Zhang, Zhengping; Dou, Meiling; Huang, Yaqin; Wang, Feng

2017-12-13

Non-aqueous electrolytes (e.g., organic and ionic liquid electrolytes) can undergo high working voltage to improve the energy densities of supercapacitors. However, the large ion sizes, high viscosities, and low ionic conductivities of organic and ionic liquid electrolytes tend to cause the low specific capacitances, poor rate, and cycling performance of supercapacitors based on conventional micropore-dominant activated carbon electrodes, limiting their practical applications. Herein, we propose an effective strategy to simultaneously obtain high power and energy densities in non-aqueous electrolytes via using a cattle bone-derived porous carbon as an electrode material. Because of the unique co-activation of KOH and hydroxyapatite (HA) within the cattle bone, nitrogen-doped hierarchically porous carbon (referred to as NHPC-HA/KOH) is obtained and possesses a mesopore- and macropore-dominant porosity with an ultrahigh specific surface area (2203 m 2 g -1 ) of meso- and macropores. The NHPC-HA/KOH electrodes exhibit superior performance with specific capacitances of 224 and 240 F g -1 at 5 A g -1 in 1.0 M TEABF 4 /AN and neat EMIMBF 4 electrolyte, respectively. The symmetric supercapacitor using NHPC-HA/KOH electrodes can deliver integrated high energy and power properties (48.6 W h kg -1 at 3.13 kW kg -1 in 1.0 M TEABF 4 /AN and 75 W h kg -1 at 3.75 kW kg -1 in neat EMIMBF 4 ), as well as superior cycling performance (over 89% of the initial capacitance after 10 000 cycles at 10 A g -1 ).

Sorption of lanthanum and erbium from aqueous solution by activated carbon prepared from rice husk

International Nuclear Information System (INIS)

Awwad, N.S.; Gad, H.M.H.; Ahmad, M.I.; Aly, H.F.

2010-01-01

A biomass agricultural waste material, rice husk (RH) was used for preparation of activated carbon by chemical activation using phosphoric acid. The effect of various factors, e.g. time, ph, initial concentration and temperature of carbon on the adsorption capacity of lanthanum and erbium were quantitatively determined. It was found that the monolayer capacity is 175.4 mg/g for La(III) and 250 mg/g for Er(III) . The calculated activation energy of La(III) adsorption on the activated carbon derived from rice husk was equal to 5.84 kJ/ mol while 14.6 kJ/ mol for Er(III), which confirm that the reaction is mainly particle-diffusion controlled. The kinetics of sorption was described by a model of a pseudo-second-order. External diffusion and intra-particular diffusion were examined. The experimental data show that the external diffusion and intra-particular diffusion are significant in the determination of the sorption rate. Therefore, the developed sorbent is considered as a better replacement technology for removal of La (III) and Er(III) ions from aqueous solution due to its low cost and good efficiency, fast kinetics, as well as easy to handle and thus no or small amount of secondary sludge is obtained in this application

Factors affecting the equilibrium constant of homolysis of complexes with metal-carbon σ bonds in aqueous solutions. Pulse radiolysis studies

International Nuclear Information System (INIS)

Meyerstein, D.; Ben-Gurion Univ. of the Negev, Beersheba

1989-01-01

Pulse-Radiolysis is a powerful technique for the determination of the equilibrium constants of the homolytic cleavage of metal-carbon σ bonds in aqueous solutions. In most systems studied the observed reaction is: L m-1 M (n+1) -R + L ↔ ML m. n + ·R. Therefore the results do not enable a direct determination of the metal-carbon bond dissociation energies. The results obtained indicate that these equilibrium constants are not directly related to the redox potential of either L .m M (n) or of ·R, or to the activation energies for the homolytic cleavage of a family of similarly substituted ethanes. (author)

Adsorption of Reactive Blue 171 from Aqueous Solution using Low Cost Activated Carbon Prepared from Agricultural Solid Waste: Albizia amara

Directory of Open Access Journals (Sweden)

K. Anitha

2015-07-01

Full Text Available The adsorption of Reactive Blue 171 (Reactive Dye from aqueous solution using activated carbon prepared from Albizia amara pod shell waste as an adsorbent have been carried out. The experimental adsorption data fitted reasonably well to Langmuir and Freundlich adsorption isotherms. Kinetic parameters as a function of Initial dye concentration have been calculated and the kinetic data were substituted in Pseudo First Order, Elovich and Pseudo Second order equations. A probable explanation is offered to account for the results of kinetic study. The thermodynamic parameter enthalpy change (∆H suggests the exothermic nature of absorption of Reactive Blue 171 onto activated Albizia amara pod shell waste carbon.

77 FR 68150 - Meeting of the SANE/SART AI/AN Initiative Committee

Science.gov (United States)

2012-11-15

.../SART AI/AN Initiative Committee AGENCY: Office for Victims of Crime, Justice. ACTION: Notice of meeting... Response Team (SART) American Indian/Alaskan Native (AI/AN) Initiative (``SANE/SART AI/AN Initiative... violence within AI/AN communities. Dates and Locations: The meeting will be held on the reservation of the...

Microwave-induced carbon nanotubes catalytic degradation of organic pollutants in aqueous solution

Energy Technology Data Exchange (ETDEWEB)

Chen, Jing; Xue, Shuang; Song, Youtao; Shen, Manli [School of Environment Science, Liaoning University, Shenyang 110036 (China); Zhang, Zhaohong, E-mail: lnuhjhx@163.com [School of Environment Science, Liaoning University, Shenyang 110036 (China); Yuan, Tianxin; Tian, Fangyuan [School of Environment Science, Liaoning University, Shenyang 110036 (China); Dionysiou, Dionysios D., E-mail: dionysios.d.dionysiou@uc.edu [Environmental Engineering and Science Program, University of Cincinnati, Cincinnati, OH 45221-0012 (United States)

2016-06-05

Highlights: • Microwave-induced CNTs-based catalytic degradation technology is developed. • Microwave catalytic activities of CNTs with different diameters are compared. • Organic pollutants with different structure can be degraded in MW/CNTs system. • The 10–20 nm CNTs shows the higher catalytic activity under MW irradiation. - Abstract: In this study, a new catalytic degradation technology using microwave induced carbon nanotubes (MW/CNTs) was proposed and applied in the treatment of organic pollutants in aqueous solution. The catalytic activity of three CNTs of 10–20 nm, 20–40 nm, and 40–60 nm diameters were compared. The results showed that organic pollutants such as methyl orange (MO), methyl parathion (MP), sodium dodecyl benzene sulfonate (SDBS), bisphenol A (BPA), and methylene blue (MB) in aqueous solution could be degraded effectively and rapidly in MW/CNTs system. CNTs with diameter of 10–20 nm exhibited the highest catalytic activity of the three CNTs under MW irradiation. Further, complete degradation was obtained using 10–20 nm CNTs within 7.0 min irradiation when 25 mL MO solution (25 mg/L), 1.2 g/L catalyst dose, 450 W, 2450 MHz, and pH = 6.0 were applied. The rate constants (k) for the degradation of SDBS, MB, MP, MO and BPA using 10–20 nm CNTs/MW system were 0.726, 0.679, 0.463, 0.334 and 0.168 min{sup −1}, respectively. Therefore, this technology may have potential application for the treatment of targeted organic pollutants in wastewaters.

Microwave-induced carbon nanotubes catalytic degradation of organic pollutants in aqueous solution

International Nuclear Information System (INIS)

Chen, Jing; Xue, Shuang; Song, Youtao; Shen, Manli; Zhang, Zhaohong; Yuan, Tianxin; Tian, Fangyuan; Dionysiou, Dionysios D.

2016-01-01

Highlights: • Microwave-induced CNTs-based catalytic degradation technology is developed. • Microwave catalytic activities of CNTs with different diameters are compared. • Organic pollutants with different structure can be degraded in MW/CNTs system. • The 10–20 nm CNTs shows the higher catalytic activity under MW irradiation. - Abstract: In this study, a new catalytic degradation technology using microwave induced carbon nanotubes (MW/CNTs) was proposed and applied in the treatment of organic pollutants in aqueous solution. The catalytic activity of three CNTs of 10–20 nm, 20–40 nm, and 40–60 nm diameters were compared. The results showed that organic pollutants such as methyl orange (MO), methyl parathion (MP), sodium dodecyl benzene sulfonate (SDBS), bisphenol A (BPA), and methylene blue (MB) in aqueous solution could be degraded effectively and rapidly in MW/CNTs system. CNTs with diameter of 10–20 nm exhibited the highest catalytic activity of the three CNTs under MW irradiation. Further, complete degradation was obtained using 10–20 nm CNTs within 7.0 min irradiation when 25 mL MO solution (25 mg/L), 1.2 g/L catalyst dose, 450 W, 2450 MHz, and pH = 6.0 were applied. The rate constants (k) for the degradation of SDBS, MB, MP, MO and BPA using 10–20 nm CNTs/MW system were 0.726, 0.679, 0.463, 0.334 and 0.168 min"−"1, respectively. Therefore, this technology may have potential application for the treatment of targeted organic pollutants in wastewaters.

The aqueous electrochemistry of carbon-based surfaces-investigation by scanning tunneling microscopy

Science.gov (United States)

Mühl, T.; Myhra, S.

2007-04-01

Electro-oxidation of carbon-based materials will lead to conversion of the solid to CO2/CO at the anode, with H2 being produced at the cathode. Recent voltammetric investigations of carbon nano-tubes and single crystal graphite have shown that only edge sites and other defect sites are electrochemically active. Local oxidation of diamond-like carbon films (DLC) by an STM tip in moist air followed by imaging allows correlation of topographical change with electro-chemical conditions and surface reactivity. The results may have implications for lithographic processing of carbon surfaces, and may have relevance for electrochemical H2 production.

Creating an AI modeling application for designers and developers

Science.gov (United States)

Houlette, Ryan; Fu, Daniel; Jensen, Randy

2003-09-01

Simulation developers often realize an entity's AI by writing a program that exhibits the intended behavior. These behaviors are often the product of design documents written by designers. These individuals, while possessing a vast knowledge of the subject matter, might not have any programming knowledge whatsoever. To address this disconnect between design and subsequent development, we have created an AI application whereby a designer or developer sketches an entity's AI using a graphical "drag and drop" interface to quickly articulate behavior using a UML-like representation of state charts. Aside from the design-level benefits, the application also features a runtime engine that takes the application's data as input along with a simulation or game interface, and makes the AI operational. We discuss our experience in creating such an application for both designer and developer.

Effect of Aqueous Phase Recycling in Continuous Hydrothermal Liquefaction

DEFF Research Database (Denmark)

Klemmer, Maika; Madsen, René Bjerregaard; Houlberg, Kasper

2016-01-01

was observed with a maximum increase in the first recycle experiment. However, the recycling of the aqueous phase also resulted in lower heating values and higher water contents in the oil fraction. Based on these findings, recycling the aqueous phase is a trade-off between improved yields and reduced burn...... qualities of the biocrude. That said, recycling also lowers carbon discharge to the aqueous fraction, which may contribute significantly to reducing the environmental footprint of an industrial HTL plant....

Aqueous two-phase systems for extractive enzymatic hydrolysis of biomass

DEFF Research Database (Denmark)

Bussamra, Bianca Consorti; Azzoni, Sindelia Freitas; Mussatto, Solange I.

and enzymes, phase diagrams and volumetric ratios. The results of this project will make possible to design a process that enables high sugar concentration during the hydrolysis reaction, overcoming one of the biggest drawbacks regarding the production of second-generation ethanol: the enzymatic inhibition...... optimal aqueous two-phase systems for the separation of sugars and enzymes, which allow the development of an improved second-generation ethanol process.......Sugars derived from lignocellulosic materials are the main carbon sources in bio-based processes aiming to produce renewable fuels and chemicals. One of the major drawbacks during enzymatic hydrolysis of lignocellulosic materials to obtainsugars is the inhibition of enzymes by reaction products...

Influence of formulation and processing variables on properties of itraconazole nanoparticles made by advanced evaporative precipitation into aqueous solution.

Science.gov (United States)

Bosselmann, Stephanie; Nagao, Masao; Chow, Keat T; Williams, Robert O

2012-09-01

Nanoparticles, of the poorly water-soluble drug, itraconazole (ITZ), were produced by the Advanced Evaporative Precipitation into Aqueous Solution process (Advanced EPAS). This process combines emulsion templating and EPAS processing to provide improved control over the size distribution of precipitated particles. Specifically, oil-in-water emulsions containing the drug and suitable stabilizers are sprayed into a heated aqueous solution to induce precipitation of the drug in form of nanoparticles. The influence of processing parameters (temperature and volume of the heated aqueous solution; type of nozzle) and formulation aspects (stabilizer concentrations; total solid concentrations) on the size of suspended ITZ particles, as determined by laser diffraction, was investigated. Furthermore, freeze-dried ITZ nanoparticles were evaluated regarding their morphology, crystallinity, redispersibility, and dissolution behavior. Results indicate that a robust precipitation process was developed such that size distribution of dispersed nanoparticles was shown to be largely independent across the different processing and formulation parameters. Freeze-drying of colloidal dispersions resulted in micron-sized agglomerates composed of spherical, sub-300-nm particles characterized by reduced crystallinity and high ITZ potencies of up to 94% (w/w). The use of sucrose prevented particle agglomeration and resulted in powders that were readily reconstituted and reached high and sustained supersaturation levels upon dissolution in aqueous media.

Application of Artificial Intelligence (AI) Programming Techniques to Tactical Guidance for Fighter Aircraft

Science.gov (United States)

McManus, John W.; Goodrich, Kenneth H.

1989-01-01

A research program investigating the use of Artificial Intelligence (AI) techniques to aid in the development of a Tactical Decision Generator (TDG) for Within-Visual-Range (WVR) air combat engagements is discussed. The application of AI methods for development and implementation of the TDG is presented. The history of the Adaptive Maneuvering Logic (AML) program is traced and current versions of the AML program are compared and contrasted with the TDG system. The Knowledge-Based Systems (KBS) used by the TDG to aid in the decision-making process are outlined in detail and example rules are presented. The results of tests to evaluate the performance of the TDG versus a version of AML and versus human pilots in the Langley Differential Maneuvering Simulator (DMS) are presented. To date, these results have shown significant performance gains in one-versus-one air combat engagements, and the AI-based TDG software has proven to be much easier to modify than the updated FORTRAN AML programs.

Ion Movement in Polypyrrole/Dodecylbenzenesulphonate Films in aqueous and non-aqueous electrolytes