2010-01-01
... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false State. 147.665 Section 147.665... WORKPLACE (NONPROCUREMENT) Definitions § 147.665 State. State means any of the States of the United States... United States. ...
2010-10-01
... 50 Wildlife and Fisheries 9 2010-10-01 2010-10-01 false Definitions. 665.221 Section 665.221..., DEPARTMENT OF COMMERCE (CONTINUED) FISHERIES IN THE WESTERN PACIFIC Hawaii Fisheries § 665.221 Definitions...) Man grey reef shark Carcharhinus amblyrhynchos. Man galapagos shark Carcharhinus galapagensis. Man...
2010-04-01
... 22 Foreign Relations 2 2010-04-01 2010-04-01 true State. 312.665 Section 312.665 Foreign Relations....665 State. State means any of the States of the United States, the District of Columbia, the Commonwealth of Puerto Rico, or any territory or possession of the United States. ...
2010-04-01
... 22 Foreign Relations 1 2010-04-01 2010-04-01 false State. 133.665 Section 133.665 Foreign Relations DEPARTMENT OF STATE MISCELLANEOUS GOVERNMENTWIDE REQUIREMENTS FOR DRUG-FREE WORKPLACE (FINANCIAL ASSISTANCE) Definitions § 133.665 State. State means any of the States of the United States, the District of...
2010-07-01
... 28 Judicial Administration 2 2010-07-01 2010-07-01 false State. 83.665 Section 83.665 Judicial...) Definitions § 83.665 State. State means any of the States of the United States, the District of Columbia, the Commonwealth of Puerto Rico, or any territory or possession of the United States. ...
2010-07-01
... 29 Labor 1 2010-07-01 2010-07-01 true State. 94.665 Section 94.665 Labor Office of the Secretary....665 State. State means any of the States of the United States, the District of Columbia, the Commonwealth of Puerto Rico, or any territory or possession of the United States. ...
2010-07-01
... 29 Labor 4 2010-07-01 2010-07-01 false State. 1472.665 Section 1472.665 Labor Regulations Relating...-FREE WORKPLACE (FINANCIAL ASSISTANCE) Definitions § 1472.665 State. State means any of the States of the United States, the District of Columbia, the Commonwealth of Puerto Rico, or any territory or...
2010-04-01
... 24 Housing and Urban Development 1 2010-04-01 2010-04-01 false State. 21.665 Section 21.665... GOVERNMENTWIDE REQUIREMENTS FOR DRUG-FREE WORKPLACE (GRANTS) Definitions § 21.665 State. State means any of the States of the United States, the District of Columbia, the Commonwealth of Puerto Rico, or any territory...
2010-10-01
... 45 Public Welfare 3 2010-10-01 2010-10-01 false State. 1155.665 Section 1155.665 Public Welfare...) Definitions § 1155.665 State. State means any of the States of the United States, the District of Columbia, the Commonwealth of Puerto Rico, or any territory or possession of the United States. ...
2010-07-01
... 32 National Defense 1 2010-07-01 2010-07-01 false State. 26.665 Section 26.665 National Defense... REQUIREMENTS FOR DRUG-FREE WORKPLACE (FINANCIAL ASSISTANCE) Definitions § 26.665 State. State means any of the States of the United States, the District of Columbia, the Commonwealth of Puerto Rico, or any territory...
2010-07-01
... 31 Money and Finance: Treasury 1 2010-07-01 2010-07-01 false State. 20.665 Section 20.665 Money...-FREE WORKPLACE (FINANCIAL ASSISTANCE) Definitions § 20.665 State. State means any of the States of the United States, the District of Columbia, the Commonwealth of Puerto Rico, or any territory or possession...
2010-04-01
... 20 Employees' Benefits 2 2010-04-01 2010-04-01 false State. 439.665 Section 439.665 Employees... ASSISTANCE) Definitions § 439.665 State. State means any of the States of the United States, the District of Columbia, the Commonwealth of Puerto Rico, or any territory or possession of the United States. ...
2010-01-01
... 10 Energy 4 2010-01-01 2010-01-01 false State. 607.665 Section 607.665 Energy DEPARTMENT OF ENERGY...) Definitions § 607.665 State. State means any of the States of the United States, the District of Columbia, the Commonwealth of Puerto Rico, or any territory or possession of the United States. ...
2010-04-01
... 22 Foreign Relations 2 2010-04-01 2010-04-01 true State. 1509.665 Section 1509.665 Foreign... ASSISTANCE) Definitions § 1509.665 State. State means any of the States of the United States, the District of Columbia, the Commonwealth of Puerto Rico, or any territory or possession of the United States. ...
2010-10-01
... 49 Transportation 1 2010-10-01 2010-10-01 false State. 32.665 Section 32.665 Transportation Office... ASSISTANCE) Definitions § 32.665 State. State means any of the States of the United States, the District of Columbia, the Commonwealth of Puerto Rico, or any territory or possession of the United States. ...
2010-04-01
... 22 Foreign Relations 1 2010-04-01 2010-04-01 false State. 210.665 Section 210.665 Foreign... (FINANCIAL ASSISTANCE) Definitions § 210.665 State. State means any of the States of the United States, the District of Columbia, the Commonwealth of Puerto Rico, or any territory or possession of the United States. ...
2010-10-01
... 45 Public Welfare 3 2010-10-01 2010-10-01 false State. 630.665 Section 630.665 Public Welfare... DRUG-FREE WORKPLACE (FINANCIAL ASSISTANCE) Definitions § 630.665 State. State means any of the States of the United States, the District of Columbia, the Commonwealth of Puerto Rico, or any territory or...
2010-04-01
... 22 Foreign Relations 2 2010-04-01 2010-04-01 true State. 1008.665 Section 1008.665 Foreign... ASSISTANCE) Definitions § 1008.665 State. State means any of the States of the United States, the District of Columbia, the Commonwealth of Puerto Rico, or any territory or possession of the United States. ...
2010-10-01
... 45 Public Welfare 3 2010-10-01 2010-10-01 false State. 1173.665 Section 1173.665 Public Welfare...) Definitions § 1173.665 State. State means any of the States of the United States, the District of Columbia, the Commonwealth of Puerto Rico, or any territory or possession of the United States. ...
2010-01-01
... 2 Grants and Agreements 1 2010-01-01 2010-01-01 false State. 182.665 Section 182.665 Grants and... GOVERNMENTWIDE REQUIREMENTS FOR DRUG-FREE WORKPLACE (FINANCIAL ASSISTANCE) Definitions § 182.665 State. State means any of the States of the United States, the District of Columbia, the Commonwealth of Puerto Rico...
2010-01-01
... 14 Aeronautics and Space 5 2010-01-01 2010-01-01 false State. 1267.665 Section 1267.665... WORKPLACE (FINANCIAL ASSISTANCE) Definitions § 1267.665 State. State means any of the States of the United States, the District of Columbia, the Commonwealth of Puerto Rico, or any territory or possession of the...
2010-07-01
... 40 Protection of Environment 1 2010-07-01 2010-07-01 false State. 36.665 Section 36.665 Protection... REQUIREMENTS FOR DRUG-FREE WORKPLACE (FINANCIAL ASSISTANCE) Definitions § 36.665 State. State means any of the States of the United States, the District of Columbia, the Commonwealth of Puerto Rico, or any territory...
2010-04-01
... 21 Food and Drugs 9 2010-04-01 2010-04-01 false State. 1405.665 Section 1405.665 Food and Drugs... ASSISTANCE) Definitions § 1405.665 State. State means any of the States of the United States, the District of Columbia, the Commonwealth of Puerto Rico, or any territory or possession of the United States. ...
2010-01-01
... 15 Commerce and Foreign Trade 1 2010-01-01 2010-01-01 false State. 29.665 Section 29.665 Commerce... WORKPLACE (FINANCIAL ASSISTANCE) Definitions § 29.665 State. State means any of the States of the United States, the District of Columbia, the Commonwealth of Puerto Rico, or any territory or possession of the...
2010-10-01
... 43 Public Lands: Interior 1 2010-10-01 2010-10-01 false State. 43.665 Section 43.665 Public Lands... (FINANCIAL ASSISTANCE) Definitions § 43.665 State. State means any of the States of the United States, the District of Columbia, the Commonwealth of Puerto Rico, or any territory or possession of the United States. ...
2010-07-01
... 34 Education 1 2010-07-01 2010-07-01 false State. 84.665 Section 84.665 Education Office of the...) Definitions § 84.665 State. State means any of the States of the United States, the District of Columbia, the Commonwealth of Puerto Rico, or any territory or possession of the United States. (Authority: E.O.s 12549 and...
46 CFR 154.665 - Welding procedures.
2010-10-01
... 46 Shipping 5 2010-10-01 2010-10-01 false Welding procedures. 154.665 Section 154.665 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) CERTAIN BULK DANGEROUS CARGOES SAFETY STANDARDS... Construction § 154.665 Welding procedures. Welding procedure tests for cargo tanks for a design temperature...
2010-07-01
... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false State. 105-74.665 Section 105-74.665 Public Contracts and Property Management Federal Property Management Regulations System...-GOVERNMENTWIDE REQUIREMENTS FOR DRUG-FREE WORKPLACE (FINANCIAL ASSISTANCE) Definitions § 105-74.665 State. State...
49 CFR 665.25 - Transportation of vehicle.
2010-10-01
... 49 Transportation 7 2010-10-01 2010-10-01 false Transportation of vehicle. 665.25 Section 665.25 Transportation Other Regulations Relating to Transportation (Continued) FEDERAL TRANSIT ADMINISTRATION, DEPARTMENT OF TRANSPORTATION BUS TESTING Operations § 665.25 Transportation of vehicle. A manufacturer shall...
2010-01-01
... 7 Agriculture 15 2010-01-01 2010-01-01 false State. 3021.665 Section 3021.665 Agriculture... State. State means any of the States of the United States, the District of Columbia, the Commonwealth of Puerto Rico, or any territory or possession of the United States. ...
Observations of a Cast Cu-Cr-Zr Alloy
Ellis, David L.
2006-01-01
Prior work has demonstrated that Cu-Cr-Nb alloys have considerable advantages over the copper alloys currently used in regeneratively cooled rocket engine liners. Observations indicated that Zr and Nb have similar chemical properties and form very similar compounds. Glazov and Zakharov et al. reported the presence of Cr2Zr in Cu-Cr-Zr alloys with up to 3.5 wt% Cr and Zr though Zeng et al. calculated that Cr2Zr could not exist in a ternary Cu-Cr-Zr alloy. A cast Cu-6.15 wt% Cr-5.25 wt% Zr alloy was examined to determine if the microstructure developed would be similar to GRCop-84 (Cu-6.65 wt% Cr-5.85 wt% Nb). It was observed that the Cu-Cr-Zr system did not form any Cr2Zr even after a thermal exposure at 875 C for 176.5 h. Instead the alloy consisted of three phases: Cu, Cu5Zr, and Cr.
Lifescience Database Archive (English)
Full Text Available SH (Link to library) SHA665 (Link to dictyBase) - - - Contig-U15540-1 - (Link to Or...iginal site) - - SHA665Z 676 - - - - Show SHA665 Library SH (Link to library) Clone ID SHA665 (Link to dicty...Base) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U15540-1 Original site URL http://dictycdb.b...TQIDDKTGIFDSQRFLAFNNPQAMSKYESYRIYIHPSLGY SGNAKRFKQQPDVNEKALILDGNVYDGHLNPIYNCKICTE...ACWNLLEPMHR NYYQPIQFKLPSFPDTSLPITQIDDKTGIFDSQRFLAFNNPQAMSKYESYRIYIHPSLGY SGNAKRFKQQPDVNEKALILDGNVYDGHLNPIYNCKICT
2010-07-01
... 36 Parks, Forests, and Public Property 3 2010-07-01 2010-07-01 false State. 1212.665 Section 1212... GOVERNMENTWIDE REQUIREMENTS FOR DRUG-FREE WORKPLACE (FINANCIAL ASSISTANCE) Definitions § 1212.665 State. State means any of the States of the United States, the District of Columbia, the Commonwealth of Puerto Rico...
2010-07-01
... 38 Pensions, Bonuses, and Veterans' Relief 2 2010-07-01 2010-07-01 false State. 48.665 Section 48... REQUIREMENTS FOR DRUG-FREE WORKPLACE (FINANCIAL ASSISTANCE) Definitions § 48.665 State. State means any of the States of the United States, the District of Columbia, the Commonwealth of Puerto Rico, or any territory...
Directory of Open Access Journals (Sweden)
Jessica E Potts
Full Text Available To determine the effects of glucagon-like peptide-1 receptor agonists compared with placebo and other anti-diabetic agents on weight loss in overweight or obese patients with type 2 diabetes mellitus.Electronic searches were conducted for randomised controlled trials that compared a glucagon-like peptide-1 receptor agonist therapy at a clinically relevant dose with a comparator treatment (other type 2 diabetes treatment or placebo in adults with type 2 diabetes and a mean body mass index ≥ 25 kg/m2. Pair-wise meta-analyses and mixed treatment comparisons were conducted to examine the difference in weight change at six months between the glucagon-like peptide-1 receptor agonists and each comparator.In the mixed treatment comparison (27 trials, the glucagon-like peptide-1 receptor agonists were the most successful in terms of weight loss; exenatide 2 mg/week: -1.62 kg (95% CrI: -2.95 kg, -0.30 kg, exenatide 20 μg: -1.37 kg (95% CI: -222 kg, -0.52 kg, liraglutide 1.2 mg: -1.01 kg (95%CrI: -2.41 kg, 0.38 kg and liraglutide 1.8 mg: -1.51 kg (95% CI: -2.67 kg, -0.37 kg compared with placebo. There were no differences between the GLP-1 receptor agonists in terms of weight loss.This review provides evidence that glucagon-like peptide-1 receptor agonist therapies are associated with weight loss in overweight or obese patients with type 2 diabetes with no difference in weight loss seen between the different types of GLP-1 receptor agonists assessed.
46 CFR 108.665 - Appliances for watertight integrity.
2010-10-01
... 46 Shipping 4 2010-10-01 2010-10-01 false Appliances for watertight integrity. 108.665 Section 108.665 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) A-MOBILE OFFSHORE DRILLING UNITS DESIGN AND EQUIPMENT Equipment Markings and Instructions § 108.665 Appliances for watertight integrity...
50 CFR 665.98 - Management area.
2010-10-01
... 50 Wildlife and Fisheries 9 2010-10-01 2010-10-01 false Management area. 665.98 Section 665.98 Wildlife and Fisheries FISHERY CONSERVATION AND MANAGEMENT, NATIONAL OCEANIC AND ATMOSPHERIC ADMINISTRATION... Management area. The American Samoa fishery management area is the EEZ seaward of the Territory of American...
50 CFR 665.220 - Hawaii coral reef ecosystem fisheries. [Reserved
2010-10-01
... 50 Wildlife and Fisheries 9 2010-10-01 2010-10-01 false Hawaii coral reef ecosystem fisheries. [Reserved] 665.220 Section 665.220 Wildlife and Fisheries FISHERY CONSERVATION AND MANAGEMENT, NATIONAL... PACIFIC Hawaii Fisheries § 665.220 Hawaii coral reef ecosystem fisheries. [Reserved] ...
50 CFR 665.420 - Mariana coral reef ecosystem fisheries. [Reserved
2010-10-01
... 50 Wildlife and Fisheries 9 2010-10-01 2010-10-01 false Mariana coral reef ecosystem fisheries. [Reserved] 665.420 Section 665.420 Wildlife and Fisheries FISHERY CONSERVATION AND MANAGEMENT, NATIONAL... PACIFIC Mariana Archipelago Fisheries § 665.420 Mariana coral reef ecosystem fisheries. [Reserved] ...
50 CFR 665.620 - PRIA coral reef ecosystem fisheries. [Reserved
2010-10-01
... 50 Wildlife and Fisheries 9 2010-10-01 2010-10-01 false PRIA coral reef ecosystem fisheries. [Reserved] 665.620 Section 665.620 Wildlife and Fisheries FISHERY CONSERVATION AND MANAGEMENT, NATIONAL... PACIFIC Pacific Remote Island Area Fisheries § 665.620 PRIA coral reef ecosystem fisheries. [Reserved] ...
10 CFR 603.665 - Periodic audits of nonprofit participants.
2010-01-01
... 10 Energy 4 2010-01-01 2010-01-01 false Periodic audits of nonprofit participants. 603.665 Section 603.665 Energy DEPARTMENT OF ENERGY (CONTINUED) ASSISTANCE REGULATIONS TECHNOLOGY INVESTMENT AGREEMENTS Award Terms Affecting Participants' Financial, Property, and Purchasing Systems Financial Matters...
50 CFR 665.227 - Allowable gear and gear restrictions.
2010-10-01
... 50 Wildlife and Fisheries 9 2010-10-01 2010-10-01 false Allowable gear and gear restrictions. 665... Fisheries § 665.227 Allowable gear and gear restrictions. (a) Hawaii coral reef ecosystem MUS may be taken only with the following allowable gear and methods: (1) Hand harvest; (2) Spear; (3) Slurp gun; (4...
50 CFR 665.427 - Allowable gear and gear restrictions.
2010-10-01
... 50 Wildlife and Fisheries 9 2010-10-01 2010-10-01 false Allowable gear and gear restrictions. 665... Archipelago Fisheries § 665.427 Allowable gear and gear restrictions. (a) Mariana coral reef ecosystem MUS may be taken only with the following allowable gear and methods: (1) Hand harvest; (2) Spear; (3) Slurp...
50 CFR 665.127 - Allowable gear and gear restrictions.
2010-10-01
... 50 Wildlife and Fisheries 9 2010-10-01 2010-10-01 false Allowable gear and gear restrictions. 665... Fisheries § 665.127 Allowable gear and gear restrictions. (a) American Samoa coral reef ecosystem MUS may be taken only with the following allowable gear and methods: (1) Hand harvest; (2) Spear; (3) Slurp gun; (4...
50 CFR 665.627 - Allowable gear and gear restrictions.
2010-10-01
... 50 Wildlife and Fisheries 9 2010-10-01 2010-10-01 false Allowable gear and gear restrictions. 665... Island Area Fisheries § 665.627 Allowable gear and gear restrictions. (a) Coral reef ecosystem MUS may be taken only with the following allowable gear and methods: (1) Hand harvest; (2) Spear; (3) Slurp gun; (4...
Comparing Cr, and N only doping with (Cr,N)-codoping for enhancing visible light reactivity of TiO2
International Nuclear Information System (INIS)
Li, Yuan; Wang, Wei; Qiu, Xiaofeng; Meyer, Harry M. III; Paranthaman, Mariappan Parans; Eres, Gyula; Zhang, Zhenyu; Gu, Baohua
2011-01-01
The photoreactivity of titania (TiO2) nanoclusters with varying levels of N or Cr-doping, or (Cr,N)-codoping, was systematically investigated using photodegradation of methyl orange in aqueous suspensions. The shifting of the TiO2 absorption edge into the visible spectral region that is primarily attributable to band gap narrowing was found to be a reliable metric for estimating the photoreactivity of the doped nanoclusters. Compared to the weak response with undoped and N-doped TiO2, Cr-doping and (Cr, N)-codoping were found to significantly enhance photodegradation of methyl orange under visible light. The initial reaction rates increase from about 0 to above 1.6 10-2 min-1 when the doping concentration of Cr in TiO2 increases from 0 to 5%. In stark contrast, under UV irradiation, doping is not only ineffective but detrimental to the photoreactivity, and all doping including N or Cr only and (Cr, N)-codoping were found to reduce photoreactivity.
2010-04-01
... TREASURY LIQUORS âTIED-HOUSEâ Unlawful Inducements Extension of Credit § 6.65 General. Extension of credit by an industry member to a retailer for a period of time in excess of 30 days from the date of...
47 CFR 73.665 - Use of TV aural baseband subcarriers.
2010-10-01
... 47 Telecommunication 4 2010-10-01 2010-10-01 false Use of TV aural baseband subcarriers. 73.665... RADIO BROADCAST SERVICES Television Broadcast Stations § 73.665 Use of TV aural baseband subcarriers. Licensees of TV broadcast stations may transmit, without further authorization from the FCC, subcarriers and...
50 CFR Figure 1 to Part 665 - Carapace Length of Lobsters
2010-10-01
... 50 Wildlife and Fisheries 9 2010-10-01 2010-10-01 false Carapace Length of Lobsters 1 Figure 1 to Part 665 Wildlife and Fisheries FISHERY CONSERVATION AND MANAGEMENT, NATIONAL OCEANIC AND ATMOSPHERIC... Part 665—Carapace Length of Lobsters ER14JA10.126 ...
26 CFR 1.665(f)-1A - Undistributed capital gain.
2010-04-01
... 26 Internal Revenue 8 2010-04-01 2010-04-01 false Undistributed capital gain. 1.665(f)-1A Section... Beginning on Or After January 1, 1969 § 1.665(f)-1A Undistributed capital gain. (a) Domestic trusts. (1) The term undistributed capital gain means (in the case of a trust other than a foreign trust created by a U...
PARTIAL AGONISTS, FULL AGONISTS, ANTAGONISTS - DILEMMAS OF DEFINITION
HOYER, D; BODDEKE, HWGM
The absence of selective antagonists makes receptor characterization difficult, and largely dependent on the use of agonists. However, there has been considerable debate as to whether certain drugs acting at G protein-coupled receptors are better described as agonists, partial agonists or
Roy, Prabir Kumar
2018-04-01
This paper highlights a comparative assessment of creep life of 1.25Cr-0.5Mo, 2.25Cr-1Mo and modified 9Cr-1Mo steels based on accelerated creep rupture tests. Creep rupture test data have been analysed and creep life of the above mentioned materials have been assessed using Larson Miller parameter at the stress levels of 60 and 42 MPa for different temperatures. Limiting steam temperatures for minimum design life of 105 h at 42 and 60 MPa for the above mentioned steels have also been calculated. Microstructural studies for the three above mentioned steels are also done.
Data acquisition for FNAL E665
International Nuclear Information System (INIS)
Geesaman, D.F.; Green, M.C.; Kaufman, S.
1989-01-01
The data acquisition system for FNAL E665, an experiment to study deep inelastic muon scattering from nucleons and nuclei, is described. The system is built with the FNAL VAXONLINE and RSX DA building blocks. The structure, capabilities and limitations for data flow, control and monitoring are discussed. 20 refs., 1 fig
Energy Technology Data Exchange (ETDEWEB)
Hwang, Dae Hee; Hong, Ser Gi [Kyung Hee University, Yongin (Korea, Republic of); In, Wang Kee [KAERI, Daejeon (Korea, Republic of)
2016-05-15
In this work, a comparative neutronic analysis of the cores using ATFs which include metallic micro-cell UO{sub 2}-Cr, UO{sub 2}-Mo pellets and Cr-based alloy coating on cladding was performed to show the effects of the ATF fuels on the core performance. In this study, the cores having different ATFs use the same initial uranium enrichments. The ATF concepts studied in this work are the metallic microcell UO{sub 2} pellets containing Cr or Mo with cladding outer coating composed of Cr-based alloy which have been suggested as the ATF concepts in KAERI (Korea Atomic Energy Research Institute). The metallic micro-cell pellets and Cr-based alloy coating can enhance thermal conductivity of fuel and reduce the production of hydrogen from the reaction of cladding with coolant, respectively. The objective of this work is to compare neutronic characteristics of commercial PWR equilibrium cores utilizing the different variations of metallic micro-cell UO{sub 2} pellets with cladding coating composed of Cr-based alloy. The results showed that the cores using UO{sub 2}-Cr and UO{sub 2}-Mo pellets with Cr-based alloy coating on cladding have reduced cycle lengths by 60 and 106 EFPDs, respectively, in comparison with the reference UO{sub 2} fueled core due to the reduced heavy metal inventories and large thermal absorption cross section but they do not have any significant differences in the core performances parameters. However, it is notable that the core fueled the micro-cell UO{sub 2}-Mo pellet and Cr-based alloy coating has considerably more negative MTC and slightly more negative FTC than the other cases. These characteristics of the core using micro-cell UO{sub 2}-Mo pellet and Cr-based alloy coating is due to the hard neutron spectrum and large capture resonance cross section of Mo isotopes.
Morote, Juan; Comas, Inma; Planas, Jacques; Maldonado, Xavier; Celma, Ana; Placer, José; Ferrer, Roser; Carles, Joan; Regis, Lucas
2018-04-01
Serum testosterone measurement is recommended to assess the efficacy of androgen deprivation therapy (ADT) and to diagnose castration resistance in patients with prostate cancer (PCa). Currently, the accepted castrate level of serum testosterone is 50 ng/dL. Liquid chromatography and tandem mass spectrometry (LC MSMS) is the appropriate method to measure testosterone, especially at low levels. However, worldwide, chemiluminescent assays (CLIAs) are used in clinical laboratories, despite their lack of accuracy and reproducibility, because they are automatable, fast, sensitive, and inexpensive. We compared serum testosterone levels measured using LC MSMS and CLIAs in 126 patients with PCa undergoing luteinizing hormone-releasing hormone (LHRH) agonist therapy. The median serum testosterone level was 14.0 ng/dL (range, 2.0-67.0 ng/dL) with LC MSMS and 31.9 ng/dL (range, 10.0-91.6 ng/dL) with CLIA (P 50 ng/dL in 3 patients (2.4%). These ranges were found in 34 (27%), 72 (57.1%), and 20 (15.9%) patients when testosterone was measured using CLIA (P < .001). The castrate level of serum testosterone using LC MSMS and CLIA was 39.8 ng/dL (95% confidence interval [CI], 37.1-43.4 ng/dL) and 66.5 ng/dL (95% CI, 62.3-71.2 ng/dL), respectively. We found that CLIA overestimated the testosterone levels in PCa patients undergoing LHRH agonist therapy. Thus, the castration level was incorrectly considered inadequate with CLIA in almost 15% of patients. The true castration level of serum testosterone using an appropriate method is < 50 ng/dL. Copyright © 2017 Elsevier Inc. All rights reserved.
Matran, R; Naline, E; Advenier, C; Duroux, P
1989-01-01
The aim of this study was to investigate quantitatively the action of and the interaction between beta-adrenergic receptor agonists in desensitizing guinea pig isolated trachea. It was also to evaluate the influence of substances whose effects on desensitization are either disputed (theophylline, indomethacin, ketotifen, hydrocortisone) or unknown (nicardipine, Bay K 8644, fenspiride, adenosine). Tracheal strips were contracted with histamine (5 x 10(-5) M) or acetylcholine (5.10(-5) M) and concentration-response (C/R) curves for various beta-adrenoceptor agonists were determined before and after incubation (20 min to 4 h) with the same beta-adrenoceptor agonist (autodesensitization), with other beta-adrenoceptor agonists (cross-desensitization), or with a beta-adrenoceptor agonist and another substance. Our results show that the autodesensitization induced by isoprenaline is concentration dependent and that concentration dependence is more pronounced with salbutamol and fenoterol than with isoprenaline and adrenaline with respect to autodesensitization: shifts (log unit) of the C/R curves were 0.59 +/- 0.06 (N = 5) for salbutamol (10(-5) M), 0.78 +/- 0.09 (N = 5) for fenoterol (10(-6) M), 0.30 +/- 0.04 (N = 9) for isoprenaline (10(-5) M), and 0.33 +/- 0.05 (N = 5) for adrenaline (10(-5) M). Our studies of cross-desensitization (desensitization to isoprenaline, adrenaline, salbutamol, and fenoterol induced by incubation with isoprenaline 10(-5) M) showed a significantly greater shift in the C/R curves for fenoterol (0.56 +/- 0.08, N = 5) and salbutamol (0.62 +/- 0.05, N = 5) than for adrenaline (0.35 +/- 0.07, N = 5) and isoprenaline itself (0.30 +/- 0.05, N = 9). Of the substances we studied, none modified the desensitization induced by isoprenaline except hydrocortisone and adenosine. Hydrocortisone (10(-8) M) reduced it significantly, although to a negligible extent. Adenosine (3 x 10(-4) M) did not shift the C/R curve to isoprenaline by itself, but incubation
DEFF Research Database (Denmark)
Vogensen, Stine Byskov; Greenwood, Jeremy R; Bunch, Lennart
2011-01-01
The neurotransmitter (S)-glutamate [(S)-Glu] is responsible for most of the excitatory neurotransmission in the central nervous system. The effect of (S)-Glu is mediated by both ionotropic and metabotropic receptors. Glutamate receptor agonists are generally a-amino acids with one or more...... stereogenic centers due to strict requirements in the agonist binding pocket of the activated state of the receptor. By contrast, there are many examples of achiral competitive antagonists. The present review addresses how stereochemistry affects the activity of glutamate receptor ligands. The review focuses...... mainly on agonists and discusses stereochemical and conformational considerations as well as biostructural knowledge of the agonist binding pockets, which is useful in the design of glutamate receptor agonists. Examples are chosen to demonstrate how stereochemistry not only determines how the agonist...
Evaluation of partial beta-adrenoceptor agonist activity.
Lipworth, B J; Grove, A
1997-01-01
A partial beta-adrenoceptor (beta-AR) agonist will exhibit opposite agonist and antagonist activity depending on the prevailing degree of adrenergic tone or the presence of a beta-AR agonist with higher intrinsic activity. In vivo partial beta-AR agonist activity will be evident at rest with low endogenous adrenergic tone, as for example with chronotropicity (beta 1/beta 2), inotropicity (beta 1) or peripheral vasodilatation and finger tremor (beta 2). beta-AR blocking drugs which have partial agonist activity may exhibit a better therapeutic profile when used for hypertension because of maintained cardiac output without increased systemic vascular resistance, along with an improved lipid profile. In the presence of raised endogenous adrenergic tone such as exercise or an exogenous full agonist, beta-AR subtype antagonist activity will become evident in terms of effects on exercise induced heart rate (beta 1) and potassium (beta 2) responses. Reduction of exercise heart rate will occur to a lesser degree in the case of a beta-adrenoceptor blocker with partial beta 1-AR agonist activity compared with a beta-adrenoceptor blocker devoid of partial agonist activity. This may result in reduced therapeutic efficacy in the treatment of angina on effort when using beta-AR blocking drugs with partial beta 1-AR agonist activity. Effects on exercise hyperkalaemia are determined by the balance between beta 2-AR partial agonist activity and endogenous adrenergic activity. For predominantly beta 2-AR agonist such as salmeterol and salbutamol, potentiation of exercise hyperkalaemia occurs. For predominantly beta 2-AR antagonists such as carteolol, either potentiation or attenuation of exercise hyperkalaemia occurs at low and high doses respectively. beta 2-AR partial agonist activity may also be expressed as antagonism in the presence of an exogenous full agonist, as for example attenuation of fenoterol induced responses by salmeterol. Studies are required to investigate whether
Energy Technology Data Exchange (ETDEWEB)
Peng, Lixia [Institute of Materials Research, China Academy of Engineering Physics, Jiangyou, Sichuan Province 621908 (China); Li, Xiongwei [Institute of Metal Research, China Academy of Sciences, 72 Wenhua Road, Shenyang 110016 (China); Fan, Zhijian [Institute of Nuclear Physics and Chemistry, China Academy of Engineering Physics, Mianyang, Sichuan Province 621900 (China); Jiang, Chunli; Zhou, Ping [Institute of Materials Research, China Academy of Engineering Physics, Jiangyou, Sichuan Province 621908 (China); Lai, Xinchun, E-mail: laixinchun@caep.cn [Institute of Materials Research, China Academy of Engineering Physics, Jiangyou, Sichuan Province 621908 (China)
2017-04-15
Recrystallization texture evolution of rolled V-4Cr-4Ti alloy has been investigated by quasi-in-situ EBSD (electron back-scattering diffraction) method. Concurrently, the precipitates were characterized by SEM (Scanning Electron Microscopy). It was found that both the initial rolling textures and the distribution of the precipitates affected the formation of the recrystallization texture. It was revealed that the texture transformations of (558) 〈110〉 + (665) 〈110〉 to (334) 〈483〉 + (665) 〈1 1 2.4〉 were possibly attributed to the selective drag induced by the sparsely dispersed Ti-rich precipitates. While the densely distributed Ti-rich precipitates were responsible for the randomized recrystallization texture. Finally, when the precipitates were absent, the orientation changes from (112) 〈110〉 and (558) 〈110〉 to (111) 〈112〉 and (001) <110> to (001) <520> were observed. - Highlights: • Micro recrystallization texture evolution in V-4Cr-4Ti alloys is reported for the first time. • The volume fraction of Ti-rich precipitates has significant effect on the recrystallization texture evolution. • The dissolution of the Ti-rich precipitates above 1100 °C induces the strengthening of (111) <112> texture.
Sun, Wen-Chong; Pei, Ling
2016-07-01
Propofol exerts a cytotoxic influence over immature neurocytes. Our previous study revealed that clinically relevant doses of propofol accelerated apoptosis of primary cultured astrocytes of developing rodent brains via rno-miR-665 regulation. However, the role of rno-miR-665 during the growth spurt of neonatal rodent brains in vivo is still uncertain. Post-natal day 7 (P7) rats received a single injection of propofol 30 mg/kg intraperitoneally (i.p.), and neuroapoptosis of hippocampal astrocytes was analyzed by immunofluorescence and scanning electron microscopy. The differential expression of rno-miR-665, BCL2L1 (Bcl-xl), and cleaved caspase 3 (CC3) was surveyed by qRT-PCR and western blotting. In addition, the utility of A-1155463, a highly potent and BCL2L1-selective antagonist, was aimed to assess the contribution of BCL2L1 for neuroglial survival. Following the intraventricular injection of lentivirus rno-miR-665, neuroprotection was detected by 5-point scale measurement. The single dose of propofol 30 mg/kg triggered dose-dependent apoptosis of developing hippocampal astrocytes. Meanwhile, propofol triggered both rno-miR-665 and CC3, and depressed BCL2L1, which was predicted as one target gene of rno-miR-665. Combination treatment with A-1155463 and propofol induced lower mRNA and protein levels of BCL2L1 and more CC3 activation than propofol treatment alone in vivo. The lentivirus-mediated knockdown of rno-miR-665 elevated BCL2L1 and attenuated CC3 levels, whereas up-regulation of rno-miR-665 suppressed BCL2L1 and induced CC3 expression in vivo. More importantly, rno-miR-665 antagomir infusion improved neurological outcomes of pups receiving propofol during the brain growth spurt. Rno-miR-665, providing a potential target for alternative therapeutics for pediatric anesthesia, is susceptible to propofol by negatively targeting antiapoptotic BCL2L1. Relatively little is known about the association between exposure of astrocytes to brief propofol
Directory of Open Access Journals (Sweden)
Ronald Anderson
2014-01-01
Full Text Available The clinical relevance of the anti-inflammatory properties of beta-2 agonists remains contentious possibly due to differences in their molecular structures and agonist activities. The current study has compared the effects of 3 different categories of β2-agonists, namely, salbutamol (short-acting, formoterol (long-acting and indacaterol (ultra-long-acting, at concentrations of 1–1000 nM, with human blood neutrophils in vitro. Neutrophils were activated with either N-formyl-L-methionyl-L-leucyl-L-phenylalanine (fMLP, 1 µM or platelet-activating factor (PAF, 200 nM in the absence and presence of the β2-agonists followed by measurement of the generation of reactive oxygen species and leukotriene B4, release of elastase, and expression of the β2-integrin, CR3, using a combination of chemiluminescence, ELISA, colorimetric, and flow cytometric procedures respectively. These were correlated with alterations in the concentrations of intracellular cyclic-AMP and cytosolic Ca2+. At the concentrations tested, formoterol and indacaterol caused equivalent, significant (P<0.05 at 1–10 nM dose-related inhibition of all of the pro-inflammatory activities tested, while salbutamol was much less effective (P<0.05 at 100 nM and higher. Suppression of neutrophil reactivity was accompanied by elevations in intracellular cAMP and accelerated clearance of Ca2+ from the cytosol of activated neutrophils. These findings demonstrate that β2-agonists vary with respect to their suppressive effects on activated neutrophils.
20 CFR 416.665 - How does your representative payee account for the use of benefits?
2010-04-01
... for the use of benefits? 416.665 Section 416.665 Employees' Benefits SOCIAL SECURITY ADMINISTRATION... in order to make accounting reports and must make those records available upon our request. If your representative payee fails to provide an annual accounting of benefits or other required reports, we may require...
7 CFR 205.665 - Noncompliance procedure for certifying agents.
2010-01-01
... applicable State organic program's governing State official all records concerning its certification...) ORGANIC FOODS PRODUCTION ACT PROVISIONS NATIONAL ORGANIC PROGRAM Administrative Compliance § 205.665... agent. (f) Cessation of certification activities. A certifying agent whose accreditation is suspended or...
20 CFR 665.300 - What are rapid response activities and who is responsible for providing them?
2010-04-01
... responsible for providing them? 665.300 Section 665.300 Employees' Benefits EMPLOYMENT AND TRAINING... natural or other disaster resulting in a mass job dislocation. (b) The State is responsible for providing.... The State must establish methods by which to provide additional assistance to local areas that...
Cr-Ni ALLOY ELECTRODEPOSITION AND COMPARISON WITH CONVENTIONAL PURE Cr COATING TECHNIQUE
Directory of Open Access Journals (Sweden)
M. Moniruzzaman
2012-12-01
Full Text Available Cr coating is widely used as the outer surface of precision parts due to its attractive appearance and superior corrosion resistance properties. It is obtained by electrodeposition via a conventional bath with hexavalent Cr ions. This manufacturing technique has many drawbacks, such as very low efficiency and high operating temperature and it is hazardous to health. In this work, we studied a Cr-Ni alloy deposition technique and compared the alloy coating properties to those with conventional Cr coating. Sequential two-step alloy electrodeposition was also compared. We took varying concentrations of Cr, Ni and complexing agents for the electrodeposition of Cr-Ni alloy and sequential Cr-Ni alloy coating on mild steel. Operating parameters, i.e. current density and temperature, were varied to examine their effects on the coating properties. The coatings thus obtained were characterized by visual observation, corrosion test, microhardness measurement, morphology and chemical analysis. The Cr-Ni alloy coating was found to be more corrosion resistant in 5% NaCl solution and harder than the pure Cr coating obtained by conventional electrodeposition. Toxic gas was produced in a much lower extent in the alloy coating than the conventional Cr coating technique. Again, the two-step Cr-Ni alloy coating was found better in terms of corrosion resistance as well as hardness compared to the Cr-Ni alloy coating. The process was also found to be much more environmentally friendly.
Modification of opiate agonist binding by pertussis toxin
Energy Technology Data Exchange (ETDEWEB)
Abood, M.E.; Lee, N.M.; Loh, H.H.
1986-03-05
Opiate agonist binding is decreased by GTP, suggesting the possible involvement of GTP binding proteins in regulation of opiate receptor binding. This possibility was addressed by asking whether pertussis toxin treatment, which results in ADP-ribosylation and modification of G proteins, would alter opiate agonist binding. The striatum was chosen for the initial brain area to be studied, since regulation of opiate action in this area had been shown to be modified by pertussis toxin. Treatment of striatal membranes with pertussis toxin results in up to a 55% decrease in /sup 3/(H)-DADLE binding as compared with membranes treated identically without toxin. This corresponds to a near complete ADP-ribosylation of both G proteins in the striatal membrane. The decrease in agonist binding appears to be due to an altered affinity of the receptor for agonist as opposed to a decrease in the number of sites. This effect of pertussis toxin on opiate agonist binding demonstrates the actual involvement of G proteins in regulation of opiate receptor binding.
Modification of opiate agonist binding by pertussis toxin
International Nuclear Information System (INIS)
Abood, M.E.; Lee, N.M.; Loh, H.H.
1986-01-01
Opiate agonist binding is decreased by GTP, suggesting the possible involvement of GTP binding proteins in regulation of opiate receptor binding. This possibility was addressed by asking whether pertussis toxin treatment, which results in ADP-ribosylation and modification of G proteins, would alter opiate agonist binding. The striatum was chosen for the initial brain area to be studied, since regulation of opiate action in this area had been shown to be modified by pertussis toxin. Treatment of striatal membranes with pertussis toxin results in up to a 55% decrease in 3 (H)-DADLE binding as compared with membranes treated identically without toxin. This corresponds to a near complete ADP-ribosylation of both G proteins in the striatal membrane. The decrease in agonist binding appears to be due to an altered affinity of the receptor for agonist as opposed to a decrease in the number of sites. This effect of pertussis toxin on opiate agonist binding demonstrates the actual involvement of G proteins in regulation of opiate receptor binding
20 CFR 408.665 - How does your representative payee account for the use of your SVB payments?
2010-04-01
... for the use of your SVB payments? 408.665 Section 408.665 Employees' Benefits SOCIAL SECURITY... records of how benefits were used in order to provide accounting reports and must make those records available upon our request. If your representative payee fails to provide an annual accounting of benefits...
50 CFR 665.812 - Sea turtle take mitigation measures.
2010-10-01
....812 Section 665.812 Wildlife and Fisheries FISHERY CONSERVATION AND MANAGEMENT, NATIONAL OCEANIC AND... of hook sizes and styles used by the vessel. (B) Extended reach handle. The hook removal device must... hook sizes and styles used by the vessel. (B) Handle. The handle must have a length equal to or greater...
Uchida, Masahiko; Ito, Tetsuhide; Nakamura, Taichi; Hijioka, Masayuki; Igarashi, Hisato; Oono, Takamasa; Kato, Masaki; Nakamura, Kazuhiko; Suzuki, Koichi; Takayanagi, Ryoichi; Jensen, Robert T.
2014-01-01
Objectives Numerous studies suggest important roles of the chemokine, fractalkine (CX3CL1) in acute/chronic pancreatitis, however the possible mechanisms of the effects are unclear. Pancreatic stellate cells (PSCs) can play important roles in pancreatitis, secreting inflammatory cytokines/chemokines, as well as proliferation. Therefore, we investigated CX3CL1 receptor (CX3CR1) occurrence in normal pancreas and pancreatitis (acute/chronic) tissues, and the effects of CX3CL1 on activated-PSCs. Methods CX3CR1 expression/localization in normal pancreas and pancreatitis (acute/chronic) tissues were evaluated with immunohistochemical analysis. CX3CR1 expression and effects of CX3CL1 on activated-PSCs were examined with realtime-PCR, BrdU assays and Western Blotting. Results In normal pancreas, acinar cells expressed CX3CR1 within granule-like-formations in the cytoplasm, whereas in acute/chronic pancreatitis, acinar, ductal and activated-PSCs expressed CX3CR1 on cell membranes. With activation of normal PSCs, CX3CR1 is increased. CX3CL1 activated multiple signaling cascades in PSCs. CX3CL1, did not induce inflammatory-genes expression in activated-PSCs, but induced proliferation. Conclusions CX3CR1s are expressed in normal pancreas. Expression is increased in acute/chronic pancreatitis and the CX3CR1s are activated. CX3CL1 induces proliferation of activated-PSCs without increasing release of inflammatory-mediators. These results suggest that CX3CR1 activation of PSCs could be important in their effects in pancreatitis, especially to PSCs proliferation in pancreatitis where CX3CL1 levels are elevated. PMID:24681877
Directory of Open Access Journals (Sweden)
Eliane Cristina Zacarias
2007-04-01
Full Text Available OBJETIVOS: Avaliar se o tratamento com teofilina associada ao beta2-agonista inalatório de curta ou longa duração é mais eficaz que o placebo e que o uso isolado de cada um dos fármacos, para os pacientes com doença pulmonar obstrutiva crônica estável. MÉTODOS: Realizou-se uma revisão sistemática com metanálise, sendo selecionados todos os ensaios clínicos aleatórios e duplo-cegos encontrados na literatura. RESULTADOS: Foram incluídos oito estudos. Teofilina associada ao beta2-agonista vs. placebo: houve melhora estatisticamente significante para o VEF1 (L, com média 0,27 (IC95% 0,11 a 0,43; e para a dispnéia, com média -0,78 (IC95% -1,26 a -0,29. Teofilina associada ao beta2-agonista vs. beta2-agonista isolado: nenhuma das metanálises realizadas detectou diferença entre os grupos. Teofilina associada ao beta2-agonista vs. teofilina isolada: houve melhora estatisticamente significante para a dispnéia, com média -0,19 (IC95% -0,34 a -0,04. CONCLUSÕES: Em pacientes com doença pulmonar obstrutiva crônica estável: 1 teofilina associada ao beta2-agonista é mais eficaz que o placebo, em relação ao VEF1 e dispnéia; 2a teofilina associada ao beta2-agonista é mais eficaz que a teofilina isolada, em relação à dispnéia; e 2b teofilina associada ao beta2-agonista não é mais eficaz que o beta2-agonista isolado, para quaisquer das variáveis estudadas.OBJECTIVES: To determine whether, in stable patients with chronic obstructive pulmonary disease, administration of theophylline in combination with short-acting or long-acting inhaled beta2-agonists is more efficacious than is a placebo or each of these drugs used in isolation. METHODS: A systematic review and meta-analysis were carried out. All randomized and double-blind clinical trials found in the literature were selected. RESULTS: A total of eight studies were included. In comparing the effect of theophylline combined with beta2-agonists to that of a placebo, we found a
Jakubík, J; Janíčková, H; El-Fakahany, E E; Doležal, V
2011-03-01
Conventional determination of agonist efficacy at G-protein coupled receptors is measured by stimulation of guanosine-5'-γ-thiotriphosphate (GTPγS) binding. We analysed the role of guanosine diphosphate (GDP) in the process of activation of the M₂ muscarinic acetylcholine receptor and provide evidence that negative cooperativity between agonist and GDP binding is an alternative measure of agonist efficacy. Filtration and scintillation proximity assays measured equilibrium binding as well as binding kinetics of [³⁵S]GTPγS and [³H]GDP to a mixture of G-proteins as well as individual classes of G-proteins upon binding of structurally different agonists to the M₂ muscarinic acetylcholine receptor. Agonists displayed biphasic competition curves with the antagonist [³H]-N-methylscopolamine. GTPγS (1 µM) changed the competition curves to monophasic with low affinity and 50 µM GDP produced a similar effect. Depletion of membrane-bound GDP increased the proportion of agonist high-affinity sites. Carbachol accelerated the dissociation of [³H]GDP from membranes. The inverse agonist N-methylscopolamine slowed GDP dissociation and GTPγS binding without changing affinity for GDP. Carbachol affected both GDP association with and dissociation from G(i/o) G-proteins but only its dissociation from G(s/olf) G-proteins. These findings suggest the existence of a low-affinity agonist-receptor conformation complexed with GDP-liganded G-protein. Also the negative cooperativity between GDP and agonist binding at the receptor/G-protein complex determines agonist efficacy. GDP binding reveals differences in action of agonists versus inverse agonists as well as differences in activation of G(i/o) versus G(s/olf) G-proteins that are not identified by conventional GTPγS binding. © 2011 The Authors. British Journal of Pharmacology © 2011 The British Pharmacological Society.
Uchida, Masahiko; Ito, Tetsuhide; Nakamura, Taichi; Hijioka, Masayuki; Igarashi, Hisato; Oono, Takamasa; Kato, Masaki; Nakamura, Kazuhiko; Suzuki, Koichi; Takayanagi, Ryoichi; Jensen, Robert T
2014-07-01
Numerous studies suggest important roles of the chemokine, fractalkine (CX3CL1), in acute/chronic pancreatitis; however, the possible mechanisms of the effects are unclear. Pancreatic stellate cells (PSCs) can play important roles in pancreatitis, secreting inflammatory cytokines/chemokines, as well as proliferation. Therefore, we investigated CX3CL1 receptor (CX3CR1) occurrence in normal pancreas and pancreatitis (acute/chronic) tissues and the effects of CX3CL1 on activated PSCs. CX3CR1 expression/localization in normal pancreas and pancreatitis (acute/chronic) tissues was evaluated with immunohistochemical analysis. CX3CR1 expression and effects of CX3CL1 on activated PSCs were examined with real-time polymerase chain reaction, BrdU (5-bromo-2-deoxyuridine) assays, and Western blotting. In normal pancreas, acinar cells expressed CX3CR1 within granule-like formations in the cytoplasm, whereas in acute/chronic pancreatitis, acinar, ductal, and activated PSCs expressed CX3CR1 on cell membranes. With activation of normal PSCs, CX3CR1 is increased. CX3CL1 activated multiple signaling cascades in PSCs. CX3CL1 did not induce inflammatory genes expression in activated PSCs, but induced proliferation. CX3CR1s are expressed in normal pancreas. Expression is increased in acute/chronic pancreatitis, and the CX3CR1s are activated. CX3CL1 induces proliferation of activated PSCs without increasing release of inflammatory mediators. These results suggest that CX3CR1 activation of PSCs could be important in their effects in pancreatitis, especially to PSC proliferation in pancreatitis where CX3CL1 levels are elevated.
Low-dose add-back therapy during postoperative GnRH agonist treatment
Directory of Open Access Journals (Sweden)
Hsiao-Wen Tsai
2016-02-01
Conclusion: Low dose add-back therapy could effectively ameliorate hypoestrogenic side effects and simultaneously maintain the therapeutic response of GnRH agonist treatment. The treatment dropout was lower compared with a regular dose. Therefore, low dose add-back therapy can be considered a treatment choice during postoperative GnRH agonist treatment.
Hendriks, D.J.; Broekmans, F.J.M.; Bancsi, L.F.J.M.M.; Looman, C.W.N.; Jong, F.H. de; Velde, E.R. te
Purpose: To study the value of a single or repeated GnRH agonist stimulation test (GAST) in predicting outcome in IVF compared to basal ovarian reserve tests. Methods: A total of 57 women was included. In a cycle prior to the IVF treatment, on day 3, an antral follicle count (AFC) was performed
32 CFR 37.665 - Must I require nonprofit participants to have periodic audits?
2010-07-01
... DEFENSE DoD GRANT AND AGREEMENT REGULATIONS TECHNOLOGY INVESTMENT AGREEMENTS Award Terms Affecting Participants' Financial, Property, and Purchasing Systems Financial Matters § 37.665 Must I require nonprofit...
Fretting Corrosion Behavior of Experimental Ti-20Cr Compared to Titanium.
Sawada, Tomofumi; Schille, Christine; Almadani, Atif; Geis-Gerstorfer, Jürgen
2017-02-17
Experimental cast titanium alloys containing 20 mass% chromium (Ti-20Cr) show preferable mechanical properties and a good corrosion resistance. This study evaluated the fretting corrosion behavior of Ti-20Cr. Ti-20Cr ( n = 4) and commercially pure titanium (CP-Ti, n = 6) disk specimens were used. The fretting corrosion test was performed by electrochemical corrosion at 0.3 V in 0.9% saline solution and mechanical damage using 10 scratching cycles with three different scratching speeds (10-40 mm/s) at 10 N. After testing, the activation peak, repassivation time and surface morphology of each specimen were analyzed. The differences between the results were tested by parametric tests (α = 0.05). The average activation peaks were significantly higher in CP-Ti than in Ti-20Cr ( p Ti. Slight differences in the repassivation time were observed between the materials at every scratching speed; faster scratching speeds showed shorter repassivation times in both materials ( p Ti showed severe damage and significantly higher wear depth than Ti-20Cr ( p < 0.05). In conclusion, adding chromium to titanium reduced surface damage and improved the fretting corrosion resistance.
Hedberg, Yolanda S; Lidén, Carola; Odnevall Wallinder, Inger
2014-09-15
About 1-3% of the adult general population in Europe is allergic to chromium (Cr). The assessment of the potential release of Cr(III) and Cr(VI) from leather is hence important from a human health and environmental risk perspective. The Cr(VI) content in leather was recently restricted in the European Union. The aim of this study was to assess possible correlations between the bulk and surface chemistry of leather, released Cr(III) and Cr(VI), and capacities of co-released leather specific species to reduce and complex released Cr. Four differently tanned leathers were characterized by scanning electron microscopy with energy dispersive spectroscopy, X-ray photoelectron spectroscopy, attenuated total reflectance Fourier transform infrared (ATR-FTIR) spectroscopy, and the diphenylcarbazide colorimetric method. Their characteristics were compared with results on Cr(III) and Cr(VI) release into artificial sweat (ASW, pHleather-specific species were shown to reduce Cr(VI), both in ASW and in PB. Their reduction capacities correlated with findings of the surface content of Cr and of released Cr. Leather samples without this capacity, and with less aromatic surface groups visible by ATR-FTIR, revealed Cr(VI) both at the surface and in solution (PB). Copyright © 2014 The Authors. Published by Elsevier B.V. All rights reserved.
Directory of Open Access Journals (Sweden)
Min Gao
Full Text Available Corneal transplantation is the most used therapy for eye disorders. Although the cornea is somewhat an immune privileged organ, immune rejection is still the major problem that reduces the success rate. Therefore, effective chemical drugs that regulate immunoreactions are needed to improve the outcome of corneal transplantations. Here, a sphingosine-1-phosphate receptor 1 (S1P1 selective agonist was systematically evaluated in mouse allogeneic corneal transplantation and compared with the commonly used immunosuppressive agents. Compared with CsA and the non-selective sphingosine 1-phosphate (S1P receptor agonist FTY720, the S1P1 selective agonist can prolong the survival corneal transplantation for more than 30 days with a low immune response. More importantly, the optimal dose of the S1P1 selective agonist was much less than non-selective S1P receptor agonist FTY720, which would reduce the dose-dependent toxicity in drug application. Then we analyzed the mechanisms of the selected S1P1 selective agonist on the immunosuppression. The results shown that the S1P1 selective agonist could regulate the distribution of the immune cells with less CD4+ T cells and enhanced Treg cells in the allograft, moreover the expression of anti-inflammatory cytokines TGF-β1 and IL-10 unregulated which can reduce the immunoreactions. These findings suggest that S1P1 selective agonist may be a more appropriate immunosuppressive compound to effectively prolong mouse allogeneic corneal grafts survival.
Plantago lanceolata growth and Cr uptake after mycorrhizal inoculation in a Cr amended substrate
Directory of Open Access Journals (Sweden)
Amaia Nogales
2012-03-01
Full Text Available Arbuscular mycorrhizal fungi from two chromium contaminated sites, one with 275 mg kg-1 of Cr (zone A and the other with 550 mg kg-1 Cr (zone B, were multiplied and tentatively identified. The effect of both fungal consortia on Plantago lanceolata plant growth in a substrate amended with 200 mg kg-1 of Cr and with 400 mg kg-1 Cr was assessed and compared with the growth of plants inoculated with Glomus intraradices BEG72. Only the plants inoculated with G. intraradices BEG72 and with the fungal consortia obtained from the area with a high Cr contamination (zone B grew in the soil with 400 mg kg-1 of Cr. The consortia of fungi from zone B, decreased the plant’s uptake/translocation of the heavy metal compared with G. intraradices BEG72. These results underscore the differential effect of AM fungi in conferring bioprotection in Cr contaminated soils.
The epileptogenic spectrum of opiate agonists.
Snead, O C; Bearden, L J
1982-11-01
The present authors gave mu, delta, kappa, epsilon and sigma opiate receptor agonists intracerebroventricularly to rats both singly and in combination while monitoring the electroencephalogram from cortical and depth electrodes. Dose-response curves were plotted with naloxone against the changes produced by each agonist, and the effect of a number of anticonvulsant drugs on agonist-induced seizures was ascertained. Each opiate agonist produced a different seizure pattern with a different naloxone dose-response curve and anticonvulsant profile. The order of convulsive potency was epsilon greater than delta greater than mu greater than sigma much greater than kappa. Petit mal-like seizure activity was unique to the delta agonist, leucine-enkephalin, while only the mu agonist, morphine produced generalized convulsive seizures. These experiments raise the possibility that opiate systems in the brain may be involved in the pathogenesis of a wide spectrum of seizure disorders.
Energy Technology Data Exchange (ETDEWEB)
Hedberg, Yolanda S., E-mail: yolanda@kth.se [KTH Royal Institute of Technology, School of Chemical Science and Engineering, Department of Chemistry, Division of Surface and Corrosion Science, SE-10044 Stockholm (Sweden); Institute of Environmental Medicine, Karolinska Institutet, Box 210, SE-17177 Stockholm (Sweden); Lidén, Carola, E-mail: carola.liden@ki.se [Institute of Environmental Medicine, Karolinska Institutet, Box 210, SE-17177 Stockholm (Sweden); Odnevall Wallinder, Inger, E-mail: ingero@kth.se [KTH Royal Institute of Technology, School of Chemical Science and Engineering, Department of Chemistry, Division of Surface and Corrosion Science, SE-10044 Stockholm (Sweden)
2014-09-15
Graphical abstract: - Highlights: • Released reducing/complexing leather-specific species can reduce released Cr(VI). • No co-released species enable the formation of Cr(VI) in solution. • The major Cr species released from leather in phosphate buffer was Cr(III) (>82%). • No Cr(VI) was released into artificial sweat. - Abstract: About 1–3% of the adult general population in Europe is allergic to chromium (Cr). The assessment of the potential release of Cr(III) and Cr(VI) from leather is hence important from a human health and environmental risk perspective. The Cr(VI) content in leather was recently restricted in the European Union. The aim of this study was to assess possible correlations between the bulk and surface chemistry of leather, released Cr(III) and Cr(VI), and capacities of co-released leather specific species to reduce and complex released Cr. Four differently tanned leathers were characterized by scanning electron microscopy with energy dispersive spectroscopy, X-ray photoelectron spectroscopy, attenuated total reflectance Fourier transform infrared (ATR-FTIR) spectroscopy, and the diphenylcarbazide colorimetric method. Their characteristics were compared with results on Cr(III) and Cr(VI) release into artificial sweat (ASW, pH < 6.5) and phosphate buffer (PB, pH 7.5–8.0), measured by means of spectrophotometry and atomic absorption spectroscopy. Co-released leather-specific species were shown to reduce Cr(VI), both in ASW and in PB. Their reduction capacities correlated with findings of the surface content of Cr and of released Cr. Leather samples without this capacity, and with less aromatic surface groups visible by ATR-FTIR, revealed Cr(VI) both at the surface and in solution (PB)
2010-04-01
... 26 Internal Revenue 8 2010-04-01 2010-04-01 false Exclusions from accumulation distributions in the case of trusts (other than a foreign trust created by a U.S. person). 1.665(b)-2 Section 1.665(b)-2 Internal Revenue INTERNAL REVENUE SERVICE, DEPARTMENT OF THE TREASURY (CONTINUED) INCOME TAX (CONTINUED) INCOME TAXES Treatment of Excess...
Kinetics of Cr(III) and Cr(VI) removal from water by two floating macrophytes.
Maine, M A; Hadad, H R; Sánchez, G; Caffaratti, S; Pedro, M C
2016-01-01
The aim of this work was to compare Cr(III) and Cr(VI) removal kinetics from water by Pistia stratiotes and Salvinia herzogii. The accumulation in plant tissues and the effects of both Cr forms on plant growth were also evaluated. Plants were exposed to 2 and 6 mg L(-1) of Cr(III) or Cr(VI) during 30 days. At the end of the experiment, Cr(VI) removal percentages were significantly lower than those obtained for Cr(III) for both macrophytes. Cr(III) removal kinetics involved a fast and a slow component. The fast component was primarily responsible for Cr(III) removal while Cr(VI) removal kinetics involved only a slow process. Cr accumulated principally in the roots. In the Cr(VI) treatments a higher translocation from roots to aerial parts than in Cr(III) treatments was observed. Both macrophytes demonstrated a high ability to remove Cr(III) but not Cr(VI). Cr(III) inhibited the growth at the highest studied concentration of both macrophytes while Cr(VI) caused senescence. These results have important implications in the use of constructed wetlands for secondary industrial wastewater treatment. Common primary treatments of effluents containing Cr(VI) consists in its reduction to Cr(III). Cr(III) concentrations in these effluents are normally below the highest studied concentrations in this work.
Identification of novel selective V2 receptor non-peptide agonists.
Del Tredici, Andria L; Vanover, Kim E; Knapp, Anne E; Bertozzi, Sine M; Nash, Norman R; Burstein, Ethan S; Lameh, Jelveh; Currier, Erika A; Davis, Robert E; Brann, Mark R; Mohell, Nina; Olsson, Roger; Piu, Fabrice
2008-10-30
Peptides with agonist activity at the vasopressin V(2) receptor are used clinically to treat fluid homeostasis disorders such as polyuria and central diabetes insipidus. Of these peptides, the most commonly used is desmopressin, which displays poor bioavailability as well as potent activity at the V(1b) receptor, with possible stress-related adverse effects. Thus, there is a strong need for the development of small molecule chemistries with selective V(2) receptor agonist activity. Using the functional cell-based assay Receptor Selection and Amplification Technology (R-SAT((R))), a screening effort identified three small molecule chemotypes (AC-94544, AC-88324, and AC-110484) with selective agonist activity at the V(2) receptor. One of these compounds, AC-94544, displayed over 180-fold selectivity at the V(2) receptor compared to related vasopressin and oxytocin receptors and no activity at 28 other G protein-coupled receptors (GPCRs). All three compounds also showed partial agonist activity at the V(2) receptor in a cAMP accumulation assay. In addition, in a rat model of central diabetes insipidus, AC-94544 was able to significantly reduce urine output in a dose-dependent manner. Thus, AC-94544, AC-88324, and AC-110484 represent novel opportunities for the treatment of disorders associated with V(2) receptor agonist deficiency.
The lattice distortion effect for zinc-blende CrAs and CrSb
International Nuclear Information System (INIS)
Yamana, Keita; Geshi, Masaaki; Tsukamoto, Hidekazu; Uchida, Ichiro; Shirai, Masafumi; Kusakabe, Koichi; Suzuki, Naoshi
2004-01-01
We investigated the stability of the ferromagnetism of CrAs and CrSb in the zinc-blende structure against the lattice distortion, systematically. A calculation within the generalized gradient approximation using a full potential linearized augmented plane wave method was performed. We compared the ferromagnetic state and the antiferromagnetic state assuming tetragonal distortion with the lattice constants a and c changing independently and determined the spin polarization ratio in the ferromagnetic phase. The result shows that complete spin polarization (half-metallic ferromagnetism) remains stable even in the presence of large tetragonal distortion. On the other hand, our calculation shows that two monolayers of CrAs is enough to produce a half-metallic state in the CrAs/GaAs multilayer. Thus, the present result suggests that the half-metallic nature persists in various atomic-scale superlattices made of distorted CrAs or CrSb
GnRH antagonist versus long agonist protocols in IVF
DEFF Research Database (Denmark)
Lambalk, C B; Banga, F R; Huirne, J A
2017-01-01
BACKGROUND: Most reviews of IVF ovarian stimulation protocols have insufficiently accounted for various patient populations, such as ovulatory women, women with polycystic ovary syndrome (PCOS) or women with poor ovarian response, and have included studies in which the agonist or antagonist...... was not the only variable between the compared study arms. OBJECTIVE AND RATIONALE: The aim of the current study was to compare GnRH antagonist protocols versus standard long agonist protocols in couples undergoing IVF or ICSI, while accounting for various patient populations and treatment schedules. SEARCH...... in couples undergoing IVF or ICSI. The primary outcome was ongoing pregnancy rate. Secondary outcomes were: live birth rate, clinical pregnancy rate, number of oocytes retrieved and safety with regard to ovarian hyperstimulation syndrome (OHSS). Separate comparisons were performed for the general IVF...
Sun, Wen-Chong; Liang, Zuo-Di; Pei, Ling
2015-12-01
Propofol exerts neurotoxic effects on the developing mammalian brains, but the underlying molecular mechanism remains unclear. MicroRNAs (miRNAs) are a class of small noncoding RNAs that modulate gene expression at the post-transcriptional level. However, in specific types of neurocytes, the detailed functions of miRNAs were not entirely understood. We investigated the potential role of miRNAs in astrocyte pathogenesis caused by propofol. We performed genome-wide microRNA expression profiling in immature cultured hippocampal astrocytes by microarray analysis and predicted their targets and functions using bioinformatics tools. The functional effects of one differentially expressed miRNA were examined experimentally in relation to astrocyte viability. The results showed that 13 miRNAs were significantly differentially expressed after both short-term exposure to high-concentration propofol (10 μg/ml for 1h) and long-term exposure to low-concentration propofol (0.9 μg/ml for 48 h), including rno-miR-665, differing significantly between the 2. Bioinformatics predicted putative binding sites for rno-miR-665 existing in the 3'-untranslated region of Bcl-2-like protein 1 BCL2L1 (Bcl-xl) mRNA. Moreover, such relationship was assessed by luciferase reporter assay, qRT-PCR and western blot. Rno-miR-665 which was significantly up-regulated by propofol can suppress BCL2L1 and elevate cleaved caspase-3 expression in immature astrocytes in vitro. Apoptosis of developing hippocampal astrocytes was thus significantly influenced by propofol or rno-miR-665, or both. Taken together, rno-miR-665 is involved in the neurotoxicity induced by propofol via a caspase-3 mediated mechanism by negatively regulating BCL2L1. It might act as an alternative therapeutic target for treatment of neurological disorders in peadiatric prolonged anesthesia or sedation with propofol clinically. Copyright © 2015. Published by Elsevier B.V.
Energy Technology Data Exchange (ETDEWEB)
Aharchaou, Imad [Laboratoire Interdisciplinaire des Environnements Continentaux, UMR 7360, Université de Lorraine and CNRS, 8 rue du Général Delestraint, 57070 Metz (France); Rosabal, Maikel; Liu, Fengjie [Institut National de la Recherche Scientifique, Centre Eau Terre Environnement (INRS-ETE), 490 rue de la Couronne, Québec (Québec) G1K 9A9 (Canada); Battaglia, Eric; Vignati, Davide A.L. [Laboratoire Interdisciplinaire des Environnements Continentaux, UMR 7360, Université de Lorraine and CNRS, 8 rue du Général Delestraint, 57070 Metz (France); Fortin, Claude, E-mail: claude.fortin@ete.inrs.ca [Institut National de la Recherche Scientifique, Centre Eau Terre Environnement (INRS-ETE), 490 rue de la Couronne, Québec (Québec) G1K 9A9 (Canada)
2017-01-15
Highlights: • C. reinhardtii accumulated similar levels of Cr(III) and Cr(VI). • The subcellular partitioning of Cr(III) and Cr(VI) was similar. • Cr(III) and Cr(VI) associated mainly with organelles and heat-stable proteins. • Metallomic analysis showed two main Cr-binding biomolecules after 72 h of exposure. - Abstract: Chromium occurs in aquatic environments under two main redox forms, namely Cr(III) and Cr(VI), with different geochemical and biochemical properties. Cr(VI) readily crosses biological membranes of living organisms and once inside the cells it undergoes a rapid reduction to Cr(III). The route of entry for the latter form is, however, poorly known. Using the radioactive tracer {sup 51}Cr we compared the accumulation (absorption and adsorption) of the two Cr forms by the green unicellular alga Chlamydomonas reinhardii after 1 h and 72 h of exposure to 100 nM of either Cr(III) or Cr(VI) at pH 7. Both Cr forms had similar accumulation, with a major part in the extracellular (adsorbed) fraction after 1 h and a major part of total accumulated Cr in the intracellular (absorbed) fraction after 72 h. We also investigated the intracellular partitioning of Cr using an operational fractionation scheme and found that both Cr forms had similar distributions among fractions: Cr was mostly associated with organelles (23 ± 12% after 1 h and 37 ± 7% after 72 h) and cytosolic heat-stable proteins and peptides (39 ± 18% after 1 h and 35 ± 3% after 72 h) fractions. Further investigations using a metallomic approach (SEC-ICP-MS) were performed with the heat-stable proteins and peptides fraction to compare the distribution of the two Cr forms among various biomolecules of this fraction. One Cr-binding biomolecule (∼28 kDa) appeared after 1 h of exposure for both Cr species. After 72 h another biomolecule of lower molecular weight (∼0.7 kDa) was involved in binding Cr and higher signal intensities were observed for Cr(VI) than for Cr(III). We show, for the
International Nuclear Information System (INIS)
Aharchaou, Imad; Rosabal, Maikel; Liu, Fengjie; Battaglia, Eric; Vignati, Davide A.L.; Fortin, Claude
2017-01-01
Highlights: • C. reinhardtii accumulated similar levels of Cr(III) and Cr(VI). • The subcellular partitioning of Cr(III) and Cr(VI) was similar. • Cr(III) and Cr(VI) associated mainly with organelles and heat-stable proteins. • Metallomic analysis showed two main Cr-binding biomolecules after 72 h of exposure. - Abstract: Chromium occurs in aquatic environments under two main redox forms, namely Cr(III) and Cr(VI), with different geochemical and biochemical properties. Cr(VI) readily crosses biological membranes of living organisms and once inside the cells it undergoes a rapid reduction to Cr(III). The route of entry for the latter form is, however, poorly known. Using the radioactive tracer "5"1Cr we compared the accumulation (absorption and adsorption) of the two Cr forms by the green unicellular alga Chlamydomonas reinhardii after 1 h and 72 h of exposure to 100 nM of either Cr(III) or Cr(VI) at pH 7. Both Cr forms had similar accumulation, with a major part in the extracellular (adsorbed) fraction after 1 h and a major part of total accumulated Cr in the intracellular (absorbed) fraction after 72 h. We also investigated the intracellular partitioning of Cr using an operational fractionation scheme and found that both Cr forms had similar distributions among fractions: Cr was mostly associated with organelles (23 ± 12% after 1 h and 37 ± 7% after 72 h) and cytosolic heat-stable proteins and peptides (39 ± 18% after 1 h and 35 ± 3% after 72 h) fractions. Further investigations using a metallomic approach (SEC-ICP-MS) were performed with the heat-stable proteins and peptides fraction to compare the distribution of the two Cr forms among various biomolecules of this fraction. One Cr-binding biomolecule (∼28 kDa) appeared after 1 h of exposure for both Cr species. After 72 h another biomolecule of lower molecular weight (∼0.7 kDa) was involved in binding Cr and higher signal intensities were observed for Cr(VI) than for Cr(III). We show, for the
International Nuclear Information System (INIS)
Abdel-Sabour, M.F.; Abdou, F.M.; Elwan, I.M.; Al-Salama, Y.J.
2003-01-01
Fifteen soil samples were chosen from different locations (five different locations at north greater Cairo, Egypt to represent different soils (alluvial and sandy) as well as different source of contaminated wastewater (sewage and industrial effluent). Using sequential extraction technique (extracting the soil with different solutions, which is designed to separate metal fractions), Cr was separated into six operationally defined fractions water soluble, exchangeable, carbonate bound, Fe-Mn oxides bound, organic bound and residual fractions. Result of soil total-Cr indicated the serious accumulation of Cr in soils subjected to prolonged irrigation with contaminated wastewater. As it could seen, total-Cr in the tested contaminated soils exceeds the permissible levels (75-100)ppm Cr by several order of magnitude particularly at the surface and subsurface layers. The highest accumulation of total Cr down to depth 60 cm was observed in case of soil E. Data showed that values of total Cr determined by NAA method were always higher than the relevant values determined either by AAS or those calculated after the sequential extraction method. T-test analysis showed the significant difference between NAA and either AAS or sequential extraction methods. Although T-test analysis showed that were significant differences between total content in soils as determined by destructive (AAS or SUM) and non-destructive (NAA) analytical techniques however, strong liner relation between NAA and other tested methods was obtained. Chromium distribution between different extractants shows that the greatest amounts are found in the residual and Occluded in Fe and Mn-Oxides fractions followed by carbonate or organic fractions. In most cases the proportion of all tested Cr-forms has increased in contaminated soil layers with higher enrichment in organically bound Cr, occluded in Fe and Mn oxides, carbonate exchangeable and soluble fractions. Results indicate that soil properties have a
Dopaminergic agonists for hepatic encephalopathy
DEFF Research Database (Denmark)
Als-Nielsen, B; Gluud, L L; Gluud, C
2004-01-01
Hepatic encephalopathy may be associated with an impairment of the dopaminergic neurotransmission. Dopaminergic agonists may therefore have a beneficial effect on patients with hepatic encephalopathy.......Hepatic encephalopathy may be associated with an impairment of the dopaminergic neurotransmission. Dopaminergic agonists may therefore have a beneficial effect on patients with hepatic encephalopathy....
Cholecystokinin receptors on gallbladder muscle and pancreatic acinar cells: a comparative study
International Nuclear Information System (INIS)
von Schrenck, T.; Moran, T.H.; Heinz-Erian, P.; Gardner, J.D.; Jensen, R.T.
1988-01-01
To compare receptors for cholecystokinin (CCK) in pancreas and gallbladder, we measured binding of 125I-Bolton-Hunter-labeled CCK-8 (125I-BH-CCK-8) to tissue sections from guinea pig gallbladder and pancreas under identical conditions. In both tissues, binding had similar time-, temperature-, and pH dependence, was reversible, saturable and inhibited only by CCK related peptides or CCK receptor antagonists. Autoradiography localized 125I-BH-CCK-8 binding to the smooth muscle layer in the gallbladder. Binding of 125I-BH-CCK-8 to gallbladder sections was inhibited by various agonists with the following potencies (IC50):CCK-8 (0.4 nM) greater than des(SO3)CCK-8 (0.07 microM) greater than gastrin-17-I (1.7 +/- 0.3 microM) and by various receptor antagonists with the following potencies: L364,718 (1.5 nM) greater than CR 1409 (0.19 microM) greater than asperlicin = CBZ-CCK-(27-32)-NH2 (1 microM) greater than Bt2cGMP (120 microM). Similar potencies were found for the agonists and antagonists for pancreas sections. Inhibition of binding of 125I-BH-CCK-8 by 11 different analogues of proglumide gave similar potencies for both pancreas and gallbladder. The potencies of agonists in stimulating and antagonists in inhibiting CCK-stimulated contraction or amylase release correlated closely with their abilities to inhibit 125I-BH-CCK-8 binding to gallbladder or pancreas sections or acini, respectively. The present results demonstrate and characterize a method that can be used to compare the CCK receptors in guinea pig gallbladder and pancreas under identical conditions. Moreover, this study demonstrates that gallbladder and pancreatic CCK receptors have similar affinities for the various agonists and antagonists tested and, therefore, provides no evidence that they represent different subtypes of CCK receptors that can be distinguished pharmacologically
Effect of beta-agonists on LAM progression and treatment.
Le, Kang; Steagall, Wendy K; Stylianou, Mario; Pacheco-Rodriguez, Gustavo; Darling, Thomas N; Vaughan, Martha; Moss, Joel
2018-01-30
Lymphangioleiomyomatosis (LAM), a rare disease of women, is associated with cystic lung destruction resulting from the proliferation of abnormal smooth muscle-like LAM cells with mutations in the tuberous sclerosis complex (TSC) genes TSC1 and/or TSC2 The mutant genes and encoded proteins are responsible for activation of the mechanistic target of rapamycin (mTOR), which is inhibited by sirolimus (rapamycin), a drug used to treat LAM. Patients who have LAM may also be treated with bronchodilators for asthma-like symptoms due to LAM. We observed stabilization of forced expiratory volume in 1 s over time in patients receiving sirolimus and long-acting beta-agonists with short-acting rescue inhalers compared with patients receiving only sirolimus. Because beta-agonists increase cAMP and PKA activity, we investigated effects of PKA activation on the mTOR pathway. Human skin TSC2 +/- fibroblasts or LAM lung cells incubated short-term with isoproterenol (beta-agonist) showed a sirolimus-independent increase in phosphorylation of S6, a downstream effector of the mTOR pathway, and increased cell growth. Cells incubated long-term with isoproterenol, which may lead to beta-adrenergic receptor desensitization, did not show increased S6 phosphorylation. Inhibition of PKA blocked the isoproterenol effect on S6 phosphorylation. Thus, activation of PKA by beta-agonists increased phospho-S6 independent of mTOR, an effect abrogated by beta-agonist-driven receptor desensitization. In agreement, retrospective clinical data from patients with LAM suggested that a combination of bronchodilators in conjunction with sirolimus may be preferable to sirolimus alone for stabilization of pulmonary function.
Beta-agonists and animal welfare
The use of beta-agonists in animal feed is a high profile topic within the U.S. as consumers and activist groups continue to question its safety. The only beta-agonist currently available for use in swine is ractopamine hydrochloride (RAC). This is available as Paylean™ (Elanco Animal Health – FDA a...
Design and Discovery of Functionally Selective Serotonin 2C (5-HT2C) Receptor Agonists.
Cheng, Jianjun; McCorvy, John D; Giguere, Patrick M; Zhu, Hu; Kenakin, Terry; Roth, Bryan L; Kozikowski, Alan P
2016-11-10
On the basis of the structural similarity of our previous 5-HT 2C agonists with the melatonin receptor agonist tasimelteon and the putative biological cross-talk between serotonergic and melatonergic systems, a series of new (2,3-dihydro)benzofuran-based compounds were designed and synthesized. The compounds were evaluated for their selectivity toward 5-HT 2A , 5-HT 2B , and 5-HT 2C receptors in the calcium flux assay with the ultimate goal to generate selective 5-HT 2C agonists. Selected compounds were studied for their functional selectivity by comparing their transduction efficiency at the G protein signaling pathway versus β-arrestin recruitment. The most functionally selective compound (+)-7e produced weak β-arrestin recruitment and also demonstrated less receptor desensitization compared to serotonin in both calcium flux and phosphoinositide (PI) hydrolysis assays. We report for the first time that selective 5-HT 2C agonists possessing weak β-arrestin recruitment can produce distinct receptor desensitization properties.
Directory of Open Access Journals (Sweden)
Haney Sarah
2007-03-01
Full Text Available Abstract Background Asthmatics treated with long-acting beta-agonists have a reduced bronchodilator response to moderate doses of inhaled short acting beta-agonists during acute bronchoconstriction. It is not known if the response to higher doses of nebulised beta-agonists or other bronchodilators is impaired. We assessed the effect of long-acting beta-agonist treatment on the response to 5 mg nebulised salbutamol and to ipratropium bromide. Methods Two double-blind, placebo-controlled, crossover studies of inhaled formoterol 12 μg twice daily in patients with asthma. High-dose salbutamol: 36 hours after the last dose of 1 week of formoterol or placebo treatment, 11 subjects inhaled methacholine to produce a 20% fall in FEV1. Salbutamol 5 mg was then administered via nebuliser and the FEV1 was monitored for 20 minutes. Ipratropium: 36 hours after the last dose of 1 week of formoterol or placebo treatment, 11 subjects inhaled 4.5% saline to produce a 20% fall in FEV1. Salbutamol 200 μg or ipratropium bromide 40 μg was then inhaled and the FEV1 was monitored for 30 minutes. Four study arms compared the response to each bronchodilator after formoterol and placebo. Analyses compared the area under the bronchodilator response curves, adjusting for changes in pre-challenge FEV1, dose of provocational agent and FEV1 fall during the challenge procedure. Results The response to nebulised salbutamol was 15% lower after formoterol therapy compared to placebo (95% confidence 5 to 25%, p = 0.008. The response to ipratropium was unchanged. Conclusion Long-acting beta-agonist treatment induces tolerance to the bronchodilator effect of beta-agonists, which is not overcome by higher dose nebulised salbutamol. However, the bronchodilator response to ipratropium bromide is unaffected.
Targeted Delivery of LXR Agonist Using a Site-Specific Antibody-Drug Conjugate.
Lim, Reyna K V; Yu, Shan; Cheng, Bo; Li, Sijia; Kim, Nam-Jung; Cao, Yu; Chi, Victor; Kim, Ji Young; Chatterjee, Arnab K; Schultz, Peter G; Tremblay, Matthew S; Kazane, Stephanie A
2015-11-18
Liver X receptor (LXR) agonists have been explored as potential treatments for atherosclerosis and other diseases based on their ability to induce reverse cholesterol transport and suppress inflammation. However, this therapeutic potential has been hindered by on-target adverse effects in the liver mediated by excessive lipogenesis. Herein, we report a novel site-specific antibody-drug conjugate (ADC) that selectively delivers a LXR agonist to monocytes/macrophages while sparing hepatocytes. The unnatural amino acid para-acetylphenylalanine (pAcF) was site-specifically incorporated into anti-CD11a IgG, which binds the α-chain component of the lymphocyte function-associated antigen 1 (LFA-1) expressed on nearly all monocytes and macrophages. An aminooxy-modified LXR agonist was conjugated to anti-CD11a IgG through a stable, cathepsin B cleavable oxime linkage to afford a chemically defined ADC. The anti-CD11a IgG-LXR agonist ADC induced LXR activation specifically in human THP-1 monocyte/macrophage cells in vitro (EC50-27 nM), but had no significant effect in hepatocytes, indicating that payload delivery is CD11a-mediated. Moreover, the ADC exhibited higher-fold activation compared to a conventional synthetic LXR agonist T0901317 (Tularik) (3-fold). This novel ADC represents a fundamentally different strategy that uses tissue targeting to overcome the limitations of LXR agonists for potential use in treating atherosclerosis.
Detection of glucocorticoid receptor agonists in effluents from sewage treatment plants in Japan.
Suzuki, Go; Sato, Kentaro; Isobe, Tomohiko; Takigami, Hidetaka; Brouwer, Abraham; Nakayama, Kei
2015-09-15
Glucocorticoids (GCs) are widely used as anti-inflammatory drugs. Our previous study demonstrated that several GCs such as cortisol and dexamethasone (Dex) were frequently detected in effluents collected from Japanese sewage treatment plants (STPs) in 2012. In this study, we used the GC-Responsive Chemical-Activated LUciferase gene eXpression (GR-CALUX) assay to elucidate GC receptor (GR) agonistic activities of ten pure synthetic GCs and selected STP effluents in Japan for assessment of the risks associated with the presence of GR agonists. The tested GCs demonstrated dose-dependent agonistic effects in the GR-CALUX assay and their EC50 values were calculated for estimation of relative potencies (REPs) compared to Dex. The GR agonistic potency was in the rank of: clobetasol propionate > clobetasone butyrate > betamethasone 17-valerate > difluprednate > betamethasone 17,21-dipropionate > Dex > betamethasone > 6α-methylprednisolone > prednisolone > cortisol. The GR agonistic activity in STP effluents as measured in Dex-equivalent (Dex-EQ) activities ranged from effluents in Japan. Copyright © 2015 Elsevier B.V. All rights reserved.
Elaboration, characterization of CrN- based coatings
International Nuclear Information System (INIS)
Tlili, B.; Nouveau, C.; Guillemot, G.
2011-01-01
Cr, CrN and CrAlN monolayers were synthesized by RF dual magnetron sputtering on AISI4140 steel and silicon substrates at 200 deg. C. Multilayers coatings based on the three mono-layers such as CrN/CrAlN and Cr/CrN/CrAlN were also synthesized only on Si. The physico-chemical and mechanical properties of the layers were determined by AFM, SEM+WDS, stress, roughness and nanoindentation measurements. The influence of the thickness on the mechanical properties of the monolayers stresses has been studied and as a consequence we compared the mono and multilayers stress state.
Modification of kindled amygdaloid seizures by opiate agonists and antagonists.
Albertson, T E; Joy, R M; Stark, L G
1984-03-01
The effects of 19 opiate agonists and antagonists on kindled amygdaloid seizures in the rat were studied. The mu agonists tended to reduce the length of elicited afterdischarges and behavioral ranks, while markedly increasing postictal electroencephalogram spikes and behavioral arrest time. These effects were reversed by naloxone. The kappa agonists reduced behavioral rank and variably reduced afterdischarge length with a concomitant lengthening of postictal behavioral arrest time and number of electroencephalogram spikes. The putative sigma agonist, SKF 10,047, reduced afterdischarge durations only at the higher doses tested. The decreases found after the sigma agonists in postictal electroencephalogram spiking and time of behavioral arrest were not reversed by naloxone. Only the lower doses of normeperidine were found to decrease seizure thresholds. The mixed agonist/antagonists (MAA) cyclazocine and cyclorphan markedly increased seizure threshold and reduced afterdischarge duration and behavioral rank. Only the MAA pentazocine tended to increase threshold but not suprathreshold afterdischarge durations. The order of ability to modify the ictal events was MAA (selected) greater than kappa agonists greater than mu agonists greater than sigma agonists. The increase in postictal events (behavior arrest and spikes) was caused most effectively by pretreatment with mu agonist greater than kappa agonist greater than selected MAA greater than sigma agonists.(ABSTRACT TRUNCATED AT 250 WORDS)
International Nuclear Information System (INIS)
Molenaar, P.; Malta, E.
1986-01-01
In electrically driven guinea pig left atria, positive inotropic responses to (-)-isoprenaline and the selective beta 1-adrenoceptor agonist RO363 were obtained in the absence and in the presence of the functional antagonists adenosine, carbachol, gallopamil, nifedipine, and Ro 03-7894. Each of the functional antagonists reduced the maximum response to both agonists and produced nonparallel rightward shifts in the cumulative concentration effect curves. For both agonists, dissociation constants (KA) were calculated using the equation described by Furchgott (1966) for irreversible antagonism. For RO363, which is a partial agonist with high agonist activity, the equations outlined for functional interaction by Mackay (1981) were also employed to calculate KA values. The KA values obtained by each method were compared with the dissociation constants (KD) for the two agonists determined from their ability to displace the radioligand (-)-[ 125 I]iodocyanopindolol from beta 1-adrenoceptors in guinea pig left atrial membrane preparations. The estimates of KA varied substantially from KD values. The KD values were taken as more accurate estimates of the true values for the dissociation constants because a high degree of correlation exists between pKD and pD2 values for a number of other beta-adrenoceptor agonists that behave as partial agonists and between pKD and pKB values for a number of beta-adrenoceptor antagonists. Thus, it appears that there are serious limitations in the current theory for using functional antagonism as a means of obtaining agonist dissociation constants
Sui, Xudong; Liu, Jinyu; Zhang, Shuaituo; Yang, Jun; Hao, Junying
2018-05-01
Adhesive wear is one of the major reasons for the failure of components during various tribological application, especially for rubbing with viscous materials. This study presents CrN/DLC/Cr-DLC multilayer composite coatings prepared on a plasma enhanced chemical vapor deposition (PECVD) device with the close field unbalanced magnetron sputtering ion plating (CFUBMSIP) technique. SEM, XRD and Raman spectroscopy were used to determine the structure of multilayer coatings. It was found that the multilayer coatings are composed by the alternating CrN and DLC layers. Compared with the single CrN coatings, the friction coefficient of the CrN/DLC/Cr-DLC multilayer coating decreases about more than seven times after sliding a distance of 500 m. This helps to reduce the adhesive wear of multilayer coatings. Compared with the single CrN and DLC coating, the wear rate of the CrN/DLC/Cr-DLC multilayer coating is reduced by an order of magnitude to 7.10 × 10-17 (sliding with AISI 440C) and 2.64 × 10-17 (sliding with TC4) m3/(N m). The improved tribological performance of multilayer coatings mainly attributes to the introduction of lubricant DLC and hard support CrN layers, the enhancement of crack propagation inhibition, and the increment of elastic recovery value We (71.49%) by multilayer design method.
GnRH agonist versus GnRH antagonist in in vitro fertilization and embryo transfer (IVF/ET
Directory of Open Access Journals (Sweden)
Depalo Raffaella
2012-04-01
Full Text Available Abstract Several protocols are actually available for in Vitro Fertilization and Embryo Transfer. The review summarizes the main differences and the clinic characteristics of the protocols in use with GnRH agonists and GnRH antagonists by emphasizing the major outcomes and hormonal changes associated with each protocol. The majority of randomized clinical trials clearly shows that in “in Vitro” Fertilization and Embryo Transfer, the combination of exogenous Gonadotropin plus a Gonadotropin Releasing Hormone (GnRH agonist, which is able to suppress pituitary FSH and LH secretion, is associated with increased pregnancy rate as compared with the use of gonadotropins without a GnRH agonist. Protocols with GnRH antagonists are effective in preventing a premature rise of LH and induce a shorter and more cost-effective ovarian stimulation compared to the long agonist protocol. However, a different synchronization of follicular recruitment and growth occurs with GnRH agonists than with GnRH antagonists. Future developments have to be focused on timing of the administration of GnRH antagonists, by giving a great attention to new strategies of stimulation in patients in which radio-chemotherapy cycles are needed.
Dopamine agonist withdrawal syndrome: implications for patient care.
Nirenberg, Melissa J
2013-08-01
Dopamine agonists are effective treatments for a variety of indications, including Parkinson's disease and restless legs syndrome, but may have serious side effects, such as orthostatic hypotension, hallucinations, and impulse control disorders (including pathological gambling, compulsive eating, compulsive shopping/buying, and hypersexuality). The most effective way to alleviate these side effects is to taper or discontinue dopamine agonist therapy. A subset of patients who taper a dopamine agonist, however, develop dopamine agonist withdrawal syndrome (DAWS), which has been defined as a severe, stereotyped cluster of physical and psychological symptoms that correlate with dopamine agonist withdrawal in a dose-dependent manner, cause clinically significant distress or social/occupational dysfunction, are refractory to levodopa and other dopaminergic medications, and cannot be accounted for by other clinical factors. The symptoms of DAWS include anxiety, panic attacks, dysphoria, depression, agitation, irritability, suicidal ideation, fatigue, orthostatic hypotension, nausea, vomiting, diaphoresis, generalized pain, and drug cravings. The severity and prognosis of DAWS is highly variable. While some patients have transient symptoms and make a full recovery, others have a protracted withdrawal syndrome lasting for months to years, and therefore may be unwilling or unable to discontinue DA therapy. Impulse control disorders appear to be a major risk factor for DAWS, and are present in virtually all affected patients. Thus, patients who are unable to discontinue dopamine agonist therapy may experience chronic impulse control disorders. At the current time, there are no known effective treatments for DAWS. For this reason, providers are urged to use dopamine agonists judiciously, warn patients about the risks of DAWS prior to the initiation of dopamine agonist therapy, and follow patients closely for withdrawal symptoms during dopamine agonist taper.
50 CFR 665.249 - Lobster size and condition restrictions in Permit Area 2.
2010-10-01
... 50 Wildlife and Fisheries 9 2010-10-01 2010-10-01 false Lobster size and condition restrictions in... WESTERN PACIFIC Hawaii Fisheries § 665.249 Lobster size and condition restrictions in Permit Area 2. (a) Only spiny lobsters with a carapace length of 8.26 cm or greater may be retained (see Figure 1 to this...
Development of improved HP/IP rotor material 2% CrMoNiWV (23 CrMoNiWV 88)
International Nuclear Information System (INIS)
Wiemann, W.
1989-01-01
The new 2% CrMoNiWV steel has a sufficient strength level, a very good creep (rupture) behaviour and an excellent toughness behaviour for a creep resistant steel. Even after long time high temperature exposure the toughness degradation is so small that it is still better than this of best 1% CrMo(Ni)V steels. The fatigue behaviour is well comparable to this of 1% CrMo(Ni)V. The 2% CrMoNiWV steel has the capability to substitute the traditional 1% CrMo(Ni)V. (orig.) With 26 annexes
Contamination with retinoic acid receptor agonists in two rivers in the Kinki region of Japan.
Inoue, Daisuke; Nakama, Koki; Sawada, Kazuko; Watanabe, Taro; Takagi, Mai; Sei, Kazunari; Yang, Min; Hirotsuji, Junji; Hu, Jianying; Nishikawa, Jun-ichi; Nakanishi, Tsuyoshi; Ike, Michihiko
2010-04-01
This study was conducted to investigate the agonistic activity against human retinoic acid receptor (RAR) alpha in the Lake Biwa-Yodo River and the Ina River in the Kinki region of Japan. To accomplish this, a yeast two-hybrid assay was used to elucidate the spatial and temporal variations and potential sources of RARalpha agonist contamination in the river basins. RARalpha agonistic activity was commonly detected in the surface water samples collected along two rivers at different periods, with maximum all-trans retinoic acid (atRA) equivalents of 47.6 ng-atRA/L and 23.5 ng-atRA/L being observed in Lake Biwa-Yodo River and Ina River, respectively. The results indicated that RARalpha agonists are always present and widespread in the rivers. Comparative investigation of RARalpha and estrogen receptor alpha agonistic activities at 20 stations along each river revealed that the spatial variation pattern of RARalpha agonist contamination was entirely different from that of the estrogenic compound contamination. This suggests that the effluent from municipal wastewater treatment plants, a primary source of estrogenic compounds, seemed not to be the cause of RARalpha agonist contamination in the rivers. Fractionation using high performance liquid chromatography (HPLC) directed by the bioassay found two bioactive fractions from river water samples, suggesting the presence of at least two RARalpha agonists in the rivers. Although a trial conducted to identify RARalpha agonists in the major bioactive fraction was not completed as part of this study, comparison of retention times in HPLC analysis and quantification with liquid chromatography-mass spectrometry analysis revealed that the major causative contaminants responsible for the RARalpha agonistic activity were not RAs (natural RAR ligands) and 4-oxo-RAs, while 4-oxo-RAs were identified as the major RAR agonists in sewage in Beijing, China. These findings suggest that there are unknown RARalpha agonists with high
Suppression of atherosclerosis by synthetic REV-ERB agonist
Energy Technology Data Exchange (ETDEWEB)
Sitaula, Sadichha [Department of Molecular Therapeutics, The Scripps Research Institute, Jupiter, FL 33458 (United States); Billon, Cyrielle [Department of Pharmacological & Physiological Science, Saint Louis University School of Medicine, St. Louis, MO 63104 (United States); Kamenecka, Theodore M.; Solt, Laura A. [Department of Molecular Therapeutics, The Scripps Research Institute, Jupiter, FL 33458 (United States); Burris, Thomas P., E-mail: burristp@slu.edu [Department of Pharmacological & Physiological Science, Saint Louis University School of Medicine, St. Louis, MO 63104 (United States)
2015-05-08
The nuclear receptors for heme, REV-ERBα and REV-ERBβ, play important roles in the regulation of metabolism and inflammation. Recently it was demonstrated that reduced REV-ERBα expression in hematopoetic cells in LDL receptor null mice led to increased atherosclerosis. We sought to determine if synthetic REV-ERB agonists that we have developed might have the ability to suppress atherosclerosis in this model. A previously characterized synthetic REV-ERB agonist, SR9009, was used to determine if activation of REV-ERB activity would affect atherosclerosis in LDL receptor deficient mice. Atherosclerotic plaque size was significantly reduced (p < 0.05) in mice administered SR9009 (100 mg/kg) for seven weeks compared to control mice (n = 10 per group). SR9009 treatment of bone marrow-derived mouse macrophages (BMDM) reduced the polarization of BMDMs to proinflammatory M1 macrophage while increasing the polarization of BMDMs to anti-inflammatory M2 macrophages. Our results suggest that pharmacological targeting of REV-ERBs may be a viable therapeutic option for treatment of atherosclerosis. - Highlights: • Synthetic REV-ERB agonist treatment reduced atherosclerosis in a mouse model. • Pharmacological activation of REV-ERB decreased M1 macrophage polarization. • Pharmacological activation of REV-ERB increased M2 macrophage polarization.
Effect of free Cr content on corrosion behavior of 3Cr steels in a CO2 environment
Li, Wei; Xu, Lining; Qiao, Lijie; Li, Jinxu
2017-12-01
The corrosion behavior of 3Cr steels with three microstructures (martensite, bainite, combined ferrite and pearlite) in simulated oil field formation water with a CO2 partial pressure of 0.8 MPa was investigated. The relationships between Cr concentrations in corrosion scales and corrosion rates were studied. The precipitated phases that contained Cr were observed in steels of different microstructures, and free Cr content levels were compared. The results showed that steel with the martensite microstructure had the highest free Cr content, and thus had the highest corrosion resistance. The free Cr content of bainite steel was lower than that of martensite steel, and the corrosion rate of bainite steel was higher than that of martensite steel. Because large masses of Cr were combined in ferrite and pearlite steel, the corrosion rates of ferrite and pearlite steel were the highest. Free Cr content in steel affects its corrosion behavior greatly.
GnRH-agonist versus GnRH-antagonist IVF cycles
DEFF Research Database (Denmark)
Papanikolaou, E G; Pados, G; Grimbizis, G
2012-01-01
In view of the current debate concerning possible differences in efficacy between the two GnRH analogues used in IVF stimulated cycles, the current study aimed to explore whether progesterone control in the late follicular phase differs when GnRH antagonist is used as compared with GnRH agonist...
Inhibition by TRPA1 agonists of compound action potentials in the frog sciatic nerve
Energy Technology Data Exchange (ETDEWEB)
Matsushita, Akitomo; Ohtsubo, Sena; Fujita, Tsugumi; Kumamoto, Eiichi, E-mail: kumamote@cc.saga-u.ac.jp
2013-04-26
Highlights: •TRPA1 agonists inhibited compound action potentials in frog sciatic nerves. •This inhibition was not mediated by TRPA1 channels. •This efficacy was comparable to those of lidocaine and cocaine. •We found for the first time an ability of TRPA1 agonists to inhibit nerve conduction. -- Abstract: Although TRPV1 and TRPM8 agonists (vanilloid capsaicin and menthol, respectively) at high concentrations inhibit action potential conduction, it remains to be unknown whether TRPA1 agonists have a similar action. The present study examined the actions of TRPA1 agonists, cinnamaldehyde (CA) and allyl isothiocyanate (AITC), which differ in chemical structure from each other, on compound action potentials (CAPs) recorded from the frog sciatic nerve by using the air-gap method. CA and AITC concentration-dependently reduced the peak amplitude of the CAP with the IC{sub 50} values of 1.2 and 1.5 mM, respectively; these activities were resistant to a non-selective TRP antagonist ruthenium red or a selective TRPA1 antagonist HC-030031. The CA and AITC actions were distinct in property; the latter but not former action was delayed in onset and partially reversible, and CA but not AITC increased thresholds to elicit CAPs. A CAP inhibition was seen by hydroxy-α-sanshool (by 60% at 0.05 mM), which activates both TRPA1 and TRPV1 channels, a non-vanilloid TRPV1 agonist piperine (by 20% at 0.07 mM) and tetrahydrolavandulol (where the six-membered ring of menthol is opened; IC{sub 50} = 0.38 mM). It is suggested that TRPA1 agonists as well as TRPV1 and TRPM8 agonists have an ability to inhibit nerve conduction without TRP activation, although their agonists are quite different in chemical structure from each other.
Sports doping: emerging designer and therapeutic β2-agonists.
Fragkaki, A G; Georgakopoulos, C; Sterk, S; Nielen, M W F
2013-10-21
Beta2-adrenergic agonists, or β2-agonists, are considered essential bronchodilator drugs in the treatment of bronchial asthma, both as symptom-relievers and, in combination with inhaled corticosteroids, as disease-controllers. The use of β2-agonists is prohibited in sports by the World Anti-Doping Agency (WADA) due to claimed anabolic effects, and also, is prohibited as growth promoters in cattle fattening in the European Union. This paper reviews the last seven-year (2006-2012) literature concerning the development of novel β2-agonists molecules either by modifying the molecule of known β2-agonists or by introducing moieties producing indole-, adamantyl- or phenyl urea derivatives. New emerging β2-agonists molecules for future therapeutic use are also presented, intending to emphasize their potential use for doping purposes or as growth promoters in the near future. © 2013.
The mechanism of action of endothelin-1 as compared with other agonists in vascular smooth muscle
International Nuclear Information System (INIS)
Wallnoefer, A.W.; Weir, S.; Rueegg, U.C.; Cauvin, C.
1989-01-01
The effects of endothelin-1 (ET-1) on tension and membrane potential in rat isolated mesenteric resistance vessels (MRVs) and on 45Ca influx, 45Ca efflux, inositol-1,4,5-triphosphate (IP3) production, and cytoplasmic Ca2+ concentration ([Ca2+]1) in cultured aortic smooth muscle cells were compared with those of other agonists. ET-1 induced contractions of the MRVs, which were slow in onset, but reached a similar maximum amplitude (at 10 nM ET-1) as that seen with norepinephrine (NE, 10 microM) or [arg8]vasopressin (AVP, 0.1 microM). The EC50 for ET-1 was 1.3 +/- 0.1 nM. Removal of extracellular Ca2+ reduced ET-1-induced contractions to 11 +/- 3% of those in Ca2+-containing medium. With NE, the same procedure reduced contractions to 47 +/- 7% of those in Ca2+-containing medium, while with AVP, the reduction was similar in magnitude to that induced by ET-1 (11 +/- 5% of those in Ca2+-containing medium). Relaxation of ET-1-induced and NE-induced contractions by diltiazem was not complete (maximal at 58 +/- 6% with 10 microM diltiazem after 6 nM ET-1, and at 70 +/- 3% after 0.1 microM NE), in contrast to that of 80 mM K+-induced contractions, which were potently (IC50 = 0.2 microM) and completely reversed (100% relaxation at 10 microM diltiazem). ET-1 (6 nM) caused a small but significant depolarization of the MRVs (approximately 7 mV), the magnitude of which was only about one-third of that induced by equieffective contractile concentrations of NE and AVP. The voltage-sensitive Ca2+ channel agonist Bay K 8644 (1 microM), in contrast to ET-1, NE, and AVP, produced a small contraction (30 +/- 2% of the maximum response to NE), but no further depolarization when added in the presence of 15 mM K+ (which elicited approximately 12 mV depolarization but no contraction)
DEFF Research Database (Denmark)
Holst, Birgitte; Frimurer, Thomas M; Mokrosinski, Jacek
2008-01-01
A library of robust ghrelin receptor mutants with single substitutions at 22 positions in the main ligand-binding pocket was employed to map binding sites for six different agonists: two peptides (the 28-amino-acid octanoylated endogenous ligand ghrelin and the hexapeptide growth hormone......, and PheVI:23 on the opposing face of transmembrane domain (TM) VI. Each of the agonists was also affected selectively by specific mutations. The mutational map of the ability of L-692,429 and GHRP-6 to act as allosteric modulators by increasing ghrelin's maximal efficacy overlapped with the common....... It is concluded that although each of the ligands in addition exploits other parts of the receptor, a large, common binding site for both small-molecule agonists--including ago-allosteric modulators--and the endogenous agonist is found on the opposing faces of TM-III and -VI of the ghrelin receptor....
Tabassum, Nargis; Ma, Qianyun; Wu, Guanzhao; Jiang, Tao; Yu, Rilei
2017-09-01
Nicotinic acetylcholine receptors (nAChRs) belong to the Cys-loop receptor family and are important drug targets for the treatment of neurological diseases. However, the precise determinants of the binding efficacies of ligands for these receptors are unclear. Therefore, in this study, the binding energy profiles of various ligands (full agonists, partial agonists, and antagonists) were quantified by docking those ligands with structural ensembles of the α7 nAChR exhibiting different degrees of C-loop closure. This approximate treatment of interactions suggested that full agonists, partial agonists, and antagonists of the α7 nAChR possess distinctive binding energy profiles. Results from docking revealed that ligand binding efficacy may be related to the capacity of the ligand to stabilize conformational states with a closed C loop.
Gonadotropin releasing hormone agonists: Expanding vistas
Directory of Open Access Journals (Sweden)
Navneet Magon
2011-01-01
Full Text Available Gonadotropin-releasing hormone (GnRH agonists are derived from native GnRH by amino acid substitution which yields the agonist resistant to degradation and increases its half-life. The hypogonadotropic hypogonadal state produced by GnRH agonists has been often dubbed as "pseudomenopause" or "medical oophorectomy," which are both misnomers. GnRH analogues (GnRH-a work by temporarily "switching off" the ovaries. Ovaries can be "switched off" for the therapy and therapeutic trial of many conditions which include but are not limited to subfertility, endometriosis, adenomyosis, uterine leiomyomas, precocious puberty, premenstrual dysphoric disorder, chronic pelvic pain, or the prevention of menstrual bleeding in special clinical situations. Rapidly expanding vistas of usage of GnRH agonists encompass use in sex reassignment of male to female transsexuals, management of final height in cases of congenital adrenal hyperplasia, and preserving ovarian function in women undergoing cytotoxic chemotherapy. Hypogonadic side effects caused by the use of GnRH agonists can be tackled with use of "add-back" therapy. Goserelin, leuprolide, and nafarelin are commonly used in clinical practice. GnRH-a have provided us a powerful therapeutic approach to the treatment of numerous conditions in reproductive medicine. Recent synthesis of GnRH antagonists with a better tolerability profile may open new avenues for both research and clinical applications. All stakeholders who are partners in women′s healthcare need to join hands to spread awareness so that these drugs can be used to realize their full potential.
Sports doping: Emerging designer and therapeutic B2-agonists
Fragkaki, A.G.; Georgakopoulos, C.; Sterk, S.S.; Nielen, M.W.F.
2013-01-01
Beta2-adrenergic agonists, or ß2-agonists, are considered essential bronchodilator drugs in the treatment of bronchial asthma, both as symptom-relievers and, in combination with inhaled corticosteroids, as disease-controllers. The use of ß2-agonists is prohibited in sports by the World Anti-Doping
Inhibitory GTP binding protein G/sub i/ regulates β-adrenoceptor affinity towards β-agonists
International Nuclear Information System (INIS)
Marbach, I.; Levitzki, A.
1987-01-01
Treatment of S-49 lymphoma cell membranes with pertussis toxin (PT) causes a three-fold reduction of β-adrenoceptor (βAR) affinity towards isoproterenol. A similar treatment with cholera toxin (CT) does not cause such a modulation. The effects were studied by the detailed analysis of 125 I-cyanopindolol (CYP) binding curves in the absence and presence of increasing agonist concentrations. Thus, the authors were able to compare in detail the effects of G/sub s/ and G/sub i/ on the agonist-associated state of the βAR. In contrast to these findings, PT treatment does not have any effect on the displacement of 125 I-CYP by (-)isoproterenol. These results demonstrate that the inhibitory GTP protein G/sub i/ modulates the βAR affinity towards β-agonists. This might be due to the association of G/sub i/ with the agonist-bound βAR x G/sub s/ x C complex within the membrane. This hypothesis, as well as others, is under investigation
LaCrO{sub 3}-dispersed Cr for metallic interconnect of planar SOFC
Energy Technology Data Exchange (ETDEWEB)
Song, Rak-Hyun; Shin, Dong Ryul [Korea Institute of Energy Research, Taejon (Korea, Republic of); Dokiya, Masayuki [National Institute of Materials and Chemical Research, Ibaraki (Japan)
1996-12-31
In the planar SOFC, the interconnect materials plays two roles as an electrical connection and as a gas separation plate in a cell stack. The interconnect materials must be chemically stable in reducing and oxidizing environments, and have high electronic conductivity, high thermal conductivity, matching thermal expansion with an electrolyte, high mechanical strength, good fabricability, and gas tightness. Lanthanum chromite so far has been mainly used as interconnect materials in planar SOFC. However, the ceramic materials are very weak in mechanical strength and have poor machining property as compared with metal. Also the metallic materials have high electronic conductivity and high thermal conductivity. Recently some researchers have studied metallic interconnects such as Al{sub 2}O{sub 3}/Inconel 600 cermet, Ni-20Cr coated with (LaSr)CoO{sub 3}, and Y{sub 2}O{sub 3-} or La{sub 2}O{sub 3}-dispersed Cr alloy. These alloys have still some problems because Ni-based alloys have high thermal expansion, the added Al{sub 2}O{sub 3}, Y{sub 2}O{sub 3} and La{sub 2}O{sub 3} to metals have no electronic conductivity, and the oxide formed on the surface of Cr alloy has high volatility. To solve these problems, in this study, LaCrO{sub 3}-dispersed Cr for metallic interconnect of planar SOFC was investigated. The LaCrO{sub 3}-dispersed Cr can be one candidate of metallic interconnect because LaCrO{sub 3} possesses electronic conductivity and Cr metal has relatively low thermal expansion. The content of 25 vol.% LaCrO{sub 3} Was selected on the basis of a theoretically calculated thermal expansion. The thermal expansion, electrical and oxidation properties were examined and the results were discussed as related to SOFC requirements.
Energy Technology Data Exchange (ETDEWEB)
Muroga, T., E-mail: muroga@nifs.ac.jp [National Institute for Fusion Science, 322-6 Oroshi, Toki, Gifu 509-5292 (Japan); Nagasaka, T. [National Institute for Fusion Science, 322-6 Oroshi, Toki, Gifu 509-5292 (Japan); Li, Y.; Abe, H. [Institute for Materials Research, Tohoku University, 2-1-1 Katahira, Aoba-ku, Sendai 980-8577 (Japan); Ukai, S. [Graduate School of Engineering, Hokkaido University, N13, W8, Kita-ku, Sapporo 060-8628 (Japan); Kimura, A. [Institute of Advanced Energy, Kyoto University, Gokasho, Uji, Kyoto 611-0011 (Japan); Okuda, T. [Kobelco Research Institute, 1-5-5 Takatsukadai, Nishi-ku, Kobe, Hyogo 651-2271 (Japan)
2014-10-15
For the purpose of arranging reference alloys available for various characterization efforts by Japanese fusion research groups, fabrication of reference 9Cr and 12Cr-ODS steels have been carried out with similar manufacturing processes followed by various characterizations. The fabrication proceeded with powder mixing, MA, encapsulation into mild steel cases, hot extrusion and hot forging, followed by final heat treatments. Each alloy was extruded into three bars. The characterization included chemical composition analysis, SEM and TEM microstructural observations, hardness tests, tensile tests at RT and 973 K, and relatively short-term thermal creep tests at 973 K. Room temperature hardness for 9Cr-ODS was larger than 12Cr-ODS, the former showing large increase when annealing temperature exceeded 1200 K and the latter showing no significant change with annealing temperature. Tensile strength of 9Cr-ODS was significantly larger than that of 12Cr-ODS at RT but comparable at 973 K. 9Cr-ODS showed longer and shorter creep rupture time than 12Cr-ODS at high and low stress levels, respectively. The mechanism of the difference in creep properties of the two alloys was discussed.
Chen, Zunwei; Song, Shufang; Wen, Yuezhong
2016-12-01
The priority pollutant chromium (Cr) was ubiquitous and great efforts have been made to reduce Cr (VI) into less-toxic Cr (III) by alga for the convenient availability and low expense. However, the functional role of organelle inside the algal cell in Cr (VI) reduction was poorly understood. In this study, organelles in green algae Chlorella vulgaris were extracted and further decorated for Cr (VI) reduction tests. Results showed that the chloroplast exhibited not only adsorption ability of total Cr (21.18% comparing to control) but also reduction potential of Cr (VI) (almost 70% comparing to control), whose most suitable working concentration was at 17μg/mL. Furtherly, the isolated thylakoid membrane (ITM) showed better Cr (VI) reduction potential with the presence of sodium alginate (SA), even though the Hill reaction activity (HRA) was inhibited. As for photosystem II (PSII), the addition of mesoporous silica SBA-15 enhanced the reduction ability through improving the light-harvesting complex (LHC) II efficiency and electron transport rate. On the whole, the reduction ability order of the three kinds of materials based on chloroplast in C. vulgaris was PSII@SBA-15>Chloroplast>ITM@SA. The attempt made in this study to reduce the Cr (VI) with C. vulgaris organelles might not only offer basement to detect the potential action mechanism of Cr (VI) reduction by C. vulgaris but also provide a new sight for the scavenge of heavy metal with biological materials. Copyright © 2016 Elsevier B.V. All rights reserved.
Directory of Open Access Journals (Sweden)
Guo S
2017-03-01
Full Text Available Song Guo,1,* Xiaowei Lu,1,* Ruihuan Gu,2 Di Zhang,3 Yijuan Sun,2 Yun Feng1 1Department of Obstetrics and Gynecology, Reproductive Medicine Center, Ruijin Hospital Affiliated to Shanghai Jiaotong University School of Medicine, Shanghai, People’s Republic of China; 2Gynecology, Shanghai Ji Ai Genetics & In Vitro Fertilization Institute, Obstetrics and Gynecology Hospital, Fudan University, Shanghai, People’s Republic of China; 3Department of Gynecology and Obstetrics, Jinan Military General Hospital, Jinan, People’s Republic of China *These authors contributed equally to this work Purpose: Adenomyosis is a common, benign gynecological condition of the female reproductive tract characterized by heavy menstrual bleeding and dysmenorrhea. Gonadotropin-releasing hormone (GnRH agonists are one of the medications used in adenomyosis treatment; however, their underlying mechanisms are poorly understood. Moreover, it is difficult to obtain endometrial samples from women undergoing such treatment. To overcome this, we generated an adenomyosis mouse model, which we treated with an GnRH agonist to determine its effect on pregnancy outcomes. We also analyzed endometrial gene expression following GnRH agonist treatment to determine the mechanisms that may affect pregnancy outcome in individuals with adenomyosis.Methods: Neonatal female mice were divided into a control group, an untreated adenomyosis group, and an adenomyosis group treated with a GnRH agonist (n=6 each. The pregnancy outcome was observed and compared among the groups. Then, three randomly chosen transcriptomes from endometrial tissues from day 4 of pregnancy were analyzed between the adenomyosis group and the GnRH agonist treatment group by RNA sequencing and quantitative reverse transcription polymerase chain reaction (PCR.Results: The litter size was significantly smaller in the adenomyosis group than in the control group (7±0.28 vs 11±0.26; P<0.05. However, the average live litter
Complex analysis and CR geometry
Zampieri, Giuseppe
2008-01-01
Cauchy-Riemann (CR) geometry is the study of manifolds equipped with a system of CR-type equations. Compared to the early days when the purpose of CR geometry was to supply tools for the analysis of the existence and regularity of solutions to the \\bar\\partial-Neumann problem, it has rapidly acquired a life of its own and has became an important topic in differential geometry and the study of non-linear partial differential equations. A full understanding of modern CR geometry requires knowledge of various topics such as real/complex differential and symplectic geometry, foliation theory, the geometric theory of PDE's, and microlocal analysis. Nowadays, the subject of CR geometry is very rich in results, and the amount of material required to reach competence is daunting to graduate students who wish to learn it. However, the present book does not aim at introducing all the topics of current interest in CR geometry. Instead, an attempt is made to be friendly to the novice by moving, in a fairly relaxed way, f...
Jutkiewicz, Emily M; Baladi, Michelle G; Folk, John E; Rice, Kenner C; Woods, James H
2006-06-01
delta-Opioid agonists produce convulsions and antidepressant-like effects in rats. It has been suggested that the antidepressant-like effects are produced through a convulsant mechanism of action either through overt convulsions or nonconvulsive seizures. This study evaluated the convulsive and seizurogenic effects of nonpeptidic delta-opioid agonists at doses that previously were reported to produce antidepressant-like effects. In addition, delta-opioid agonist-induced electroencephalographic (EEG) and behavioral changes were compared with those produced by the chemical convulsant pentylenetetrazol (PTZ). For these studies, EEG changes were recorded using a telemetry system before and after injections of the delta-opioid agonists [(+)-4-[(alphaR)-alpha-[(2S,5R)-2,5-dimethyl-4-(2-propenyl)-1-piperazinyl]-(3-methoxyphenyl)methyl]-N,N-diethylbenz (SNC80) and [(+)-4-[alpha(R)-alpha-[(2S,5R)-2,5-dimethyl-4-(2-propenyl)-1-piperazinyl]-(3-hydroxyphenyl)methyl]-N,N-diethylbenzamide [(+)-BW373U86]. Acute administration of nonpeptidic delta-opioid agonists produced bilateral ictal and paroxysmal spike and/or sharp wave discharges. delta-Opioid agonists produced brief changes in EEG recordings, and tolerance rapidly developed to these effects; however, PTZ produced longer-lasting EEG changes that were exacerbated after repeated administration. Studies with antiepileptic drugs demonstrated that compounds used to treat absence epilepsy blocked the convulsive effects of nonpeptidic delta-opioid agonists. Overall, these data suggest that delta-opioid agonist-induced EEG changes are not required for the antidepressant-like effects of these compounds and that neural circuitry involved in absence epilepsy may be related to delta-opioid agonist-induced convulsions. In terms of therapeutic development, these data suggest that it may be possible to develop delta-opioid agonists devoid of convulsive properties.
Analysis of PTA hardfacing with CoCrWC and CoCrMoSi alloys
Directory of Open Access Journals (Sweden)
Adriano Scheid
2013-12-01
Full Text Available CoCrWC alloys are widely used to protect components that operate under wear and high temperature environments. Enhanced performance has been achieved with the CoCrMoSi alloys but processing this alloy system is still a challenge due to the presence of the brittle Laves phase, particularly when welding is involved. This work evaluated Plasma Transferred Arc coatings processed with the Co-based alloy CoMoCrSi - Tribaloy T400, reinforced with Laves phase, comparing its weldability to the CoCrWC - Stellite 6, reinforced with carbides. Coatings were also analyzed regarding the response to temperature exposure at 600°C for 7 days and subsequent effect on microstructure and sliding abrasive wear. Coatings characterization was carried out by light and scanning electron microscopy, X-ray diffraction and Vickers hardness. CoCrWC coatings exhibited a Cobalt solid solution dendritic microstructure and a thin interdendritic region with eutectic carbides, while CoCrMoSi deposits exhibit a large lamellar eutectic region of Laves phase and Cobalt solid solution and a small fraction of primary Laves phase. Although phase stability was observed by X-ray diffraction, coarsening of the microstructure occurred for both alloys. CoCrMoSi showed thicker lamellar Laves phase and CoCrWC coarser eutectic carbides. Coatings stability assessed by wear tests revealed that although the wear rate of the as-deposited CoCrMoSi alloy was lower than that of CoCrWC alloy its increase after temperature exposure was more significant, 22% against 15%. Results were discussed regarding the protection of industrial components in particular, bearings in 55AlZn hot dip galvanizing components.
Development of Cr3C2-25(Ni20Cr) nanostructured coatings
International Nuclear Information System (INIS)
Cunha, Cecilio Alvares da
2012-01-01
This study is divided in two parts. The first part is about the preparation of nanostructured Cr 3 C 2 -25(Ni20Cr) powders by high energy milling followed by characterization of the milled and the as received powder. Analyses of some of the data obtained were done using a theoretical approach. The second part of this study is about the preparation and characterization of coatings prepared with the nanostructured as well as the as received Cr 3 C 2 -25(Ni20Cr) powders. The high temperature erosion-oxidation (E-O) behavior of the coatings prepared with the two types of powders has been compared based on a technological approach. The average crystallite size of the Cr 3 C 2 -25(Ni20Cr) powder decreased rapidly from 145 nm to 50 nm in the initial stages of milling and thereafter decreased slowly to a steady state value of around 10 nm with further increase in milling time. This steady state corresponds to the beginning of a dynamic recovery process. The maximum lattice strain (ε = 1,17%) was observed in powders milled for 16 hours, and this powders critical crystallite size was 28 nm. In contrast, the lattice parameter attained a minimum for powders milled for 16 hours. Upon reaching the critical crystallite size, the dislocation density attained a steady state regime and all plastic deformation introduced in the material there after was in the form of events occurring at the grain boundaries, due mainly to grain boundary sliding. The deformation energy stored in the crystal lattice of the Cr 3 C 2 -25(Ni20Cr) powders milled for different times was determined from enthalpy variation measurements. These results indicated that the maximum enthalpy variation (δH = 722 mcal) also occurred for powders milled for 16 hours. In a similar manner, the maximum specific heat variation (δC p = 0,278 cal/gK) occurred for powders milled for 16 hours. The following mechanical properties of Cr 3 C 2 -25(Ni20Cr) coatings prepared using the HVOF thermal spray process were determined
Energy Technology Data Exchange (ETDEWEB)
Carneiro, J.F.; Sabioni, A.C.S. [Universidade Federal de Ouro Preto (LDM/DF/UFOP), MG (Brazil). Dept. de Fisica. Lab. de Difusao em Materiais; Trindade, V.B. [Universidade Federal de Ouro Preto (DEMM/UFOP), MG (Brazil). Dept. de Engenharia Metalurgica e de Materiais; Ji, V. [Laboratoire d' Etude des Materiaux Hors-Equilibre (LEMHE), Orsay (France)
2010-07-01
The high temperature oxidation behavior of Fe-1.5%Cr, Fe-5.0%Cr, Fe-10%Cr and Fe- 15%Cr model alloys were investigated from 700 to 850 deg C, in air atmosphere. The oxidation treatments were performed in a thermobalance with a sensitivity of 1{mu}g. The oxide films grown by oxidation of the alloys were characterized by scanning electronic microscopy (SEM), energy dispersive X-ray spectroscopy (EDS) and X-ray diffraction (XRD). The oxide films are Fe-Cr spinels with variable composition depending on the alloy composition. For all conditions studied, the oxidation kinetics of these alloys follow a parabolic law. The comparison of the oxidation rates of the four alloys, at 700 deg C, shows that the parabolic oxidation constants decrease from 1.96x10{sup -9}g{sup 2}.cm{sup -4}.s{sup -1}, for the alloy Fe-1.5% Cr, to 1.18 x 10-14g{sup 2}.cm{sup -4}.s{sup -1} for the alloy Fe-15% Cr. Comparative analysis of the oxidation behavior of the Fe-10%Cr and Fe-15%Cr alloys, between 700 and 850 deg C, shows that the oxidation rates of these alloys are comparable to 800 deg C, above this temperature the Fe-10%Cr alloy shows lower resistance to oxidation. (author)
Miretzky, P; Cirelli, A Fernandez
2010-08-15
In aqueous systems, chromium usually exists in both trivalent and hexavalent oxidation states, being Cr(VI) of particular importance and concern due to its great toxicity. Industrial sources of Cr(VI) are leather tanning, mining of chrome ore, production of steel and alloys, etc. The most common conventional method for Cr(VI) removal is reduction to Cr(III) at pH 2.0 and precipitation of Cr (OH)(3) with lime at pH 9-10. The disadvantage of precipitation is the disposal of the solid waste. Adsorption of Cr by different low cost materials seems to be a suitable choice for wastewater treatment. Many by-products of agriculture have proved to be suitable low cost adsorbents for Cr(VI) and Cr(III) removal from water. Lignocellulosic residues, which include both wood residues and agricultural residues, have adsorption capacity comparable to other natural sorbents, but they have the advantage of very low or no cost, great availability and simple operational process. This study is a review of the recent literature on the use of natural and modified lignocellulosic residues for Cr adsorption. The Cr maximum adsorption capacity and the adsorption mechanism under different experimental conditions are reported when possibly. Copyright 2010 Elsevier B.V. All rights reserved.
Sirohi, Sunil; Dighe, Shveta V; Madia, Priyanka A; Yoburn, Byron C
2009-08-01
Opioid antagonists can be classified as inverse agonists and neutral antagonists. In the opioid-dependent state, neutral antagonists are significantly less potent in precipitating withdrawal than inverse agonists. Consequently, neutral opioid antagonists may offer advantages over inverse agonists in the management of opioid overdose. In this study, the relative potency of three opioid antagonists to block opioid analgesia and toxicity and precipitate withdrawal was examined. First, the potency of two opioid inverse agonists (naltrexone and naloxone) and a neutral antagonist (6beta-naltrexol) to antagonize fentanyl-induced analgesia and lethality was determined. The order of potency to block analgesia was naltrexone > naloxone > 6beta-naltrexol (17, 4, 1), which was similar to that to block lethality (13, 2, 1). Next, the antagonists were compared using withdrawal jumping in fentanyl-dependent mice. The order of potency to precipitate withdrawal jumping was naltrexone > naloxone 6beta-naltrexol (1107, 415, 1). The relative potencies to precipitate withdrawal for the inverse agonists compared with the neutral antagonist were dramatically different from that for antagonism of analgesia and lethality. Finally, the effect of 6beta-naltrexol pretreatment on naloxone-precipitated jumping was determined in morphine and fentanyl-dependent mice. 6beta-Naltrexol pretreatment decreased naloxone precipitated withdrawal, indicating that 6beta-naltrexol is a neutral antagonist. These data demonstrate that inverse agonists and neutral antagonists have generally comparable potencies to block opioid analgesia and lethality, whereas the neutral opioid antagonist is substantially less potent in precipitating opioid withdrawal. These results support suggestions that neutral antagonists may have advantages over inverse agonists in the management of opioid overdose.
O'Byrne, Paul M.; Naya, Ian P.; Kallen, Anders; Postma, Dirkje S.; Barnes, Peter J.
2008-01-01
Background: Combination therapy with inhaled corticosteroids (ICSs) and long-acting beta(2)-agonists (LABAs), or treatment with high doses of ICSs alone improves asthma control when therapy with low-dose ICSs is not sufficient. However, it is not known which of these treatment options is more
Reciprocity of agonistic support in ravens.
Fraser, Orlaith N; Bugnyar, Thomas
2012-01-01
Cooperative behaviour through reciprocation or interchange of valuable services in primates has received considerable attention, especially regarding the timeframe of reciprocation and its ensuing cognitive implications. Much less, however, is known about reciprocity in other animals, particularly birds. We investigated patterns of agonistic support (defined as a third party intervening in an ongoing conflict to attack one of the conflict participants, thus supporting the other) in a group of 13 captive ravens, Corvus corax. We found support for long-term, but not short-term, reciprocation of agonistic support. Ravens were more likely to support individuals who preened them, kin and dominant group members. These results suggest that ravens do not reciprocate on a calculated tit-for-tat basis, but aid individuals from whom reciprocated support would be most useful and those with whom they share a good relationship. Additionally, dyadic levels of agonistic support and consolation (postconflict affiliation from a bystander to the victim) correlated strongly with each other, but we found no evidence to suggest that receiving agonistic support influences the victim's likelihood of receiving support (consolation) after the conflict ends. Our findings are consistent with an emotionally mediated form of reciprocity in ravens and provide additional support for convergent cognitive evolution in birds and mammals.
Energy Technology Data Exchange (ETDEWEB)
Luo, Yueh-Hsia; Kuo, Yu-Chun; Tsai, Ming-Hsien; Ho, Chia-Chi; Tsai, Hui-Ti; Hsu, Chin-Yu; Chen, Yu-Cheng; Lin, Pinpin, E-mail: pplin@nhri.org.tw
2017-06-01
Exposure to environmental aryl hydrocarbon receptor (AhR) agonists, such as halogenated aromatic hydrocarbons and polycyclic aromatic hydrocarbons (PAHs), has great impacts on the development of various lung diseases. As emerging molecular targets for AhR agonists, cytokines may contribute to the inflammatory or immunotoxic effects of environmental AhR agonists. However, general cytokine expression may not specifically indicate environmental AhR agonist exposure. By comparing cytokine and chemokine expression profiles in human lung adenocarcinoma cell line CL5 treated with AhR agonists and the non-AhR agonist polychlorinated biphenyl (PCB) 39, we identified a target cytokine of environmental AhR agonist exposure of in the lungs. Thirteen cytokine and chemokine genes were altered in the AhR agonists-treated cells, but none were altered in the PCB39-treated cells. Interleukin (IL)-24 was the most highly induced gene among AhR-modulated cytokines. Cotreatment with AhR antagonist completely prevented IL-24 induction by AhR agonists in the CL5 cells. Knockdown AhR expression with short-hairpin RNA (shRNA) significantly reduced benzo[a]pyrene (BaP)-induced IL-24 mRNA levels. We further confirmed that gene transcription, but not mRNA stability, was involved in IL-24 upregulation by BaP. Particulate matter (PM) in the ambient air contains some PAHs and is reported to activate AhR. Oropharyngeal aspiration of PM significantly increased IL-24 levels in lung epithelia and in bronchoalveolar lavage fluid of mice 4 weeks after treatment. Thus, our data suggests that IL-24 is a pulmonary exposure target cytokine of environmental AhR agonists. - Graphical abstract: (A) Cytokine and chemokine gene expressions were examined in CL5 cells treated with AhR and non-AhR agonists. Thirteen cytokines and chemokines genes were altered in the AhR agonist-treated cells, but not in the non-AhR agonist-treated cells. IL-24 was the most highly induced gene among the AhR-modulated cytokines. (B
Corrosion resistance of amorphous NiCrZr and NiCrMoZr alloys
International Nuclear Information System (INIS)
Naka, M.; Miyake, M.; Okamoto, I.
1987-01-01
One of the authors has reported that the corrosion resistance of chromium containing amorphous alloys is extremely improved by alloying phosphorus among metalloids. Two factors operate for the improvement of corrosion resistance of the amorphous alloys. First, phosphorus serves for the rapid formation of protective passive film. Second, the compositional and structural homogeneity in amorphous state also account for the formation of protective film. The latter factor has been clearly seen in the high corrosion resistance of CoCrMoZr and CoCrWZr alloys without metalloids. In order to clarify the separately two factors in the corrosion resistance of amorphous alloys, the corrosion resistance of amorphous alloys without metalloids has to be further investigated. This paper also deals with the corrosion resistance and electrochemical behavior of NiCrZr and NiCrMoZr alloys in 1N HCl, and compare them with the corrosion behavior of the crystalline alloys containing the same composition as that of the amorphous alloys
Shiri, Mariam; Komaki, Alireza; Oryan, Shahrbanoo; Taheri, Masoumeh; Komaki, Hamidreza; Etaee, Farshid
2017-04-01
Despite previous findings on the effects of cannabinoid and vanilloid systems on learning and memory, the effects of the combined stimulation of these 2 systems on learning and memory have not been studied. Therefore, in this study, we tested the interactive effects of cannabinoid and vanilloid systems on learning and memory in rats by using passive avoidance learning (PAL) tests. Forty male Wistar rats were divided into the following 4 groups: (1) control (DMSO+saline), (2) WIN55,212-2, (3) capsaicin, and (4) WIN55,212-2 + capsaicin. On test day, capsaicin, a vanilloid receptor type 1 (TRPV1) agonist, or WIN55,212-2, a cannabinoid receptor (CB 1 /CB 2 ) agonist, or both substances were injected intraperitoneally. Compared to the control group, the group treated with capsaicin (TRPV1 agonist) had better scores in the PAL acquisition and retention test, whereas treatment with WIN55,212-2 (CB 1 /CB 2 agonist) decreased the test scores. Capsaicin partly reduced the effects of WIN55,212-2 on PAL and memory. We conclude that the acute administration of a TRPV1 agonist improves the rats' cognitive performance in PAL tasks and that a vanilloid-related mechanism may underlie the agonistic effect of WIN55,212-2 on learning and memory.
Energy Technology Data Exchange (ETDEWEB)
Cunha, Cecilio Alvares da
2012-07-01
This study is divided in two parts. The first part is about the preparation of nanostructured Cr{sub 3}C{sub 2}-25(Ni20Cr) powders by high energy milling followed by characterization of the milled and the as received powder. Analyses of some of the data obtained were done using a theoretical approach. The second part of this study is about the preparation and characterization of coatings prepared with the nanostructured as well as the as received Cr{sub 3}C{sub 2}-25(Ni20Cr) powders. The high temperature erosion-oxidation (E-O) behavior of the coatings prepared with the two types of powders has been compared based on a technological approach. The average crystallite size of the Cr{sub 3}C{sub 2}-25(Ni20Cr) powder decreased rapidly from 145 nm to 50 nm in the initial stages of milling and thereafter decreased slowly to a steady state value of around 10 nm with further increase in milling time. This steady state corresponds to the beginning of a dynamic recovery process. The maximum lattice strain ({epsilon} = 1,17%) was observed in powders milled for 16 hours, and this powders critical crystallite size was 28 nm. In contrast, the lattice parameter attained a minimum for powders milled for 16 hours. Upon reaching the critical crystallite size, the dislocation density attained a steady state regime and all plastic deformation introduced in the material there after was in the form of events occurring at the grain boundaries, due mainly to grain boundary sliding. The deformation energy stored in the crystal lattice of the Cr{sub 3}C{sub 2}-25(Ni20Cr) powders milled for different times was determined from enthalpy variation measurements. These results indicated that the maximum enthalpy variation ({delta}H = 722 mcal) also occurred for powders milled for 16 hours. In a similar manner, the maximum specific heat variation ({delta}C{sub p} = 0,278 cal/gK) occurred for powders milled for 16 hours. The following mechanical properties of Cr{sub 3}C{sub 2}-25(Ni20Cr) coatings
Liquidus projection of the Nb-Cr-Al system near the Al3(Nb,Cr) + Cr(Al,Nb) eutectic region
International Nuclear Information System (INIS)
Souza, S.A.; Ferrandini, P.L.; Nunes, C.A.; Coelho, A.A.; Caram, R.
2006-01-01
The system Nb-Cr-Al was investigated in the region near the Al 3 (Nb,Cr) + Cr(Al,Nb) eutectic and the liquidus projection of that region was determined based on the microstructural characterization of arc melted alloys. The characterization utilized scanning electron microscopy (SEM), energy dispersive spectroscopy (EDS), differential thermal analysis (DTA) and X-ray diffraction (XRD). The results allowed one to determine three primary solidification liquidus surfaces ((Cr,Al) 2 Nb, Cr(Al,Nb) and Al 3 (Nb,Cr)), that are originated from the binary systems Cr-Nb, Cr-Al and Al-Nb. It is proposed the occurrence of the invariant reaction L + (Cr,Al) 2 Nb ↔ Al 3 (Nb,Cr) + Cr(Al,Nb) and of a point of minimum, which involves a three phase reaction, L ↔ Al 3 (Nb,Cr) + Cr(Al,Nb). All alloys studied showed formation of the Al 3 (Nb,Cr) + Cr(Al,Nb) eutectic as the last solidification step with Al(Nb)Cr 2 precipitating from Cr(Al,Nb)
Koutsoukis, Theodoros; Zinelis, Spiros; Eliades, George; Al-Wazzan, Khalid; Rifaiy, Mohammed Al; Al Jabbari, Youssef S
2015-06-01
The aim of this study was to review the effect of selective laser melting (SLM) procedure on the properties of dental structures made of Co-Cr alloys and to evaluate its quality and compare it to those produced by conventional casting and milling fabrication techniques. A computerized database search using PubMed and Scopus was conducted for peer-reviewed scientific research studies regarding the use of SLM in Co-Cr dental alloys with no restrictions for publication years. The search engines provided hundreds of results, and only 48 scientific research papers, case studies, or literature reviews were considered relevant for this review. The innovative manufacturing concept of SLM offers many advantages compared with casting and milling fabrication techniques. SLM provides different microstructure from casting and milling with minimal internal porosity and internal fitting, marginal adaptation, and comparable bond strength to porcelain. Mechanical and electrochemical properties of SLM structures are enhanced compared to cast, while clinical longevity of single-metal ceramic crowns is comparable to Au-Pt dental alloy. The SLM technique provides dental prosthetic restorations more quickly and less expensively without compromising their quality compared with restorations prepared by casting and milling techniques. The current SLM devices provide metallic restorations made of Co-Cr alloys for removable and fixed partial dentures without compromising the alloy or restoration properties at a fraction of the time and cost, showing great potential to replace the aforementioned fabrication techniques in the long term; however, further clinical studies are essential to increase the acceptance of this technology by the worldwide dental community. © 2015 by the American College of Prosthodontists.
Should We Use PPAR Agonists to Reduce Cardiovascular Risk?
Directory of Open Access Journals (Sweden)
Jennifer G. Robinson
2008-01-01
Full Text Available Trials of peroxisome proliferator-activated receptor (PPAR agonists have shown mixed results for cardiovascular prevention. Fibrates are PPAR- agonists that act primarily to improve dyslipidemia. Based on low- and high-density lipoprotein cholesterol (LDL and HDL effects, gemfibrozil may be of greater cardiovascular benefit than expected, fenofibrate performed about as expected, and bezafibrate performed worse than expected. Increases in both cardiovascular and noncardiovascular serious adverse events have been observed with some fibrates. Thiazolidinediones (TZDs are PPAR- agonists used to improve impaired glucose metabolism but also influence lipids. Pioglitazone reduces atherosclerotic events in diabetic subjects, but has no net cardiovascular benefit due to increased congestive heart failure risk. Rosiglitazone may increase the risk of atherosclerotic events, and has a net harmful effect on the cardiovascular system when congestive heart failure is included. The primary benefit of TZDs appears to be the prevention of diabetic microvascular complications. Dual PPAR-/ agonists have had unacceptable adverse effects but more selective agents are in development. PPAR- and pan-agonists are also in development. It will be imperative to prove that future PPAR agonists not only prevent atherosclerotic events but also result in a net reduction on total cardiovascular events without significant noncardiovascular adverse effects with long-term use.
Principles of agonist recognition in Cys-loop receptors
DEFF Research Database (Denmark)
Lynagh, Timothy Peter; Pless, Stephan Alexander
2014-01-01
, functional studies, and X-ray crystallography experiments identified the extracellular interface of adjacent subunits as the principal site of agonist binding. The question of how subtle differences at and around agonist-binding sites of different Cys-loop receptors can accommodate transmitters as chemically...
DEFF Research Database (Denmark)
Thomsen, Morten Skøtt; El-Sayed, Mona; Mikkelsen, Jens D
2011-01-01
of repeated administration of α7 nAChR agonists. We further compare the effect of agonists to that of α7 nAChR positive allosteric modulators (PAMs), which do not induce upregulation of the α7 nAChR. Using the social discrimination test as a measure of short-term memory, we show that the α7 nAChR agonist A......-582941 improves short-term memory immediately after repeated (7× daily), but not a single administration. The α7 nAChR PAMs PNU-120596 and AVL-3288 do not affect short-term memory immediately after a single or repeated administration. This demonstrates a fundamental difference in the behavioral effects...... of agonists and PAMs that may be relevant for clinical development. Importantly, A-582941 and AVL-3288 increase short-term memory 24 hrs after repeated, but not a single, administration, suggesting that repeated administration of both agonists and PAMs may produce sustained effects on cognitive performance...
Directory of Open Access Journals (Sweden)
JIN Jie
2016-10-01
Full Text Available The CrN and CrNiN coatings were prepared on the surface of 304 stainless steel by closed field unbalanced magnetron sputtering.X ray diffraction and field emission scanning electron microscopy were used to characterize the structure and morphology of the coatings.The electrochemical corrosion properties under the simulated proton exchange membrane fuel cell(PEMFC environment, interfacial contact resistance and hydrophobic properties of the two kinds of different coatings were investigated by electrochemical methods,contact resistance test and hydrophobic test,respectively.The results indicate that CrN coating mainly consists of CrN and Cr2N phase,CrN and Cr2N phases in the CrNiN coating are less compared to CrN film, and Ni exist as element in CrNiN coating; dynamic polarization tests show the coating is of better corrosion resistance,whereas the corrosion resistance of CrNiN coating is worse than that of CrN coating,constant potential polarization test shows the corrosion current density of CrN and CrNiN coatings are equivalent; CrN and CrNiN coatings significantly reduce the interfacial contact resistance of the 304 stainless steel,among which CrN coating has the smallest contact resistance; and CrNiN coating which has better hydrophobicity than that of CrN coating is more beneficial for the water management in proton exchange membrane fuel cell.
Directory of Open Access Journals (Sweden)
Ana Paula Martins
2016-04-01
Full Text Available Introduction: Glucagon-like peptide analogues are a new class of drugs used in the treatment of type 2 diabetes mellitus that mimic the endogenous hormone glucagon-like peptide 1. Glucagon-like peptide 1 regulates glucose levels by stimulating glucose-dependent insulin secretion, suppressing glucagon secretion, delayed gastric emptying and promoting satiety. The individualized treatment of type 2 diabetes mellitus, using various glucagon--like peptide receptor agonists, has recently been described and the interest related to these drugs continues to grow. Objectives: To review the efficacy and safety of glucagon-like peptide 1 agonists in patients with inadequately controlled type 2 diabetes mellitus on metformin alone, highlighting their added value in therapeutic use comparatively to second line oral therapies used in type 2 diabetes mellitus. Methods: Studies were obtained from electronic searches of The Cochrane Library and PubMed. Randomized controlled trials were selected if they were at least 8 weeks in duration; compared a glucagon-like peptide 1 analogue with an oral anti-diabetic agent in patients experiencing inadequate glycemic control with metformin monotherapy; and reported hemoglobin A1c data in non-pregnant adults with type 2 diabetes mellitus. Results: Of 72 potentially relevant articles identified, 23 were retrieved for detailed evaluation and 10 met the inclusion criteria. The majority of glucagon-like peptide 1 agonists showed equivalent or superior efficacy than most active comparators for reducing hemoglobin A1c, with a greater proportion of patients achieving hemoglobin A1c <7%. Glucagon-like peptide 1 agonists also showed extra-glycemic effects such as weight loss and the reduction of important cardiovascular parameters. Side effects included gastrointestinal complications, mainly nausea, vomiting and diarrhea. The incidence of hypoglycemia was less common for this class of agents. Conclusion: Glucagon-like peptide 1
DEFF Research Database (Denmark)
Henriksen, Kim; Byrjalsen, Inger; Qvist, Per
2011-01-01
Treatment of patients with full PPARγ agonists is associated with weight gain, heart failure, peripheral oedema and bone loss. However, the safety of partial PPARγ agonists has not been established in a clinical trial. The BALLET trial aimed to establish the glucose-lowering effects and safety...... in all treatment arms. DXA analyses showed balaglitazone 10mg led to less fat and fluid accumulation and no change in bone mineral density, when compared to pioglitazone. In the balaglitazone 10mg treated group clinically relevant reductions in HbA(1c) and glucose levels were observed, although...... it appeared to be a little less potent that pioglitazone 45mg. On the other hand significantly less fluid and fat accumulation were observed, highlighting this treatment regimen for further studies....
Comparative studies of chemically synthesized and RF plasma ...
Indian Academy of Sciences (India)
journal of. April 2015 physics pp. 653–665. Comparative studies of ... MS received 16 April 2013; revised 5 February 2014; accepted 28 May 2014 ... RF plasma polymerization; poly(o-toluidine); Fourier transform infrared; UV–visible ... tial applications, e.g., as electrodes and membranes for electrochemical energy ...
Takezako, Takanobu; Unal, Hamiyet; Karnik, Sadashiva S; Node, Koichi
2018-03-23
Conditions such as hypertension and renal allograft rejection are accompanied by chronic, agonist-independent, signalling by angiotensin II AT 1 receptors. The current treatment paradigm for these diseases entails the preferred use of inverse agonist AT 1 receptor blockers (ARBs). However, variability in the inverse agonist activities of common biphenyl-tetrazole ARBs for the active state of AT 1 receptors often leads to treatment failure. Therefore, characterization of robust inverse agonist ARBs for the active state of AT 1 receptors is necessary. To identify the robust inverse agonist for active state of AT 1 receptors and its molecular mechanism, we performed site-directed mutagenesis, competition binding assay, inositol phosphate production assay and molecular modelling for both ground-state wild-type AT 1 receptors and active-state N111G mutant AT 1 receptors. Although candesartan and telmisartan exhibited weaker inverse agonist activity for N111G- compared with WT-AT 1 receptors, only eprosartan exhibited robust inverse agonist activity for both N111G- and WT- AT 1 receptors. Specific ligand-receptor contacts for candesartan and telmisartan are altered in the active-state N111G- AT 1 receptors compared with the ground-state WT-AT 1 receptors, suggesting an explanation of their attenuated inverse agonist activity for the active state of AT 1 receptors. In contrast, interactions between eprosartan and N111G-AT 1 receptors were not significantly altered, and the inverse agonist activity of eprosartan was robust. Eprosartan may be a better therapeutic option than other ARBs. Comparative studies investigating eprosartan and other ARBs for the treatment of diseases caused by chronic, agonist-independent, AT 1 receptor activation are warranted. © 2018 The British Pharmacological Society.
Long-acting β2-agonists in asthma
DEFF Research Database (Denmark)
Jacobson, Glenn A; Raidal, Sharanne; Hostrup, Morten
2018-01-01
Long-acting β2-agonists (LABAs) such as formoterol and salmeterol are used for prolonged bronchodilatation in asthma, usually in combination with inhaled corticosteroids (ICSs). Unexplained paradoxical asthma exacerbations and deaths have been associated with LABAs, particularly when used without...... and effects on BHR, particularly that (S)-enantiomers of β2-agonists may be deleterious to asthma control. LABAs display enantioselective pharmacokinetics and pharmacodynamics. Biological plausibility of the deleterious effects of β2-agonists (S)-enantiomers is provided by in vitro and in vivo studies from...... mechanism in rapid asthma deaths. More effort should therefore be applied to investigating potential enantiospecific effects of LABAs on safety, specifically bronchoprotection. Safety studies directly assessing the effects of LABA (S)-enantiomers on BHR are long overdue....
Small-molecule AT2 receptor agonists
DEFF Research Database (Denmark)
Hallberg, Mathias; Sumners, Colin; Steckelings, U Muscha
2018-01-01
The discovery of the first selective, small-molecule ATR receptor (AT2R) agonist compound 21 (C21) (8) that is now extensively studied in a large variety of in vitro and in vivo models is described. The sulfonylcarbamate derivative 8, encompassing a phenylthiofen scaffold is the drug-like agonist...... with the highest affinity for the AT2R reported to date (Ki = 0.4 nM). Structure-activity relationships (SAR), regarding different biaryl scaffolds and functional groups attached to these scaffolds and with a particular focus on the impact of various para substituents displacing the methylene imidazole group of 8......, are discussed. Furthermore, the consequences of migration of the methylene imidazole group and presumed structural requirements for ligands that are aimed as AT2R agonists (e.g. 8) or AT2R antagonists (e.g. 9), respectively, are briefly addressed. A summary of the pharmacological actions of C21 (8) is also...
Hostrup, Morten; Onslev, Johan; Jacobson, Glenn A; Wilson, Richard; Bangsbo, Jens
2018-01-15
= 0.005), wherein β 2 -agonist caused a repression of 25 proteins in HIT+β 2 A compared to HIT, and an upregulation of 7 proteins compared to HIT. β 2 -Agonist repressed or even downregulated training-induced enrichment of pathways related to oxidative phosphorylation and glycogen metabolism, but upregulated pathways related to histone trimethylation and the nucleosome. Muscle contractile phenotype changed differently in HIT and HIT+β 2 A (P ≤ 0.001), with a fast-to-slow twitch transition in HIT and a slow-to-fast twitch transition in HIT+β 2 A. β 2 -Agonist attenuated training-induced enhancements in maximal oxygen consumption (P ≤ 0.01) and exercise performance (6.1 vs. 11.6%, P ≤ 0.05) in HIT+β 2 A compared to HIT. These findings indicate that daily β 2 -agonist treatment attenuates the beneficial effects of high intensity training on exercise performance and oxidative capacity, and causes remodelling of muscle proteome signature towards a fast-twitch phenotype. © 2017 The Authors. The Journal of Physiology © 2017 The Physiological Society.
Long-acting beta(2)-agonists in management of childhood asthma
DEFF Research Database (Denmark)
Bisgaard, H
2000-01-01
This review assesses the evidence regarding the use of long-acting beta(2)-agonists in the management of pediatric asthma. Thirty double-blind, randomized, controlled trials on the effects of formoterol and salmeterol on lung function in asthmatic children were identified. Single doses of inhaled......, long-acting beta(2)-agonists provide effective bronchodilatation and bronchoprotection when used as intermittent, single-dose treatment of asthma in children, but not when used as regular treatment. Future studies should examine the positioning of long-acting beta(2)-agonists as an "as needed" rescue...... medication instead of short-acting beta(2)-agonists for pediatric asthma management....
He, Jiaying; He, Chiquan; Chen, Xueping; Liang, Xia; Huang, Tongli; Yang, Xuecheng; Shang, Hai
2018-06-01
The purpose of this research is to design a new bioremediation-electrokinetic (Bio-EK) remediation process to increase treatment efficiency of chromium contamination in soil. Upon residual chromium analysis, it is shown that traditional electrokinetic-PRB system (control) does not have high efficiency (80.26%) to remove Cr(VI). Bio-electrokinetics of exogenous add with reduction bacteria Microbacterium sp. Y2 and electrokinetics can enhance treatment efficiency Cr(VI) to 90.67% after 8 days' remediation. To optimize the overall performance, integrated bio-electrokinetics were designed by synergy with 200 g humic substances (HS) into the systems. According to our results, Cr(VI) (98.33%) was effectively removed via electrokinetics. Moreover, bacteria and humic substances are natural, sustainable, and economical enhancement agents. The research results indicated that the use of integrated bio-electrokinetics is an effective method to remediate chromium-contaminated soils.
Youssef, Mohamed A. F. M.; van Wely, Madelon; Hassan, Mohamed Ahmed; Al-Inany, Hesham Gaber; Mochtar, Monique; Khattab, Sherif; van der Veen, Fulco
2010-01-01
Recently, dopamine agonists were proposed as a prophylactic treatment for ovarian hyperstimulation syndrome (OHSS) in women at high risk in IVF/ICSI treatment cycles. We conducted a systematic review and meta-analysis of randomized trials comparing the prophylactic effect of the dopamine agonist,
Trial Watch: Toll-like receptor agonists for cancer therapy.
Vacchelli, Erika; Eggermont, Alexander; Sautès-Fridman, Catherine; Galon, Jérôme; Zitvogel, Laurence; Kroemer, Guido; Galluzzi, Lorenzo
2013-08-01
Toll-like receptors (TLRs) have long been known for their ability to initiate innate immune responses upon exposure to conserved microbial components such as lipopolysaccharide (LPS) and double-stranded RNA. More recently, this family of pattern recognition receptors has been attributed a critical role in the elicitation of anticancer immune responses, raising interest in the development of immunochemotherapeutic regimens based on natural or synthetic TLR agonists. In spite of such an intense wave of preclinical and clinical investigation, only three TLR agonists are currently licensed by FDA for use in cancer patients: bacillus Calmette-Guérin (BCG), an attenuated strain of Mycobacterium bovis that operates as a mixed TLR2/TLR4 agonist; monophosphoryl lipid A (MPL), a derivative of Salmonella minnesota that functions as a potent agonist of TLR4; and imiquimod, a synthetic imidazoquinoline that activates TLR7. One year ago, in the August and September issues of OncoImmunology , we described the main biological features of TLRs and discussed the progress of clinical studies evaluating the safety and therapeutic potential of TLR agonists in cancer patients. Here, we summarize the latest developments in this exciting area of research, focusing on preclinical studies that have been published during the last 13 mo and clinical trials launched in the same period to investigate the antineoplastic activity of TLR agonists.
Ascorbic acid enables reversible dopamine receptor 3H-agonist binding
International Nuclear Information System (INIS)
Leff, S.; Sibley, D.R.; Hamblin, M.; Creese, I.
1981-01-01
The effects of ascorbic acid on dopaminergic 3 H-agonist receptor binding were studied in membrane homogenates of bovine anterior pituitary and caudate, and rat striatum. In all tissues virtually no stereospecific binding (defined using 1uM (+)butaclamol) of the 3 H-agonists N-propylnorapomorphine (NPA), apomorphine, or dopamine could be demonstrated in the absence of ascorbic acid. Although levels of total 3 H-agonist binding were three to five times greater in the absence than in the presence of 0.1% ascorbic acid, the increased binding was entirely non-stereospecific. Greater amounts of dopamine-inhibitable 3 H-NPA binding could be demonstrated in the absence of 0.1% ascorbic acid, but this measure of ''specific binding'' was demonstrated not to represent dopamine receptor binding since several other catecholamines and catechol were equipotent with dopamine and more potent than the dopamine agonist (+/-)amino-6,7-dihydroxy-1,2,3,4-tetrahydronapthalene (ADTN) in inhibiting this binding. High levels of dopamine-displaceable 3 H-agonist binding were detected in fresh and boiled homogenates of cerebellum, an area of brain which receives no dopaminergic innervation, further demonstrating the non-specific nature of 3 H-agonist binding in the absence of ascorbic acid. These studies emphasize that under typical assay conditions ascorbic acid is required in order to demonstrate reversible and specific 3 H-agonist binding to dopamine receptors
Agonist-induced affinity alterations of a central nervous system. cap alpha. -bungarotoxin receptor
Energy Technology Data Exchange (ETDEWEB)
Lukas, R.J.; Bennett, E.L.
1979-01-01
The ability of cholinergic agonists to block the specific interaction of ..cap alpha..-bungarotoxin (..cap alpha..-Bgt) with membrane-bound sites derived from rat brain is enhanced when membranes are preincubated with agonist. Thus, pretreatment of ..cap alpha..-Bgt receptors with agonist (but not antagonist) causes transformation of sites to a high-affinity form toward agonist. This change in receptor state occurs with a half-time on the order of minutes, and is fully reversible on dilution of agonist. The results are consistent with the identity of ..cap alpha..-Bgt binding sites as true central nicotinic acetylcholine receptors. Furthermore, this agonist-induced alteration in receptor state may represent an in vitro correlate of physiological desensitization. As determined from the effects of agonist on toxin binding isotherms, and on the rate of toxin binding to specific sites, agonist inhibition of toxin binding to the high-affinity state is non-competitive. This result suggests that there may exist discrete toxin-binding and agonist-binding sites on central toxin receptors.
Cr(III) reactivity and foot dermatitis in Cr(VI) positive patients
DEFF Research Database (Denmark)
Hansen, Malene Barré; Menné, Torkil; Johansen, Jeanne Duus
2006-01-01
Chromium allergy has become synonymous with Cr(VI) allergy. However, real exposure to chromium from leather products may include both Cr(III) and Cr(VI). In this study, we investigate the reactivity to both Cr(VI) and Cr(III) in consecutive patients to analyse the relation between foot eczema/leather...... to Cr(III). The increased risk was not due to a higher degree of sensitivity to Cr(VI). Leather was reported most frequently as the suspected cause of chromium dermatitis (54%). However, Cr(VI) allergics having foot eczema and positive or doubtful Cr(III) reactions often had positive reactions to other...
Yang, Lu; Ciceri, Elena; Mester, Zoltán; Sturgeon, Ralph E
2006-11-01
A method is presented for the simultaneous determination of Cr(III) and Cr(VI) in yeast using species-specific double-spike isotope dilution (SSDSID) with anion-exchange liquid chromatography (LC) separation and sector field inductively coupled plasma mass spectrometric (SF-ICP-MS) detection. Total Cr is quantitated using ID SF-ICP-MS. Samples were digested on a hot plate at 95+/-2 degrees C for 6 h in an alkaline solution of 0.5 M NaOH and 0.28 M Na2CO3 for the determination of Cr(III) and Cr(VI), whereas microwave-assisted decomposition with HNO3 and H2O2 was used for the determination of total Cr. Concentrations of 2,014+/-16, 1,952+/-103 and 76+/-48 mg kg-1 (one standard deviation, n=4, 3, 3), respectively were obtained for total Cr, Cr(III) and Cr(VI) in the yeast sample. Significant oxidation of Cr(III) to Cr(VI) (24.2+/-7.6% Cr(III) oxidized, n=3) and reduction of Cr(VI) to Cr(III) (37.6+/-6.5% Cr(VI) reduced, n=3) occurred during alkaline extraction and subsequent chromatographic separation at pH 7. Despite this significant bidirectional redox transformation, quantitative recoveries for both Cr(III) and Cr(VI) were achieved using the SSDSID method. In addition, mass balance between total Cr and the sum of Cr(III) and Cr(VI) concentrations was achieved. Method detection limits of 0.3, 2 and 30 mg kg-1 were obtained for total Cr, Cr(VI) and Cr(III), respectively, based on a 0.2-g sub-sample.
Duncan, Dallas; Sankar, Ashwin; Beattie, W Scott; Wijeysundera, Duminda N
2018-03-06
The surgical stress response plays an important role on the pathogenesis of perioperative cardiac complications. Alpha-2 adrenergic agonists attenuate this response and may help prevent postoperative cardiac complications. To determine the efficacy and safety of α-2 adrenergic agonists for reducing mortality and cardiac complications in adults undergoing cardiac surgery and non-cardiac surgery. We searched CENTRAL (2017, Issue 4), MEDLINE (1950 to April Week 4, 2017), Embase (1980 to May 2017), the Science Citation Index, clinical trial registries, and reference lists of included articles. We included randomized controlled trials that compared α-2 adrenergic agonists (i.e. clonidine, dexmedetomidine or mivazerol) against placebo or non-α-2 adrenergic agonists. Included trials had to evaluate the efficacy and safety of α-2 adrenergic agonists for preventing perioperative mortality or cardiac complications (or both), or measure one or more relevant outcomes (i.e. death, myocardial infarction, heart failure, acute stroke, supraventricular tachyarrhythmia and myocardial ischaemia). Two authors independently assessed trial quality, extracted data and independently performed computer entry of abstracted data. We contacted study authors for additional information. Adverse event data were gathered from the trials. We evaluated included studies using the Cochrane 'Risk of bias' tool, and the quality of the evidence underlying pooled treatment effects using GRADE methodology. Given the clinical heterogeneity between cardiac and non-cardiac surgery, we analysed these subgroups separately. We expressed treatment effects as pooled risk ratios (RR) with 95% confidence intervals (CI). We included 47 trials with 17,039 participants. Of these studies, 24 trials only included participants undergoing cardiac surgery, 23 only included participants undergoing non-cardiac surgery and eight only included participants undergoing vascular surgery. The α-2 adrenergic agonist studied
Tripathi, Trivendra; Shahid, Mohammad; Khan, Haris M; Negi, Mahendra Pal Singh; Siddiqui, Mashiatullah; Khan, Rahat A
2010-01-01
The present study was designed to delineate the immunomodulatory role of histamine receptors (H1R and H2R) and their antibody generation in a rabbit model. Six groups containing 18 rabbits each received either vehicle (sterile distilled water, 1 ml/kg x b.i.d), histamine (100 μg/kg x b.i.d.), H1R agonist (HTMT, 10 μg/kg x b.i.d.), H2R agonist (amthamine, 10 μg/kg x b.i.d.), H1R antagonist (pheniramine, 10 mg/kg x b.i.d.) or H2R antagonist (ranitidine, 10 mg/kg x b.i.d.). All animals were subsequently immunized with an intravenous injection of sheep red blood cells (SRBC). Estimations of total serum immunoglobulins (Igs), immunoglobulin M (IgM) and immunoglobulin G (IgG) were performed by ELISA and hemagglutination assay (HA) at days 0 (pre-immunization), 7, 14, 21, 28 and 58 (post-immunization). Both the ELISA and the HA showed similar production of Igs, IgM and IgG but the results were found comparatively more significant by ELISA as opposed to HA. Results showed that histamine could influence a detectable antibody response to SRBC early (i.e., at day 7), which lasted until day 58. Immunomodulatory processes showed suppression of an Ig generation in the H1R-antagonist group with enhancement in the H2R-antagonist group. The H1R-agonist group showed an increased Ig production in comparison to the H2R-agonist group. The IgM production was inhibited in the H1R-antagonist group as compared to the H2R-antagonist group, and it was also suppressed in H1R-agonist group as compared to H2R-agonist group. IgG production was inhibited in the H1R-antagonist group as opposed to the H2R-antagonist group. In contrast, the H1R-agonist group increased IgG production as compared to the H2R-agonist group. All the results were found to be statistically significant (p < 0.05 or p < 0.01). In conclusion, histamine and its receptor (H1R and H2R) agonists enhance antibody production by triggering the histamine receptors (H1R and H2R), and both the H1R antagonist and the H2R antagonist
Energy Technology Data Exchange (ETDEWEB)
Gürbüz, Osman, E-mail: osgurbuz@yildiz.edu.tr; Okutan, Mustafa
2016-11-30
Highlights: • Magnetic material of Cr and semiconductor material of ZnO were grown by the magnetron sputtering co-sputter technique. • Perfect single crystalline structures were grown. • DC and AC conductivity with dielectric properties as a function of frequency (f = 5Hz–13 MHz) at room temperature were measured and compared. • Cr doped ZnO can be used in microwave, sensor and optoelectronic devices as the electrical conductivity increases while dielectric constant decreases with the Cr content. - Abstract: An undoped zinc oxide (ZnO) and different concentrations of chromium (Cr) doped ZnO Cr{sub x}ZnO{sub 1−x} (x = 3.74, 5.67, 8.10, 11.88, and 15.96) thin films were prepared using a magnetron sputtering technique at room temperature. These films were characterized by X-ray diffraction (XRD), High resolution scanning electron microscope (HR-SEM), and Energy dispersive X-ray spectrometry (EDS). XRD patterns of all the films showed that the films possess crystalline structure with preferred orientation along the (100) crystal plane. The average crystallite size obtained was found to be between 95 and 83 nm which was beneficial in high intensity recording peak. Both crystal quality and crystallite sizes decrease with increasing Cr concentration. The crystal and grain sizes of the all film were investigated using SEM analysis. The surface morphology that is grain size changes with increase Cr concentration and small grains coalesce together to form larger grains for the Cr{sub 11.88}ZnO and Cr{sub 15.96}ZnO samples. Impedance spectroscopy studies were carried out in the frequencies ranging from 5 Hz to 13 MHz at room temperature. The undoped ZnO film had the highest dielectric value, while dielectric values of other films decreased as doping concentrations increased. Besides, the dielectric constants decreased whereas the loss tangents increased with increasing Cr content. This was considered to be related to the reduction of grain size as Cr content in Zn
Ginkel, van L.A.; Bovee, T.F.H.; Blokland, M.H.; Sterk, S.S.; Smits, N.G.E.; Pleadin, Jelka; Vulić, Ana
2016-01-01
This chapter provides some updated information on contemporary methods for hormone and β-agonist analyses. It deals with the classical approaches for the effective detection and identification of exogenous hormones. The chapter examines specific problems related to control strategies for natural
Diverse anaerobic Cr(VI) tolerant bacteria from Cr(VI)-contaminated 100H site at Hanford
Chakraborty, R.; Phan, R.; Lam, S.; Leung, C.; Brodie, E. L.; Hazen, T. C.
2007-12-01
Hexavalent Chromium [Cr(VI)] is a widespread contaminant found in soil, sediment, and ground water. Cr(VI) is more soluble, toxic, carcinogenic, and mutagenic compared to its reduced form Cr(III). In order to stimulate microbially mediated reduction of Cr(VI), a poly-lactate compound HRC was injected into the chromium contaminated aquifers at site 100H at Hanford. Based on the results of the bacterial community composition using high-density DNA microarray analysis of 16S rRNA gene products, we recently investigated the diversity of the dominant anaerobic culturable microbial population present at this site and their role in Cr(VI) reduction. Positive enrichments set up at 30°C using specific defined anaerobic media resulted in the isolation of an iron reducing isolate strain HAF, a sulfate reducing isolate strain HBLS and a nitrate reducing isolate, strain HLN among several others. Preliminary 16S rDNA sequence analysis identifies strain HAF as Geobacter metallireducens, strain HLN as Pseudomonas stutzeri and strain HBLS as a member of Desulfovibrio species. Strain HAF isolated with acetate as the electron donor utilized propionate, glycerol and pyruvate as alternative carbon sources, and reduced metals like Mn(IV) and Cr(VI). Growth was optimal at 37°C, pH of 6.5 and 0% salinity. Strain HLN isolated with lactate as electron donor utilized acetate, glycerol and pyruvate as alternative carbon sources, and reduced metals like Mn(IV) and Cr(VI). Optimal growth was observed at 37°C, at a pH of 7.5 and 0.3% salinity. Anaerobic active washed cell suspension of strain HLN reduced almost 95 micromolar Cr(VI) within 4 hours relative to controls. Further, with 100 micromolar Cr(VI) as the sole electron acceptor, cells of strain HLN grew to cell numbers of 4.05X 107/ml over a period of 24hrs after an initial lag, demonstrating direct enzymatic Cr(VI) reduction by this species. 10mM lactate served as the sole electron donor. These results demonstrate that Cr
Barikbin, Behrooz; Khodamrdi, Zeinab; Kholoosi, Leila; Akhgri, Mohammad Reza; Haj Abbasi, Majid; Hajabbasi, Mojgan; Razzaghi, Zahra; Akbarpour, Samaneh
2017-05-17
This study aimed to evaluate the effectiveness of a combined set of low level diode laser scanner (665 nm and 808nm) on hair growth, and assessment of safety and effectiveness of a new laser scanner on hair growth treatment procedure in androgenic alopecia. 90 patients (18 to 70 years) with androgenic alopecia were randomized into three groups. The first group (n=30) received 655 nm red light using laser hat, the second group (n=30) received 655 nm red laser plus 808 nm infrared laser using a laser scanner of hair growth device (with the patent number: 77733) and the third group (n=30) received no laser as the control group. Patients in laser scanner group had better results and showed a higher increase in terminal hair density compared with laser hat group (mean of 9.61 versus 9.16 per cm 2 ). We found significant decrease in terminal hair density from baseline in control group (mean -1.8 per cm 2 , plaser scanner of the hair growth group compared with laser hat and the control group. The study showed that treatment with new laser devise had a promising result without any observable adverse effects.
Moore, Thomas J; Glenmullen, Joseph; Mattison, Donald R
2014-12-01
Severe impulse control disorders involving pathological gambling, hypersexuality, and compulsive shopping have been reported in association with the use of dopamine receptor agonist drugs in case series and retrospective patient surveys. These agents are used to treat Parkinson disease, restless leg syndrome, and hyperprolactinemia. To analyze serious adverse drug event reports about these impulse control disorders received by the US Food and Drug Administration (FDA) and to assess the relationship of these case reports with the 6 FDA-approved dopamine receptor agonist drugs. We conducted a retrospective disproportionality analysis based on the 2.7 million serious domestic and foreign adverse drug event reports from 2003 to 2012 extracted from the FDA Adverse Event Reporting System. Cases were selected if they contained any of 10 preferred terms in the Medical Dictionary for Regulatory Activities (MedDRA) that described the abnormal behaviors. We used the proportional reporting ratio (PRR) to compare the proportion of target events to all serious events for the study drugs with a similar proportion for all other drugs. We identified 1580 events indicating impulse control disorders from the United States and 21 other countries:710 fordopamine receptor agonist drugs and 870 for other drugs. The dopamine receptor agonist drugs had a strong signal associated with these impulse control disorders (n = 710; PRR = 277.6, P < .001). The association was strongest for the dopamine agonists pramipexole (n = 410; PRR = 455.9, P < .001) and ropinirole (n = 188; PRR = 152.5, P < .001), with preferential affinity for the dopamine D3 receptor. A signal was also seen for aripiprazole, an antipsychotic classified as a partial agonist of the D3 receptor (n = 37; PRR = 8.6, P < .001). Our findings confirm and extend the evidence that dopamine receptor agonist drugs are associated with these specific impulse control disorders. At present
International Nuclear Information System (INIS)
Kakiuchi-Kiyota, Satoko; Vetro, Joseph A.; Suzuki, Shugo; Varney, Michelle L.; Han, Huai-Yun; Nascimento, Merielen; Pennington, Karen L.; Arnold, Lora L.; Singh, Rakesh K.; Cohen, Samuel M.
2009-01-01
Peroxisome proliferator-activated receptor gamma (PPARγ) agonists and PPARγ/α dual agonists have been or are being developed for clinical use in the treatment of type 2 diabetes mellitus and hyperlipidemias. A common tumor finding in rodent carcinogenicity studies for these agonists is hemangioma/hemangiosarcoma in mice but not in rats. We hypothesized that increased endothelial cell proliferation may be involved in the mechanism of PPAR agonist-induced vascular tumors in mice, and we investigated the effects on endothelial cells utilizing troglitazone, the first clinically used PPARγ agonist, in vivo and in vitro. Troglitazone (400 and 800 mg/kg/day) induced hemangiosarcomas in mice in a 2-year bioassay. We showed that troglitazone increased endothelial cell proliferation in brown and white adipose tissue and liver in mice at sarcomagenic doses after 4 weeks of treatment. Troglitazone was cytotoxic both to human dermal microvascular endothelial cells (HMEC1) and mouse mammary fat pad microvascular endothelial cells (MFP MVEC) at high concentrations. However, MFP MVEC were more resistant to the cytotoxic effects of troglitazone based on the much lower LC 50 in HMEC1 (17.4 μM) compared to MFP MVEC (92.2 μM). Troglitazone increased the proliferation and survival of MFP MVEC but not HMEC1 in growth factor reduced conditions. Our data demonstrate that troglitazone may induce hemangiosarcomas in mice, at least in part, through enhancement of survival and proliferation of microvascular endothelial cells. Such an effect does not occur with human cells, suggesting that human may react differently to exposure to PPAR agonists compared with mice.
Effects of lipopolysaccharides on the corrosion behavior of Ni-Cr and Co-Cr alloys.
Yu, Weiqiang; Qian, Chao; Weng, Weimin; Zhang, Songmei
2016-08-01
Lipopolysaccharides (LPS) are constituents of gingival crevicular fluid and may affect the base metal alloys used in metal ceramic crowns. The role of LPS in base metal alloys is currently unknown. The purpose of this in vitro study was to evaluate the effects of gram-negative bacterial LPS on the electrochemical behavior of Ni-Cr and Co-Cr alloys. Alloy specimens were divided into 4 groups according to Escherichia coli LPS concentration (0, 0.15, 15, and 150 μg/mL) in acidic saliva (pH 5). Open circuit potential (OCP) and potentiodynamic polarization behavior were examined using a computer-controlled potentiostat. Metal ions released from the 2 alloys were measured by immersion in LPS-free solution and 150 μg/mL LPS solution and analyzed by inductively coupled plasma atomic emission spectrometry (ICP-AES). Data were evaluated using 1-way ANOVA (α=.05). Compared with control groups, medium LPS concentration (15 μg/mL) accelerated Ni-Cr alloy corrosion (Palloy corrosion (Pcorrosion current density, and polarization resistance parameters. After immersion in high LPS concentrations (150 μg/mL), a slight increase in Ni ion release (P >.05) was observed for the Ni-Cr alloy, while a more significant Co ion release (Palloy. LPS negatively affected the electrochemical behavior of both the Ni-Cr and Co-Cr alloys. Copyright © 2016 Editorial Council for the Journal of Prosthetic Dentistry. Published by Elsevier Inc. All rights reserved.
Unique interaction pattern for a functionally biased ghrelin receptor agonist
DEFF Research Database (Denmark)
Sivertsen, Bjørn Behrens; Lang, Manja; Frimurer, Thomas M.
2011-01-01
Based on the conformationally constrained D-Trp-Phe-D-Trp (wFw) core of the prototype inverse agonist [D-Arg(1),D-Phe(5),D-Trp(7,9),Leu(11)]substance P, a series of novel, small, peptide-mimetic agonists for the ghrelin receptor were generated. By using various simple, ring-constrained spacers...... connecting the D-Trp-Phe-D-Trp motif with the important C-terminal carboxyamide group, 40 nm agonism potency was obtained and also in one case (wFw-Isn-NH(2), where Isn is isonipecotic acid) ~80% efficacy. However, in contrast to all previously reported ghrelin receptor agonists, the piperidine-constrained w......Fw-Isn-NH(2) was found to be a functionally biased agonist. Thus, wFw-Isn-NH(2) mediated potent and efficacious signaling through the Ga(q) and ERK1/2 signaling pathways, but in contrast to all previous ghrelin receptor agonists it did not signal through the serum response element, conceivably the Ga(12...
DEFF Research Database (Denmark)
Schlezinger, Jennifer J; Bernard, Pamela L; Haas, Amelia
2010-01-01
(PCB)-exposed Faroe Islanders using an AhR-driven reporter cell line. To validate relationships between serum AhR agonist levels and biological outcomes, AhR agonist activity in mouse sera correlated with toxic end points. AhR agonist activity in unmanipulated ("neat") human sera was compared......, was associated with the frequency of recent pilot whale dinners, but did not correlate with levels of PCBs quantified by GC/MS. Surprisingly, significant "baseline" AhR activity was found in commercial human sera. CONCLUSIONS: An AhR reporter assay revealed cumulative levels of AhR activation potential in neat...
(S)-homo-AMPA, a specific agonist at the mGlu6 subtype of metabotropic glutamic acid receptors
DEFF Research Database (Denmark)
Ahmadian, H; Nielsen, B; Bräuner-Osborne, Hans
1997-01-01
of the spectroscopic configurational assignments. The activities of 6 and 7 at ionotropic EAA (iGlu) receptors and at mGlu1-7 were studied. (S)-Homo-AMPA (6) was shown to be a specific agonist at mGlu6 (EC50 = 58 +/- 11 microM) comparable in potency with the endogenous mGlu agonist (S)-glutamic acid (EC50 = 20 +/- 3......Our previous publication (J. Med. Chem. 1996, 39, 3188-3194) described (RS)-2-amino-4-(3-hydroxy-5-methylisoxazol-4-yl)butyric acid (Homo-AMPA) as a highly selective agonist at the mGlu6 subtype of metabotropic excitatory amino acid (EAA) receptors. Homo-AMPA has already become a standard agonist...... microM). Although Homo-AMPA did not show significant effects at iGlu receptors, (R)-Homo-AMPA (7), which was inactive at mGlu1-7, turned out to be a weak N-methyl-D-aspartic acid (NMDA) receptor antagonist (IC50 = 131 +/- 18 microM)....
Thermodynamic properties of crystalline Sr0.5Zr2(PO4)3 phosphate from T → 0 to 665 K
International Nuclear Information System (INIS)
Pet'kov, V.I.; Markin, A.V.; Bykova, T.A.; Sukhanov, M.V.; Smirnova, N.N.; Loshkarev, V.N.
2007-01-01
The temperature dependence of the heat capacity of crystalline Sr 0.5 Zr 2 (PO 4 ) 3 phosphate was studied by precision adiabatic vacuum and dynamic scanning calorimetry over the temperature range 7-665 K. The low-temperature dependence of the heat capacity was analyzed using the Debye theory of the heat capacity of solids and its multifractal generalization, which allowed conclusions to be drawn about the heterodynamic characteristics of the structure. The experimental data obtained were used to calculate the standard thermodynamic functions of Sr 0.5 Zr 2 (PO 4 ) 3 from T → 0 to 665 K. The standard absolute entropy of Sr 0.5 Zr 2 (PO 4 ) 3 was in turn used to calculate the standard entropy of its formation from simple substances at 298.15 K [ru
''Spare'' alpha 1-adrenergic receptors and the potency of agonists in rat vas deferens
International Nuclear Information System (INIS)
Minneman, K.P.; Abel, P.W.
1984-01-01
The existence of ''spare'' alpha 1-adrenergic receptors in rat vas deferens was examined directly using radioligand binding assays and contractility measurements. Alpha 1-adrenergic receptors in homogenates of rat vas deferens were labeled with [ 125 I]BE 2254 ( 125 IBE). Norepinephrine and other full alpha 1-adrenergic receptor agonists were much less potent in inhibiting 125 IBE binding than in contracting the vas deferens in vitro. Treatment with 300 nM phenoxybenzamine for 10 min to irreversibly inactivate alpha 1-adrenergic receptors caused a large decrease in the potency of full agonists in causing contraction of this tissue and a 23-48% decrease in the maximal contraction observed. Using those data, equilibrium constants for activation (Kact values) of the receptors by agonists were calculated. These Kact values agreed well with the equilibrium binding constants (KD values) determined from displacement of 125 IBE binding. The reduction in alpha 1-adrenergic receptor density following phenoxybenzamine treatment was determined by Scatchard analysis of specific 125 IBE binding sites and compared with the expected reduction (q values) calculated from the agonist dose-response curves before and after phenoxybenzamine treatment. This suggests that phenoxybenzamine functionally inactivates alpha 1-adrenergic receptors at or near the receptor binding site. These experiments suggest that the potencies of agonists in activating alpha 1-adrenergic receptors in rat vas deferens agree well with their potencies in binding to the receptors. The greater potency of agonists in causing contraction may be due to spare receptors in this tissue. The data also demonstrate that phenoxybenzamine irreversibly inactivates alpha 1-adrenergic receptors in rat vas deferens, but that the decrease in receptor density is much smaller than that predicted from receptor theory
Differential activation of G-proteins by μ-opioid receptor agonists
Saidak, Zuzana; Blake-Palmer, Katherine; Hay, Debbie L; Northup, John K; Glass, Michelle
2006-01-01
We investigated the ability of the activated μ-opioid receptor (MOR) to differentiate between myristoylated Gαi1 and GαoA type Gα proteins, and the maximal activity of a range of synthetic and endogenous agonists to activate each Gα protein. Membranes from HEK293 cells stably expressing transfected MOR were chaotrope extracted to denature endogenous G-proteins and reconstituted with specific purified G-proteins. The Gα subunits were generated in bacteria and were demonstrated to be recognised equivalently to bovine brain purified Gα protein by CB1 cannabinoid receptors. The ability of agonists to catalyse the MOR-dependent GDP/[35S]GTPγS exchange was then compared for Gαi1 and GαoA. Activation of MOR by DAMGO produced a high-affinity saturable interaction for GαoA (Km=20±1 nM) but a low-affinity interaction with Gαi1 (Km=116±12 nM). DAMGO, met-enkephalin and leucine-enkephalin displayed maximal Gα activation among the agonists evaluated. Endomorphins 1 and 2, methadone and β-endorphin activated both Gα to more than 75% of the maximal response, whereas fentanyl partially activated both G-proteins. Buprenorphine and morphine demonstrated a statistically significant difference between the maximal activities between Gαi1 and GαoA. Interestingly, DAMGO, morphine, endomorphins 1 and 2, displayed significant differences in the potencies for the activation of the two Gα. Differences in maximal activity and potency, for Gαi1 versus GαoA, are both indicative of agonist selective activation of G-proteins in response to MOR activation. These findings may provide a starting point for the design of drugs that demonstrate greater selectivity between these two G-proteins and therefore produce a more limited range of effects. PMID:16415903
Effect of Cr content on the SHS reaction of Cr-Ti-C system
International Nuclear Information System (INIS)
Zhang, W.N.; Wang, H.Y.; Wang, P.J.; Zhang, J.; He, L.; Jiang, Q.C.
2008-01-01
The effect of Cr content on the self-propagating high temperature synthesis (SHS) reaction of Cr-Ti-C system has been investigated in this research. The thermodynamics calculation indicates that the TiC possesses higher thermodynamic stability than the Cr 23 C 6 , Cr 7 C 3 and Cr 3 C 2 phases, and the formation of TiC is the most exothermic. Additionally, the adiabatic combustion temperature (T ad ) decreases with the increase of Cr content except for the phase transition regions. The XRD result shows that the type of products synthesized by SHS changes that a higher Cr content corresponds to higher chromium carbide. When Cr content is 10 wt.%, only solid solution (Ti,Cr)C ss is formed in the products. When Cr content increases to 20 wt.%, besides (Ti,Cr)C ss , the Cr 7 C 3 phase is also detected. With the Cr content further increasing to 30 and 40 wt.%, the products consist of (Ti,Cr)C ss , Cr 23 C 6 , Cr 7 C 3 and Cr, and therefore, much higher chromium carbide is synthesized. When Cr content reaches 50 wt.%, however, the Cr 7 C 3 disappears and the final products become (Ti,Cr)C ss , Cr 23 C 6 and Cr. Moreover, when Cr content increases from 10 to 20 wt.%, the lattice parameter of (Ti,Cr)C ss decreases, while it increases when the Cr content ranges from 20 to 50 wt.%. Furthermore, the microstructure shows that the TiC particulate size decreases from ∼8 to ∼2 μm with the increase of Cr content from 10 to 50 wt.%, and the morphology shape of TiC particulate becomes more and more spherical
Yanofsky, Stephen D; Shen, Emily S; Holden, Frank; Whitehorn, Erik; Aguilar, Barbara; Tate, Emily; Holmes, Christopher P; Scheuerman, Randall; MacLean, Derek; Wu, May M; Frail, Donald E; López, Francisco J; Winneker, Richard; Arey, Brian J; Barrett, Ronald W
2006-05-12
The pituitary glycoprotein hormones, luteinizing hormone and follicle-stimulating hormone (FSH), act through their cognate receptors to initiate a series of coordinated physiological events that results in germ cell maturation. Given the importance of FSH in regulating folliculogenesis and fertility, the development of FSH mimetics has been sought to treat infertility. Currently, purified and recombinant human FSH are the only FSH receptor (FSH-R) agonists available for infertility treatment. By screening unbiased combinatorial chemistry libraries, using a cAMP-responsive luciferase reporter assay, we discovered thiazolidinone agonists (EC50's = 20 microm) of the human FSH-R. Subsequent analog library screening and parallel synthesis optimization resulted in the identification of a potent agonist (EC50 = 2 nm) with full efficacy compared with FSH that was FSH-R-selective and -dependent. The compound mediated progesterone production in Y1 cells transfected with the human FSH-R (EC50 = 980 nm) and estradiol production from primary rat ovarian granulosa cells (EC50 = 10.5 nm). This and related compounds did not compete with FSH for binding to the FSH-R. Use of human FSH/thyroid-stimulating hormone (TSH) receptor chimeras suggested a novel mechanism for receptor activation through a binding site independent of the natural hormone binding site. This study is the first report of a high affinity small molecule agonist that activates a glycoprotein hormone receptor through an allosteric mechanism. The small molecule FSH receptor agonists described here could lead to an oral alternative to the current parenteral FSH treatments used clinically to induce ovarian stimulation for both in vivo and in vitro fertilization therapy.
Design and synthesis of small molecule agonists of EphA2 receptor.
Petty, Aaron; Idippily, Nethrie; Bobba, Viharika; Geldenhuys, Werner J; Zhong, Bo; Su, Bin; Wang, Bingcheng
2018-01-01
Ligand-independent activation of EphA2 receptor kinase promotes cancer metastasis and invasion. Activating EphA2 receptor tyrosine kinase with small molecule agonist is a novel strategy to treat EphA2 overexpressing cancer. In this study, we performed a lead optimization of a small molecule Doxazosin that was identified as an EphA2 receptor agonist. 33 new analogs were developed and evaluated; a structure-activity relationship was summarized based on the EphA2 activation of these derivatives. Two new derivative compounds 24 and 27 showed much improved activity compared to Doxazosin. Compound 24 possesses a bulky amide moiety, and compound 27 has a dimeric structure that is very different to the parental compound. Compound 27 with a twelve-carbon linker of the dimer activated the kinase and induced receptor internalization and cell death with the best potency. Another dimer with a six-carbon linker has significantly reduced potency compared to the dimer with a longer linker, suggesting that the length of the linker is critical for the activity of the dimeric agonist. To explore the receptor binding characteristics of the new molecules, we applied a docking study to examine how the small molecule binds to the EphA2 receptor. The results reveal that compounds 24 and 27 form more hydrogen bonds to EphA2 than Doxazosin, suggesting that they may have higher binding affinity to the receptor. Published by Elsevier Masson SAS.
Ibrahim, Khalil; Mahbubur Rahman, M.; Taha, Hatem; Mohammadpour, Ehsan; Zhou, Zhifeng; Yin, Chun-Yang; Nikoloski, Aleksandar; Jiang, Zhong-Tao
2018-05-01
Mo, CrN, and Mo:CrN sputtered coatings synthesized onto silicon Si(100) substrates were investigated as solar selective surfaces and their potential applications in optical devices. These coatings were characterized using XRD, SEM, UV-vis, and FTIR techniques. XRD investigation, showed a change in CrN thin film crystallite characteristic due to Mo doping. Compared to the CrN coating, the Mo:CrN film has a higher lattice parameter and lower grain size of 4.19 nm and 106.18 nm, respectively. FESEM morphology confirmed the decrement in Mo:CrN crystal size due to Mo doping. Optical analysis showed that in the visible range of the solar spectrum, the CrN coatings exhibit the highest solar absorptance of 66% while the lowest thermal emittance value of 5.67 was recorded for the CrN coating doped with Mo. Consequently, the highest solar selectivity of 9.6, and the energy band-gap of 2.88 eV were achieved with the Mo-doped CrN coatings. Various optical coefficients such as optical absorption coefficient, refractive index, extinction coefficient, real and imaginary parts of dielectric constants, and energy loss functions of these coatings were also estimated from the optical reflectance data recorded in the wavelength range of 190-2300 nm.
Study of the oxidation of Fe-Cr alloys at high temperatures
International Nuclear Information System (INIS)
Carneiro, J.F.; Sabioni, A.C.S.
2010-01-01
The high temperature oxidation behavior of Fe-1.5%Cr, Fe-5.0%Cr, Fe-10%Cr and Fe- 15%Cr model alloys were investigated from 700 to 850 deg C, in air atmosphere. The oxidation treatments were performed in a thermobalance with a sensitivity of 1μg. The oxide films grown by oxidation of the alloys were characterized by scanning electronic microscopy (SEM), energy dispersive X-ray spectroscopy (EDS) and X-ray diffraction (XRD). The oxide films are Fe-Cr spinels with variable composition depending on the alloy composition. For all conditions studied, the oxidation kinetics of these alloys follow a parabolic law. The comparison of the oxidation rates of the four alloys, at 700 deg C, shows that the parabolic oxidation constants decrease from 1.96x10 -9 g 2 .cm -4 .s -1 , for the alloy Fe-1.5% Cr, to 1.18 x 10-14g 2 .cm -4 .s -1 for the alloy Fe-15% Cr. Comparative analysis of the oxidation behavior of the Fe-10%Cr and Fe-15%Cr alloys, between 700 and 850 deg C, shows that the oxidation rates of these alloys are comparable to 800 deg C, above this temperature the Fe-10%Cr alloy shows lower resistance to oxidation. (author)
Istrate, B.; Munteanu, C.; Lupescu, S.; Benchea, M.; Vizureanu, P.
2017-06-01
Thermal coatings have a large scale application in aerospace and automotive field, as barriers improving wear mechanical characteristics and corrosion resistance. In present research, there have been used two types of coatings, Ni-Cr-Fe, respectively Cr3C2-NiCr which were deposited on magnesium based alloys (pure magnesium and Mg-30Y master alloy). There have been investigated the microstructural aspects through scanning electronic microscopy and XRD analysis and also a series of mechanical characteristics through microscratch and indentation determinations. The results revealed the formation of some adherent layers resistant to the penetration of the metallic indenter, the coatings did not suffer major damages. Microstructural analysis highlighted the formation of Cr3C2, Cr7C3, Cr3Ni2, Cr7Ni3, FeNi3, Cr-Ni phases. Also, the apparent coefficient of friction for Ni-Cr-Fe coatings presents superior values than Cr3C2-NiCr coatings.
DEFF Research Database (Denmark)
Raudsepp, Piret; Brüggemann, Dagmar Adeline; Andersen, Mogens Larsen
2014-01-01
(E,E)-3,5-Bis(4-phenyl-1,3-butadienyl)-4,4-difluoro-4-bora-3a,4a-diaza-s-indacene, BODIPY(665/676), is a lipophilic radical-sensitive fluorescent probe that can be used to study radical-driven lipid autoxidation. The sensitivity of BODIPY(665/676) was studied in the presence of radical initiators...... di-tert-butyl peroxide and 2,2'-azobis(2,4-dimethyl)valeronitrile (AMVN). In both cases the fluorescence of BODIPY(665/676) changed more in saturated medium-chain triglyceride oil than in linseed or sunflower oils, where the high degree of unsaturation is expected to give more pronounced radical......-derived lipid oxidation. It was suggested that BODIPY(665/676), as the only available oxidizable substance in the saturated oil, was directly attacked by radicals, resulting in high rates of probe oxidation, while in the unsaturated oils, radicals attacked either unsaturated fatty acids or BODIPY(665...
Metabolic effects of beta2-agonists in relation to exercise performance
DEFF Research Database (Denmark)
Kalsen, Anders
2015-01-01
athletes. The present PhD thesis is based on four manuscripts in which the acute effects of beta2-agonists on exercise performance were investigated. The aims were 1) to investigate whether supratherapeutic inhalation of beta2-agonists enhances muscle strength, anaerobic performance and aerobic performance......, 2) to uncover the mechanisms behind potential beta2-adrenergic improvements in anaerobic performance, 3) to investigate whether inhalation of beta2-agonists is ergogenic in elite athletes with or without airway hyperresponsiveness (AHR). Results from the studies of the thesis show...... administration of a certain dose, but a further increase in dose does not seem to elicit a greater performance-enhancing effect. Moreover, the effects of beta2-agonists on performance are unaffected by training status and AHR, but athletes with AHR who regularly use beta2-agonists get a reduced ergogenic...
PPARα-Independent Arterial Smooth Muscle Relaxant Effects of PPARα Agonists
Directory of Open Access Journals (Sweden)
Neerupma Silswal
2012-01-01
Full Text Available We sought to determine direct vascular effects of peroxisome proliferator-activated receptor alpha (PPARα agonists using isolated mouse aortas and middle cerebral arteries (MCAs. The PPARα agonists GW7647, WY14643, and gemfibrozil acutely relaxed aortas held under isometric tension and dilated pressurized MCAs with the following order of potency: GW7647≫WY14643>gemfibrozil. Responses were endothelium-independent, and the use of PPARα deficient mice demonstrated that responses were also PPARα-independent. Pretreating arteries with high extracellular K+ attenuated PPARα agonist-mediated relaxations in the aorta, but not in the MCA. In the aorta, the ATP sensitive potassium (KATP channel blocker glibenclamide also impaired relaxations whereas the other K+ channel inhibitors, 4-aminopyridine and Iberiotoxin, had no effect. In aortas, GW7647 and WY14643 elevated cGMP levels by stimulating soluble guanylyl cyclase (sGC, and inhibition of sGC with ODQ blunted relaxations to PPARα agonists. In the MCA, dilations were inhibited by the protein kinase C (PKC activator, phorbol 12,13-dibutyrate, and also by ODQ. Our results demonstrated acute, nonreceptor-mediated relaxant effects of PPARα agonists on smooth muscle of mouse arteries. Responses to PPARα agonists in the aorta involved KATP channels and sGC, whereas in the MCA the PKC and sGC pathways also appeared to contribute to the response.
Directory of Open Access Journals (Sweden)
Sreenivasan Paruthiyil
2009-07-01
Full Text Available Estrogens produce biological effects by interacting with two estrogen receptors, ERalpha and ERbeta. Drugs that selectively target ERalpha or ERbeta might be safer for conditions that have been traditionally treated with non-selective estrogens. Several synthetic and natural ERbeta-selective compounds have been identified. One class of ERbeta-selective agonists is represented by ERB-041 (WAY-202041 which binds to ERbeta much greater than ERalpha. A second class of ERbeta-selective agonists derived from plants include MF101, nyasol and liquiritigenin that bind similarly to both ERs, but only activate transcription with ERbeta. Diarylpropionitrile represents a third class of ERbeta-selective compounds because its selectivity is due to a combination of greater binding to ERbeta and transcriptional activity. However, it is unclear if these three classes of ERbeta-selective compounds produce similar biological activities. The goals of these studies were to determine the relative ERbeta selectivity and pattern of gene expression of these three classes of ERbeta-selective compounds compared to estradiol (E(2, which is a non-selective ER agonist. U2OS cells stably transfected with ERalpha or ERbeta were treated with E(2 or the ERbeta-selective compounds for 6 h. Microarray data demonstrated that ERB-041, MF101 and liquiritigenin were the most ERbeta-selective agonists compared to estradiol, followed by nyasol and then diarylpropionitrile. FRET analysis showed that all compounds induced a similar conformation of ERbeta, which is consistent with the finding that most genes regulated by the ERbeta-selective compounds were similar to each other and E(2. However, there were some classes of genes differentially regulated by the ERbeta agonists and E(2. Two ERbeta-selective compounds, MF101 and liquiritigenin had cell type-specific effects as they regulated different genes in HeLa, Caco-2 and Ishikawa cell lines expressing ERbeta. Our gene profiling studies
Hsu, Hsi-Hsien; Kuo, Wei-Wen; Ju, Da-Tong; Yeh, Yu-Lan; Tu, Chuan-Chou; Tsai, Ying-Lan; Shen, Chia-Yao; Chang, Sheng-Huang; Chung, Li-Chin; Huang, Chih-Yang
2014-11-28
To investigate the effects of 17β-estradiol via estrogen receptors (ER) or direct administration of ER agonists on human colorectal cancer. LoVo cells were established from the Bioresource Collection and Research Center and cultured in phenol red-free DMEM (Sigma, United States). To investigate the effects of E2 and/or ER selective agonists on cellular proliferation, LoVo colorectal cells were treated with E2 or ER-selective agonists for 24 h and 48 h and subjected to the MTT (Sigma) assay to find the concentration. And investigate the effects of E2 and/or ER selective agonists on cell used western immunoblotting to find out the diversification of signaling pathways. In order to observe motility and migration the wound healing assay and a transwell chamber (Neuro Probe) plate were tased. For a quantitative measure, we counted the number of migrating cells to the wound area post-wounding for 24 h. We further examined the cellular migration-regulating factors urokinase-type plasminogen activator (u-PA), tissue-type plasminogen activator (t-PA) and matrix metalloproteinase (MMP)-9 in human LoVo cells so gelatin zymography that we used and gelatinolytic activity was visualized by Coomassie blue staining. And these results are presented as means ± SE, and statistical comparisons were made using Student's t-test. The structure was first compared with E2 and ER agonists. We then treated the LoVo cells with E2 and ER agonists (10(-8) mol/L) for 24 h and 48 h and subsequently measured the cell viability using MTT assay. Our results showed that treatment with 17β-estradiol and/or ER agonists in human LoVo colorectal cancer cells activated p53 and then up-regulated p21 and p27 protein levels, subsequently inhibiting the downstream target gene, cyclin D1, which regulates cell proliferation. Taken together, our findings demonstrate the anti-tumorigenesis effects of 17β-estradiol and/or ER agonists and suggest that these compounds may prove to be a potential alternative
A production method for Cr-51 at IEN's cyclotron
International Nuclear Information System (INIS)
Bastos, M.A.V.; Britto, J.L.Q. de; Vinagre, U.M.; Silva, A.G. da.
1989-01-01
Thick target yields for the reactions 51 V(p,n) 51 Cr and 51 V(d,2n) 51 Cr were measured and compared with literature values. The excitation function for the 51 V(p,n) 51 Cr reaction was also measured. A method for the production and separation of this radioisotope was developed via the 51 V(p,n) 51 Cr reaction and a combination of Fe +3 co-precipitation and an anion exchange technique using a Dowex 1x8(100-200 mesh) resin in hydrochloric acid medium [pt
2004-01-01
RIGScan CR49, a 125I-labelled CR monoclonal antibody directed against the tumour-associated antigen TAG-72, is undergoing development with Neoprobe for the intraoperative detection of metastatic colorectal cancer. The Neoprobe's proprietary RIGS (radioimmunoguided surgery) technology combines an injectable radiolabelled cancer-targeting agent and hand-held radiation detection probe that emits an audible tone when located tissue has accumulated a significant amount of the radioactive agent. Neoprobe's RIGS technology also includes a patented surgical method providing surgeons with real-time information to locate tumour deposits that can not be detected by other conventional methods. The RIGS technology has been evaluated in late clinical studies for the detection of adenocarcinomas including primary colorectal, gastrointestinal, breast, ovarian, pancreatic, prostate and neuroendocrine/endocrine. Neoprobe signed an option agreement for its first-generation RIGScan compound, RIGScan CR, with OncoSurg Inc. (formerly NuRigs Ltd). The second-generation humanised RIGScan CR agent was also optionally licensed to OncoSurg Inc. In 1997, Neoprobe filed for approval with the US FDA and the EMEA for RIGScan CR for the intraoperative detection of metastatic colorectal cancer. Both regulatory agencies have requested additional clinical data. On 19 April 2004, Neoprobe announced that it had met with the US FDA to discuss its position on submitting additional clinical information in response to the FDA's questions regarding the Biologic Licence Application (BLA) for RIGScan CR49. The company provided the FDA with new information related to a survival differential for patients whose colorectal cancer was evaluated with RIGScan CR49. The information was not available at the time of the BLA's submission in 1997. The agency indicated that it would consider accepting survival data from one of the two phase III trials, NEO2-14, but not from another trial NEO2-13, as supportive data for a
Zaurova, Milana; Hoffman, Robert S; Vlahov, David; Manini, Alex F
2016-12-01
Synthetic cannabinoid receptor agonists (SCRAs) are heterogeneous compounds originally intended as probes of the endogenous cannabinoid system or as potential therapeutic agents. We assessed the clinical toxicity associated with recent SCRA use in a large cohort of drug overdose patients. This subgroup analysis of a large (n = 3739) drug overdose cohort study involved consecutive ED patients at two urban teaching hospitals collected between 2009 and 2013. Clinical characteristics of patients with the exposure to SCRAs (SRCA subgroup) were compared with those from patients who smoked traditional cannabinoids (marijuana subgroup). Data included demographics, exposure details, vital signs, mental status, and basic chemistries gathered as part of routine clinical care. Study outcomes included altered mental status and cardiotoxicity. Eighty-seven patients reported exposure to any cannabinoid, of whom 17 reported SCRAs (17 cases, 70 controls, mean age 38.9 years, 77 % males, 31 % Hispanic). There were no significant differences between SRCA and marijuana with respect to demographics (age, gender, and race/ethnicity), exposure history (suicidality, misuse, and intent), vital signs, or serum chemistries. Mental status varied between SRCA and marijuana, with agitation significantly more likely in SCRA subgroup (OR = 3.8, CI = 1.2-11.9). Cardiotoxicity was more pronounced in the SCRA subgroup with dysrhythmia significantly more likely (OR = 9.2, CI = 1.0-108). In the first clinical study comparing the adverse effects of SCRA overdose vs. marijuana controls in an ED population, we found that SCRA overdoses had significantly pronounced neurotoxicity and cardiotoxicity compared with marijuana.
Subtype selective kainic acid receptor agonists
DEFF Research Database (Denmark)
Bunch, Lennart; Krogsgaard-Larsen, Povl
2009-01-01
(S)-Glutamic acid (Glu) is the major excitatory neurotransmitter in the mammalian central nervous system, activating the plethora of glutamate receptors (GluRs). In broad lines, the GluRs are divided into two major classes: the ionotropic Glu receptors (iGluRs) and the metabotropic Glu receptors (m......GluRs). Within the iGluRs, five subtypes (KA1, KA2, iGluR5-7) show high affinity and express full agonist activity upon binding of the naturally occurring amino acid kainic acid (KA). Thus these receptors have been named the KA receptors. This review describes all-to our knowledge-published KA receptor agonists...
Cr3+ and Cr4+ luminescence in glass ceramic silica
International Nuclear Information System (INIS)
Martines, Marco A.U.; Davolos, Marian R.; Jafelicci, Miguel Junior; Souza, Dione F. de; Nunes, Luiz A.O.
2008-01-01
This paper reports on the effect of glass ceramic silica matrix on [CrO 4 ] 4- and Cr 2 O 3 NIR and visible luminescence. Chromium-containing silica was obtained by precipitation from water-glass and chromium nitrate acid solution with thermal treatment at 1000 deg. C. From XRD results silica and silica-chromium samples are crystalline. The chromium emission spectrum presents two main broad bands: one in the NIR region (1.1-1.7μm) and other in the visible region (0.6-0.7μm) assigned to Cr 4+ and to Cr 3+ , respectively. This thermal treated glass ceramic silica-chromium sample stabilizes the [CrO 4 ] 4- where Cr 4+ substitutes for Si 4+ and also hexacoordinated Cr 3+ group probably as segregated phase in the system. It can be pointed out that luminescence spectroscopy is a powerful tool for detecting the two chromium optical centers in the glass ceramic silica
Oxidation resistance of TiN, CrN, TiAlN and CrAlN coatings deposited by lateral rotating cathode arc
International Nuclear Information System (INIS)
Chim, Y.C.; Ding, X.Z.; Zeng, X.T.; Zhang, S.
2009-01-01
In this paper, four kinds of hard coatings, TiN, CrN, TiAlN and CrAlN (with Al/Ti or Al/Cr atomic ratio around 1:1), were deposited on stainless steel substrates by a lateral rotating cathode arc technique. The as-deposited coatings were annealed in ambient atmosphere at different temperatures (500-1000 o C) for 1 h. The evolution of chemical composition, microstructure, and microhardness of these coatings after annealing at different temperatures was systematically analyzed by energy dispersive X-ray spectroscopy (EDX), X-ray diffraction (XRD) and nanoindentation experiments. The oxidation behaviour and its influence on overall hardness of these four coatings were compared. It was found that the ternary TiAlN and CrAlN coatings have better oxidation resistance than their binary counterparts, TiN and CrN coatings. The Cr-based coatings (CrN and CrAlN) exhibited evidently better oxidation resistance than the Ti-based coatings (TiN and TiAlN). TiN coating started to oxidize at 500 o C. After annealing at 700 o C no N could be detected by EDX, indicating that the coating was almost fully oxidized. After annealed at 800 o C, the coating completely delaminated from the substrate. TiAlN started to oxidize at 600 o C. It was nearly fully oxidized (with little residual nitrogen detected in the coating by EDX) and partially delaminated at 1000 o C. Both CrN and CrAlN started to oxidize at 700 o C. CrN was almost fully oxidized (with little residual nitrogen detected in the coating by EDX) and partially delaminated at 900 o C. The oxidation rate of the CrAlN coating is quite slow. After annealing at 1000 o C, only about 19 at.% oxygen was detected and the coating showed no delamination. The Ti-based (TiN and TiAlN) coatings were not able to retain their hardness at higher temperatures (≥ 700 o C). On the other hand, the hardness of CrAlN was stable at a high level between 33 and 35 GPa up to an annealing temperature of 800 o C and still kept at a comparative high value of
Ecdysone Agonist: New Insecticides with Novel Mode of Action
Directory of Open Access Journals (Sweden)
Y. Andi Trisyono
2002-12-01
Full Text Available Development of insect resistance to insecticide has been the major driving force for the development of new insecticides. Awareness and demand from public for more environmentally friendly insecticides have contributed in shifting the trend from using broad spectrum to selective insecticides. As a result, scientists have looked for new target sites beyond the nervous system. Insect growth regulators (IGRs are more selective insecticides than conventional insecticides, and ecdysone agonists are the newest IGRs being commercialized, e.g. tebufenozide, methoxyfenozide, and halofenozide. Ecdysone agonists bind to the ecdysteroid receptors, and they act similarly to the molting hormone 20-hydroxyecdysone. The binding provides larvae or nymphs with a signal to enter a premature and lethal molting cycle. In addition, the ecdysone agonists cause a reduction in the number of eggs laid by female insects. The ecdysone agonists are being developed as selective biorational insecticides. Tebufenozide and methoxyfenozide are used to control lepidopteran insect pests, whereas halofenozide is being used to control coleopteran insect pests. Their selectivity is due to differences in the binding affinity between these compounds to the receptors in insects from different orders. The selectivity of these compounds makes them candidates to be used in combinations with other control strategies to develop integrated pest management programs in agricultural ecosystems. Key words: new insecticides, selectivity, ecdysone agonists
Consoli, Agostino; Formoso, Gloria; Baldassarre, Maria Pompea Antonia; Febo, Fabrizio
2018-03-01
Glucagon-like peptide-1 receptor agonists (GLP-1RA) and sodium glucose cotransporter 2 inhibitors (SGLT2i) are of particular interest in type 2 diabetes treatment strategies, due to their efficacy in reducing HbA1c with a low risk of hypoglycaemia, to their positive effects on body weight and blood pressure and in light of their effects on cardiovascular risk and on nephroprotection emerged from the most recent cardiovascular outcome trials. Since it is therefore very likely that GLP-1RA and SGLT2i use will become more and more common, it is more and more important to gather and discuss information about their safety profile. Area Covered: adverse events and the safety concerns most often emerged in trials with GLP-1RA namely, exenatide long acting release (LAR), dulaglutide, liraglutide, semaglutide, lixisenatide or SGLT2i, namely empagliflozin, dapagliflozin, canagliflozin and SGLT2i with an attempt at comparing the safety profiles of molecules of these two classes. Expert opinion: GLP-1RA and SGLT2i, although each associated with different specific side effects, share a 'similar' safety profile and are both drugs relatively easy to handle. The potentially complementary mechanisms of action, the cardio and nephroprotective effects demonstrated by molecules of both classes, make these drugs potentially useful even in add on to each other.
Partially filled intermediate band of Cr-doped GaN films
International Nuclear Information System (INIS)
Sonoda, S.
2012-01-01
We investigated the band structure of sputtered Cr-doped GaN (GaCrN) films using optical absorption, photoelectron yield spectroscopy, and charge transport measurements. It was found that an additional energy band is formed in the intrinsic band gap of GaN upon Cr doping, and that charge carriers in the material move in the inserted band. Prototype solar cells showed enhanced short circuit current and open circuit voltage in the n-GaN/GaCrN/p-GaN structure compared to the GaCrN/p-GaN structure, which validates the proposed concept of an intermediate-band solar cell.
Reconstitution of high-affinity opioid agonist binding in brain membranes
Energy Technology Data Exchange (ETDEWEB)
Remmers, A.E.; Medzihradsky, F. (Univ. of Michigan Medical School, Ann Arbor (United States))
1991-03-15
In synaptosomal membranes from rat brain cortex, the {mu} selective agonist ({sup 3}H)dihydromorphine in the absence of sodium, and the nonselective antagonist ({sup 3}H)naltrexone in the presence of sodium, bound to two populations of opioid receptor sites with K{sub d} values of 0.69 and 8.7 nM for dihydromorphine, and 0.34 and 5.5 nM for naltrexone. The addition of 5 {mu}M guanosine 5{prime}-({gamma}-thio)triphosphate (GTP({gamma}S)) strongly reduced high-affinity agonist but not antagonist binding. Exposure of the membranes to high pH reduced the number of GTP({gamma}-{sup 35}S) binding sites by 90% and low K{sub m}, opioid-sensitive GTPase activity by 95%. In these membranes, high-affinity agonist binding was abolished and modulation of residual binding by GTP({gamma}S) was diminished. Alkali treatment of the glioma cell membranes prior to fusion inhibited most of the low K{sub m} GTPase activity and prevented the reconstitution of agonist binding. The results show that high-affinity opioid agonist binding reflects the ligand-occupied receptor - guanine nucleotide binding protein complex.
Hypertrophic effect of inhaled beta -agonist with and without concurrent exercise training
DEFF Research Database (Denmark)
Jessen, Søren; Onslev, Johan; Lemminger, Anders
2018-01-01
INTRODUCTION: Due to a high prevalence of asthma and exercise-induced bronchoconstriction in elite athletes, there is a high use of beta2 -adrenoceptor agonists (beta2 -agonists) in the athletic population. While anabolic in rodents, no study has been able to detect hypertrophy in humans after...... chronic beta2 -agonist inhalation. METHODS: We investigated if inhaled beta2 -agonist, terbutaline, alters body composition and metabolic rate with and without concurrent exercise training in healthy young men. Sixty-seven participants completed a four-week intervention of daily terbutaline (8×0.5 mg...
X-ray fluorescence analysis of Cr6+ component in mixtures of Cr2O3 and K2CrO4
International Nuclear Information System (INIS)
Tochio, Tatsunori; Sakakura, Shusuke; Oohashi, Hirofumi
2010-01-01
X-ray fluorescence analysis using Cr K α spectra was applied to the determination of the mixing ratio of Cr 6+ to (Cr 6+ + Cr 3+ ) in several mixtures of K 2 CrO 4 and Cr 2 O 3 . Because the powder of K 2 CrO 4 contained large particles that were more than 50 μm in diameter, it was ground between a pestle and a mortar for about 8 h. The coarse particles still remaining were removed by using a sieve with 325-mesh (44 μm) in order to reduce the difference in absorption effects between emissions from Cr 6+ and those from Cr 3+ . The mixing ratio, K 2 CrO 4 /(K 2 CrO 4 + Cr 2 O 3 ), of the five mixtures investigated is 0.50, 0.40, 0.20, 0.10, and 0.05 in weight, respectively. Each spectrum obtained was analyzed by decomposing it into two reference spectra, those of the two pure materials, K 2 CrO 4 and Cr 2 O 3 , with a constant background. The results for the mixtures containing K 2 CrO 4 of more than 20 wt% are that the relative deviation from the true value is less than ∼5%. On the other hand, when the content of K 2 CrO 4 decreases to less than 10 wt%, the relative deviation gets so large as 20 - 25%. The error coming from a peak separation of spectrum involved in our results were estimated by applying our method to five sets of data for each mixture computationally generated, taking into account the uncertainty in total counts of real measurements. (author)
X-ray fluorescence analysis of Cr(6+) component in mixtures of Cr(2)O(3) and K(2)CrO(4).
Tochio, Tatsunori; Sakakura, Shusuke; Oohashi, Hirofumi; Mizota, Hirohisa; Zou, Yanhui; Ito, Yoshiaki; Fukushima, Sei; Tanuma, Shigeo; Shoji, Takashi; Fujimura, Hajime; Yamashita, Michiru
2010-01-01
X-ray fluorescence analysis using Cr K(alpha) spectra was applied to the determination of the mixing ratio of Cr(6+) to (Cr(6+) + Cr(3+)) in several mixtures of K(2)CrO(4) and Cr(2)O(3). Because the powder of K(2)CrO(4) contained large particles that were more than 50 microm in diameter, it was ground between a pestle and a mortar for about 8 h. The coarse particles still remaining were removed by using a sieve with 325-mesh (44 microm) in order to reduce the difference in absorption effects between emissions from Cr(6+) and those from Cr(3+). The mixing ratio, K(2)CrO(4)/(K(2)CrO(4) + Cr(2)O(3)), of the five mixtures investigated is 0.50, 0.40, 0.20, 0.10, and 0.05 in weight, respectively. Each spectrum obtained was analyzed by decomposing it into two reference spectra, those of the two pure materials, K(2)CrO(4) and Cr(2)O(3), with a constant background. The results for the mixtures containing K(2)CrO(4) of more than 20 wt% are that the relative deviation from the true value is less than approximately 5%. On the other hand, when the content of K(2)CrO(4) decreases to less than 10 wt%, the relative deviation gets so large as 20 - 25%. The error coming from a peak separation of spectrum involved in our results were estimated by applying our method to five sets of data for each mixture computationally generated, taking into account the uncertainty in total counts of real measurements.
Bulk and surface properties of liquid Al-Cr and Cr-Ni alloys
International Nuclear Information System (INIS)
Novakovic, R
2011-01-01
The energetics of mixing and structural arrangement in liquid Al-Cr and Cr-Ni alloys has been analysed through the study of surface properties (surface tension and surface segregation), dynamic properties (chemical diffusion) and microscopic functions (concentration fluctuations in the long-wavelength limit and chemical short-range order parameter) in the framework of statistical mechanical theory in conjunction with quasi-lattice theory. The Al-Cr phase diagram exhibits the existence of different intermetallic compounds in the solid state, while that of Cr-Ni is a simple eutectic-type phase diagram at high temperatures and includes the low-temperature peritectoid reaction in the range near a CrNi 2 composition. Accordingly, the mixing behaviour in Al-Cr and Cr-Ni alloy melts was studied using the complex formation model in the weak interaction approximation and by postulating Al 8 Cr 5 and CrNi 2 chemical complexes, respectively, as energetically favoured.
Bulk and surface properties of liquid Al-Cr and Cr-Ni alloys.
Novakovic, R
2011-06-15
The energetics of mixing and structural arrangement in liquid Al-Cr and Cr-Ni alloys has been analysed through the study of surface properties (surface tension and surface segregation), dynamic properties (chemical diffusion) and microscopic functions (concentration fluctuations in the long-wavelength limit and chemical short-range order parameter) in the framework of statistical mechanical theory in conjunction with quasi-lattice theory. The Al-Cr phase diagram exhibits the existence of different intermetallic compounds in the solid state, while that of Cr-Ni is a simple eutectic-type phase diagram at high temperatures and includes the low-temperature peritectoid reaction in the range near a CrNi(2) composition. Accordingly, the mixing behaviour in Al-Cr and Cr-Ni alloy melts was studied using the complex formation model in the weak interaction approximation and by postulating Al(8)Cr(5) and CrNi(2) chemical complexes, respectively, as energetically favoured.
Regulation of ventilation and oxygen consumption by delta- and mu-opioid receptor agonists.
Schaeffer, J I; Haddad, G G
1985-09-01
To study the effect of endorphins on metabolic rate and on the relationship between O2 consumption (VO2) and ventilation, we administered enkephalin analogues (relatively selective delta-receptor agonists) and a morphiceptin analogue (a highly selective mu-receptor agonist) intracisternally in nine unanesthetized chronically instrumented adult dogs. Both delta- and mu-agonists decreased VO2 by 40-60%. delta-Agonists induced a dose-dependent decrease in mean instantaneous minute ventilation (VT/TT) associated with periodic breathing. The decrease in VT/TT started and resolved prior to the decrease and returned to baseline of VO2, respectively. In contrast, the mu-agonists induced an increase in VT/TT associated with rapid shallow breathing. Arterial PCO2 increased and arterial PO2 decreased after both delta- and mu-agonists. Low doses of intracisternal naloxone (0.002-2.0 micrograms/kg) reversed the opioid effect on VT/TT but not on VO2; higher doses of naloxone (5-25 micrograms/kg) reversed both. Naloxone administered alone had no effect on VT/TT or VO2. These data suggest that 1) both delta- and mu-agonists induce alveolar hypoventilation despite a decrease in VO2, 2) this hypoventilation results from a decrease in VT/TT after delta-agonists but an increase in dead space ventilation after mu-agonists, and 3) endorphins do not modulate ventilation and metabolic rate tonically, but we speculate that they may do so in response to stressful stimulation.
A production method for Cr-51 at IEN's cyclotron
Energy Technology Data Exchange (ETDEWEB)
Bastos, M A.V.; Britto, J L.Q. de; Vinagre, U M; Silva, A.G. da [Universidade Federal, Rio de Janeiro, RJ (Brazil). Coordenacao dos Programas de Pos-graduacao de Engenharia
1990-01-01
Thick target yields for the reactions {sup 51} V(p,n){sup 51} Cr and {sup 51} V(d, 2 n){sup 51} Cr were measured and compared with literature values. The excitation function for the {sup 51} V(p,n){sup 51} Cr reaction was also measured. A method for the production and separation of this radioisotope was developed via the {sup 51} V(p,n){sup 51} Cr reaction and a combination of Fe+3 coprecipitation and an anion exchange technique using a Dowex 1X8(100-200 mesh) resin in hydrochloric acid medium. (author).
A production method for Cr-51 at IEN's cyclotron
Energy Technology Data Exchange (ETDEWEB)
Bastos, M A.V.; Britto, J L.Q. de; Vinagre, U M; Silva, A.G. da [Instituto de Engenharia Nuclear, Rio de Janeiro (Brazil). Dept. de Fisica
1990-01-01
Thick target yields for the reactions {sup 51}V(p,n){sup 51}Cr and {sup 51}V(d,2n){sup 51}Cr were measured and compared with literature values. The excitation function for the {sup 51}V(p,n){sup 51}Cr reaction was also measured. A method for the production and separation of this radioisotope was developed via the {sup 51}V(p,n){sup 51}Cr reaction and a combination of Fe{sup +3} coprecipitation and an anion exchange technique using a Dowex 1X8 (100-200 mesh) resin in hydrochloric acid medium. (orig.).
Optimization of CR-39 for fast neutron dosimetry applications
International Nuclear Information System (INIS)
Vilela, E.; Fantuzzi, E.; Giacomelli, G.; Giorgini, M.; Morelli, B.; Patrizii, L.; Serra, P.; Togo, V.
1999-01-01
We present the results of an experimental work aimed at improving the performances of the CR-39[reg] (Registered Trademark of PPG Industries Inc.) nuclear track detector for neutron dosimetry applications. The work was done in collaboration with the Intercast Europe S.p.A., producer of CR-39 for commercial and scientific applications. We compare the CR-39 made with different additives concentrations and different polymerization processes. We evaluate the response of the CR-39 to fast neutrons from three sources: 241 Am-Be, 252 Cf and 238 Pu-Li. Particular attention was paid to background fluctuations that limit the lower detectable dose
FXR agonist activity of conformationally constrained analogs of GW 4064.
Akwabi-Ameyaw, Adwoa; Bass, Jonathan Y; Caldwell, Richard D; Caravella, Justin A; Chen, Lihong; Creech, Katrina L; Deaton, David N; Madauss, Kevin P; Marr, Harry B; McFadyen, Robert B; Miller, Aaron B; Navas, Frank; Parks, Derek J; Spearing, Paul K; Todd, Dan; Williams, Shawn P; Bruce Wisely, G
2009-08-15
Two series of conformationally constrained analogs of the FXR agonist GW 4064 1 were prepared. Replacement of the metabolically labile stilbene with either benzothiophene or naphthalene rings led to the identification of potent full agonists 2a and 2g.
Directory of Open Access Journals (Sweden)
Parisa Khani
2013-01-01
Full Text Available Background: This study compares the microdose flare-up protocol to the ultrashort gonadotropinreleasinghormone (GnRH agonist flare combined with the fixed multidose GnRH antagonistprotocol in poor responders undergoing ovarian stimulation.Materials and Methods: In this randomized clinical trial, 120 women who were candidates forassisted reproductive techniques (ART and had histories of one or more failed in vitro fertilization(IVF cycles with three or fewer retrieved oocytes were prospectively randomized into two groups.Group I (60 patients received the microdose flare-up regimen and group II (60 patients receivedthe ultrashort GnRH agonist combined with fixed GnRH antagonist.Results: There were no significant differences between the groups in the number of used gonadotropinampoules (p=0.591, duration of stimulation (p=0.610, number of retrieved oocytes (p=0.802,fertilization rate (p=0.456, and the number of transferred embryos (p=0.954. The clinical pregnancyrates were statistically similar in group I (10% compared with group II (13.3%, p=0.389.Conclusion: According to our results, there is no significant difference between these protocolsfor improving the ART outcome in poor responders. Additional prospective, randomizedstudies with more patients is necessary to determine the best protocol (Registration Number:IRCT201105096420N1.
Eftekhar, Maryam; Mohammadian, Farnaz; Yousefnejad, Fariba; Khani, Parisa
2013-01-01
This study compares the microdose flare-up protocol to the ultrashort gonadotropinreleasing hormone (GnRH) agonist flare combined with the fixed multidose GnRH antagonist protocol in poor responders undergoing ovarian stimulation. In this randomized clinical trial, 120 women who were candidates for assisted reproductive techniques (ART) and had histories of one or more failed in vitro fertilization (IVF) cycles with three or fewer retrieved oocytes were prospectively randomized into two groups. Group I (60 patients) received the microdose flare-up regimen and group II (60 patients) received the ultrashort GnRH agonist combined with fixed GnRH antagonist. There were no significant differences between the groups in the number of used gonadotropin ampoules (p=0.591), duration of stimulation (p=0.610), number of retrieved oocytes (p=0.802), fertilization rate (p=0.456), and the number of transferred embryos (p=0.954). The clinical pregnancy rates were statistically similar in group I (10%) compared with group II (13.3%, p=0.389). According to our results, there is no significant difference between these protocols for improving the ART outcome in poor responders. Additional prospective, randomized studies with more patients is necessary to determine the best protocol (Registration Number: IRCT201105096420N1).
Comparison of long GnRH agonist versus GnRH antagonist protocol in poor responders
Directory of Open Access Journals (Sweden)
Sadık Şahin
2014-12-01
Full Text Available Objective: To compare long GnRH agonist with GnRH antagonist protocol in poor responders. Materials and Methods: Medical charts of 531 poor responder women undergoing in-vitro fertilization (IVF cycle at Zeynep Kamil Maternity and Children’s Hospital, IVF Center were retrospectively analysed. Those who received at least 300 IU/daily gonadotropin and had ≤3 oocytes retrieved were enrolled in the study. Poor responders were categorized into two groups as those who received long GnRH agonist or GnRH antagonist regimen. Results: Treatment duration and total gonadotropin dosage were significantly higher in women undergoing the long GnRH agonist regimen compared with the GnRH antagonist regimen (p<0.001 for both. Although the number of total and mature oocytes retrieved was similar between the groups, good quality embryos were found to be higher in the GnRH antagonist regimen. The day of embryo transfer and number of transferred embryos were similar in the groups. No statistically significant differences were detected in pregnancy (10.5% vs 14.1%, clinical pregnancy (7.7% vs 10.6% and early pregnancy loss rates (27.2% vs 35% between the groups. Conclusion: GnRH antagonist regimen may be preferable to long GnRH regimen as it could decrease the cost and treatment duration in poor responders.
Radiation damage in Fe-Cr alloys: Atomistic studies
International Nuclear Information System (INIS)
Terentyev, Dmitry; Malerba, Lorenzo; Bonny, Giovanni; Castin, Nicolas
2009-01-01
High-Cr ferritic-martensitic steels are the most promising candidate structural materials for future advanced fission reactors, as well as for fusion systems, due to their better thermomechanical properties and higher radiation resistance as compared to austenitic steels. The performance of these steels, especially under irradiation, appears to be largely determined by the Cr content. For instance, the current choice of steel compositions around ∼9 wt% Cr is mainly based on the observation of a local minimum in the ductile-brittle transition temperature shift at this composition. On the other hand, reduced void swelling is observed between 3 and 12 wt% Cr. The origin of these and other Cr-dependent effects remained unexplained for a long time, thereby calling for a physical modelling effort addressing these questions. In this presentation, an overview is given on the effort made in recent years to construct a whole modelling framework, from ab initio to dislocations, to provide explanations to the above-mentioned issues. Ab initio calculations combined to the development of the interatomic potentials capable of grasping key features of Cr atoms embedded in perfect and defected Fe matrix, were required. Primary damage, defect migration, Cr mass transport, phase separation, Cr-defect segregation and dislocation-defect interactions could then be studied using fully atomistic approaches. Our research shows that many of the effects of Cr content on the behaviour of these alloys under irradiation can be attributed to the only recently highlighted high solubility of Cr in Fe (∼10 wt%), below which, in addition, Cr atoms tend to order. The presentation will clarify how this aspect, combined with the high affinity between Cr atoms and self-interstitials defects, influences and partly explain both microstructure evolution and mechanical behaviour of high-Cr steels under irradiation. (author)
Biliary excretion and distribution of 51Cr(III) and 51Cr(VI) in rats
International Nuclear Information System (INIS)
Cikrt, M.; Bencko, V.
1979-01-01
The biliary excretion and distribution of 51 Cr after intravenous administration of 51 Cr(III) ( 51 CrCl 3 ) or 51 Cr(VI) (Na 2 51 CrO 4 .4H 2 O) were studied in rats. The cumulative biliary excretion of 51 Cr 24 hrs after the injection was significantly higher after administration of 51 Cr(VI) than of 51 Cr(III) (3.51+-0.7% and 0.51+-0.05% of administered dose, respectively). This difference was especially due to a higher rate of biliary excretion of 51 Cr in the first hours after 51 Cr(VI) administration. The excretion of 51 Cr via feces was also higher after administration of 51 Cr(VI) (7.35+-0.45%) of administered dose, as against 4.23+-0.23% after 51 Cr(III). On the other hand, no significant difference in urinary excretion of 51 Cr was found. Statistically significant differences were also observed in the distribution of 51 Cr in the organism after administration of both valence states of the metal. (author)
International Nuclear Information System (INIS)
Wiecinski, Piotr; Smolik, Jerzy; Garbacz, Halina; Kurzydlowski, Krzysztof J.
2011-01-01
Five different nanostructured, multilayer coatings (CrN/Cr)x8 with different thickness ratio of Cr and CrN layers were deposited by PAPVD (Plasma Assisted Physical Vapour Deposition) vacuum arc method on Ti6Al4V titanium alloy. The microstructure, chemical and phase composition of the CrN and Cr sub-layers were characterized by SEM with EDX and Cs-corrected dedicated STEM on cross-sections prepared by focus ion beam. Besides, hardness and Young's modulus of the (Cr/CrN)x8 coatings has been measured. The adhesion has been tested by scratch test method. The obtained (CrN/Cr) multilayer coatings, 5-6 μm in thickness, have homogeneous and nanocrystalline structure, free of pores and cracks. The microstructures of Cr and CrN layers consist of columnar grains below 100 nm in diameter. The hardness and Young's modulus of these coatings depend linearly on thickness ratio of Cr and CrN layers. The decrease of the thickness ratio Cr/CrN 0.81 to 0.15 results in the increase of hardness from 1275 HV to 1710 HV and Young's modulus from 260 GPa to 271 GPa.
Comparative study of cytotoxicity of direct metal laser sintered and cast Co-Cr-Mo dental alloy
Directory of Open Access Journals (Sweden)
T. Puskar
2015-07-01
Full Text Available The presented work investigated the cytotoxicity of direct metal laser sintered (DMLS and cast Co-Cr-Mo (CCM dental alloy. In vitro tests were done on human fibroblast cell line MRC-5. There was no statistically significant difference in the cytotoxic effects of DMLS and CCM alloy specimens. The results of this investigation show good potential of DMLS Co-Cr-Mo alloy for application in dentistry.
Amorphization of C-implanted Fe(Cr) alloys
International Nuclear Information System (INIS)
Knapp, J.A.; Follstaedt, D.M.; Sorensen, N.R.; Pope, L.E.
1991-01-01
The amorphous phase formed by implanting C into Fe alloyed with Cr, which is a prototype for the amorphous phase formed by implanting C into stainless steels, is compared to that formed by implanting C and Ti into Fe and steels. The composition range of the phase has been examined; higher Cr and C concentrations are required than needed with Ti and C. The friction and wear benefits obtained by implanting stainless steels with C only do not persist for the long durations and high wear loads found with Ti and C. However, the amorphous Fe-Cr-C alloys exhibit good aqueous corrosion resistance. (orig.)
PPARγ partial agonist GQ-16 strongly represses a subset of genes in 3T3-L1 adipocytes
Energy Technology Data Exchange (ETDEWEB)
Milton, Flora Aparecida [Faculdade de Ciências da Saúde, Laboratório de Farmacologia Molecular, Universidade de Brasília (Brazil); Genomic Medicine, Houston Methodist Research Institute, Houston, TX (United States); Cvoro, Aleksandra [Genomic Medicine, Houston Methodist Research Institute, Houston, TX (United States); Amato, Angelica A. [Faculdade de Ciências da Saúde, Laboratório de Farmacologia Molecular, Universidade de Brasília (Brazil); Sieglaff, Douglas H.; Filgueira, Carly S.; Arumanayagam, Anithachristy Sigamani [Genomic Medicine, Houston Methodist Research Institute, Houston, TX (United States); Caro Alves de Lima, Maria do; Rocha Pitta, Ivan [Laboratório de Planejamento e Síntese de Fármacos – LPSF, Universidade Federal de Pernambuco (Brazil); Assis Rocha Neves, Francisco de [Faculdade de Ciências da Saúde, Laboratório de Farmacologia Molecular, Universidade de Brasília (Brazil); Webb, Paul, E-mail: pwebb@HoustonMethodist.org [Genomic Medicine, Houston Methodist Research Institute, Houston, TX (United States)
2015-08-28
Thiazolidinediones (TZDs) are peroxisome proliferator-activated receptor gamma (PPARγ) agonists that improve insulin resistance but trigger side effects such as weight gain, edema, congestive heart failure and bone loss. GQ-16 is a PPARγ partial agonist that improves glucose tolerance and insulin sensitivity in mouse models of obesity and diabetes without inducing weight gain or edema. It is not clear whether GQ-16 acts as a partial agonist at all PPARγ target genes, or whether it displays gene-selective actions. To determine how GQ-16 influences PPARγ activity on a gene by gene basis, we compared effects of rosiglitazone (Rosi) and GQ-16 in mature 3T3-L1 adipocytes using microarray and qRT-PCR. Rosi changed expression of 1156 genes in 3T3-L1, but GQ-16 only changed 89 genes. GQ-16 generally showed weak effects upon Rosi induced genes, consistent with partial agonist actions, but a subset of modestly Rosi induced and strongly repressed genes displayed disproportionately strong GQ-16 responses. PPARγ partial agonists MLR24 and SR1664 also exhibit disproportionately strong effects on transcriptional repression. We conclude that GQ-16 displays a continuum of weak partial agonist effects but efficiently represses some negatively regulated PPARγ responsive genes. Strong repressive effects could contribute to physiologic actions of GQ-16. - Highlights: • GQ-16 is an insulin sensitizing PPARγ ligand with reduced harmful side effects. • GQ-16 displays a continuum of weak partial agonist activities at PPARγ-induced genes. • GQ-16 exerts strong repressive effects at a subset of genes. • These inhibitor actions should be evaluated in models of adipose tissue inflammation.
PPARγ partial agonist GQ-16 strongly represses a subset of genes in 3T3-L1 adipocytes
International Nuclear Information System (INIS)
Milton, Flora Aparecida; Cvoro, Aleksandra; Amato, Angelica A.; Sieglaff, Douglas H.; Filgueira, Carly S.; Arumanayagam, Anithachristy Sigamani; Caro Alves de Lima, Maria do; Rocha Pitta, Ivan; Assis Rocha Neves, Francisco de; Webb, Paul
2015-01-01
Thiazolidinediones (TZDs) are peroxisome proliferator-activated receptor gamma (PPARγ) agonists that improve insulin resistance but trigger side effects such as weight gain, edema, congestive heart failure and bone loss. GQ-16 is a PPARγ partial agonist that improves glucose tolerance and insulin sensitivity in mouse models of obesity and diabetes without inducing weight gain or edema. It is not clear whether GQ-16 acts as a partial agonist at all PPARγ target genes, or whether it displays gene-selective actions. To determine how GQ-16 influences PPARγ activity on a gene by gene basis, we compared effects of rosiglitazone (Rosi) and GQ-16 in mature 3T3-L1 adipocytes using microarray and qRT-PCR. Rosi changed expression of 1156 genes in 3T3-L1, but GQ-16 only changed 89 genes. GQ-16 generally showed weak effects upon Rosi induced genes, consistent with partial agonist actions, but a subset of modestly Rosi induced and strongly repressed genes displayed disproportionately strong GQ-16 responses. PPARγ partial agonists MLR24 and SR1664 also exhibit disproportionately strong effects on transcriptional repression. We conclude that GQ-16 displays a continuum of weak partial agonist effects but efficiently represses some negatively regulated PPARγ responsive genes. Strong repressive effects could contribute to physiologic actions of GQ-16. - Highlights: • GQ-16 is an insulin sensitizing PPARγ ligand with reduced harmful side effects. • GQ-16 displays a continuum of weak partial agonist activities at PPARγ-induced genes. • GQ-16 exerts strong repressive effects at a subset of genes. • These inhibitor actions should be evaluated in models of adipose tissue inflammation
MELATONIN DAN MELATONIN RECEPTOR AGONIST SEBAGAI PENANGANAN INSOMNIA PRIMER KRONIS
Directory of Open Access Journals (Sweden)
Ni Luh Putu Ayu Maha Iswari
2013-04-01
Full Text Available Melatonin is a hormone that has an important role in the mechanism of sleep. Hypnotic effects of melatonin and melatonin receptor agonist are mediated via MT1 and MT2 receptors, especially in circadian rhythm pacemaker, suprachiasmatic nucleus, which is worked on the hypothalamic sleep switch. This mechanism is quite different with the GABAergic drugs such as benzodiazepine. Agonist melatonin triggers the initiation of sleep and normalize circadian rhythms so that makes it easier to maintain sleep. The main disadvantage of melatonin in helping sleep maintenance on primary insomnia is that the half life is very short. The solution to this problem is the use of prolonged-release melatonin and melatonin receptor agonist agents such as ramelteon. Melatoninergic agonist does not cause withdrawal effects, dependence, as well as cognitive and psychomotor disorders as often happens on the use of benzodiazepine.
Nanoparticulate STING agonists are potent lymph node-targeted vaccine adjuvants.
Hanson, Melissa C; Crespo, Monica P; Abraham, Wuhbet; Moynihan, Kelly D; Szeto, Gregory L; Chen, Stephanie H; Melo, Mariane B; Mueller, Stefanie; Irvine, Darrell J
2015-06-01
Cyclic dinucleotides (CDNs) are agonists of stimulator of IFN genes (STING) and have potential as vaccine adjuvants. However, cyclic di-GMP (cdGMP) injected s.c. shows minimal uptake into lymphatics/draining lymph nodes (dLNs) and instead is rapidly distributed to the bloodstream, leading to systemic inflammation. Here, we encapsulated cdGMP within PEGylated lipid nanoparticles (NP-cdGMP) to redirect this adjuvant to dLNs. Compared with unformulated CDNs, encapsulation blocked systemic dissemination and markedly enhanced dLN accumulation in murine models. Delivery of NP-cdGMP increased CD8+ T cell responses primed by peptide vaccines and enhanced therapeutic antitumor immunity. A combination of a poorly immunogenic liposomal HIV gp41 peptide antigen and NP-cdGMP robustly induced type I IFN in dLNs, induced a greater expansion of vaccine-specific CD4+ T cells, and greatly increased germinal center B cell differentiation in dLNs compared with a combination of liposomal HIV gp41 and soluble CDN. Further, NP-cdGMP promoted durable antibody titers that were substantially higher than those promoted by the well-studied TLR agonist monophosphoryl lipid A and comparable to a much larger dose of unformulated cdGMP, without the systemic toxicity of the latter. These results demonstrate that nanoparticulate delivery safely targets CDNs to the dLNs and enhances the efficacy of this adjuvant. Moreover, this approach can be broadly applied to other small-molecule immunomodulators of interest for vaccines and immunotherapy.
International Nuclear Information System (INIS)
Di Paolo, T.; Falardeau, P.
1987-01-01
The authors have investigated dopamine (DA) receptor agonist high- and low-affinity states in female rate estradiol-induced prolactin (PRL)-secreting pituitary tumors and intact pituitary tissue. Estradiol treatment increased the anterior pituitary weight 9-fold and plasma prolactin levels 74-fold and these measures are correlated (R = 0.745, n = 73, p 3 H]-spiperone binding to the DA receptor by apomorphine was compared in normal and adenomatous pituitary tissue. The inhibition constants (Ki) and the proportions of the two apomorphine sites are unchanged in tumors compared to intact pituitary tissue. Guanosine 5'-[β-γ-imino]triphosphate (Gpp(NH)p) causes complete conversion of the high into low affinity dopaminergic agonist site in normal pituitary and in tumors. These results suggest that rats with primary estradiol-induced pituitary tumors have normal and functional DA receptors. 9 references, 2 tables
Wang, Hao
2011-03-01
We present results from an electronic structure investigation of the chromium halides CrCl3, CrBr3, and CrI3, as obtained by the linearized augmented plane wave method of density functional theory. Our interest focuses on the chloride. While all three halides display strong ferromagnetic coupling within the halide-Cr-halide triple layers, our emphasis is on differences in the interlayer magnetic coupling. In agreement with experimental results, our calculations indicate ferromagnetic ordering for CrBr3 as well as CrI3. The antiferromagnetic state of CrCl3 can be reproduced by introducing an on-site electron-electron repulsion. However, we observe that the ground state depends critically on the specific approach used. Our results show that a low temperature structural phase transition from monoclinic to trigonal is energetically favourable for CrCl3. © 2011 IOP Publishing Ltd.
Berker, Bülent; Duvan, Candan İltemir; Kaya, Cemil; Aytaç, Ruşen; Satıroğlu, Hakan
2010-01-01
To determine the potential effect of the ultrashort gonadotropin-releasing hormone (GnRH) agonist/GnRH antagonist protocol versus the microdose GnRH agonist protocol in poor responders undergoing intracytoplasmic sperm injection (ICSI). The patients in the Agonist-Antagonist Group (n=41) were administered the ultrashort GnRH-agonist/ antagonist protocol, while the patients in the Microdose Group (n=41) were stimulated according to the microdose flare-up protocol. The mean number of mature oocytes retrieved was the primary outcome measure. Fertilization rate, implantation rate per embryo and clinical pregnancy rates were secondary outcome measures. There was no differenc between the mean number of mature oocytes retrieved in the two groups. There were also no statistical differences between the two groups in terms of peak serum E2 level, canceled cycles, endometrial thickness on hCG day, number of 2 pronucleus and number of embryos transferred. However, the total gonadotropin consumption and duration of stimulation were significantly higher with the Agonist-Antagonist Group compared with the Microdose Group. The implantation and clinical pregnancy rates were similar between the two groups. Despite the high dose of gonadotropin consumption and longer duration of stimulation with the ultrashort GnRH agonist/ antagonist protocol, it seems that the Agonist-Antagonist Protocol is not inferior to the microdose protocol in poor responders undergoing ICSI.
Click-Chemistry-Mediated Synthesis of Selective Melanocortin Receptor 4 Agonists
DEFF Research Database (Denmark)
Palmer, Daniel; Gonçalves, Juliana P.L.; Hansen, Louise V.
2017-01-01
The melanocortin receptor 4 (MC4R) subtype of the melanocortin receptor family is a target for therapeutics to ameliorate metabolic dysfunction. Endogenous MC4R agonists possess a critical pharmacophore (HFRW), and cyclization of peptide agonists often enhances potency. Thus, 17 cyclized peptides...
Rat Urinary Bladder Carcinogenesis by Dual-Acting PPARα+γ Agonists
Directory of Open Access Journals (Sweden)
Martin B. Oleksiewicz
2008-01-01
Full Text Available Despite clinical promise, dual-acting activators of PPARα and γ (here termed PPARα+γ agonists have experienced high attrition rates in preclinical and early clinical development, due to toxicity. In some cases, discontinuation was due to carcinogenic effect in the rat urothelium, the epithelial layer lining the urinary bladder, ureters, and kidney pelvis. Chronic pharmacological activation of PPARα is invariably associated with cancer in rats and mice. Chronic pharmacological activation of PPARγ can in some cases also cause cancer in rats and mice. Urothelial cells coexpress PPARα as well as PPARγ, making it plausible that the urothelial carcinogenicity of PPARα+γ agonists may be caused by receptor-mediated effects (exaggerated pharmacology. Based on previously published mode of action data for the PPARα+γ agonist ragaglitazar, and the available literature about the role of PPARα and γ in rodent carcinogenesis, we propose a mode of action hypothesis for the carcinogenic effect of PPARα+γ agonists in the rat urothelium, which combines receptor-mediated and off-target cytotoxic effects. The proposed mode of action hypothesis is being explored in our laboratories, towards understanding the human relevance of the rat cancer findings, and developing rapid in vitro or short-term in vivo screening approaches to faciliate development of new dual-acting PPAR agonist compounds.
Lambalk, C B; Banga, F R; Huirne, J A; Toftager, M; Pinborg, A; Homburg, R; van der Veen, F; van Wely, M
2017-09-01
Most reviews of IVF ovarian stimulation protocols have insufficiently accounted for various patient populations, such as ovulatory women, women with polycystic ovary syndrome (PCOS) or women with poor ovarian response, and have included studies in which the agonist or antagonist was not the only variable between the compared study arms. The aim of the current study was to compare GnRH antagonist protocols versus standard long agonist protocols in couples undergoing IVF or ICSI, while accounting for various patient populations and treatment schedules. The Cochrane Menstrual Disorders and Subfertility Review Group specialized register of controlled trials and Pubmed and Embase databases were searched from inception until June 2016. Eligible trials were those that compared GnRH antagonist protocols and standard long GnRH agonist protocols in couples undergoing IVF or ICSI. The primary outcome was ongoing pregnancy rate. Secondary outcomes were: live birth rate, clinical pregnancy rate, number of oocytes retrieved and safety with regard to ovarian hyperstimulation syndrome (OHSS). Separate comparisons were performed for the general IVF population, women with PCOS and women with poor ovarian response. Pre-planned subgroup analyses were performed for various antagonist treatment schedules. We included 50 studies. Of these, 34 studies reported on general IVF patients, 10 studies reported on PCOS patients and 6 studies reported on poor responders. In general IVF patients, ongoing pregnancy rate was significantly lower in the antagonist group compared with the agonist group (RR 0.89, 95% CI 0.82-0.96). In women with PCOS and in women with poor ovarian response, there was no evidence of a difference in ongoing pregnancy between the antagonist and agonist groups (RR 0.97, 95% CI 0.84-1.11 and RR 0.87, 95% CI 0.65-1.17, respectively). Subgroup analyses for various antagonist treatment schedules compared to the long protocol GnRH agonist showed a significantly lower ongoing
Principles of agonist recognition in Cys-loop receptors
Directory of Open Access Journals (Sweden)
Timothy eLynagh
2014-04-01
Full Text Available Cys-loop receptors are ligand-gated ion channels that are activated by a structurally diverse array of neurotransmitters, including acetylcholine, serotonin, glycine and GABA. After the term chemoreceptor emerged over 100 years ago, there was some wait until affinity labeling, molecular cloning, functional studies and X-ray crystallography experiments identified the extracellular interface of adjacent subunits as the principal site of agonist binding. The question of how subtle differences at and around agonist-binding sites of different Cys-loop receptors can accommodate transmitters as chemically diverse as glycine and serotonin has been subject to intense research over the last three decades. This review outlines the functional diversity and current structural understanding of agonist-binding sites, including those of invertebrate Cys-loop receptors. Together, this provides a framework to understand the atomic determinants involved in how these valuable therapeutic targets recognize and bind their ligands.
DEFF Research Database (Denmark)
Hostrup, Morten; Onslev, Johan; Jacobson, Glenn
2018-01-01
Although the effects of training have been studied for decades, data on muscle proteome signature remodelling induced by high intensity training in relation to functional changes in humans remains incomplete. Likewise, β2 -agonists are frequently used to counteract exercise......-induced bronchoconstriction, but the effects β2 -agonist treatment on muscle remodelling and adaptations to training are unknown. In a placebo-controlled parallel study, we randomized 21 trained men to four weeks of high intensity training with (HIT + β2 A) or without (HIT) daily inhalation of β2 -agonist (terbutaline, 4 mg...... (P ≤ 0.01) and exercise performance (11.6 vs. 6.1%, P ≤ 0.05) in HIT + β2 A compared to HIT. These findings indicate that daily β2 -agonist treatment attenuates the beneficial effects of high intensity training on exercise performance and oxidative capacity, and causes remodelling of muscle proteome...
DEFF Research Database (Denmark)
Frydenvang, Karla Andrea; Pickering, Darryl S; Greenwood, Jeremy R
2010-01-01
We describe an improved synthesis and detailed pharmacological characterization of the conformationally restricted analogue of the naturally occurring nonselective glutamate receptor agonist ibotenic acid (RS)-3-hydroxy-4,5,6,7-tetrahydroisoxazolo[5,4-c]pyridine-7-carboxylic acid (7-HPCA, 5......) at AMPA receptor subtypes. Compound 5 was shown to be a subtype-discriminating agonist at AMPA receptors with higher binding affinity and functional potency at GluA1/2 compared to GluA3/4, unlike the isomeric analogue (RS)-3-hydroxy-4,5,6,7-tetrahydroisoxazolo[5,4-c]pyridine-5-carboxylic acid (5-HPCA, 4...
Partial agonist therapy in schizophrenia: relevance to diminished criminal responsibility.
Gavaudan, Gilles; Magalon, David; Cohen, Julien; Lançon, Christophe; Léonetti, Georges; Pélissier-Alicot, Anne-Laure
2010-11-01
Pathological gambling (PG), classified in the DSM-IV among impulse control disorders, is defined as inappropriate, persistent gaming for money with serious personal, family, and social consequences. Offenses are frequently committed to obtain money for gambling. Pathological gambling, a planned and structured behavioral disorder, has often been described as a complication of dopamine agonist treatment in patients with Parkinson's disease. It has never been described in patients with schizophrenia receiving dopamine agonists. We present two patients with schizophrenia, previously treated with antipsychotic drugs without any suggestion of PG, who a short time after starting aripiprazole, a dopamine partial agonist, developed PG and criminal behavior, which totally resolved when aripiprazole was discontinued. Based on recent advances in research on PG and adverse drug reactions to dopamine agonists in Parkinson's disease, we postulate a link between aripiprazole and PG in both our patients with schizophrenia and raise the question of criminal responsibility. © 2010 American Academy of Forensic Sciences.
Pang, Q.; Hu, Z. L.; Wu, G. H.
2016-12-01
Metallic foams with a high fraction of porosity, low density and high-energy absorption capacity are a rapidly emerging class of novel ultralight weight materials for various engineering applications. In this study, Y-Cr and Ce-Cr-coated Ni-Cr-Fe alloy foams were prepared via the pack cementation method, and the effects of Y and Ce addition on the coating microstructure and oxidation performance were analyzed in order to improve the oxidation resistance of open-cell nickel-based alloy foams. The results show that the Ce-Cr coating is relatively more uniform and has a denser distribution on the surface of the nickel-based alloy foam. The surface grains of the Ce-Cr-coated alloy foam are finer compared to those of the Y-Cr-coated alloy foam. An obvious Ce peak appears on the interface between the coating and the alloy foam strut, which gives rise to a "site-blocking" effect for the short-circuit transport of the cation in the substrate. X-ray diffraction analysis shows that the Y-Cr-coated alloy foam mainly consists of Cr, (Fe, Ni) and (Ni, Cr) phases in the surface layer. The Ce-Cr-coated alloy foam is mainly composed of Cr and (Ni, Cr) phases. Furthermore, the addition of Y and Ce clearly lead to an improvement in the oxidation resistance of the coated alloy foams in the temperature range of 900-1000 °C. The addition of Ce is especially effective in enhancing the diffusion of chromium to the oxidation front, thus, accelerating the formation of a Cr2O3 layer.
Energy Technology Data Exchange (ETDEWEB)
Dogan, O.N.; Hawk, J.A.; Schrems, K.K.
2006-06-01
A new class of materials, namely TiC-reinforced cast chromium (Cr) steels, was developed for applications requiring high abrasion resistance and good fracture toughness. The research approach was to modify the carbide structure of commercial AISI 440C steel for better fracture resistance while maintaining the already high abrasion resistance. The new alloys contained 12Cr, 2.5–4.5Ti, and 1–1.5C (wt.%) and were melted in a vacuum induction furnace. Their microstructure was composed primarily of a martensitic matrix with a dispersion of TiC precipitates. Modification of TiC morphology was accomplished through changing the cooling rate during solidification. Wear rates of the TiC-reinforced Cr steels were comparable to that of AISI 440C steel, but the impact resistance was much improved.
Doğan, Ö. N.; Hawk, J. A.; Schrems, K. K.
2006-06-01
A new class of materials, namely TiC-reinforced cast chromium (Cr) steels, was developed for applications requiring high abrasion resistance and good fracture toughness. The research approach was to modify the carbide structure of commercial AISI 440C steel for better fracture resistance while maintaining the already high abrasion resistance. The new alloys contained 12Cr, 2.5-4.5Ti, and 1-1.5C (wt.%) and were melted in a vacuum induction furnace. Their microstructure was composed primarily of a martensitic matrix with a dispersion of TiC precipitates. Modification of TiC morphology was accomplished through changing the cooling rate during solidification. Wear rates of the TiC-reinforced Cr steels were comparable to that of AISI 440C steel, but the impact resistance was much improved.
Electronic structure and superconductivity of fcc Cr
International Nuclear Information System (INIS)
Xu, J.; Freeman, A.J.; Jarlborg, T.; Brodsky, M.B.
1984-01-01
Results of self-consistent electronic structure calculations are reported for metastable fcc Cr metal. Unlike the case of bcc Cr which has E/sub F/ at a minimum in the density of states (DOS), the DOS at E/sub F/ in fcc Cr is at a peak making this one of the higher-DOS metals with the fcc structure (e.g., comparable with that of Ni and Pt). A calculated Stoner factor of 0.82 indicates that ferromagnetic ordering is not expected. Calculations of the electron-phonon coupling parameter lambda and superconducting transition temperature T/sub c/ were made using the rigid-ion approximation and strong-coupling theory with various estimates of the (unknown) phonon contribution. We conclude that T/sub c/'sroughly-equal2.5 K are reasonable, although they are substantially smaller than the T/sub c/roughly-equal10 K derived from measurements on Au-Cr-Au sandwiches
Small-molecule agonists for the glucagon-like peptide 1 receptor
DEFF Research Database (Denmark)
Knudsen, Lotte Bjerre; Kiel, Dan; Teng, Min
2007-01-01
and independent agonists. Potency of GLP-1 was not changed by the allosteric agonists, but affinity of GLP-1 for the receptor was increased. The most potent compound identified stimulates glucose-dependent insulin release from normal mouse islets but, importantly, not from GLP-1 receptor knockout mice. Also...
Structure and magnetic properties of Cr nanoparticles and Cr2O3 nanoparticles
International Nuclear Information System (INIS)
Zhang, W.S.; Brueck, E.; Zhang, Z.D.; Tegus, O.; Li, W.F.; Si, P.Z.; Geng, D.Y.; Buschow, K.H.J.
2005-01-01
We have synthesized Cr nanoparticles by arc-discharge and Cr 2 O 3 nanoparticles by subsequent annealing the as-prepared Cr nanoparticles. The structure of these nanoparticles is studied by means of X-ray diffraction, X-ray photoelectron spectroscopy, and high-resolution transmission electron microscope. Most of the particles show a good crystal habit of well-defined cubic or orthorhombic shape, while some small particles show spherical shape. The as-prepared Cr nanoparticles have a BCC Cr core coated with a thin Cr 2 O 3 layer. Cr in the core of the particles heated at 873 K for 4 h is changed to Cr 2 O 3 . The results of magnetic measurements show that the Cr nanoparticles exhibit mainly antiferromagnetic properties, in addition to a weak-ferromagnetic component at lower fields. The weak-ferromagnetic component may be ascribed to uncompensated surface spins. For the field-cooled Cr 2 O 3 nanoparticles, an exchange bias is observed in the hysteresis loops, which can be interpreted as the exchange coupling between the uncompensated spins at the surface and the spins in the core of the Cr 2 O 3 nanoparticles
Ferromagnetism in Cr-doped passivated AlN nanowires
Kanoun, Mohammed; Goumri-Said, Souraya; Schwingenschlö gl, Udo
2014-01-01
We apply first principles calculations to predict the effect of Cr doping on the electronic and magnetic properties of passivated AlN nanowires. We compare the energetics of the possible dopant sites and demonstrate the favorable configuration ferromagnetic ordering. The charge density of the pristine passivated AlN nanowires is used to elucidate the bonding character. Spin density maps demonstrate an induced spin polarization for N atoms next to dopant atoms, though most of the magnetism is carried by the Cr atoms. Cr-doped AlN nanowires turn out to be interesting for spintronic devices. © 2014 the Partner Organisations.
Effect of pre-oxidation on high temperature sulfidation behavior of FeCr and FeCrAl alloys
Directory of Open Access Journals (Sweden)
Pillis Marina Fuser
2004-01-01
Full Text Available High temperature corrosion of structural alloys in sulfur bearing environments is many orders of magnitude higher than in oxidizing environments. Efforts to increase sulfidation resistance of these alloys include addition of alloying elements. Aluminum additions to iron-chromium alloys bring about increase in sulfidation resistance. This paper reports the effect of pre-oxidation on the sulfidation behavior of Fe-20Cr and Fe-20Cr-5Al alloys in H2-2% H2S environment at 800 °C. The surfaces of sulfidized specimens were also examined. Pre-oxidation of the two alloys results in an incubation period during subsequent sulfidation. After this incubation period, the Fe-20Cr alloy showed sulfidation behavior similar to that when the alloy was not pre-oxidized. The incubation period during sulfidation of the Fe-20Cr-5Al alloy was significantly longer, over 45 h, compared to 2 h for the Al free alloy. Based on the microscopic and gravimetric data a mechanism for sulfidation of these alloys with pre-oxidation has been proposed.
Scott, Tannath J; Black, Cameron R; Quinn, John; Coutts, Aaron J
2013-01-01
The purpose of this study was to examine and compare the criterion validity and test-retest reliability of the CR10 and CR100 rating of perceived exertion (RPE) scales for team sport athletes that undertake high-intensity, intermittent exercise. Twenty-one male Australian football (AF) players (age: 19.0 ± 1.8 years, body mass: 83.92 ± 7.88 kg) participated the first part (part A) of this study, which examined the construct validity of the session-RPE (sRPE) method for quantifying training load in AF. Ten male athletes (age: 16.1 ± 0.5 years) participated in the second part of the study (part B), which compared the test-retest reliability of the CR10 and CR100 RPE scales. In part A, the validity of the sRPE method was assessed by examining the relationships between sRPE, and objective measures of internal (i.e., heart rate) and external training load (i.e., distance traveled), collected from AF training sessions. Part B of the study assessed the reliability of sRPE through examining the test-retest reliability of sRPE during 3 different intensities of controlled intermittent running (10, 11.5, and 13 km·h(-1)). Results from part A demonstrated strong correlations for CR10- and CR100-derived sRPE with measures of internal training load (Banisters TRIMP and Edwards TRIMP) (CR10: r = 0.83 and 0.83, and CR100: r = 0.80 and 0.81, p training load (distance, higher speed running and player load) for both the CR10 (r = 0.81, 0.71, and 0.83) and CR100 (r = 0.78, 0.69, and 0.80) were significant (p reliability for both the CR10 (31.9% CV) and CR100 (38.6% CV) RPE scales after short bouts of intermittent running. Collectively, these results suggest both CR10- and CR100-derived sRPE methods have good construct validity for assessing training load in AF. The poor levels of reliability revealed under field testing indicate that the sRPE method may not be sensible to detecting small changes in exercise intensity during brief intermittent running bouts. Despite this limitation
International Nuclear Information System (INIS)
Onishi, T K; Gelberg, A; Sakurai, H; Yoneda, K; Aoi, N; Imai, N; Baba, H; Brentano, P von; Fukuda, N; Ichikawa, Y; Ishihara, M; Iwasaki, H; Kameda, D; Kishida, T; Lisetskiy, A F; Ong, H J; Osada, M; Otsuka, T; Suzuki, M K; Ue, K; Utsuno, Y; Watanabe, H
2006-01-01
The Gamow-Teller transition of 46 Cr to the N = Z odd-odd nucleus 46 V has been observed for the first time. By means of β-γ coincidence measurements, a γ-ray peak at 993 keV corresponding to the decay of the 1 + 1 state in 46 V was observed. The branching ratio of the decay to this state was found to be b GT = 0.25 ± 0.050. The half-life of 46 Cr was measured to be T 1/2 = 240 ± 140 ms. The transition strength was determined to be B(GT) = 0.64 ± 0.20. This result was compared with theoretical calculations
Raj. Sai V.
2008-01-01
The isothermal oxidation kinetics of as-cast Cu-17%Cr and Cu-17%Cr-5%Al in air were studied between 773 and 1173 K under atmospheric pressure. These observations reveal that Cu- 17%Cr-5%Al oxidizes at significantly slower rates than Cu-17%Cr. The rate constants for the alloys were determined from generalized analyses of the data without an a priori assumption of the nature of the oxidation kinetics. Detailed analyses of the isothermal thermogravimetric weight change data revealed that Cu-17%Cr exhibited parabolic oxidation kinetics with an activation energy of 165.9 9.5 kJ mol-1. In contrast, the oxidation kinetics for the Cu-17%Cr- 5%Al alloy exhibited a parabolic oxidation kinetics during the initial stages followed by a quartic relationship in the later stages of oxidation. Alternatively, the oxidation behavior of Cu-17%CR- 5%Al could be better represented by a logarithmic relationship. The parabolic rate constants and activation energy data for the two alloys are compared with literature data to gain insights on the nature of the oxidation mechanisms dominant in these alloys.
Risk of severe ovarian hyperstimulation syndrome in GnRH antagonist versus GnRH agonist protocol
DEFF Research Database (Denmark)
Toftager, M.; Bogstad, J; Bryndorf, T
2016-01-01
interval (CI): 0.33-0.57) compared with the traditional GnRH agonist protocol. Previous trials comparing the two protocols mainly included selected patient populations, a limited number of patients and the applied OHSS criteria differed, making direct comparisons difficult. In two recent large meta...... IV, dual-centre, open-label, RCT including 1050 women allocated to either short GnRH antagonist or long GnRH agonist protocol in a 1:1 ratio and enrolled over a 5-year period using a web-based concealed randomization code. This is a superiority study designed to detect a difference in severe OHSS...... between the two arms. None of the women had undergone previous ART treatment. PARTICIPANTS/MATERIALS, SETTING, METHODS: All infertile women referred for their first IVF/ICSI at two public fertility clinics, less than 40 years of age and with no uterine malformations were asked to participate. A total...
Energy Technology Data Exchange (ETDEWEB)
Di Paolo, T.; Falardeau, P.
1987-08-31
The authors have investigated dopamine (DA) receptor agonist high- and low-affinity states in female rate estradiol-induced prolactin (PRL)-secreting pituitary tumors and intact pituitary tissue. Estradiol treatment increased the anterior pituitary weight 9-fold and plasma prolactin levels 74-fold and these measures are correlated (R = 0.745, n = 73, p < 0.001). Competition for (/sup 3/H)-spiperone binding to the DA receptor by apomorphine was compared in normal and adenomatous pituitary tissue. The inhibition constants (Ki) and the proportions of the two apomorphine sites are unchanged in tumors compared to intact pituitary tissue. Guanosine 5'-(..beta..-..gamma..-imino)triphosphate (Gpp(NH)p) causes complete conversion of the high into low affinity dopaminergic agonist site in normal pituitary and in tumors. These results suggest that rats with primary estradiol-induced pituitary tumors have normal and functional DA receptors. 9 references, 2 tables.
Generalized concentration addition: a method for examining mixtures containing partial agonists.
Howard, Gregory J; Webster, Thomas F
2009-08-07
Environmentally relevant toxic exposures often consist of simultaneous exposure to multiple agents. Methods to predict the expected outcome of such combinations are critical both to risk assessment and to an accurate judgment of whether combinations are synergistic or antagonistic. Concentration addition (CA) has commonly been used to assess the presence of synergy or antagonism in combinations of similarly acting chemicals, and to predict effects of combinations of such agents. CA has the advantage of clear graphical interpretation: Curves of constant joint effect (isoboles) must be negatively sloped straight lines if the mixture is concentration additive. However, CA cannot be directly used to assess combinations that include partial agonists, although such agents are of considerable interest. Here, we propose a natural extension of CA to a functional form that may be applied to mixtures including full agonists and partial agonists. This extended definition, for which we suggest the term "generalized concentration addition," encompasses linear isoboles with slopes of any sign. We apply this approach to the simple example of agents with dose-response relationships described by Hill functions with slope parameter n=1. The resulting isoboles are in all cases linear, with negative, zero and positive slopes. Using simple mechanistic models of ligand-receptor systems, we show that the same isobole pattern and joint effects are generated by modeled combinations of full and partial agonists. Special cases include combinations of two full agonists and a full agonist plus a competitive antagonist.
Homogeneous and Heterogeneous (Fex, Cr1-x)(OH)3 Precipitation: Implications for Cr Sequestration.
Dai, Chong; Zuo, Xiaobing; Cao, Bo; Hu, Yandi
2016-02-16
The formation of (Fe, Cr)(OH)3 nanoparticles determines the fate of aqueous Cr in many aquatic environments. Using small-angle X-ray scattering, precipitation rates of (Fe, Cr)(OH)3 nanoparticles in solution and on quartz were quantified from 0.1 mM Fe(III) solutions containing 0-0.25 mM Cr(III) at pH = 3.7 ± 0.2. Concentration ratio of aqueous Cr(III)/Fe(III) controlled the chemical composition (x) of (Fex, Cr1-x)(OH)3 precipitates, solutions' supersaturation with respect to precipitates, and the surface charge of quartz. Therefore, the aqueous Cr(III)/Fe(III) ratio affected homogeneous (in solution) and heterogeneous (on quartz) precipitation rates of (Fex, Cr1-x)(OH)3 through different mechanisms. The sequestration mechanisms of Cr(III) in precipitates were also investigated. In solutions with high aqueous Cr(III)/Fe(III) ratios, surface enrichment of Cr(III) on the precipitates occurred, resulting in slower particle growth in solutions. From solutions with 0-0.1 mM Cr(III), the particles on quartz grew from 2 to 4 nm within 1 h. Interestingly, from solution with 0.25 mM Cr(III), particles of two distinct sizes (2 and 6 nm) formed on quartz, and their sizes remained unchanged throughout the reaction. Our study provided new insights on homogeneous and heterogeneous precipitation of (Fex, Cr1-x)(OH)3 nanoparticles, which can help determine the fate of Cr in aquatic environments.
Effect of Si on DC arc plasma generation from Al-Cr and Al-Cr-Si cathodes used in oxygen
Zhirkov, I.; Landälv, L.; Göthelid, E.; Ahlgren, M.; Eklund, P.; Rosen, J.
2017-02-01
Al2O3 alloyed with Cr is an important material for the tooling industry. It can be synthesized from an arc discharge using Al-Cr cathodes in an oxygen atmosphere. Due to formation of Al-rich oxide islands on the cathode surface, the arc process stability is highly sensitive to oxygen pressure. For improved stability, the use of Al0.70Cr0.25Si0.05 cathodes has previously been suggested, where Si may reduce island formation. Here, we have investigated the effect of Si by comparing plasma generation and thin film deposition from Al0.7Cr0.3 and Al0.7Cr0.25Si0.05 cathodes. Plasma ion composition, ion energies, ion charge states, neutral species, droplet formation, and film composition have been characterized at different O2 flow rates for arc currents of 60 and 90 A. Si and related compounds are detected in plasma ions and in plasma neutrals. Scanning electron microscopy and energy dispersive X-ray analysis show that the cathode composition and the film composition are the same, with Si present in droplets as well. The effect of Si on the process stability, ion energies, and ion charge states is found to be negligible compared to that of the arc current. The latter is identified as the most relevant parameter for tuning the properties of the reactive discharge. The present work increases the fundamental understanding of plasma generation in a reactive atmosphere, and provides input for the choice of cathode composition and process parameters in reactive DC arc synthesis.
Optimization of CR-39 for fast neutron dosimetry applications
Vilela, E; Giacomelli, G; Giorgini, M; Morelli, B; Patrizii, L; Serra, P; Togo, V
1999-01-01
We present the results of an experimental work aimed at improving the performances of the CR-39[reg] (Registered Trademark of PPG Industries Inc.) nuclear track detector for neutron dosimetry applications. The work was done in collaboration with the Intercast Europe S.p.A., producer of CR-39 for commercial and scientific applications. We compare the CR-39 made with different additives concentrations and different polymerization processes. We evaluate the response of the CR-39 to fast neutrons from three sources: sup 2 sup 4 sup 1 Am-Be, sup 2 sup 5 sup 2 Cf and sup 2 sup 3 sup 8 Pu-Li. Particular attention was paid to background fluctuations that limit the lower detectable dose.
Directory of Open Access Journals (Sweden)
Marios Politis
2017-01-01
Full Text Available We aimed to investigate the integrity and clinical relevance of striatal dopamine receptor type-2 (D2R availability in Parkinson's disease (PD patients. We studied 68 PD patients, spanning from early to advanced disease stages, and 12 healthy controls. All participants received one [11C]raclopride PET scan in an OFF medication condition for quantification of striatal D2R availability in vivo. Parametric images of [11C]raclopride non-displaceable binding potential were generated from the dynamic [11C]raclopride scans using implementation of the simplified reference tissue model with cerebellum as the reference tissue. PET data were interrogated for correlations with clinical data related to disease burden and dopaminergic treatment. PD patients showed a mean 16.7% decrease in caudate D2R and a mean 3.5% increase in putaminal D2R availability compared to healthy controls. Lower caudate [11C]raclopride BPND correlated with longer PD duration. PD patients on dopamine agonist treatment had 9.2% reduced D2R availability in the caudate and 12.8% in the putamen compared to PD patients who never received treatment with dopamine agonists. Higher amounts of lifetime dopamine agonist therapy correlated with reduced D2Rs availability in both caudate and putamen. No associations between striatal D2R availability and levodopa treatment and dyskinesias were found. In advancing PD the caudate and putamen D2R availability are differentially affected. Chronic exposure to treatment with dopamine agonists, but no levodopa, suppresses striatal D2R availability, which may have relevance to output signaling to frontal lobes and the occurrence of executive deficits, but not dyskinesias.
Hot corrosion of Co-Cr, Co-Cr-Al, and Ni-Cr alloys in the temperature range of 700-750 deg C
Chiang, K. T.; Meier, G. H.
1980-01-01
The effect of SO3 pressure in the gas phase on the Na2SO4 induced hot corrosion of Co-Cr, Ni-Cr, and Co-Cr-Al alloys was studied in the temperature range 700 to 750 C. The degradation of the Co-Cr and Ni-Cr alloys was found to be associated with the formation of liquid mixed sulfates (CoSO4-Na2SO4 or NiSO4-Na2SO4) which provided a selective dissolution of the Co or Ni and a subsequent sulfidation oxidation mode of attack which prevented the maintenance of a protective Cr2O3 film. A clear mechanism was not developed for the degradation of Co-Cr-Al alloys. A pitting corrosion morphology was induced by a number of different mechanisms.
Electrochemical processes for the environmental remediation of toxic Cr(VI): A review
International Nuclear Information System (INIS)
Jin, Wei; Du, Hao; Zheng, Shili; Zhang, Yi
2016-01-01
Highlights: • Recent advances in electrochemical technologies for practical Cr(VI) treatment applications was reviewed. • The mechanism and performance of electrocoagulation, electrochemical reduction, electrodialysis, electro-electrodialysis and electrodeionization were discussed and compared. • The remained challenges and future perspectives were commented. - Abstract: Hexavalent chromium Cr(VI) is extremely toxic and classified as one of the 17 chemicals posing the greatest threat to humans. Large amounts of Cr(VI) compounds are directly or indirectly discharged into the environment, therefore considerable efforts have been made to control the Cr(VI) concentration below the recommended level. It has been demonstrated that electrochemical technique is one of the most efficient and environmental benign approach for the Cr(VI) removal. This review aims at recent advances in electrochemical technology for practical Cr(VI) treatment applications. By using the “clean reagent” of electron, Cr(VI) can be completely eliminated or separated via different electrochemical techniques such as electrocoagulation, electrochemical reduction, electrodialysis, electro-electrodialysis and electrodeionization. Besides, the mechanism and performance of different strategies are commented and compared. The treatment process is largely dependent on variables such as pH, electrode materials, cell configuration and techniques integration. Furthermore, the remained limitation and challenges for the electrochemical Cr(VI) remediation are also discussed.
The Good, the Bad, and the Ugly: Agonistic Behaviour in Juvenile Crocodilians
Brien, Matthew L.; Lang, Jeffrey W.; Webb, Grahame J.; Stevenson, Colin; Christian, Keith A.
2013-01-01
We examined agonistic behaviour in seven species of hatchling and juvenile crocodilians held in small groups (N = 4) under similar laboratory conditions. Agonistic interactions occurred in all seven species, typically involved two individuals, were short in duration (5-15 seconds), and occurred between 1600-2200 h in open water. The nature and extent of agonistic interactions, the behaviours displayed, and the level of conspecific tolerance varied among species. Discrete postures, non-contact...
Changes in heart rate associated with contest outcome in agonistic encounters in lobsters.
Hernáindez-Falcón, Jesús; Basu, Alo C; Govindasamy, Siddhartan; Kravitz, Edward A
2005-03-01
Agonistic contests between lobsters housed together in a confined space progress through encounters of increasing intensity until a dominance relationship is established. Once this relationship is established, losing animals continually retreat from the advances of winners. These encounters are likely to consume much energy in both winning and losing animals. Therefore, one might expect involvement of many physiological systems before, during and after fights. Here, we report effects of agonistic encounters on cardiac frequency in winning and losing adult lobsters involved in dyadic interactions. The results show that: (i) small but significant increases in heart rate are observed upon chemical detection of a conspecific; (ii) during agonistic interactions, further increases in heart rate are seen; and (iii) ultimate winners exhibit greater increases in heart rate lasting longer periods of time compared to ultimate losers. Heart rate in winners remains elevated for at least 15 min after the contests have ended and animals have been returned to their home tanks. Reduced effects are seen in second and third pairings between familiar opponents. The sustained changes in heart rate that we observe in winning lobsters may result from hormonal modulation of cardiac function related to the change in social status brought about by contest outcome.
Mechanical properties of irradiated 9Cr-2WVTa steel
International Nuclear Information System (INIS)
Klueh, R.L.; Alexander, D.J.; Rieth, M.
1998-01-01
An Fe-9Cr-2W-0.25V-0.07Ta-0.1C (9Cr-2WVTa) steel has excellent strength and impact toughness before and after irradiation in the Fast Flux Test Facility and the High Flux Reactor (HFR). The ductile-brittle transition temperature (DBTT) increased only 32 C after 28 dpa at 365 C in FFTF, compared to a shift of ∼60 C for a 9Cr-2WV steel--the same as the 9Cr-2WVTa steel but without tantalum. This difference occurred despite the two steels having similar tensile but without tantalum. This difference occurred despite the two steels having similar tensile properties before and after irradiation. The 9Cr-2WVTa steel has a smaller prior-austenite grain size, but otherwise microstructures are similar before irradiation and show similar changes during irradiation. The irradiation behavior of the 9Cr-2WVTa steel differs from the 9Cr-2WV steel and other similar steels in two ways: (1) the shift in DBTT of the 9Cr-2WVTa steel irradiated in FFTF does not saturate with fluence by ∼28 dpa, whereas for the 9Cr-2WV steel and most similar steels, saturation occurs at <10 dpa, and (2) the shift in DBTT for 9Cr-2WVTa steel irradiated in FFTF and HFR increased with irradiation temperature, whereas it decreased for the 9Cr-2WV steel, as it does for most similar steels. The improved properties of the 9Cr-2WVTa steel and the differences with other steels were attributed to tantalum in solution
A cosmic ALP background and the cluster soft X-ray excess in A665, A2199 and A2255
Energy Technology Data Exchange (ETDEWEB)
Powell, Andrew J., E-mail: Andrew.Powell2@physics.ox.ac.uk [Rudolf Peierls Centre for Theoretical Physics, University of Oxford, 1 Keble Road, Oxford, OX1 3NP (United Kingdom)
2015-09-01
It has been proposed that an excess in soft X-ray emission observed from many galaxy clusters can be explained by conversion into photons of axion-like particles (ALPs) in the cluster's magnetic field. Previously it has been shown that conversion of this primordially-generated background of relativistic ALPs—a cosmic ALP background (CAB)—can explain the observed soft X-ray excess in both the centre and the outskirts of the Coma cluster. Here we extend this work to the three clusters A665, A2199 and A2255. We use a stochastic, power law model of the cluster magnetic field to numerically calculate ALP-photon conversion probabilities to predict the CAB-generated soft X-ray flux in these clusters. The simulated magnetic fields include models with non-standard (i.e. not turbulent Kolmogorov) power spectra, the index of the spectrum changes from cluster to cluster and even within the cluster A2255. We compare this flux to ROSAT PSPC observations of the three clusters, and use these observations to constrain the CAB parameter space. Assuming these non-standard magnetic field power spectra are valid, we find the CAB can reproduce the magnitude of the observed excess in A2199 and A2255 for the same CAB parameters that match the observed soft excess in the Coma cluster. We also find good fit to the morphology of the excesses in these clusters. Simulation of CAB conversion in the cluster A665 is in mild tension with the other clusters due to producing a small but observable excess at large radii where none is observed. This tension is alleviated considering the uncertainty on predicting the count rate in the ROSAT detector, and on the systematics affecting the magnetic field determination. Overall we find good agreement between the CAB parameters for the four clusters studied so far.
A cosmic ALP background and the cluster soft X-ray excess in A665, A2199 and A2255
International Nuclear Information System (INIS)
Powell, Andrew J.
2015-01-01
It has been proposed that an excess in soft X-ray emission observed from many galaxy clusters can be explained by conversion into photons of axion-like particles (ALPs) in the cluster's magnetic field. Previously it has been shown that conversion of this primordially-generated background of relativistic ALPs—a cosmic ALP background (CAB)—can explain the observed soft X-ray excess in both the centre and the outskirts of the Coma cluster. Here we extend this work to the three clusters A665, A2199 and A2255. We use a stochastic, power law model of the cluster magnetic field to numerically calculate ALP-photon conversion probabilities to predict the CAB-generated soft X-ray flux in these clusters. The simulated magnetic fields include models with non-standard (i.e. not turbulent Kolmogorov) power spectra, the index of the spectrum changes from cluster to cluster and even within the cluster A2255. We compare this flux to ROSAT PSPC observations of the three clusters, and use these observations to constrain the CAB parameter space. Assuming these non-standard magnetic field power spectra are valid, we find the CAB can reproduce the magnitude of the observed excess in A2199 and A2255 for the same CAB parameters that match the observed soft excess in the Coma cluster. We also find good fit to the morphology of the excesses in these clusters. Simulation of CAB conversion in the cluster A665 is in mild tension with the other clusters due to producing a small but observable excess at large radii where none is observed. This tension is alleviated considering the uncertainty on predicting the count rate in the ROSAT detector, and on the systematics affecting the magnetic field determination. Overall we find good agreement between the CAB parameters for the four clusters studied so far
Long-acting beta 2-agonists in chronic obstructive pulmonary disease.
Llewellyn-Jones, Carol
2002-01-01
Until recently, the use of long-acting beta 2-agonists in chronic obstructive pulmonary disease has been understated. There is now evidence that they may offer benefits beyond bronchodilation. This article reviews the management of chronic obstructive pulmonary disease and looks at the place of long-acting beta 2-agonists as a first-line treatment option.
Non-Acidic Free Fatty Acid Receptor 4 Agonists with Antidiabetic Activity
DEFF Research Database (Denmark)
Goncalves de Azavedo, Carlos M. B. P.; Watterson, Kenneth R; Wargent, Ed T
2016-01-01
The free fatty acid receptor 4 (FFA4 or GPR120) has appeared as an interesting potential target for the treatment of metabolic disorders. At present, most FFA4 ligands are carboxylic acids that are assumed to mimic the endogenous long-chain fatty acid agonists. Here, we report preliminary structure......-activity relationship studies of a previously disclosed non-acidic sulfonamide FFA4 agonist. Mutagenesis studies indicate that the compounds are orthosteric agonists despite the absence of a carboxylate function. The preferred compounds showed full agonist activity on FFA4 and complete selectivity over FFA1, although...... a significant fraction of these non-carboxylic acids also showed partial antagonistic activity on FFA1. Studies in normal and diet-induced obese (DIO) mice with the preferred compound 34 showed improved glucose tolerance after oral dosing in an oral glucose tolerance test. Chronic dosing of 34 in DIO mice...
Chromium sorption and Cr(VI) reduction to Cr(III) by grape stalks and yohimbe bark.
Fiol, Núria; Escudero, Carlos; Villaescusa, Isabel
2008-07-01
In this work, two low cost sorbents, grape stalks and yohimbe bark wastes were used to remove Cr(VI) and Cr(III) from aqueous solutions. Batch experiments were designed to obtain Cr(VI) and Cr(III) sorption data. The mechanism of Cr(III) and Cr(VI) removal and Cr(VI) reduction to Cr(III) by the two vegetable wastes, has been investigated. Fourier transform infrared rays (FTIR) and X-ray photoelectron spectroscopy (XPS) analysis on solid phase were performed to determine the main functional groups that might be involved in metal uptake and to confirm the presence of Cr(III) on the sorbent, respectively. Results put into evidence that both sorbents are able to reduce Cr(VI) to its trivalent form.
Internal carbonitriding behavior of Ni-V, Ni-Cr, and Ni-3Nb alloys
International Nuclear Information System (INIS)
Allen, A.T.; Douglass, D.L.
1999-01-01
Ni-2V, Ni-5V, Ni-12V, Ni-10Cr, Ni-20Cr, and Ni-3Nb alloys were carbonitrided in C 3 H 6 and NH 3 gas mixtures (bal H 2 ) over the range 700--1,000 C. Carbonitridation of Ni-12V and Ni-20Cr in C 3 H 6 /NH 3 /H 2 (1.5/1.5/97 v/o) and (1.5/10/88.5 v/o) produced duplex subscales consisting of near-surface nitrides with underlying carbides. Growth of each zone obeyed the parabolic rate law under most conditions. The presence of carbon generally did not effect the depth of the nitride zones compared to nitriding the alloys in NH 3 /H 2 (10/90 v/o). However, at 700 C, the nitride zones were deeper in the carbonitrided Ni-V alloys and Ni-20Cr. The presence of nitrogen generally increased the depth of the carbide zones in Ni-12V and Ni-20Cr compared to carburizing these alloys in C 3 H 6 /H 2 (1.5/98.5 v/o). VN, CrN, and NbN formed in Ni-V, Ni-Cr, and Ni-Nb alloys, respectively, whereas the underlying carbide layers contained V 4 C 3 in Ni-12V, Cr 3 C 2 above a zone of Cr 7 C 3 in Ni-20Cr, and NbC in Ni-3Nb. The solubilities and diffusivities of nitrogen and carbon in nickel were determined. Nitrogen and carbon each exhibited retrograde solubility with temperature in pure Ni in both carbonitriding environments. Nitrogen diffusion in nickel was generally lower in each carbonitriding mixture compared to nitrogen diffusion in a nitriding environment, except at 700 C when nitrogen diffusion was higher. Carbon diffusion in nickel was generally higher in the carbonitriding environments compared to carbon diffusion in a carburizing environment
Setiyanto, Henry; Muhida, Rifki; Kishi, Tomoya; Rempillo, Ofelia; Rahman, Mahmudur; Dipojono, Hermawan Kresno; Di\\ {n}o, Wilson Agerico; Matsumoto, Shigeno; Kasai, Hideaki
2006-10-01
We investigate the chemical reaction between a Cr transition-metal atom and sodium diethyldithiocarbamate (NaDDC), a complexing agent used to detect and extract Cr in human blood samples. Using density-functional-theory-based calculations, we determine their stable structures of Cr(DDC)2ODDC and Cr(DDC)3 complexes and obtain their dissociation energies. We found dissociation energies of -10.66 and -3.24 eV for Cr(DDC)2ODDC and Cr(DDC)3 complexes, respectively. Hence, on the basis of dissociation energies, we have verified that the reaction of NaDDC with Cr produces Cr(DDC)2ODDC as a major product.
Investigation of preparation technique and tribological properties of CrN piston rings coatings
International Nuclear Information System (INIS)
Cai Zhihai; Zhang Ping; Zhao Junjun; Du Jun; Niu Qingyin
2009-01-01
By using multi-ion plating, CrN films were made on surface of piston rings to improve its tribological properties and service life. Effects of nitrogen content to prepare the film on hardness and phase structure were studied. The high-temperature tribological properties of Cr plating and CrN films were compared with CETR friction tester. The results show that nitrogen partial pressure significantly affects the mechanical properties of CrN films. With increasing N 2 partial pressure, preferential growth orientation of the film changed from Cr 2 N(211) to CrN(220) phase, leading to two hardness peaks corresponding to the Cr 2 N and CrN phases,respectively. Having higher high-temperature wear resistance and lower friction coefficient than Cr plating, the CrN films are suitable for piston rings under high temperature conditions. (authors)
Long-term Stability of 9- to 12 % Cr Steels
DEFF Research Database (Denmark)
Hald, John
2004-01-01
In the recent 25 years creep rupture strength of 9- to 12 %Cr steels for steam pipes and turbines has been doubled by development of new alloys. This development has formed a basis for improved efficiency of fossil fired steam power plants by introduction of advanced steam temperatures...... and pressures. Newly developed steam pipe steels are based on modifications of well-established steels like the X 20CrMoV12 1. Balanced addition of V, Nb and N to a 9Cr 1 Mo steel led to the Modified 9 Cr steel P 91. Addition of 1% W to a 9Cr 1 MoVNbN base composition led to steel E 911 and partial replacement...... of Mo with 1.8 % W combined with a slight amount of Boron led to steel P 92. The creep rupture strength of these new alloys are now secured with long-term tests up to 100,000 hours, which demonstrate improvements of 50% (P 91), 75 % (E 911) and 100 % (P 92) in strength compared to X 20CrMoV12 1....
Verpoest, Willem; De Vos, Anick; De Rycke, Martine; Parikh, Shruti; Staessen, Catherine; Tournaye, Herman; De Vos, Michel; Vloeberghs, Veerle; Blockeel, Christophe
2017-11-10
The use of GnRH analogue medication is essential in reproductive medicine to avoid premature ovulation by pituitary suppression for the duration of ovarian stimulation by gonadotrophins. The type of pituitary suppression by either GnRH agonist analogues versus GnRH antagonist analogues may result in different embryological hence clinical results. Preimplantation genetic diagnosis is a subtype of IVF in which embryos are created for genetic diagnosis of hereditary disorders in order to avoid genetically affected children. Embryological quality hence ovarian stimulation in preimplantation genetic diagnosis is crucial as genetic selection will reduce the number of available embryos to a fraction of the total. The aim of this study was to assess the efficiency of GnRH antagonist versus GnRH agonist treatment for pituitary suppression in ovarian stimulation for PGD, by proxy of number and quality of embryos at cleavage stage available for biopsy. We conducted a prospective randomised controlled trial comparing pituitary suppression by GnRH antagonist versus GnRH agonist in ovarian stimulation for PGD. The primary outcome measure was the number of embryos of sufficient quality for biopsy at cleavage stage. Secondary outcome parameters were the number of blastocysts available of top quality, and clinical pregnancy rate. There was no difference in number of oocytes retrieved, embryos at cleavage stage available for biopsy or embryo quality. The clinical pregnancy rate was higher in the GnRH agonist group; however the sample size was insufficient to allow conclusions. The use of GnRH agonist versus antagonist treatment does not result in differences in a number of oocytes, embryos or embryo quality in ovarian stimulation for preimplantation genetic diagnosis. Copyright© Bentham Science Publishers; For any queries, please email at epub@benthamscience.org.
In silico CrNF, a half-metallic ferromagnetic nitride–fluoride mimicking CrO2
International Nuclear Information System (INIS)
Matar, Samir F.
2014-01-01
Isoelectronic with CrO 2 , CrNF is proposed in silico based on rutile derived structures with DFT computations. The ground state structure defined from cohesive energies is of MgUO 4 -type, characterized by short covalent Cr–N and long ionic Cr–F distances. Like CrO 2 it is a half-metallic ferromagnet with M=2 μ B /FU integer magnetization with reduced band gap at minority spins. Major difference of magnetic response to pressure characterizes CrNF as a soft ferromagnet versus hard magnetic CrO 2 . The chemical bonding properties point to prevailing covalent Cr–N versus ionic Cr–F bonding. Different synthesis routes are examined. - Highlights: • DFT identification of CrNF is based on isoelectronicity and rutile derivatives. • Similarly to CrO 2 , CrNF is a half-metallic ferromagnet with reduced band gap. • Strong pressure dependence of magnetization of CrNF oppositely to CrO 2 . • Covalent Cr–N bonding prevails in spite of the presence of ionic Cr–F. • Cohesive energies favor the synthesis for which protocols are proposed
DEFF Research Database (Denmark)
Schwartz, Thue W; Holst, Birgitte
2007-01-01
Many small-molecule agonists also display allosteric properties. Such ago-allosteric modulators act as co-agonists, providing additive efficacy--instead of partial antagonism--and they can affect--and often improve--the potency of the endogenous agonist. Surprisingly, the apparent binding sites...... different binding modes. In another, dimeric, receptor scenario, the endogenous agonist binds to one protomer while the ago-allosteric modulator binds to the other, 'allosteric' protomer. It is suggested that testing for ago-allosteric properties should be an integral part of the agonist drug discovery...... process because a compound that acts with--rather than against--the endogenous agonist could be an optimal agonist drug....
The treatment of Parkinson's disease with dopamine agonists
Directory of Open Access Journals (Sweden)
Frank, Wilhelm
2008-06-01
Full Text Available Parkinson’s disease is a chronic degenerative organic disease with unknown causes. A disappearance of cells with melanin in the substantia nigra is considered as biological artefact of the disease, which causes a degenerative loss of neurons in the corpus striatum of mesencephalon. This structure produces also the transmitter substance dopamine. Due to this disappearance of cells dopamine is not produced in a sufficient quantity which is needed for movement of the body. The questions of this report are concerned the efficiency and safety of a treatment with dopamine agonists. Furthermore the cost-effectiveness is investigated as well as ethic questions. The goal is to give recommendation for the use of dopamine agonists to the German health system. A systematic literature search was done. The identified studies have different methodological quality and investigate different hypothesis and different outcome criteria. Therefore a qualitative method of information synthesis was chosen. Since the introduction of L-Dopa in the 1960´s it is considered as the most effective substance to reduce all the cardinal symptoms of Parkinson disease. This substance was improved in the course of time. Firstly some additional substances were given (decarbonxylase inhibitors, catechol-o-transferase inhibitors (COMT-inhibitors, monoaminoxydase-inhibitors (MAO-inhibitors and NMDA-antagonists (N-Methyl-d-aspartat-antagonists. In the practical therapy of Parkinson dopamine agonists play an important role, because they directly use the dopamine receptors. The monotherapy of Parkinson disease is basically possible and is used in early stages of the disease. Clinical practise has shown, that an add on therapy with dopamine agonists can led to a reduction of the dose of L-dopa and a reduction of following dyskinesia. The studies for effectiveness include studies for the initial therapy, monotherapy and add-on-therapy. Basically there is a good effectiveness of dopamine
Correlation of microstructure and fracture toughness of advanced 9Cr/CrMoV dissimilarly welded joint
Energy Technology Data Exchange (ETDEWEB)
Guo, Qian [Shanghai Key Laboratory of Materials Laser Processing and Modification, School of Materials Science and Engineering, Shanghai Jiao Tong University, Shanghai 200240 (China); Lu, Fenggui, E-mail: Lfg119@sjtu.edu.cn [Shanghai Key Laboratory of Materials Laser Processing and Modification, School of Materials Science and Engineering, Shanghai Jiao Tong University, Shanghai 200240 (China); Liu, Xia [Shanghai Turbine Plant of Shanghai Electric Power Generation Equipment Co. Ltd., Shanghai 200240 (China); Yang, Renjie [Shanghai Turbine Works Company, Shanghai 200240 (China); Cui, Haichao [Shanghai Key Laboratory of Materials Laser Processing and Modification, School of Materials Science and Engineering, Shanghai Jiao Tong University, Shanghai 200240 (China); Gao, Yulai, E-mail: ylgao@shu.edu.cn [State Key Laboratory of Advanced Special Steels, Shanghai University, Shanghai 200072 (China)
2015-06-25
In this paper, the fracture toughness and the related microstructure characteristics of dissimilarly welded joint manufactured by advanced 9Cr and CrMoV steels were systematically investigated. The dissimilarly welded joint was fabricated by narrow gap submerged arc welding (NG-SAW) applying multi-layer and multi-pass technique. Fracture toughness, as one of the most important property to assess the reliability of welded joint, was studied for different regions including CrMoV base metal (CrMoV-BM), heat affected zone (HAZ) of CrMoV side (CrMoV-HAZ), weld metal (WM), heat affected zone of 9Cr side (9Cr-HAZ) and 9Cr base metal (9Cr-BM). It was found that the fracture toughness of CrMoV-BM, CrMoV-HAZ and WM was better than that of 9Cr-HAZ and 9Cr-BM. In order to illustrate these results, the microstructure of the whole welded joint was observed by optical microscope (OM), scanning electron microscope (SEM) and transmission electron microscope (TEM) detailedly. It was found that the fine high-temperature tempered martensite and bainite in WM, CrMoV-BM and CrMoV-HAZ contribute to the higher fracture toughness, while lower fracture toughness for 9Cr-BM and HAZ was caused by coarse tempered lath-martensite. Furthermore, the fracture morphology showed that ductile fracture occurred in WM and CrMoV side, while brittle fracture appeared in BM and HAZ of 9Cr side.
Guo, Wenmin; Wu, Yuping; Zhang, Jianfeng; Hong, Sheng; Chen, Liyan; Qin, Yujiao
2015-06-01
The cyclic oxidation and sulfates-induced hot corrosion behaviors of a Ni-43Cr-0.3Ti arc-sprayed coating at 550-750 °C were characterized and compared in this study. In general, all the oxidation and hot corrosion kinetic curves of the coating followed a parabolic law, i.e., the weight of the specimens showed a rapid growth initially and then reached the gradual state. However, the initial stage of the hot corrosion process was approximately two times longer than that of the oxidation process, indicating a longer preparation time required for the formation of a protective scale in the former process. At 650 °C, the parabolic rate constant for the hot corrosion was 7.2 × 10-12 g2/(cm4·s), approximately 1.7 times higher than that for the oxidation at the same temperature. The lower parabolic rate constant for the oxidation was mainly attributed to the formation of a protective oxide scale on the surface of corroded specimens, which was composed of a mixture of NiO, Cr2O3, and NiCr2O4. However, as the liquid molten salts emerged during the hot corrosion, these protective oxides would be dissolved and the coating was corrupted acceleratedly.
Black, R Neil A; Ennis, Cieran N; Young, Ian S; Hunter, Steven J; Atkinson, A Brew; Bell, Patrick M
2014-01-01
Assess insulin sensitivity after treatment with a selective PPAR-alpha agonist compared to an HMG CoA reductase inhibitor in human subjects with type 2 diabetes mellitus. Thirteen subjects with Type 2 diabetes mellitus were studied in a double-blind crossover design with 4-week placebo run-in and washout and 12-week treatment periods, randomised to micronised fenofibrate 267 mg or atorvastatin 10mg daily followed by the alternate drug in the second period. Insulin resistance was measured using the isoglycaemic hyperinsulinaemic clamp method with isotope dilution. Weight, physical activity and other medications did not change. Total cholesterol (mean +/- standard error) was 4.60+/-0.21 versus 3.9+/-0.22 mmol/L after fenofibrate and atorvastatin respectively, p19 versus 1.95+/-0.23 mmol/L, p1.64+/-0.23 versus 1.84+/-0.26 mmol/L, pInsulin-stimulated whole-body glucose disposal (35.4+/-3.1 versus 33.2+/-3.0 μmol/kg/min) and nadir endogenous glucose production (6.2+/-1.4 versus 7.0+/-1.1 μmol/kg/min) revealed no significant differences in effects of the treatments. In human subjects with Type 2 diabetes mellitus there were characteristic differences in lipid profile changes but no difference in insulin sensitivity after treatment with micronised fenofibrate compared to atorvastatin. This study finds no evidence of increased insulin sensitivity using this selective PPAR-alpha agonist over a commonly used statin at these doses. Copyright © 2014 Elsevier Inc. All rights reserved.
Fundamental investigation of point defect interactions in FE-CR alloys
International Nuclear Information System (INIS)
Wirth, B.D.; Lee, H.J.; Wong, K.
2008-01-01
Full text of publication follows. Fe-Cr alloys are a leading candidate material for structural applications in Generation TV and fusion reactors, and there is a relatively large database on their irradiation performance. However, complete understanding of the response of Fe-Cr alloys to intermediate-to-high temperature irradiation, including the radiation induced segregation of Cr, requires knowledge of point defect and point defect cluster interactions with Cr solute atoms and impurities. We present results from a hierarchical multi-scale modelling approach of defect cluster behaviour in Fe-Cr alloys. The modelling includes ab initio electronic structure calculations performed using the VASP code with projector-augmented electron wave functions using PBE pseudo-potentials and a collinear treatment of magnetic spins, molecular dynamics using semi-empirical Finnic-Sinclair type potentials, and kinetic Monte Carlo simulations of coupled defect and Cr transport responsible for microstructural evolution. The modelling results are compared to experimental observations in both binary Fe-Cr and more complex ferritic-martensitic alloys, and provide a basis for understanding a dislocation loop evolution and the observations of Cr enrichment and depletion at grain boundaries in various irradiation experiments. (authors)
Dopamine agonist activity of EMD 23,448
International Nuclear Information System (INIS)
Martin, G.E.; Pettibone, D.J.
1985-01-01
EMD 23,448 was examined in tests of dopaminergic function and was found to be an atypical dopamine (DA) agonist. EMD 23,448 was a weak or inactive DA agonist when examined in tests of normal postsynaptic DA receptor function: production of stereotypy in the rat (ED 50 greater than sign 5.0 mg/kg.i.p.); production of emesis in beagles (minimum effective dose = 81μg/kg i.v.); and, enhanced locomotor activity of the mouse (no excitation in doses 3 H]-apomorphine binding to rat striatal membranes (Ki, 205 nM). On the other hand, this indolyl-3-butylamine did activate supersensitive postsynaptic DA receptors. Specifically, it elicited contralateral turning in rats with a unilateral 6-hydroxydopamine lesion of the substantia nigra (ED 50 value = 0.9 mg/kg) and did elicit stereotypy in rats given chronic daily haloperidol treatments. EMD 23,448 also exerted pharmacological effects in tests designed to measure activation of dopamine autoreceptors. It inhibited the γ-butyrolactone-induced increase in striatal dopa levels (ED 50 = 1 mg/kg i.p.) and produced a dose-related fall in the locomotor activity of the mouse. The results are discussed and contrasted with data derived for apomorphine and the putatively selective autoreceptor agonist (+-)-3-PPP. (Author)
Low-field spin dynamics of Cr7Ni and Cr7Ni-Cu -Cr 7Ni molecular rings as detected by μ SR
Sanna, S.; Arosio, P.; Bordonali, L.; Adelnia, F.; Mariani, M.; Garlatti, E.; Baines, C.; Amato, A.; Sabareesh, K. P. V.; Timco, G.; Winpenny, R. E. P.; Blundell, S. J.; Lascialfari, A.
2017-11-01
Muon spin rotation measurements were used to investigate the spin dynamics of heterometallic Cr7Ni and Cr7Ni -Cu-Cr7Ni molecular clusters. In Cr7Ni the magnetic ions are arranged in a quasiplanar ring and interact via an antiferromagnetic exchange coupling constant J , while Cr7Ni -Cu-Cr7Ni is composed of two Cr7Ni linked by a bridging moiety containing one Cu ion, that induces an inter-ring ferromagnetic interaction J'≪J . The longitudinal muon relaxation rate λ collected at low magnetic fields μ0H BPP)-like heuristic fitting model that takes into account of a distribution of electronic spin characteristic times for T >5 K, while the shoulder presented by Cr7Ni can be reproduced by a BPP function that incorporates a single electronic characteristic time theoretically predicted to dominate for T <5 K. The flattening of λ (T ) in Cr7Ni -Cu-Cr7Ni occurring at very low temperature can be tentatively attributed to field-dependent quantum effects and/or to an inelastic term in the spectral density of the electronic spin fluctuations.
Ring head recording on perpendicular media: Output spectra for CoCr and CoCr/NiFe media
Stubbs, D. P.; Whisler, J. W.; Moe, C. D.; Skorjanec, J.
1985-04-01
The recording density response for sputtered CoCr (thickness=0.5 μm) and CoCr/NiFe (t=0.25 μm/0.5 μm) as well as evaporated CoNi (t=0.12 μm) and Co surface-doped iron oxide particulate media has been measured by reading and writing with Mn-Zn ferrite heads (gap length=0.375 μm, track width=37 μm) in contact with the media. Measurements to 200 kfc/i (thousand flux changes per inch) show a gap null around 115 kfc/i. The data have been normalized by dividing out the head sensitivity to obtain the value of spacing plus transition width (d+a) for the various media. For the CoCr media this value varied from 0.075-0.088 μm; for CoNi, 0.100 μm, and for the particulate medium, 0.163 μm. In addition, testing with a larger gapped Mn-Zn ferrite head (g=2.43 μm) shows that the head fields are distorted by the soft magnetic underlayer in dual layer CoCr/NiFe samples when the gap length is large compared to the distance to the underlayer.
Analysis of CR1 Repeats in the Zebra Finch Genome
Directory of Open Access Journals (Sweden)
George E. Liu
2013-06-01
Full Text Available Most bird species have smaller genomes and fewer repeats than mammals. Chicken Repeat 1 (CR1 repeat is one of the most abundant families of repeats, ranging from ~133,000 to ~187,000 copies accounting for ~50 to ~80% of the interspersed repeats in the zebra finch and chicken genomes, respectively. CR1 repeats are believed to have arisen from the retrotransposition of a small number of master elements, which gave rise to multiple CR1 subfamilies in the chicken. In this study, we performed a global assessment of the divergence distributions, phylogenies, and consensus sequences of CR1 repeats in the zebra finch genome. We identified and validated 34 CR1 subfamilies and further analyzed the correlation between these subfamilies. We also discovered 4 novel lineage-specific CR1 subfamilies in the zebra finch when compared to the chicken genome. We built various evolutionary trees of these subfamilies and concluded that CR1 repeats may play an important role in reshaping the structure of bird genomes.
Cr(III) and Cr(VI) in leather and elicitation of eczema
DEFF Research Database (Denmark)
Hansen, Malene Barré; Menne, Torkil; Johansen, Jeanne Duus
2006-01-01
The aim of the present study was to investigate the relation between the content of Cr(VI) and soluble Cr(III) in leather and the ability of the leather to elicit eczema in chromium allergic patients. An array of chromium-tanned leather samples was analysed for the content of total Cr(VI) and sol...
International Nuclear Information System (INIS)
Gervash, A.; Mazul, I.; Yablokov, N.; Barabash, V.; Ganenko, A.
2000-01-01
Proposing beryllium as plasma facing armour this paper presents the recent results obtained in Russia in the frame of such activities. Last year testing of actively cooled mock-ups produced by fast brazing of Be onto Cu-alloy heat sink allows to consider mentioned Russian method as promising for both PH-copper like CuCrZr and DS-copper like GlidCop. Summarizing recent experimental results with their previous data authors attempt to comparatively investigate a behaviour of Be/CuCrZr and Be/GlidCop joints in ITER relevant conditions. Mechanical properties, brazing zone microstructure and thermal response were taken for comparison. The shear strength for both types of joints was found as 150-200 MPa and did not depend on testing temperature. The brazing zone morphology and microhardness are presented, the thermal fatigue behaviour of investigated joints is described. All main results as well as the nearest future plans are discussed. (orig.)
Functional human antibody CDR fusions as long-acting therapeutic endocrine agonists.
Liu, Tao; Zhang, Yong; Liu, Yan; Wang, Ying; Jia, Haiqun; Kang, Mingchao; Luo, Xiaozhou; Caballero, Dawna; Gonzalez, Jose; Sherwood, Lance; Nunez, Vanessa; Wang, Danling; Woods, Ashley; Schultz, Peter G; Wang, Feng
2015-02-03
On the basis of the 3D structure of a bovine antibody with a well-folded, ultralong complementarity-determining region (CDR), we have developed a versatile approach for generating human or humanized antibody agonists with excellent pharmacological properties. Using human growth hormone (hGH) and human leptin (hLeptin) as model proteins, we have demonstrated that functional human antibody CDR fusions can be efficiently engineered by grafting the native hormones into different CDRs of the humanized antibody Herceptin. The resulting Herceptin CDR fusion proteins were expressed in good yields in mammalian cells and retain comparable in vitro biological activity to the native hormones. Pharmacological studies in rodents indicated a 20- to 100-fold increase in plasma circulating half-life for these antibody agonists and significantly extended in vivo activities in the GH-deficient rat model and leptin-deficient obese mouse model for the hGH and hLeptin antibody fusions, respectively. These results illustrate the utility of antibody CDR fusions as a general and versatile strategy for generating long-acting protein therapeutics.
Nanometre-scale 3D defects in Cr2AlC thin films.
Chen, Y T; Music, D; Shang, L; Mayer, J; Schneider, J M
2017-04-20
MAX-phase Cr 2 AlC containing thin films were synthesized by magnetron sputtering in an industrial system. Nanometre-scale 3D defects are observed near the boundary between regions of Cr 2 AlC and of the disordered solid solution (CrAl) x C y . Shrinkage of the Cr-Cr interplanar distance and elongation of the Cr-Al distance in the vicinity of the defects are detected using transmission electron microscopy. The here observed deformation surrounding the defects was described using density functional theory by comparing the DOS of bulk Cr 2 AlC with the DOS of a strained and unstrained Cr 2 AlC(0001) surface. From the partial density of states analysis, it can be learned that Cr-C bonds are stronger than Cr-Al bonds in bulk Cr 2 AlC. Upon Cr 2 AlC(0001) surface formation, both bonds are weakened. While the Cr-C bonds recover their bulk strength as Cr 2 AlC(0001) is strained, the Cr-Al bonds experience only a partial recovery, still being weaker than their bulk counterparts. Hence, the strain induced bond strengthening in Cr 2 AlC(0001) is larger for Cr d - C p bonds than for Cr d - Al p bonds. The here observed changes in bonding due to the formation of a strained surface are consistent with the experimentally observed elongation of the Cr-Al distance in the vicinity of nm-scale 3D defects in Cr 2 AlC thin films.
How does agonistic behaviour differ in albino and pigmented fish?
Directory of Open Access Journals (Sweden)
Ondřej Slavík
2016-04-01
Full Text Available In addition to hypopigmentation of the skin and red iris colouration, albino animals also display distinct physiological and behavioural alterations. However, information on the social interactions of albino animals is rare and has mostly been limited to specially bred strains of albino rodents and animals from unique environments in caves. Differentiating between the effects of albinism and domestication on behaviour in rodents can be difficult, and social behaviour in cave fish changes according to species-specific adaptations to conditions of permanent darkness. The agonistic behaviours of albino offspring of pigmented parents have yet to be described. In this study, we observed agonistic behaviour in albino and pigmented juvenile Silurus glanis catfish. We found that the total number of aggressive interactions was lower in albinos than in pigmented catfish. The distance between conspecifics was also analysed, and albinos showed a tendency towards greater separation from their same-coloured conspecifics compared with pigmented catfish. These results demonstrate that albinism can be associated with lower aggressiveness and with reduced shoaling behaviour preference, as demonstrated by a tendency towards greater separation of albinos from conspecifics.
Sandbaumhüter, Friederike A; Theurillat, Regula; Bettschart-Wolfensberger, Regula; Thormann, Wolfgang
2017-08-01
The combination of ketamine and an α 2 -receptor agonist is often used in veterinary medicine. Four different α 2 -receptor agonists, medetomidine, detomidine, xylazine, and romifidine, which differ in their chemical structure and thus in selectivity for the α 2 -receptor and in the sedative and analgesic potency, are typically employed during surgery of equines. Recovery following anesthesia with ketamine and an α 2 -receptor agonist is dependent on the α 2 -receptor agonist. This prompted us to investigate (i) the inhibition characteristics for the N-demethylation of ketamine to norketamine and (ii) the formation of the ketamine metabolites norketamine, 6-hydroxynorketamine (6HNK), and 5,6-dehydronorketamine (DHNK) in presence of the four α 2 -receptor agonists and equine liver microsomes. Samples were analyzed with enantioselective capillary electrophoresis using highly sulfated γ-cyclodextrin as chiral selector. All four α 2 -receptor agonists have an impact on the ketamine metabolism. Medetomidine was found to be the strongest inhibitor, followed by detomidine, whereas xylazine and romifidine showed almost no effect on the ketamine N-demethylation in the inhibition studies with a short-incubation period of the reaction mixture. After prolonged incubation, inhibition with xylazine and romifidine was also observed. The formation of 6HNK and DHNK is affected by all selected α 2 -receptor agonists. With medetomidine, levels of these metabolites are reduced compared to the case without an α 2 -receptor agonist. For detomidine, xylazine, and romifidine, the opposite was found. © 2017 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.
Sulfidation behavior of Fe20Cr alloys
International Nuclear Information System (INIS)
Pillis, Marina Fuser
2001-01-01
Alloys for use in high temperature environments rely on the formation of an oxide layer for their protection. Normally, these protective oxides are Cr 2 O 3 , Al 2 O 3 and, some times, SiO 2 . Many industrial gaseous environments contain sulfur. Sulfides, formed in the presence of sulfur are thermodynamically less stable, have lower melting points and deviate much more stoichiometrically, compared to the corresponding oxides. The mechanism of sulfidation of various metals is as yet not clear, in spite of the concerted efforts during the last decade. To help address this situation, the sulfidation behavior of Fe20Cr has been studied as a function of compositional modifications and surface state of the alloy. The alloys Fe20Cr, Fe20Cr0.7Y, Fe20Cr5Al and Fe20Cr5Al0.6Y were prepared and three sets of sulfidation tests were carried out. In the first set, the alloys were sulfidized at 700 deg C and 800 deg C for 10h. In the second set, the alloys were pre-oxidized at 1000 deg C and then sulfidized at 800 deg C for up to 45h. In the third set of tests, the initial stages of sulfidation of the alloys was studied. All the tests were carried out in a thermobalance, in flowing H 2 /2%H 2 S, and the sulfidation behavior determined as mass change per unit area. Scanning electron microscopy coupled to energy dispersive spectroscopy and X-ray diffraction analysis were used to characterize the reaction products. The addition of Y and Al increased sulfidation resistance of Fe20Cr. The addition of Y altered the species that diffused predominantly during sulfide growth. It changed from predominant cationic diffusion to predominant anionic diffusion. The addition of Al caused an even greater increase in sulfidation resistance of Fe20Cr, with the parabolic rate constant decreasing by three orders of magnitude. Y addition to the FeCrAl alloy did not cause any appreciable alteration in sulfidation resistance. Pre-oxidation of the FeCrAl and FeCrAlY alloys resulted in an extended
Analysis of CrIS ATMS and AIRS AMSU Data Using Scientifically Equivalent Retrieval Algorithms
Susskind, Joel; Kouvaris, Louis; Iredell, Lena; Blaisdell, John
2016-01-01
Monthly mean August 2014 Version-6.28 AIRS and CrIS products agree well with OMPS and CERES, and reasonably well with each other. Version-6.28 CrIS total precipitable water is biased dry compared to AIRS. AIRS and CrIS Version-6.36 water vapor products are both improved compared to Version-6.28. Version-6.36 AIRS and CrIS total precipitable water also shows improved agreement with each other. AIRS Version-6.36 total ozone agrees even better with OMPS than does AIRS Version-6.28, and gives reasonable results during polar winter where OMPS does not generate products. CrIS and ATMS are high spectral resolution IR and Microwave atmospheric sounders currently flying on the SNPP satellite, and are also scheduled for flight on future NPOESS satellites. CrIS/ATMS have similar sounding capabilities to those of the AIRS/AMSU sounder suite flying on EOS Aqua. The objective of this research is to develop and implement scientifically equivalent AIRS/AMSU and CrIS/ATMS retrieval algorithms with the goal of generating a continuous data record of AIRS/AMSU and CrIS/ATMS level-3 data products with a seamless transition between them in time. To achieve this, monthly mean AIRS/AMSU and CrIS/ATMS retrieved products, and more importantly their interannual differences, should show excellent agreement with each other. The currently operational AIRS Science Team Version-6 retrieval algorithm has generated 14 years of level-3 data products. A scientifically improved AIRS Version-7 retrieval algorithm is expected to become operational in 2017. We see significant improvements in water vapor and ozone in Version-7 retrieval methodology compared to Version-6.We are working toward finalization and implementation of scientifically equivalent AIRS/AMSU and CrIS/ATMS Version-7 retrieval algorithms to be used for the eventual processing of all AIRS/AMSU and CrIS/ATMS data. The latest version of our retrieval algorithm is Verison-6.36, which includes almost all the improvements we want in Version-7
DEFF Research Database (Denmark)
Sparre-Ulrich, A H; Hansen, Lærke Smidt; Svendsen, B
2016-01-01
effect in murine studies. We conducted a pharmacological analysis of this ligand including interspecies differences between the rodent and human GIP system. EXPERIMENTAL APPROACH: Transiently transfected COS-7 cells were assessed for cAMP accumulation upon ligand stimulation and assayed in competition...... level. Thus, in rodent models human GIP is a comparatively weak partial agonist. Human (Pro3)GIP is not an effective antagonist, so there is still a need for an effective antagonist for the elucidation of GIP's physiology....
Susskind, Joel; Kouvaris, Louis; Iredell, Lena
2016-01-01
The AIRS Science Team Version 6 retrieval algorithm is currently producing high quality level-3 Climate Data Records (CDRs) from AIRSAMSU which are critical for understanding climate processes. The AIRS Science Team is finalizing an improved Version-7 retrieval algorithm to reprocess all old and future AIRS data. AIRS CDRs should eventually cover the period September 2002 through at least 2020. CrISATMS is the only scheduled follow on to AIRSAMSU. The objective of this research is to prepare for generation of a long term CrISATMS level-3 data using a finalized retrieval algorithm that is scientifically equivalent to AIRSAMSU Version-7.
Wang, Hao; Eyert, Volker; Schwingenschlö gl, Udo
2011-01-01
for CrBr3 as well as CrI3. The antiferromagnetic state of CrCl3 can be reproduced by introducing an on-site electron-electron repulsion. However, we observe that the ground state depends critically on the specific approach used. Our results show that a
Mathematical models applied to the Cr(III) and Cr(VI) breakthrough curves.
Ramirez C, Margarita; Pereira da Silva, Mônica; Ferreira L, Selma G; Vasco E, Oscar
2007-07-19
Trivalent and hexavalent chromium continuous biosorption was studied using residual brewer Saccharomyces cerevisiae immobilized in volcanic rock. The columns used in the process had a diameter of 4.5 cm and a length of 140 cm, working at an inlet flow rate of 15 mL/min. Breakthrough curves were used to study the yeast biosorption behavior in the process. The saturation time (ts) was 21 and 45 h for Cr(III) and Cr(VI), respectively, and a breakthrough time (tb) of 4 h for Cr(III) and 5 h for Cr(VI). The uptake capacity of the biosorbent for Cr(III) and Cr(VI) were 48 and 60 mg/g, respectively. Two non-diffusional mathematical models with parameters t0 and sigma were used to adjust the experimental data obtained. Microsoft Excel tools were used for the mathematical solution of the two parameters used.
Structure and wear behavior of AlCrSiN-based coatings
Energy Technology Data Exchange (ETDEWEB)
Chen, Yun [School of Mechanical Engineering, Shanghai Jiao Tong University, Shanghai 200240 (China); Chengdu Tool Research Institute Co., Ltd., Chengdu 610500 (China); Du, Hao [School of Manufacturing Science and Engineering, Sichuan University, Chengdu 610065 (China); Chen, Ming, E-mail: mchen@sjtu.edu.cn [School of Mechanical Engineering, Shanghai Jiao Tong University, Shanghai 200240 (China); Yang, Jun [Chengdu Tool Research Institute Co., Ltd., Chengdu 610500 (China); Xiong, Ji [School of Manufacturing Science and Engineering, Sichuan University, Chengdu 610065 (China); Zhao, Haibo [The Analysis and Testing Centre, Sichuan University, Chengdu 610065 (China)
2016-05-01
Graphical abstract: - Highlights: • AlCrSiN based coating showed amorphous structure. • AlCrSiN/Me{sub x}N coatings obtained better wear resistance. • Molybdenum and niobium increased the coating hardness and wear resistance. - Abstract: AlCrN, AlCrSiCN, AlCrSiN/MoN, and AlCrSiN/NbN coatings have been deposited on high-polished WC–Co cemented carbide substrate and tools by mid-frequency magnetron sputtering in Ar/N{sub 2} mixtures. Al{sub 0.6}Cr{sub 0.4}, Al{sub 0.6}Cr{sub 0.3}Si{sub 0.1}, and C/Mo/Nb targets were used during the deposition. The microstructure and mechanical properties of as-deposited coatings were investigated. Investigations of the wear behaviors of coated tools were also performed. The results showed that cubic structure was formed in the coatings. Broader CrAlN (1 1 1) and (2 0 0) peaks without SiN{sub x} peak were formed in the AlCrSiN/Me{sub x}N coatings, which showed a nanocomposited structure. Meanwhile, according to SEM micrographs, AlCrN exhibited a columnar structure, while, AlCrSiCN, AlCrSiN/MoN, and AlCrSiN/NbN coatings showed nanocrystalline morphology. The nano-multilayered coatings performed higher hardness, H/E, and H{sup 3}/E{sup 2} ratios compared with AlCrN coating. Through the Rockwell adhesion test, all the coatings exhibited adhesion strength quality HF1. After turning Inconel 718 under dry condition, the nano-multilyered coatings showed better wear resistance than AlCrN coating. Due to the molybdenum and niobium in the coating, AlCrSiN/MoN and AlCrSiN/NbN coatings showed the best wear resistance.
Scaffold-based pan-agonist design for the PPARα, PPARβ and PPARγ receptors.
Directory of Open Access Journals (Sweden)
Li-Song Zhang
Full Text Available As important members of nuclear receptor superfamily, Peroxisome proliferator-activated receptors (PPAR play essential roles in regulating cellular differentiation, development, metabolism, and tumorigenesis of higher organisms. The PPAR receptors have 3 identified subtypes: PPARα, PPARβ and PPARγ, all of which have been treated as attractive targets for developing drugs to treat type 2 diabetes. Due to the undesirable side-effects, many PPAR agonists including PPARα/γ and PPARβ/γ dual agonists are stopped by US FDA in the clinical trials. An alternative strategy is to design novel pan-agonist that can simultaneously activate PPARα, PPARβ and PPARγ. Under such an idea, in the current study we adopted the core hopping algorithm and glide docking procedure to generate 7 novel compounds based on a typical PPAR pan-agonist LY465608. It was observed by the docking procedures and molecular dynamics simulations that the compounds generated by the core hopping and glide docking not only possessed the similar functions as the original LY465608 compound to activate PPARα, PPARβ and PPARγ receptors, but also had more favorable conformation for binding to the PPAR receptors. The additional absorption, distribution, metabolism and excretion (ADME predictions showed that the 7 compounds (especially Cpd#1 hold high potential to be novel lead compounds for the PPAR pan-agonist. Our findings can provide a new strategy or useful insights for designing the effective pan-agonists against the type 2 diabetes.
The good, the bad, and the ugly: agonistic behaviour in juvenile crocodilians.
Directory of Open Access Journals (Sweden)
Matthew L Brien
Full Text Available We examined agonistic behaviour in seven species of hatchling and juvenile crocodilians held in small groups (N = 4 under similar laboratory conditions. Agonistic interactions occurred in all seven species, typically involved two individuals, were short in duration (5-15 seconds, and occurred between 1600-2200 h in open water. The nature and extent of agonistic interactions, the behaviours displayed, and the level of conspecific tolerance varied among species. Discrete postures, non-contact and contact movements are described. Three of these were species-specific: push downs by C. johnstoni; inflated tail sweeping by C. novaeguineae; and, side head striking combined with tail wagging by C. porosus. The two long-snouted species (C. johnstoni and G. gangeticus avoided contact involving the head and often raised the head up out of the way during agonistic interactions. Several behaviours not associated with aggression are also described, including snout rubbing, raising the head up high while at rest, and the use of vocalizations. The two most aggressive species (C. porosus, C. novaeguineae appeared to form dominance hierarchies, whereas the less aggressive species did not. Interspecific differences in agonistic behaviour may reflect evolutionary divergence associated with morphology, ecology, general life history and responses to interspecific conflict in areas where multiple species have co-existed. Understanding species-specific traits in agonistic behaviour and social tolerance has implications for the controlled raising of different species of hatchlings for conservation, management or production purposes.
Glucagon-like peptide-1 receptor agonists for the treatment of type 2 diabetes
DEFF Research Database (Denmark)
Lund, Asger; Knop, Filip K; Vilsbøll, Tina
2014-01-01
Glucagon-like peptide-1 (GLP-1) is a gastrointestinal hormone, secreted in response to ingestion of nutrients, and has important effects on several of the pathophysiological features of type 2 diabetes (T2D). The effects include potentiation of insulin secretion, suppression of glucagon secretion...... effects. This review gives an overview of the clinical data on GLP-1R agonists that have been compared in head-to-head studies and focuses on relevant differences between the compounds. Highlighting these similarities and differences could be beneficial for physicians in choosing the best treatment......, slowing of gastric emptying and suppression of appetite. In circulation, GLP-1 has a half-life of approximately 2min due to rapid degradation by the enzyme dipeptidyl peptidase 4 (DPP-4). Because of this short half-life GLP-1 receptor (GLP-1R) agonists, resistant to degradation by DPP-4 have been...
Auyeung, M; Tsoi, T H; Tang, W K; Cheung, C M; Lee, C N; Li, R; Yeung, Eric
2011-09-01
We studied the prevalence and related risk factors of impulse control disorders in Chinese Parkinson's disease patients. We screened all non-demented Parkinson's disease patients attending our Parkinson's disease clinic from August 2009 to March 2010. The clinical characteristics of patients with impulse control disorders and those without were compared. Of the 213 PD subjects screened, 15 (7.0%) with impulse control disorders were identified. Fourteen of these subjects were on both a dopamine agonist and Levodopa, and one was on Levodopa alone. Of the fourteen subjects on both a dopamine agonist and Levodopa, eleven were on bromocriptine and Levodopa; 10.5% of the subjects exposed to bromocriptine had impulse control disorder. Upon multivariate analysis, dose of dopamine agonist used, young age at onset of Parkinson's disease and a history of anxiety or depression were independent predictors for developing impulse control disorders. 7% of our Chinese PD subjects had impulse control disorders. When young Parkinson's disease patients with a history of anxiety or depression are treated with high dose of DA, they are at risk of developing impulse control disorders. Copyright © 2011 Elsevier Ltd. All rights reserved.
The Effects of Cr and Al Addition on Transformation and Properties in Low‐Carbon Bainitic Steels
Junyu Tian; Guang Xu; Mingxing Zhou; Haijiang Hu; Xiangliang Wan
2017-01-01
Three low‐carbon bainitic steels were designed to investigate the effects of Cr and Al addition on bainitic transformation, microstructures, and properties by metallographic method and dilatometry. The results show that compared with the base steel without Cr and Al addition, only Cr addition is effective for improving the strength of low‐carbon bainitic steel by increasing the amount of bainite. However, compared with the base steel, combined addition of Cr and Al has no significant effect o...
Structure and biological activity of endogenous and synthetic agonists of GPR119
Tyurenkov, I. N.; Ozerov, A. A.; Kurkin, D. V.; Logvinova, E. O.; Bakulin, D. A.; Volotova, E. V.; Borodin, D. D.
2018-02-01
A G-protein-coupled receptor, GPR119, is a promising pharmacological target for a new class of hypoglycaemic drugs with an original mechanism of action, namely, increase in the glucose-dependent incretin and insulin secretion. In 2005, the first ligands were found and in the subsequent years, a large number of GPR119 agonists were synthesized in laboratories in various countries; the safest and most promising agonists have entered phase I and II clinical trials as agents for the treatment of type 2 diabetes mellitus and obesity. The review describes the major endogenous GPR119 agonists and the main trends in the design and modification of synthetic structures for increasing the hypoglycaemic activity. The data on synthetic agonists are arranged according to the type of the central core of the molecules. The bibliography includes 104 references.
Spin magnetic moments from single atoms to small Cr clusters
Energy Technology Data Exchange (ETDEWEB)
Boeglin, C.; Decker, R.; Bulou, H.; Scheurer, F.; Chado, I. [IPCMS-GSI - UMR 7504, 67037 Strasbourg Cedex (France); Ohresser, P. [LURE, 91405 Orsay (France); Dhesi, S.S. [ESRF, BP 220, 38043 Grenoble Cedex (France); Present permanent address: Diamond Light Source, Chilton, Didcot OX11 0QX (United Kingdom); Gaudry, E. [LMCP, 4, place Jussieu, 75252 Paris (France); Lazarovits, B. [CCMS, T.U. Vienna, Gumpendorfstr. 1a, 1060 Wien (Austria)
2005-07-01
Morphology studies at the first stages of the growth of Cr/Au(111) are reported and compared to the magnetic properties of the nanostructures. We analyze by Scanning Tunneling Microscopy and Low Energy Electron Diffraction the Cr clusters growth between 200 K and 300 K. In the early stages of the growth the morphology of the clusters shows monoatomic high islands located at the kinks of the herringbone reconstructed Au(111) surface. By X-ray Magnetic Circular Dichroism performed on the Cr L{sub 2,3} edges it is shown that the temperature dependent morphology strongly influences the magnetic properties of the Cr clusters. We show that in the sub-monolayer regime Cr clusters are antiferromagnetic and paramagnetic when the size reaches the atomic limit. (copyright 2005 WILEY-VCH Verlag GmbH and Co. KGaA, Weinheim) (orig.)
51Cr-ethylenediaminetetraacetic acid absorption test
International Nuclear Information System (INIS)
Aabakken, L.
1989-01-01
The 51 Cr-ethylenediaminetetraacetic acid (EDTA) absorption test was evaluated in 83 healthy, male volunteers. Base-line 24 h excretion after peroral administration ranged from 0.88% to 7.96%, with a higher median absorption than reported by most authors (2.45%). However, the reproducibility and stability of the method and the reproducibility of the results were satisfactory. Urinary excretion after intraduodenal installation (n=18) was comparable to that seen after peroral test dose administration, indicating a limited significance of gastric 51 Cr-EDTA absorption under normal conditions. In 16 subjects a single intake of alcohol immediately before the test gave a modest and short-lasting increase in 51 Cr-EDTA absorption. No correlation was seen to body mass index, creatinine clearance, urinary volume, or small-bowel transit time, possibly reducing the number of confounding factors in the evaluation of absorption data. A small but significant negative correlation was, however, found to body surface area and age
Do Agonistic Motives Matter More Than Anger? Three Studies of Cardiovascular Risk in Adolescents
Ewart, Craig K.; Elder, Gavin J.; Smyth, Joshua M.; Sliwinski, Martin J.; Jorgensen, Randall S.
2011-01-01
Objective Three motivational profiles have been associated with recurring psychological stress in low-income youth and young adults: Striving to control others (agonistic striving), striving to control the self (transcendence striving), and not asserting control (dissipated striving); Agonistic Striving has been associated with elevated ambulatory blood pressure during daily activities. Three studies tested the hypotheses that: (1) Agonistic Striving is associated with poor anger regulation, and (2) Agonistic Striving and poor anger regulation interactively elevate blood pressure. Design Motivational profiles, anger regulation, and ambulatory blood pressure were assessed in a multiethnic sample of 264 urban youth. Main outcome measures (1) Anger regulation/recovery during laboratory challenge; (2) anger / blood pressure during daily activities (48 hours). Results and conclusion Replication of the profiles in distant cities showed they occur with similar frequency across differences of region, race, and gender. Analyses controlling for body size, race, and gender revealed that individuals with the Agonistic Striving profile had higher ambulatory pressure, especially during social encounters. They became more openly angry and aggressive when challenged, but did not exhibit difficulty regulating anger in the laboratory, nor did they feel more angry during monitoring. However, individuals with the Agonistic Striving profile who did display poor anger regulation in the lab had the highest blood pressure; deficient self-regulatory capability amplified the positive association between Agonistic Striving and cardiovascular risk in both genders and all ethnic groups. Although anger is thought to increase cardiovascular risk, present findings suggest that anger and elevated blood pressure are co-effects of agonistic struggles to control others. PMID:21534673
A mechanical and tribological study of Cr/CrN multilayer coatings
Energy Technology Data Exchange (ETDEWEB)
Arias, D.F., E-mail: diegomas@gmail.com [Grupo GEMA, Universidad Católica de Pereira, Pereira (Colombia); Gómez, A. [Laboratório de Fenômenos de Superficie, Escola Politécnica, Universidade de Sao Paulo, Sao Paulo (Brazil); Pontificia Universidad Javeriana Cali (Colombia); Vélez, J.M. [Escuela de Ingeniería de Materiales, Universidad Nacional de Colombia Sede Medellín (Colombia); Souza, R.M. [Laboratório de Fenômenos de Superficie, Escola Politécnica, Universidade de Sao Paulo, Sao Paulo (Brazil); Olaya, J.J. [Departamento de Ingeniería Mecánica y Mecatrónica, Universidad Nacional de Colombia, Bogotá (Colombia)
2015-06-15
Multilayer Cr/CrN coatings with different periodicities were grown on silicon substrates by means of a magnetron sputtering technique. Thin films with only Cr or CrN were also grown, in order to use them as reference samples. Structural, morphological, mechanical and tribological characterization were carried out by using X-ray diffraction (XRD), atomic force microscopy (AFM), nanohardness and nanoscratch techniques, respectively. The characterization results were analyzed as a function of the bilayer thickness (period). In general, the multilayer hardness value increased with the decrease in period. In addition, the validity of the Hall-Petch relationship was confirmed for grain sizes and period values greater than 146 nm and 333 nm, respectively. The coefficient of friction (COF) increased with increasing load, which indicates the contribution of the adhesion to the COF. - Highlights: • Multilayer Cr/CrN coatings with layer thickness between 200 and 1000 nm were grown. • Neither bias voltage not temperature were applied during deposition. • The hardness improves with the increase of the number of bilayers. • The wear rate decreases with the increase of the number of bilayers.
Species dependent radiotracer study of Cr(VI) and Cr(III) using an aqueous biphasic system
Energy Technology Data Exchange (ETDEWEB)
Roy, K.; Lahiri, S. [Chemical Sciences Div., Saha Inst. of Nuclear Physics, Kolkata (India)
2008-07-01
The speciation study of Cr(III) and Cr(VI) was carried out using a polyethylene glycol (PEG) based aqueous biphasic extraction system (ABS). Neutron activated Cr(III) and Cr(VI) salts were assayed in a HPGe detector before and after employing aqueous biphasic extraction. Different salts of various salting out abilities were taken as the salt rich phase. The best condition for extraction of Cr(VI) and the maximum differential attitude of ABS to Cr(VI) and Cr(III) was observed when 2 M Na{sub 2}SO{sub 4} and PEG 4000 (50% w/w) solutions were used. Cr(III) can also be extracted by the PEG with prior complexation with diphenylthiocarbazone (dithizone). The chromium dithizonate complex is quantitatively extracted by the PEG rich phase. (orig.)
Migration of Cr-vacancy clusters and interstitial Cr in α-Fe using the dimer method
International Nuclear Information System (INIS)
Chen, D.; Gao, F.; Hu, S. Y.; Sun, X.; Heinisch, H. L.; Henager, C. H.; Khaleel, M. A.; Hu, W. Y.; Terentyev, D.
2010-01-01
The migration mechanisms and the corresponding activation energies of Cr-vacancy (Cr-V) clusters and Cr interstitials in α-Fe have been investigated using the dimer and the nudged elastic-band methods. Dimer searches are employed to find the possible transition states of these defects and the lowest-energy paths are used to determine the energy barriers for migration. A substitutional Cr atom can migrate to a nearest-neighbor vacancy through an energy barrier of 0.56 eV but this simple mechanism alone is unlikely to lead to the long-distance migration of Cr unless there is a supersaturated concentration of vacancies in the system. The Cr-vacancy clusters can lead to long-distance migration of a Cr atom that is accomplished by Fe and Cr atoms successively jumping to nearest-neighbor vacancy positions, defined as a self-vacancy-assisted migration mechanism, with the migration energies ranging from 0.64 to 0.89 eV. In addition, a mixed Cr-Fe dumbbell interstitial can easily migrate through Fe lattices, with the migration energy barrier of 0.17, which is lower than that of the Fe-Fe interstitial. The on-site rotation of the Cr-Fe interstitial and Cr atom hopping from one site to another are believed to comprise the dominant migration mechanism. The calculated binding energies of Cr-V clusters are strongly dependent on the size of clusters and the concentration of Cr atoms in clusters.
Directory of Open Access Journals (Sweden)
A. A. Shmatov
2007-01-01
Full Text Available Optimization of saturating mixture compositions has been carried out in two three-component systems, namely: Cr-Ti-V and Cr-Ti-Mn in respect of micro-hardness and wear resistance of carbide coatings obtained by thermo-chemical treatment of high carbon steel. «Composition - properties» diagrams have been plotted using mathematical models. Treatment with optimum compositions of powder media permits to increase wear resistance of steel by factor of 30-70 as compared with untreated steel.
P-type Al-doped Cr-deficient CrN thin films for thermoelectrics
le Febvrier, Arnaud; Van Nong, Ngo; Abadias, Gregory; Eklund, Per
2018-05-01
Thermoelectric properties of chromium nitride (CrN)-based films grown on c-plane sapphire by dc reactive magnetron sputtering were investigated. In this work, aluminum doping was introduced in CrN (degenerate n-type semiconductor) by co-deposition. Under the present deposition conditions, over-stoichiometry in nitrogen (CrN1+δ) rock-salt structure is obtained. A p-type conduction is observed with nitrogen-rich CrN combined with aluminum doping. The Cr0.96Al0.04N1.17 film exhibited a high Seebeck coefficient and a sufficient power factor at 300 °C. These results are a starting point for designing p-type/n-type thermoelectric materials based on chromium nitride films, which are cheap and routinely grown on the industrial scale.
High-temperature mechanical properties of high-purity 70 mass% Cr-Fe alloy
Energy Technology Data Exchange (ETDEWEB)
Asahina, M.; Harima, N.; Takaki, S.; Abiko, K. [Tohoku Univ., Sendai (Japan). Inst. for Materials Research
2002-01-16
An ingot of high-purity 70 mass% Cr-Fe alloy was prepared by high-frequency induction melting in a high-purity argon atmosphere using a cold copper crucible. Its tensile properties such as hot-ductility and tensile strength were measured, and compared with the results for a high-purity 50 mass% Cr-Fe alloy, a high-purity 60 mass% Cr-Fe alloy and a Ni-based super-alloy. The formation of {sigma}-phase was also examined. The purity of a 70Cr-Fe alloy (70 mass% Cr-Fe alloy) ingot is more than 99.98 mass% and the total amount of gaseous impurities (C, N, O, S, H) in the 70Cr-Fe alloy is 69.9 mass ppm. The strength of the 70Cr-Fe alloy is higher than those of the 60Cr-Fe alloy and the 50Cr-Fe alloy at the temperatures between 293 and 1573 K, without decrease in ductility with increasing Cr content. The 70Cr-Fe alloy also possesses excellent high-temperature ductility. The {sigma}-phase was not observed after aging of 3.6 Ms at 873 K. Consequently, the 70Cr-Fe alloy is an excellent alloy as the base of super heat-resistant alloys. (orig.)
Susskind, Joel; Kouvaris, Louis; Iredell, Lena
2016-01-01
The AIRS Science Team Version-6 retrieval algorithm is currently producing high quality level-3 Climate Data Records (CDRs) from AIRS/AMSU which are critical for understanding climate processes. The AIRS Science Team is finalizing an improved Version-7 retrieval algorithm to reprocess all old and future AIRS data. AIRS CDRs should eventually cover the period September 2002 through at least 2020. CrIS/ATMS is the only scheduled follow on to AIRS/AMSU. The objective of this research is to prepare for generation of long term CrIS/ATMS CDRs using a retrieval algorithm that is scientifically equivalent to AIRS/AMSU Version-7.
Dopamine agonist activity of EMD 23,448
Energy Technology Data Exchange (ETDEWEB)
Martin, G E; Pettibone, D J [Merck Sharp and Dohme Research Laboratories, West Point, Pennsylvania (USA). Dept. of Pharmacology
1985-01-01
EMD 23,448 was examined in tests of dopaminergic function and was found to be an atypical dopamine (DA) agonist. EMD 23,448 was a weak or inactive DA agonist when examined in tests of normal postsynaptic DA receptor function: production of stereotypy in the rat (ED/sub 50/ greater than sign 5.0 mg/kg.i.p.); production of emesis in beagles (minimum effective dose = 81..mu..g/kg i.v.); and, enhanced locomotor activity of the mouse (no excitation in doses <=50 mg/i.p.). Moreover, EMD 23,448 was relatively weak in competing for (/sup 3/H)-apomorphine binding to rat striatal membranes (Ki, 205 nM). On the other hand, this indolyl-3-butylamine did activate supersensitive postsynaptic DA receptors. Specifically, it elicited contralateral turning in rats with a unilateral 6-hydroxydopamine lesion of the substantia nigra (ED/sub 50/ value = 0.9 mg/kg) and did elicit stereotypy in rats given chronic daily haloperidol treatments. EMD 23,448 also exerted pharmacological effects in tests designed to measure activation of dopamine autoreceptors. It inhibited the ..gamma..-butyrolactone-induced increase in striatal dopa levels (ED/sub 50/ = 1 mg/kg i.p.) and produced a dose-related fall in the locomotor activity of the mouse. The results are discussed and contrasted with data derived for apomorphine and the putatively selective autoreceptor agonist (+-)-3-PPP.
Energy Technology Data Exchange (ETDEWEB)
Khalaf Al-zyadi, Jabbar M., E-mail: jabbar_alzyadi@yahoo.com [Department of Physics, College of Education for Pure Sciences, University of Basrah (Iraq); Jolan, Mudhahir H. [Department of Physics, College of Education for Pure Sciences, University of Basrah (Iraq); Yao, Kai-Lun, E-mail: klyao@mail.hust.edu.cn [School of Physics and Wuhan National High Magnetic Field Center, Huazhong University of Science and Technology, Wuhan 430074 (China); International Center of Materials Physics, Chinese Academy of Sciences, Shenyang 110015 (China)
2016-04-01
Recent studies showed that half-Heusler FeCrSe exhibits half-metallic ferromagnetism (Huang et al. [20]). In this paper, we investigate extensively the electronic, magnetic, and half-metallic properties of the half-Heusler alloy FeCrSe (111) and (001) surfaces and the interface with GaP (111) substrate by using the first-principles calculations within the density functional theory. The atomic density of states demonstrates that the half-me tallicity verified in the bulk FeCrSe is maintained at the CrSe-terminated (001) and Se-terminated (111) surfaces, but lost at both Cr- and Fe-terminated (111) surfaces and the Fe-terminated (001) surface. Alternatively, for the interface of FeCrSe/GaP (111), the bulk half-metallicity is destroyed at Se–P configuration while Se–Ga interface and subinterface show nearly 100% spin polarization. Moreover, the calculated interfacial adhesion energies exhibit that Se–Ga shape is more stable than the Se–P one. The calculated magnetic moments of Se, Ga at the Se–Ga (111) interface and P at the Se–P (111) interface increase with respect to the corresponding bulk values while the atomic magnetic moment of Se atom at the Se–P (111) interface decreases. We also notice that the magnetic moments of subinterface Fe at both Se–Ga and Se–P (111) interfaces decrease compared to the bulk values. - Highlights: • The half-metallicity verified in the bulk FeCrSe is kept at the CrSe-terminated (001) and Se-terminated (111) surfaces. • The calculated interfacial adhesion energies exhibit that Se–Ga shape is more stable than Se–P. • The magnetic moments of Se, Ga and P atoms at the interface increase. • The Se–Ga interface shows nearly 100% spin polarization.
Bilateral deficit in explosive force production is not caused by changes in agonist neural drive.
Directory of Open Access Journals (Sweden)
Matthew W Buckthorpe
Full Text Available Bilateral deficit (BLD describes the phenomenon of a reduction in performance during synchronous bilateral (BL movements when compared to the sum of identical unilateral (UL movements. Despite a large body of research investigating BLD of maximal voluntary force (MVF there exist a paucity of research examining the BLD for explosive strength. Therefore, this study investigated the BLD in voluntary and electrically-evoked explosive isometric contractions of the knee extensors and assessed agonist and antagonist neuromuscular activation and measurement artefacts as potential mechanisms. Thirteen healthy untrained males performed a series of maximum and explosive voluntary contractions bilaterally (BL and unilaterally (UL. UL and BL evoked twitch and octet contractions were also elicited. Two separate load cells were used to measure MVF and explosive force at 50, 100 and 150 ms after force onset. Surface EMG amplitude was measured from three superficial agonists and an antagonist. Rate of force development (RFD and EMG were reported over consecutive 50 ms periods (0-50, 50-100 and 100-150 ms. Performance during UL contractions was compared to combined BL performance to measure BLD. Single limb performance during the BL contractions was assessed and potential measurement artefacts, including synchronisation of force onset from the two limbs, controlled for. MVF showed no BLD (P = 0.551, but there was a BLD for explosive force at 100 ms (11.2%, P = 0.007. There was a BLD in RFD 50-100 ms (14.9%, P = 0.004, but not for the other periods. Interestingly, there was a BLD in evoked force measures (6.3-9.0%, P<0.001. There was no difference in agonist or antagonist EMG for any condition (P≥0.233. Measurement artefacts contributed minimally to the observed BLD. The BLD in volitional explosive force found here could not be explained by measurement issues, or agonist and antagonist neuromuscular activation. The BLD in voluntary and evoked explosive force
Comparison of extrapolation methods for creep rupture stresses of 12Cr and 18Cr10NiTi steels
International Nuclear Information System (INIS)
Ivarsson, B.
1979-01-01
As a part of a Soviet-Swedish research programme the creep rupture properties of two heat resisting steels namely a 12% Cr steel and an 18% Cr12% Ni titanium stabilized steel have been studied. One heat from each country of both steels were creep tested. The strength of the 12% Cr steels was similar to earlier reported strength values, the Soviet steel being some-what stronger due to a higher tungsten content. The strength of the Swedish 18/12 Ti steel agreed with earlier results, while the properties of the Soviet steel were inferior to those reported from earlier Soviet creep testings. Three extrapolation methods were compared on creep rupture data collected in both countries. Isothermal extrapolation and an algebraic method of Soviet origin gave in many cases rather similar results, while the parameter method recommended by ISO resulted in higher rupture strength values at longer times. (author)
Cr 3d surface and bulk states in Sn1-xCrxTe/Cr crystals
International Nuclear Information System (INIS)
Guziewicz, E.; Szamota-Sadowska, K.; Kowalski, B.J.; Grodzicka, E.; Story, T.; Orlowski, B.A.; Johnson, R.L.
1997-01-01
We report a new approach to investigate metal-semiconductor interface formation. Photoemission spectroscopy was applied in order to investigate the clean surface of a Sn 0.97 Cr 0.03 Te crystal and to observe its changes under sequential deposition of small amounts of Cr atoms. In order to analyse the Cr 3d contribution to the valence band, the Fano-type resonance tuned to the Cr 3p-3d transmission was used. The experiment was designed to follow the Sn 0.97 Cr 0.03 Te/Cr interface formation process. At the clean Sn 0.97 Cr 0.03 Te surface, the Cr 3d states contribution to the valence band was found to be positioned 0.8 eV below Fermi level. After the Cr deposition processes the contribution shifted to a higher binding energy and another contribution 5.8 eV below the Fermi level also observed. (author)
Metallurgical aspects of the weldability of Cr-Mo stabilised ferritic steels
International Nuclear Information System (INIS)
Colombe, Gerard; Petrequin, Pierre; Donati, J.R.; Zacharie, C.
1977-01-01
Results of tests performed to compare the tendency of 2.25 Cr-Mo and 9 Cr-2 Mo steels stabilised with niobium and niobium + vanadium, to different cracking phenomena susceptible to occur during welding, stress-relieving and service in the conditions of fast breeder reactors are presented
Dopamine agonists and risk: impulse control disorders in Parkinson's disease.
Voon, Valerie; Gao, Jennifer; Brezing, Christina; Symmonds, Mkael; Ekanayake, Vindhya; Fernandez, Hubert; Dolan, Raymond J; Hallett, Mark
2011-05-01
Impulse control disorders are common in Parkinson's disease, occurring in 13.6% of patients. Using a pharmacological manipulation and a novel risk taking task while performing functional magnetic resonance imaging, we investigated the relationship between dopamine agonists and risk taking in patients with Parkinson's disease with and without impulse control disorders. During functional magnetic resonance imaging, subjects chose between two choices of equal expected value: a 'Sure' choice and a 'Gamble' choice of moderate risk. To commence each trial, in the 'Gain' condition, individuals started at $0 and in the 'Loss' condition individuals started at -$50 below the 'Sure' amount. The difference between the maximum and minimum outcomes from each gamble (i.e. range) was used as an index of risk ('Gamble Risk'). Sixteen healthy volunteers were behaviourally tested. Fourteen impulse control disorder (problem gambling or compulsive shopping) and 14 matched Parkinson's disease controls were tested ON and OFF dopamine agonists. Patients with impulse control disorder made more risky choices in the 'Gain' relative to the 'Loss' condition along with decreased orbitofrontal cortex and anterior cingulate activity, with the opposite observed in Parkinson's disease controls. In patients with impulse control disorder, dopamine agonists were associated with enhanced sensitivity to risk along with decreased ventral striatal activity again with the opposite in Parkinson's disease controls. Patients with impulse control disorder appear to have a bias towards risky choices independent of the effect of loss aversion. Dopamine agonists enhance sensitivity to risk in patients with impulse control disorder possibly by impairing risk evaluation in the striatum. Our results provide a potential explanation of why dopamine agonists may lead to an unconscious bias towards risk in susceptible individuals.
Raj, S. V.
2008-01-01
The isothermal oxidation kinetics of as-cast Cu-17%Cr and Cu-17%Cr-5%Al in air were studied between 773 and 1173 K under atmospheric pressure. These observations reveal that Cu-17%Cr-5%Al oxidizes at significantly slower rates than Cu-17%Cr. The rate constants for the alloys were determined from generalized analyses of the data without an a priori assumption of the nature of the oxidation kinetics. Detailed analyses of the isothermal thermogravimetric weight change data revealed that Cu-17%Cr exhibited parabolic oxidation kinetics with an activation energy of 165.9+/-9.5 kJ/mol. In contrast, the oxidation kinetics for the Cu-17%Cr-5%Al alloy exhibited a parabolic oxidation kinetics during the initial stages followed by a quartic relationship in the later stages of oxidation. Alternatively, the oxidation behavior of Cu-17%CR-5%Al could be better represented by a logarithmic relationship. The parabolic rate constants and activation energy data for the two alloys are compared with literature data to gain insights on the nature of the oxidation mechanisms dominant in these alloys.
Platelet-activating factor receptor agonists mediate xeroderma pigmentosum A photosensitivity.
Yao, Yongxue; Harrison, Kathleen A; Al-Hassani, Mohammed; Murphy, Robert C; Rezania, Samin; Konger, Raymond L; Travers, Jeffrey B
2012-03-16
To date, oxidized glycerophosphocholines (Ox-GPCs) with platelet-activating factor (PAF) activity produced non-enzymatically have not been definitively demonstrated to mediate any known disease processes. Here we provide evidence that these Ox-GPCs play a pivotal role in the photosensitivity associated with the deficiency of the DNA repair protein xeroderma pigmentosum type A (XPA). It should be noted that XPA-deficient cells are known to have decreased antioxidant defenses. These studies demonstrate that treatment of human XPA-deficient fibroblasts with the pro-oxidative stressor ultraviolet B (UVB) radiation resulted in increased reactive oxygen species and PAF receptor (PAF-R) agonistic activity in comparison with gene-corrected cells. The UVB irradiation-generated PAF-R agonists were inhibited by antioxidants. UVB irradiation of XPA-deficient (Xpa-/-) mice also resulted in increased PAF-R agonistic activity and skin inflammation in comparison with control mice. The increased UVB irradiation-mediated skin inflammation and TNF-α production in Xpa-/- mice were blocked by systemic antioxidants and by PAF-R antagonists. Structural characterization of PAF-R-stimulating activity in UVB-irradiated XPA-deficient fibroblasts using mass spectrometry revealed increased levels of sn-2 short-chain Ox-GPCs along with native PAF. These studies support a critical role for PAF-R agonistic Ox-GPCs in the pathophysiology of XPA photosensitivity.
Observations of defect structure evolution in proton and Ni ion irradiated Ni-Cr binary alloys
Energy Technology Data Exchange (ETDEWEB)
Briggs, Samuel A., E-mail: sabriggs2@wisc.edu [University of Wisconsin-Madison, 1415 Engineering Drive, Madison, WI 53706 (United States); Barr, Christopher M. [Drexel University, 3141 Chestnut Street, Philadelphia, PA 19104 (United States); Pakarinen, Janne [University of Wisconsin-Madison, 1415 Engineering Drive, Madison, WI 53706 (United States); SKC-CEN Belgian Nuclear Research Centre, Boeretang 200, B-2400 Mol (Belgium); Mamivand, Mahmood [University of Wisconsin-Madison, 1415 Engineering Drive, Madison, WI 53706 (United States); Hattar, Khalid [Sandia National Laboratories, PO Box 5800, Albuquerque, NM 87185 (United States); Morgan, Dane D. [University of Wisconsin-Madison, 1415 Engineering Drive, Madison, WI 53706 (United States); Taheri, Mitra [Drexel University, 3141 Chestnut Street, Philadelphia, PA 19104 (United States); Sridharan, Kumar [University of Wisconsin-Madison, 1415 Engineering Drive, Madison, WI 53706 (United States)
2016-10-15
Two binary Ni-Cr model alloys with 5 wt% Cr and 18 wt% Cr were irradiated using 2 MeV protons at 400 and 500 °C and 20 MeV Ni{sup 4+} ions at 500 °C to investigate microstructural evolution as a function of composition, irradiation temperature, and irradiating ion species. Transmission electron microscopy (TEM) was applied to study irradiation-induced void and faulted Frank loops microstructures. Irradiations at 500 °C were shown to generate decreased densities of larger defects, likely due to increased barriers to defect nucleation as compared to 400 °C irradiations. Heavy ion irradiation resulted in a larger density of smaller voids when compared to proton irradiations, indicating in-cascade clustering of point defects. Cluster dynamics simulations were in good agreement with the experimental findings, suggesting that increases in Cr content lead to an increase in interstitial binding energy, leading to higher densities of smaller dislocation loops in the Ni-18Cr alloy as compared to the Ni-5Cr alloy. - Highlights: • Binary Ni-Cr alloys were irradiated with protons or Ni ions at 400 and 500 °C. • Higher irradiation temperatures yield increased size, decreased density of defects. • Hypothesize that varying Cr content affects interstitial binding energy. • Fitting CD models for loop nucleation to data supports this hypothesis.
Long-term outcome of patients with macroprolactinomas initially treated with dopamine agonists
Kars, Marleen; Pereira, Alberto M.; Smit, Johannes W.; Romijn, Johannes A.
2009-01-01
Dopamine agonists are the first line therapy for the treatment of prolactinomas. The aim of this study was to assess the outcome of macroprolactinomas during long-term follow-up after initial treatment with dopamine agonists. Retrospective follow-up study. We included 72 consecutive patients (age
Oana, Fumiki; Onozuka, Hiroshi; Tsuchioka, Akihiro; Suzuki, Takayuki; Tanaka, Nobuyuki; Kaidoh, Kouichi; Hoyano, Yuji; Hiratochi, Masahiro; Kikuchi, Shinji; Takehana, Yasuo; Shibata, Nobuo
2014-03-01
The symptoms of Parkinson's disease are alleviated by dopamine D2 agonists, which are classified as ergot dopamine D2 agonists and non-ergot D2 agonists. Among the former, pergolide has been associated with valvular heart disease, since it has both potent D2 receptor and serotonin 5-HT(2B) receptor agonistic properties. Among the latter, pramipexole has few incidences of heart valve disease onset, since it has an absence of 5-HT(2B) receptor agonism. A [3H]thymidine incorporation assay was performed to monitor function, and microarray global analysis to monitor gene expression, on porcine heart valve interstitial cells (VICs) treated with pergolide or pramipexole. The 5-HT(2B) receptor was abundantly expressed in porcine VICs. The 5-HT(2B) receptor agonist pergolide induced an increase in [3H]thymidine incorporation, accompanied by a decrease in 5-HT(2B) receptor mRNA expression. [3H]thymidine incorporation was blocked by lisuride, a 5-HT(2B) receptor antagonist, and also by LY-294002, a specific inhibitor of PI3K and Akt. Moreover, type 2 iodothyronine deiodinase (Dio2) expression in porcine VICs treated with pergolide was shown, by a global analysis of mRNA, to be markedly increased compared to that induced by pramipexole. Such changes in VICs may correlate with the mechanism of heart valve disease pathogenesis. There were substantial differences (increased [3H]thymidine incorporation, and Dio2 expression) between pergolide and pramipexole, which might correlate with the mechanism of heart valve disease onset.
International Nuclear Information System (INIS)
Galanakis, I.; Pouliasis, S.G.
2009-01-01
We present an extended study of single impurity atoms and atomic swaps in half-metallic CrAs, CrSb and CrSe zinc-blende compounds. Although the perfect alloys present a rather large gap in the minority-spin band, all defects under study, with the exception of void impurities at Cr and sp sites and Cr impurities at sp sites (as long as no swap occurs), induce new states within the gap. The Fermi level can be pinned within these new minority states depending on the lattice constant used for the calculations and the electronegativity of the sp atoms. Although these impurity states are localized in space around the impurity atoms and very fast we regain the bulk behavior, their interaction can lead to wide bands within the gap and thus loss of the half-metallic character
Energy Technology Data Exchange (ETDEWEB)
Stachel, Shawn J.; Zerbinatti, Celina; Rudd, Michael T.; Cosden, Mali; Suon, Sokreine; Nanda, Kausik K.; Wessner, Keith; DiMuzio, Jillian; Maxwell, Jill; Wu, Zhenhua; Uslaner, Jason M.; Michener, Maria S.; Szczerba, Peter; Brnardic, Edward; Rada, Vanessa; Kim, Yuntae; Meissner, Robert; Wuelfing, Peter; Yuan, Yang; Ballard, Jeanine; Holahan, Marie; Klein, Daniel J.; Lu, Jun; Fradera, Xavier; Parthasarathy, Gopal; Uebele, Victor N.; Chen, Zhongguo; Li, Yingjie; Li, Jian; Cooke, Andrew J.; Bennett, D. Jonathan; Bilodeau, Mark T.; Renger, John (Merck); (WuXi App Tec)
2016-04-14
Herein, we describe the development of a functionally selective liver X receptor β (LXRβ) agonist series optimized for Emax selectivity, solubility, and physical properties to allow efficacy and safety studies in vivo. Compound 9 showed central pharmacodynamic effects in rodent models, evidenced by statistically significant increases in apolipoprotein E (apoE) and ATP-binding cassette transporter levels in the brain, along with a greatly improved peripheral lipid safety profile when compared to those of full dual agonists. These findings were replicated by subchronic dosing studies in non-human primates, where cerebrospinal fluid levels of apoE and amyloid-β peptides were increased concomitantly with an improved peripheral lipid profile relative to that of nonselective compounds. These results suggest that optimization of LXR agonists for Emax selectivity may have the potential to circumvent the adverse lipid-related effects of hepatic LXR activity.
Fracture toughness and sliding properties of magnetron sputtered CrBC and CrBCN coatings
Wang, Qianzhi; Zhou, Fei; Ma, Qiang; Callisti, Mauro; Polcar, Tomas; Yan, Jiwang
2018-06-01
CrBC and CrBCN coatings with low and high B contents were deposited on 316L steel and Si wafers using an unbalanced magnetron sputtering system. Mechanical properties including hardness (H), elastic modulus (E) and fracture toughness (KIc) as well as residual stresses (σ) were quantified. A clear correlation between structural, mechanical and tribological properties of coatings was found. In particular, structural analyses indicated that N incorporation in CrBC coatings with high B content caused a significant structural evolution of the nanocomposite structure (crystalline grains embedded into an amorphous matrix) from nc-CrB2/(a-CrBx, a-BCx) to nc-CrN/(a-BCx, a-BN). As a result, the hardness of CrBC coating with high B content decreased from 23.4 to 16.3 GPa but the fracture toughness was enhanced. Consequently, less cracks initiated on CrBCN coatings during tribological tests, which combined with the shielding effect of a-BN on wear debris, led to a low friction coefficient and wear rate.
Oba, Yuji; Lone, Nazir A
2014-01-01
A combination therapy with inhaled corticosteroid (ICS) and a long-acting beta agonist (LABA) is recommended in severe chronic obstructive pulmonary disease (COPD) patients experiencing frequent exacerbations. Currently, there are five ICS/LABA combination products available on the market. The purpose of this study was to systematically review the efficacy of various ICS/LABA combinations with a network meta-analysis. Several databases and manufacturer's websites were searched for relevant clinical trials. Randomized control trials, at least 12 weeks duration, comparing an ICS/LABA combination with active control or placebo were included. Moderate and severe exacerbations were chosen as the outcome assessment criteria. The primary analyses were conducted with a Bayesian Markov chain Monte Carlo method. Most of the ICS/LABA combinations reduced moderate-to-severe exacerbations as compared with placebo and LABA, but none of them reduced severe exacerbations. However, many studies excluded patients receiving long-term oxygen therapy. Moderate-dose ICS was as effective as high-dose ICS in reducing exacerbations when combined with LABA. ICS/LABA combinations had a class effect with regard to the prevention of COPD exacerbations. Moderate-dose ICS/LABA combination therapy would be sufficient for COPD patients when indicated. The efficacy of ICS/LABA combination therapy appeared modest and had no impact in reducing severe exacerbations. Further studies are needed to evaluate the efficacy of ICS/LABA combination therapy in severely affected COPD patients requiring long-term oxygen therapy.
The therapeutic potential of nicotinic acetylcholine receptor agonists for pain control.
Decker, M W; Meyer, M D; Sullivan, J P
2001-10-01
Due to the limitations of currently available analgesics, a number of novel alternatives are currently under investigation, including neuronal nicotinic acetylcholine receptor (nAChR) agonists. During the 1990s, the discovery of the antinociceptive properties of the potent nAChR agonist epibatidine in rodents sparked interest in the analgesic potential of this class of compounds. Although epibatidine also has several mechanism-related toxicities, the identification of considerable nAChR diversity suggested that the toxicities and therapeutic actions of the compound might be mediated by distinct receptor subtypes. Consistent with this view, a number of novel nAChR agonists with antinociceptive activity and improved safety profiles in preclinical models have now been identified, including A-85380, ABT-594, DBO-83, SIB-1663 and RJR-2403. Of these, ABT-594 is the most advanced and is currently in Phase II clinical evaluation. Nicotinically-mediated antinociception has been demonstrated in a variety of rodent pain models and is likely mediated by the activation of descending inhibitory pathways originating in the brainstem with the predominant high-affinity nicotine site in brain, the alpha4beta2 subtype, playing a critical role. Thus, preclinical findings suggest that nAChR agonists have the potential to be highly efficacious treatments in a variety of pain states. However, clinical proof-of-principle studies will be required to determine if nAChR agonists are active in pathological pain.
Mezquita-Raya, Pedro; Ram?rez de Arellano, Antonio; Kragh, Nana; Vega-Hernandez, Gabriela; P?hlmann, Johannes; Valentine, William J.; Hunt, Barnaby
2017-01-01
Introduction Glucagon-like peptide-1 (GLP-1) receptor agonists are used successfully in the treatment of patients with type 2 diabetes as they are associated with low hypoglycemia rates, weight loss and improved glycemic control. This study compared, in the Spanish setting, the cost-effectiveness of liraglutide 1.8?mg versus lixisenatide 20??g, both GLP-1 receptor agonists, for patients with type 2 diabetes who had not achieved glycemic control targets on metformin monotherapy. Methods The IM...
Chen, Rui; Wan, Jing; Song, Jing; Qian, Yan; Liu, Yong; Gu, Shuiming
2017-12-01
Peroxisome proliferator-activated receptor-γ (PPARγ) is a member of the nuclear hormone receptor superfamily of ligand-activated transcription factors. Activation of PPARγ pathway has been shown to enhance fatty acid oxidation, improve endothelial cell function, and decrease myocardial fibrosis in heart failure. Thus, the protein has been raised as an attractive target for heart failure therapy. This work attempted to discover new and potent PPARγ agonists from natural products using a synthetic strategy of computer virtual screening and transactivation reporter assay. A large library of structurally diverse, drug-like natural products was compiled, from which those with unsatisfactory pharmacokinetic profile and/or structurally redundant compounds were excluded. The binding mode of remaining candidates to PPARγ ligand-binding domain (LBD) was computationally modelled using molecular docking and their relative binding potency was ranked by an empirical scoring scheme. Consequently, eight commercially available hits with top scores were selected and their biological activity was determined using a cell-based reporter-gene assay. Four natural product compounds, namely ZINC13408172, ZINC4292805, ZINC44179 and ZINC901461, were identified to have high or moderate agonistic potency against human PPARγ with EC 50 values of 0.084, 2.1, 0.35 and 5.6 μM, respectively, which are comparable to or even better than that of the approved PPARγ full agonists pioglitazone (EC 50 = 0.16 μM) and rosiglitazone (EC 50 = 0.034 μM). Hydrophobic interactions and van der Waals contacts are the primary chemical forces to stabilize the complex architecture of PPARγ LBD domain with these agonist ligands, while few hydrogen bonds, salt bridges and/or π-π stacking at the complex interfaces confer selectivity and specificity for the domain-agonist recognition. The integrated in vitro-in silico screening strategy can be successfully applied to rational discovery of
The Reduction of Cr(VI) to Cr(III) by Natural Fe-Bearing Minerals: A Synchrotron XAS Study
Xu, H.; Guo, X.; Ding, M.; Migdissov, A. A.; Boukhalfa, H.; Sun, C.; Roback, R. C.; Reimus, P. W.; Katzman, D.
2017-12-01
Cr(VI) in the form of CrO42- is a pollutant species in groundwater and soils that can pose health and environmental problems. Cr(VI) associated with use as a corrosion inhibitor at a power plant from 1956-1972 is present in a deep groundwater aquifer at Los Alamos National Laboratory. A potential remediation strategy for the Cr contamination is reduction of Cr(VI) to Cr(III) via the acceptance of electrons from naturally occurring or induced Fe(II) occurring in Fe-bearing minerals. In this work, using synchrotron-based X-ray techniques, we investigated the Cr reduction behavior by Fe-bearing minerals from outcrop and core samples representative of the contaminated portion of the aquifer. Samples were exposed to solutions with a range of known Cr (VI) concentrations. XANES and EXAFS spectra showed that all the Cr(VI) had been reduced to Cr(III), and micro XRF mapping revealed close correlation of Cr and Fe distribution, implying that Fe(II) in minerals reduced Cr(VI) in the solution. Similar behavior was observed from in-situ XANES measurements on Cr reduction and adsorption by mineral separates from the rock samples in Cr(VI)-bearing solutions. In addition, to obtain reference parameters for interpreting the data of natural samples, we collected Cr and Fe EXAFS spectra of Cr(III)-Fe(III) hydroxide solid solutions, which show progressive changes in the local structure around Cr and Fe over the whole series.
Synthesis, characterization and stability of Cr(III) and Fe(III) hydroxides
International Nuclear Information System (INIS)
Papassiopi, N.; Vaxevanidou, K.; Christou, C.; Karagianni, E.; Antipas, G.S.E.
2014-01-01
Highlights: • Fe(III)–Cr(III) hydroxides enhance groundwater quality better than pure Cr(III) compounds. • Crystalline Cr(OH) 3 ·3H 2 O was unstable, with a solubility higher than 50 μg/l. • Amorphous Cr(OH) 3 (am) was stable with a solubility lower than 50 μg/l in the range 5.7 0.75 Cr 0.25 (OH) 3 , the stability region was extended to 4.8 3 ·xH 2 O whereas in the presence of iron the precipitate is a mixed Fe (1−x) Cr x (OH) 3 phase. In this study, we report on the synthesis, characterisation and stability of mixed (Fe x ,Cr 1−x )(OH) 3 hydroxides as compared to the stability of Cr(OH) 3 . We established that the plain Cr(III) hydroxide, abiding to the approximate molecular formula Cr(OH) 3 ·3H 2 O, was crystalline, highly soluble, i.e. unstable, with a tendency to transform into the stable amorphous hydroxide Cr(OH) 3 (am) phase. Mixed Fe 0.75 Cr 0.25 (OH) 3 hydroxides were found to be of the ferrihydrite structure, Fe(OH) 3 , and we correlated their solubility to that of a solid solution formed by plain ferrihydrite and the amorphous Cr(III) hydroxide. Both our experimental results and thermodynamic calculations indicated that mixed Fe(III)–Cr(III) hydroxides are more effective enhancers of groundwater quality, in comparison to the plain amorphous or crystalline Cr(III) hydroxides, the latter found to have a solubility typically higher than 50 μg/l (maximum EU permitted Cr level in drinking water), while the amorphous Cr(OH) 3 (am) phase was within the drinking water threshold in the range 5.7 0.75 Cr 0.25 (OH) 3 hydroxides studied were of extended stability in the 4.8 < pH < 13.5 range
Poletti, Michele; Perugi, Giulio; Logi, Chiara; Romano, Anna; Del Dotto, Paolo; Ceravolo, Roberto; Rossi, Giuseppe; Pepe, Pasquale; Dell'Osso, Liliana; Bonuccelli, Ubaldo
2012-11-01
Delusional jealousy (DJ) has been described in patients with Parkinson's disease (PD) on dopaminergic therapy, but a role for dopaminergic therapy in DJ has not been established. The current cross-sectional study on DJ investigated its association with dopaminergic therapies compared with their associations with hallucinations and its prevalence in PD patients. Eight hundred five consecutive patients with PD were enrolled between January 2009 and June 2010. DJ was identified in 20 patients (2.48%) and hallucinations in 193 patients (23.98%). In the multivariate logistic regression analyses, dopamine agonists were significantly associated with DJ (odds ratio, 18.1; 95% CI, 3.0-infinity; P = .0002) but not with hallucinations (odds ratio, 0.73; 95% CI, 0.49-1.10; P = .133). These findings suggest that dopamine agonist treatment represents a risk factor for DJ in PD independent of the presence of a dementing disorder, and the presence of this additional nonmotor side effect should be investigated in this clinical population. Copyright © 2012 Movement Disorder Society.
HIGH TEMPERATURE TENSILE PROPERTIES OF NEW FE-CR-MN DEVELOPED STEEL
M. Mahmoudiniya; Sh. Kheirandish; M. Asadi Asadabad
2017-01-01
Nowadays, Ni-free austenitic stainless steels are being developed rapidly and high price of nickel is one of the most important motivations for this development. At present research a new FeCrMn steel was designed and produced based on Fe-Cr-Mn-C system. Comparative studies on microstructure and high temperature mechanical properties of new steel and AISI 316 steel were done. The results showed that new FeCrMn developed steel has single austenite phase microstructure, and its tensile st...
NiCoCrAl/YSZ laminate composites fabricated by EB-PVD
International Nuclear Information System (INIS)
Shi Guodong; Wang Zhi; Liang Jun; Wu Zhanjun
2011-01-01
Highlights: → The metal-ceramic laminate composites were fabricated by EB-PVD. → Both metal and ceramic layers consisted of straight columns with banded structures. → Columnar grain size was limited by the periodic layer interfaces in the laminates. → Effect of columns on fracture property was decreased by limiting layer thickness. → Laminates showed greater specific strength than monolithic metal foil. - Abstract: Two NiCoCrAl/YSZ laminate composites (A and B) with different metal-layer thickness (∼35 μm and 14 μm, respectively) were fabricated by electron beam physical vapor deposition (EB-PVD). Their microstructure was examined and their mechanical properties were compared with the 289 μm thick NiCoCrAl monolithic foil produced by EB-PVD. Both the YSZ and NiCoCrAl layers of the laminate composites had columnar grain structure. But the periodic layer interfaces limited the columnar grain size. Some pores between the columns were also observed. It was found that the strength of the laminate A was equal approximately to that of the NiCoCrAl monolithic foil, and that laminate B had the greater strength. Moreover, the density of the foils decreased with the increasing thickness ratio of YSZ/NiCoCrAl layers and the increasing the layer number. Thus, comparing with the NiCoCrAl monolithic foil, the NiCoCrAl/YSZ laminate composites not only had the equal or greater strength, but also had the much greater specific strength.
Preclinical evaluation of SMM-189, a cannabinoid receptor 2-specific inverse agonist.
Presley, Chaela; Abidi, Ammaar; Suryawanshi, Satyendra; Mustafa, Suni; Meibohm, Bernd; Moore, Bob M
2015-08-01
Cannabinoid receptor 2 agonists and inverse agonists are emerging as new therapeutic options for a spectrum of autoimmune-related disease. Of particular interest, is the ability of CB2 ligands to regulate microglia function in neurodegenerative diseases and traumatic brain injury. We have previously reported the receptor affinity of 3',5'-dichloro-2,6-dihydroxy-biphenyl-4-yl)-phenyl-methanone (SMM-189) and the characterization of the beneficial effects of SMM-189 in the mouse model of mild traumatic brain injury. Herein, we report the further characterization of SMM-189 as a potent and selective CB2 inverse agonist, which acts as a noncompetitive inhibitor of CP 55,940. The ability of SMM-189 to regulate microglial activation, in terms of chemokine expression and cell morphology, has been determined. Finally, we have determined that SMM-189 possesses acceptable biopharmaceutical properties indicating that the triaryl class of CB2 inverse agonists are viable compounds for continued preclinical development for the treatment of neurodegenerative disorders and traumatic brain injury.
Energy Technology Data Exchange (ETDEWEB)
Zhu, J.H.; Liaw, P.K. [Univ. of Tennessee, Knoxville, TN (United States). Dept. of Materials Science and Engineering; Liu, C.T. [Oak Ridge National Lab., TN (United States). Metals and Ceramics Div.
1997-12-01
Phase stability in a ternary Nb-Cr-Ni Laves phase system was studied in this paper. Their previous study in NbCr{sub 2}-based transition-metal Laves phases has shown that the average electron concentration factor, e/a, is the dominating factor in controlling the phase stability of NbCr{sub 2}-based Laves phases when the atomic size ratios are kept identical. Since Ni has ten out-shell electrons, the substitution of Ni for Cr in NbCr{sub 2} will increase the average electron concentration of the alloy, thus leading to the change of the crystal structures from C15 to C14. In this paper, a number of pseudo-binary Nb(Cr,Ni){sub 2} alloys were prepared, and the crystal structures of the alloys after a long heat-treatment at 1000 C as a function of the Ni content were determined by the X-ray diffraction technique. The boundaries of the C15/C14 transition were determined and compared to their previous predictions. It was found that the electron concentration and phase stability correlation is obeyed in the Nb-Cr-Ni system. However, the e/a ratio corresponding to the C15/C14 phase transition was found to move to a higher value than the predicted one. The changes in the lattice constant, Vickers hardness and fracture toughness were also determined as a function of the Ni content, which were discussed in light of the phase stability difference of the alloys.
Directory of Open Access Journals (Sweden)
Gurgle HE
2016-06-01
Full Text Available Holly E Gurgle, Karen White, Carrie McAdam-Marx Department of Pharmacotherapy, University of Utah College of Pharmacy, Salt Lake City, UT, USA Abstract: Controversy exists regarding the selection of second-line therapy for patients with type 2 diabetes mellitus (T2DM who are unable to achieve glycemic control with metformin therapy alone. Newer pharmacologic treatments for T2DM include glucagon-like peptide-1 receptor agonists and sodium–glucose cotransporter 2 inhibitors. Both the classes of medication are efficacious, exhibit positive effects on weight, and are associated with minimal risk of hypoglycemia. The purpose of this review is to compare the clinical trial and real-world effectiveness data of glucagon-like peptide-1 receptor agonists versus sodium–glucose cotransporter 2 inhibitors related to A1c reduction, weight loss, cost-effectiveness, cardiovascular outcomes, and safety in patients with T2DM. This review summarizes comparative evidence for providers who are determining which of the two classes may be the most appropriate for a specific patient. Keywords: type 2 diabetes mellitus, GLP-1 receptor agonist, SGLT2 inhibitor, A1c, weight loss, adverse effect
Directory of Open Access Journals (Sweden)
Andrii Kostryzhev
2018-02-01
Full Text Available Steel product markets require the rolled stock with further increasing mechanical properties and simultaneously decreasing price. The steel cost can be reduced via decreasing the microalloying elements contents, although this decrease may undermine the mechanical properties. Multi-element microalloying with minor additions is the route to optimise steel composition and keep the properties high. However, this requires deep understanding of mutual effects of elements on each other’s performance with respect to the development of microstructure and mechanical properties. This knowledge is insufficient at the moment. In the present work we investigate the microstructure and mechanical properties of bainitic steels microalloyed with Cr, Mo, Nb and V. Comparison of 0.2 wt. % Mo and Cr additions has shown a more pronounced effect of Mo on precipitation than on phase balance. Superior strength of the MoNbV-steel originated from the strong solid solution strengthening effect. Superior ductility of the CrNbV-steel corresponded to the more pronounced precipitation in this steel. Nature of these mechanisms is discussed.
Comparative concentration analysis of Cr and Co in FeSi2 films performed by ERDA and RBS
International Nuclear Information System (INIS)
Bohne, W.; Reinsperger, G.-U.; Roehrich, J.; Roeschert, G.; Selle, B.; Stauss, P.
2000-01-01
Thin films of β-FeSi 2 doped by Co or Cr were grown on Si substrates by molecular beam epitaxy (MBE) using three separately controlled evaporation sources. The dopant concentration was measured concurrently by heavy-ion ERDA with 129 Xe ions of 140-250 MeV, by heavy-ion RBS with 15 MeV 14 N and by standard RBS with 1.4 MeV 4 He ions. Among these techniques, the TOF-ERDA was most powerful in providing a high mass resolution and a low detection limit for Co and Cr (∼0.1 at.%). Because of the complete overlap of the dopant signals with the Fe signal the standard RBS spectra were evaluated by relying on the differences between the scattering cross-sections from the dopant atoms and Fe. This approach proved to be applicable as far as the dopants had a constant depth profile with sufficiently high concentration. For Cr concentrations exceeding the miscibility limit the RBS results deviate significantly from those of ERDA due to increasing dopant depth inhomogeneities
International Nuclear Information System (INIS)
Leff, S.E.; Creese, I.
1985-01-01
The interactions of dopaminergic agonists and antagonists with 3 H-agonist labeled D3 dopaminergic binding sites of rat striatum have been characterized by radioligand-binding techniques. When the binding of [ 3 H]dopamine and [ 3 H]apomorphine to D2 dopamine receptors is blocked by the inclusion of D2 selective concentrations of unlabeled spiroperidol or domperidone, these ligands appear to label selectively the previously termed D3 binding site. Antagonist/[ 3 H]dopamine competition curves are of uniformly steep slope (nH . 1.0), suggesting the presence of a single D3 binding site. The relative potencies of antagonists to inhibit D3 specific [ 3 H]dopamine binding are significantly correlated with their potencies to block D1 dopamine receptors as measured by the inhibition of both dopamine-stimulated adenylate cyclase and [ 3 H]flupentixol-binding activities. The affinities of agonists to inhibit D3 specific [ 3 H]dopamine binding are also correlated with estimates of these agonists affinities for the high affinity binding component of agonist/[ 3 H]flupentixol competition curves. Both D3 specific [ 3 H] dopamine binding and the high affinity agonist-binding component of dopamine/[ 3 H]flupentixol competition curves show a similar sensitivity to guanine nucleotides. Taken together, these data strongly suggest that the D3 binding site is related to a high affinity agonist-binding state of the D1 dopamine receptor
Tack, J; Camilleri, M; Chang, L; Chey, W D; Galligan, J J; Lacy, B E; Müller-Lissner, S; Quigley, E M M; Schuurkes, J; De Maeyer, J H; Stanghellini, V
2012-04-01
The nonselective 5-HT(4) receptor agonists, cisapride and tegaserod have been associated with cardiovascular adverse events (AEs). To perform a systematic review of the safety profile, particularly cardiovascular, of 5-HT(4) agonists developed for gastrointestinal disorders, and a nonsystematic summary of their pharmacology and clinical efficacy. Articles reporting data on cisapride, clebopride, prucalopride, mosapride, renzapride, tegaserod, TD-5108 (velusetrag) and ATI-7505 (naronapride) were identified through a systematic search of the Cochrane Library, Medline, Embase and Toxfile. Abstracts from UEGW 2006-2008 and DDW 2008-2010 were searched for these drug names, and pharmaceutical companies approached to provide unpublished data. Retrieved articles on pharmacokinetics, human pharmacodynamics and clinical data with these 5-HT(4) agonists, are reviewed and summarised nonsystematically. Articles relating to cardiac safety and tolerability of these agents, including any relevant case reports, are reported systematically. Two nonselective 5-HT(4) agonists had reports of cardiovascular AEs: cisapride (QT prolongation) and tegaserod (ischaemia). Interactions with, respectively, the hERG cardiac potassium channel and 5-HT(1) receptor subtypes have been suggested to account for these effects. No cardiovascular safety concerns were reported for the newer, selective 5-HT(4) agonists prucalopride, velusetrag, naronapride, or for nonselective 5-HT(4) agonists with no hERG or 5-HT(1) affinity (renzapride, clebopride, mosapride). 5-HT(4) agonists for GI disorders differ in chemical structure and selectivity for 5-HT(4) receptors. Selectivity for 5-HT(4) over non-5-HT(4) receptors may influence the agent's safety and overall risk-benefit profile. Based on available evidence, highly selective 5-HT(4) agonists may offer improved safety to treat patients with impaired GI motility. © 2012 Blackwell Publishing Ltd.
Tack, J; Camilleri, M; Chang, L; Chey, W D; Galligan, J J; Lacy, B E; Müller-Lissner, S; Quigley, E M M; Schuurkes, J; Maeyer, J H; Stanghellini, V
2012-01-01
Summary Background The nonselective 5-HT4 receptor agonists, cisapride and tegaserod have been associated with cardiovascular adverse events (AEs). Aim To perform a systematic review of the safety profile, particularly cardiovascular, of 5-HT4 agonists developed for gastrointestinal disorders, and a nonsystematic summary of their pharmacology and clinical efficacy. Methods Articles reporting data on cisapride, clebopride, prucalopride, mosapride, renzapride, tegaserod, TD-5108 (velusetrag) and ATI-7505 (naronapride) were identified through a systematic search of the Cochrane Library, Medline, Embase and Toxfile. Abstracts from UEGW 2006–2008 and DDW 2008–2010 were searched for these drug names, and pharmaceutical companies approached to provide unpublished data. Results Retrieved articles on pharmacokinetics, human pharmacodynamics and clinical data with these 5-HT4 agonists, are reviewed and summarised nonsystematically. Articles relating to cardiac safety and tolerability of these agents, including any relevant case reports, are reported systematically. Two nonselective 5-HT4 agonists had reports of cardiovascular AEs: cisapride (QT prolongation) and tegaserod (ischaemia). Interactions with, respectively, the hERG cardiac potassium channel and 5-HT1 receptor subtypes have been suggested to account for these effects. No cardiovascular safety concerns were reported for the newer, selective 5-HT4 agonists prucalopride, velusetrag, naronapride, or for nonselective 5-HT4 agonists with no hERG or 5-HT1 affinity (renzapride, clebopride, mosapride). Conclusions 5-HT4 agonists for GI disorders differ in chemical structure and selectivity for 5-HT4 receptors. Selectivity for 5-HT4 over non-5-HT4 receptors may influence the agent's safety and overall risk–benefit profile. Based on available evidence, highly selective 5-HT4 agonists may offer improved safety to treat patients with impaired GI motility. PMID:22356640
International Nuclear Information System (INIS)
Berghaeuser, H.
1981-01-01
''Classic'' PAH and inulin clearance were determined in 81 patients with renal anomalies or renal diseases of different genesis and severity. In addition, radioisotope nephrography was carried out after administration of I-131-o-hippuric acid, followed by administration of Cr-51-EDTA. The activity decrease was recorded by a sensor located over the patient's right shoulder; the activities of a serum sample and of the urine excreted after 21 or 31 min were measured, and the findings were compared with those of the classic method. The clearance data calculated on the basis of the soulder measurements were hardly compatible with those of the conventional method in the case of 131 I-o-hippuric acid (r=0.54) and totally incompatible in the case of 51 Cr-EDTA. This means that the method described by Oberhausen is the only accurate method available for a quantitative assessment of the renal function on the basis of measurements of the activity decrease in the body. The activity of urine excreted after 31 min ( 131 I-hippuric acid:r=0.992, 51 Cr-EDTA:r=0.79) is a sufficiently accurate parameter although it is inaccurate at PAH clearance, values > 130 ml/min and inulin clearance values > 30 ml/min. Of the many parameters of radioisotope nephrogram curves, in the case of 131 I-o-hippuric acid only the parameters related to the ascent between 48 and 120 sec or to the secant ascent yield sufficient quantitative information for certain functional regions (r=0.9 resp. r=0.93). In the case of 51 Cr-EDTA, semiquantitative information on the renal function can be obtained by constructing secants on the nephrogram curves (r=0.7 resp. r=0.72). Here as in the case of 131 I-hippuric acid, the contribution of each kidney can be determined individually from the functional analysis of both kidneys. (orig.) [de
International Nuclear Information System (INIS)
Payziyev, Sh.D.; Bakhramov, S.A.; Shayimov, F.F.; Fayziev, A.Sh.
2015-01-01
The analysis of an effect of Cr 4+ impurity ions, existent in Nd 3+ :Cr 3+ :GSGG and Nd 3+ :Cr 3+ :YAG laser materials on output parameters of solar pumped lasers is carried out by modeling of lasing process at solar pumping. (authors)
Results from the first cycle of the PWR crud deposition test (IFA-665.1)
International Nuclear Information System (INIS)
Bennett, Peter
2004-03-01
The main objective of IFA-665.1 is to deposit crud on fuel rods operating under PWR thermal-hydraulic and water chemistry conditions, and to measure the resulting power reduction due to incorporation of boron into the crud. The test has operated for 160 days at power. Water chemistry conditions were 3.15 ppm LiOH and 1400 ppm boron (pH 300 =7.0). The coolant inlet temperature was 290/294 C, with sub-cooled nucleate boiling along the upper half of the fuel bundle. This report presents the results from the first cycle of operation. Three methods have been used to attempt to accelerate crud formation: (i) injection of simulated crud particles (NiFe 2 O 4 ); (ii) pH transients (reduction of pH 300 from 7.0 to 6.0 for periods of 48 hours); and (iii) oxygen addition transients. While the pH transients resulted in movement of large amounts of corrosion products around the loop, no significant deposition onto the fuel surfaces was measured. Comparison of the heat fluxes in IFA-665 with those in previous tests in which crud deposition has occurred does not clearly identify reasons for the lack of crud formation, although it is noted that higher heat fluxes may be required. In addition, the relatively benign boiling conditions in the current test (small void fraction with no detached voidage) may partly explain the absence of crud formation. For the second cycle of the test, changes will be made to the water chemistry to attempt to increase the concentrations of dissolved and colloidal Fe and Ni in the test rig, such that a continuous (Fe + Ni) level of 100 ppb will be targeted, with short-term concentrations of colloids of up to 500 ppb. (Author)
High temperature oxidation characteristics of developed Ni-Cr-W superalloys in air
International Nuclear Information System (INIS)
Suzuki, Tomio; Shindo, Masami
1996-11-01
For expanding utilization of the Ni-Cr-W superalloy, which has been developed as one of new high temperature structural materials used in the advanced High Temperature Gas-cooled Reactors (HTGRs), in various engineering fields including the structural material for heat utilization system, the oxidation behavior of this alloy in air as one of high oxidizing environments becomes one of key factors. The oxidation tests for the industrial scale heat of Ni-Cr-W superalloy with the optimized chemical composition and five kinds of experimental Ni-Cr-W alloys with different Cr/W ratio were carried out at high temperatures in the air compared with Hastelloy XR. The conclusions were obtained as follows. (1) The oxidation resistance of the industrial scale heat of Ni-Cr-W superalloy with the optimized chemical composition was superior to that of Hastelloy XR. (2) The most excellent oxidation resistance was obtained in an alloy with 19% Cr of the industrial scale heat of Ni-Cr-W superalloy. (author)
Sintering behaviour and mechanical properties of Cr3C2–NiCr ...
Indian Academy of Sciences (India)
fracture toughness. Keywords. Cermet; Cr3C2–NiCr; sintering; mechanical properties. ... et al investigated the mechanical properties of VC, Cr3C2 and NbC doped ..... Huang S G, Li L, Van der Biest O and Vleugels J 2008 J. Alloys. Compds.
CR-39 track detector for multi-MeV ion spectroscopy.
Jeong, T W; Singh, P K; Scullion, C; Ahmed, H; Hadjisolomou, P; Jeon, C; Yun, H; Kakolee, K F; Borghesi, M; Ter-Avetisyan, S
2017-05-19
We present the characteristics of track formation on the front and rear surfaces of CR-39 produced by laser-driven protons and carbon ions. A methodological approach, based on bulk etch length, is proposed to uniquely characterize the particle tracks in CR-39, enabling comparative description of the track characteristics in different experiments. The response of CR-39 to ions is studied based on the energy dependent growth rate of the track diameter to understand the intrinsic particle stopping process within the material. A large non-uniformity in the track diameter is observed for CR-39 with thickness matching with the stopping range of particles. Simulation and experimental results show the imprint of longitudinal range straggling for energetic protons. Moreover, by exploiting the energy dependence of the track diameter, the energy resolution (δE/E) of CR-39 for few MeV protons and Carbon ion is found to be about 3%.
International Nuclear Information System (INIS)
Albertsson, E.; Larsson, D.G.J.; Foerlin, L.
2010-01-01
Carbonyl reductase/20β-hydroxysteroid dehydrogenase (CR/20β-HSD) serves both as a key enzyme in the gonadal synthesis of maturing-inducing hormone in salmonids, and as an enzyme protecting against certain reactive oxygen species. We have previously shown that mRNA of the hepatic CR/20β-HSD B isoform is increased in rainbow trout caged downstream from a Swedish sewage treatment plant. Here, we report an increase of both the A as well as B form in fish kept downstream from a second sewage treatment plant. The two mRNAs were also induced in fish hepatoma cells in vitro after exposure to effluent extract. This indicates that the effects observed in vivo could be a direct effect on the liver, i.e. the mRNA induction does not require a signal from any other organ. When fish were exposed in vivo to several effluents treated with more advanced methods (ozone, moving bed biofilm reactor or membrane bioreactor) the expression of hepatic mRNA CR/20β-HSD A and B was significantly reduced. Their abundance did not parallel the reduction of estrogen-responsive transcripts, in agreement with our previous observations that ethinylestradiol is not a potent inducer. Treatment with norethisterone, methyltestosterone or hydrocortisone in vivo did not induce the hepatic CR/20β-HSD A and B mRNA expression. In contrast, both isoforms were markedly induced by the aryl hydrocarbon receptor agonist β-naphthoflavone as well as by the pro-oxidant herbicide paraquat. We hypothesize that the induction of CR/20β-HSD A and B by sewage effluents could be due to anthropogenic contaminants stimulating the aryl hydrocarbon receptor and/or causing oxidative stress.
Cr(VI) occurrence and geochemistry in water from public-supply wells in California
Izbicki, John; Wright, Michael; Seymour, Whitney A.; McCleskey, R. Blaine; Fram, Miranda S.; Belitz, Kenneth; Esser, Bradley K.
2015-01-01
Hexavalent chromium, Cr(VI), in 918 wells sampled throughout California between 2004 and 2012 by the Groundwater Ambient Monitoring and Assessment-Priority Basin Project (GAMA-PBP) ranged from less than the study reporting limit of 1 microgram per liter (μg/L) to 32 μg/L. Statewide, Cr(VI) was reported in 31 percent of wells and equaled or exceeded the recently established (2014) California Maximum Contaminant Level (MCL) for Cr(VI) of 10 μg/L in 4 percent of wells. Cr(VI) data collected for regulatory purposes overestimated Cr(VI) occurrence compared to spatially-distributed GAMA-PBP data. Ninety percent of chromium was present as Cr(VI), which was detected more frequently and at higher concentrations in alkaline (pH ≥ 8), oxic water; and more frequently in agricultural and urban land uses compared to native land uses. Chemical, isotopic (tritium and carbon-14), and noble-gas data show high Cr(VI) in water from wells in alluvial aquifers in the southern California deserts result from long groundwater-residence times and geochemical reactions such as silicate weathering that increase pH, while oxic conditions persist. High Cr(VI) in water from wells in alluvial aquifers along the west-side of the Central Valley results from high-chromium in source rock eroded to form those aquifers, and areal recharge processes (including irrigation return) that can mobilize chromium from the unsaturated zone. Cr(VI) co-occurred with oxyanions having similar chemistry, including vanadium, selenium, and uranium. Cr(VI) was positively correlated with nitrate, consistent with increased concentrations in areas of agricultural land use and mobilization of chromium from the unsaturated zone by irrigation return.
In silico discovery of novel Retinoic Acid Receptor agonist structures
Directory of Open Access Journals (Sweden)
Samuels Herbert H
2001-06-01
Full Text Available Abstract Background Several Retinoic Acid Receptors (RAR agonists have therapeutic activity against a variety of cancer types; however, unacceptable toxicity profiles have hindered the development of drugs. RAR agonists presenting novel structural and chemical features could therefore open new avenues for the discovery of leads against breast, lung and prostate cancer or leukemia. Results We have analysed the induced fit of the active site residues upon binding of a known ligand. The derived binding site models were used to dock over 150,000 molecules in silico (or virtually to the structure of the receptor with the Internal Coordinates Mechanics (ICM program. Thirty ligand candidates were tested in vitro. Conclusions Two novel agonists resulting from the predicted receptor model were active at 50 nM. One of them displays novel structural features which may translate into the development of new ligands for cancer therapy.
Directory of Open Access Journals (Sweden)
Michael Gabl
Full Text Available We recently described a novel receptor cross-talk mechanism in neutrophils, unique in that the signals generated by the PAF receptor (PAFR and the ATP receptor (P2Y2R transfer formyl peptide receptor 1 (FPR1 from a desensitized (non-signaling state back to an actively signaling state (Forsman H et al., PLoS One, 8:e60169, 2013; Önnheim K, et al., Exp Cell Res, 323∶209, 2014. In addition to the G-protein coupled FPR1, neutrophils also express the closely related receptor FPR2. In this study we used an FPR2 specific pepducin, proposed to work as an allosteric modulator at the cytosolic signaling interface, to determine whether the cross-talk pathway is utilized also by FPR2. The pepducin used contains a fatty acid linked to a peptide sequence derived from the third intracellular loop of FPR2, and it activates as well as desensensitizes this receptor. We now show that neutrophils desensitized with the FPR2-specific pepducin display increased cellular responses to stimulation with PAF or ATP. The secondary PAF/ATP induced response was sensitive to FPR2-specific inhibitors, disclosing a receptor cross-talk mechanism underlying FPR2 reactivation. The pepducin induced an activity in naïve cells similar to that of a conventional FPR2 agonist, but with lower potency (partial efficacy, meaning that the pepducin is a partial agonist. The PAF- or ATP-induced reactivation was, however, much more pronounced when neutrophils had been desensitized to the pepducin as compared to cells desensitized to conventional agonists. The pepducin should thus in this respect be classified as a full agonist. In summary, we demonstrate that desensitized FPR2 can be transferred back to an actively signaling state by receptor cross-talk signals generated through PAFR and P2Y2R, and the difference in agonist potency with respect to pepducin-induced direct receptor activation and cross-talk reactivation of FPR2 puts the concept of functional selectivity in focus.
Czech Academy of Sciences Publication Activity Database
Folbergrová, Jaroslava; Druga, Rastislav; Haugvicová, Renata; Mareš, Pavel; Otáhal, Jakub
2008-01-01
Roč. 54, č. 4 (2008), s. 665-675 ISSN 0028-3908 R&D Projects: GA ČR GA309/02/1238; GA ČR(CZ) GA309/05/2015 Institutional research plan: CEZ:AV0Z50110509 Keywords : DL-homocysteic acid induced seizures * mGluR8 agonist (S)-3,4-DCPG * protection Subject RIV: FH - Neurology Impact factor: 3.383, year: 2008
Directory of Open Access Journals (Sweden)
Phillips JM
2011-07-01
Full Text Available E David Crawford, Jason M PhillipsUniversity of Colorado Health Sciences Center, Aurora, CO, USAAbstract: Two different 6-month GnRH agonist depot formulations approved for palliative treatment of advanced and metastatic prostate cancer in the United States – leuprolide acetate 45 mg and triptorelinpalmoate 22.5 mg – provide patients with efficacy and safety comparable to those of existing 1-, 3-, and 4-month GnRH agonist depots. However, the 6-month formulations can increase patient convenience, comfort, and compliance by reducing the number of physician visits and injections required. At the conclusion of their pivotal trials, the 6-month formulations demonstrated efficacy rates in achieving chemical castration (serum testosterone #50 ng/dL that ranged between 93% and 99%. As with existing GnRH agonist depot formulations, hot flashes represented the most common adverse event reported in trials of 6-month leuprolide acetate or triptorelin. As such, these products may prove useful not only for their labeled indication, but also as adjuncts to other treatments such as radical prostatectomy, radiotherapy, and chemotherapy. We recommend further research, including head-to-head trials between the 6-month GnRH depots, to refine our understanding of these products.Keywords: prostate cancer, leuprorelin, leuprolide, triptorelin, 6-month depot, testosterone
Substrate temperature effects on reactively sputtered Cr2O3/n-Si heterojunctions
International Nuclear Information System (INIS)
Ocak, Yusuf Selim; Genisel, Mustafa Fatih; Issa, Ali Ahmed; Tombak, Ahmet; Kilicoglu, Tahsin
2016-01-01
To see the effects of substrate temperature on Cr 2 O 3 /n-Si heterojunctions, Cr 2 O 3 thin films were formed on n-Si and glass substrates at 40, 150 and 250 °C by radio frequency (RF) reactive sputtering technique. High purity Cr was used as target and oxygen was used as reactive gas. Optical properties of Cr 2 O 3 /n-Si thin films were analyzed using UV-vis data. The band gaps of the films were compared. The electrical properties of Cr 2 O 3 /n-Si heterojunction were tested by their current voltage ( I-V ) measurements in dark. It was observed that the heterojunction which was fabricated by forming Cr 2 O 3 thin film at 250 °C gave better rectification. The characteristic electrical parameters such as barrier height, ideality factor and series resistance were calculated by using its I-V data. The influence of light intensity on photovoltaic effect behavior of the device was also calculated, finally the barrier height value of the structure obtained from capacitance-voltage ( C-V ) data were compared with the one calculated from I-V measurements. (paper)
PPAR Agonists and Metabolic Syndrome: An Established Role?
Directory of Open Access Journals (Sweden)
Margherita Botta
2018-04-01
Full Text Available Therapeutic approaches to metabolic syndrome (MetS are numerous and may target lipoproteins, blood pressure or anthropometric indices. Peroxisome proliferator-activated receptors (PPARs are involved in the metabolic regulation of lipid and lipoprotein levels, i.e., triglycerides (TGs, blood glucose, and abdominal adiposity. PPARs may be classified into the α, β/δ and γ subtypes. The PPAR-α agonists, mainly fibrates (including newer molecules such as pemafibrate and omega-3 fatty acids, are powerful TG-lowering agents. They mainly affect TG catabolism and, particularly with fibrates, raise the levels of high-density lipoprotein cholesterol (HDL-C. PPAR-γ agonists, mainly glitazones, show a smaller activity on TGs but are powerful glucose-lowering agents. Newer PPAR-α/δ agonists, e.g., elafibranor, have been designed to achieve single drugs with TG-lowering and HDL-C-raising effects, in addition to the insulin-sensitizing and antihyperglycemic effects of glitazones. They also hold promise for the treatment of non-alcoholic fatty liver disease (NAFLD which is closely associated with the MetS. The PPAR system thus offers an important hope in the management of atherogenic dyslipidemias, although concerns regarding potential adverse events such as the rise of plasma creatinine, gallstone formation, drug–drug interactions (i.e., gemfibrozil and myopathy should also be acknowledged.
Directory of Open Access Journals (Sweden)
Yiyi Sun
Full Text Available Adiponectin, the adipose-derived hormone, plays an important role in the suppression of metabolic disorders that can result in type 2 diabetes, obesity, and atherosclerosis. It has been shown that up-regulation of adiponectin or adiponectin receptor has a number of therapeutic benefits. Given that it is hard to convert the full size adiponectin protein into a viable drug, adiponectin receptor agonists could be designed or identified using high-throughput screening. Here, we report on the development of a two-step screening process to identify adiponectin agonists. First step, we developed a high throughput screening assay based on fluorescence polarization to identify adiponectin ligands. The fluorescence polarization assay reported here could be adapted to screening against larger small molecular compound libraries. A natural product library containing 10,000 compounds was screened and 9 hits were selected for validation. These compounds have been taken for the second-step in vitro tests to confirm their agonistic activity. The most active adiponectin receptor 1 agonists are matairesinol, arctiin, (--arctigenin and gramine. The most active adiponectin receptor 2 agonists are parthenolide, taxifoliol, deoxyschizandrin, and syringin. These compounds may be useful drug candidates for hypoadiponectin related diseases.
Gil-Cardeza, María L; Ferri, Alejandro; Cornejo, Pablo; Gomez, Elena
2014-09-15
The accumulation of Cr in soil could be highly toxic to human health; therefore Cr soil distribution was studied in rhizosphere soils from Ricinus communis and Conium maculatum and bare soil (BS) from an industrial and urban area in Argentina. Total Cr, Cr(VI) and Cr(III) concentrations were determined in 3 soil fractions: total, extractable and associated to total-glomalin-related protein (T-GRSP). BS had the highest total Cr and total Cr(VI) concentrations. Total Cr(VI) concentration from both rhizosphere soils did not differ from the allowed value for residential area in Argentina (8 μg Cr(VI) g(-1) soil), while total Cr(VI) in BS was 1.8 times higher. Total Cr concentration in all the soils was higher than the allowed value (250 μg Cr g(-1) soil). Extractable and associated to T-GRSP Cr(VI) concentrations were below the detection limit. Cr(III) bound to T-GRSP was the highest in the BS. These findings are in agreement with a long term effect of glomalin in sequestrating Cr. In both plant species, total Cr was higher in root than in shoot and both species presented arbuscular mycorrhizal fungi (AMF). As far as we know, this is the first study that reports the presence of Cr in T-GRSP fraction of soil organic matter. These findings suggest that Cr mycorrhizostabilization could be a predominant mechanism used by R. communis and C. maculatum to diminish Cr soil concentration. Nevertheless, further research is needed to clarify the contribution of native AMF isolated from R. communis and C. maculatum rhizosphere to the Cr phytoremediation process. Copyright © 2014 Elsevier B.V. All rights reserved.
The Effects of Cr and Al Addition on Transformation and Properties in Low‐Carbon Bainitic Steels
Directory of Open Access Journals (Sweden)
Junyu Tian
2017-01-01
Full Text Available Three low‐carbon bainitic steels were designed to investigate the effects of Cr and Al addition on bainitic transformation, microstructures, and properties by metallographic method and dilatometry. The results show that compared with the base steel without Cr and Al addition, only Cr addition is effective for improving the strength of low‐carbon bainitic steel by increasing the amount of bainite. However, compared with the base steel, combined addition of Cr and Al has no significant effect on bainitic transformation and properties. In Cr‐bearing steel, Al addition accelerates initial bainitic transformation, but meanwhile reduces the final amount of bainitic transformation due to the formation of a high‐temperature transformation product such as ferrite. Consequently, the composite strengthening effect of Cr and Al addition is not effective compared with individual addition of Cr in low‐carbon bainitic steels. Therefore, in contrast to high‐carbon steels, bainitic transformation in Cr‐bearing low‐carbon bainitic steels can be finished in a short time, and Al should not be added because Al addition would result in lower mechanical properties.
Black Cr/α-Cr2O3 nanoparticles based solar absorbers
International Nuclear Information System (INIS)
Khamlich, S.; Nemraoui, O.; Mongwaketsi, N.; McCrindle, R.; Cingo, N.; Maaza, M.
2012-01-01
Monodisperse spherical core–shell particles of Cr/α-Cr 2 O 3 with high adhesion were successfully coated on rough copper substrates by a simple self-assembly-like method for the use in solar thermal absorbers. The structure and morphology of the core-shell particles of Cr/α-Cr 2 O 3 were effectively controlled by deposition temperature and the pH of the initial precursor solution. Their characterizations were carried out with X-ray diffraction, scanning electron microscopy, energy dispersive spectrometry and attenuated total reflection, as well as UV–vis diffuse reflectance spectroscopy. The samples aged for more than 40 h at 75 °C exhibit the targeted high absorbing optical characteristic “Black chrome” while those aged for ≤40 h show a significant high UV–vis diffuse reflectance “green color”.
International Nuclear Information System (INIS)
McCormick, Patrick N.; Kapur, Shitij; Seeman, Philip; Wilson, Alan A.
2008-01-01
Introduction: In vitro, the dopamine D2 receptor exists in two states, with high and low affinity for agonists. The high-affinity state is the physiologically active state thought to be involved in dopaminergic illnesses such as schizophrenia. The positron emission tomography radiotracer [ 11 C](+)-PHNO ([ 11 C](+)-4-propyl-3,4,4a,5,6,10b-hexahydro-2H-naphtho[1,2-b][1,4] oxazin-9-o l), being a D2 agonist, should selectively label the high-affinity state at tracer dose and therefore be more susceptible to competition by agonist as compared to the antagonist [ 3 H]raclopride, which binds to both affinity states. Methods: We tested this prediction using ex vivo dual-radiotracer experiments in conscious rats. D2 antagonists (haloperidol or clozapine), a partial agonist (aripiprazole), a full agonist [(-)-NPA] or the dopamine-releasing drug amphetamine (AMPH) were administered to rats prior to an intravenous coinjection of [ 11 C](+)-PHNO and [ 3 H]raclopride. Rats were sacrificed 60 min after radiotracer injection. Striatum, cerebellum and plasma samples were counted for 11 C and 3 H. The specific binding ratio {SBR, i.e., [%ID/g (striatum)-%ID/g (cerebellum)]/(%ID/g (cerebellum)} was used as the outcome measure. Results: In response to D2 antagonists, partial agonist or full agonist, [ 11 C](+)-PHNO and [ 3 H]raclopride SBRs responded indistinguishably in terms of both ED 50 and Hill slope (e.g., (-)-NPA ED 50 values are 0.027 and 0.023 mg/kg for [ 11 C](+)-PHNO and [ 3 H]raclopride, respectively). In response to AMPH challenge, [ 11 C](+)-PHNO and [ 3 H]raclopride SBRs were inhibited to the same degree. Conclusions: We have shown that the SBRs of [ 11 C](+)-PHNO- and [ 3 H]raclopride do not differ in their response to agonist challenge. These results do not support predictions of the in vivo binding behavior of a D2 agonist radiotracer and cast some doubt on the in vivo applicability of the D2 two-state model, as described by in vitro binding experiments
Agonist-induced desensitization of adenylyl cyclase in Y1 adrenocortical tumor cells
International Nuclear Information System (INIS)
Olson, M.F.; Tsao, J.; Pon, D.J.; Schimmer, B.P.
1991-01-01
Y1 adrenocortical tumor cells (Y1DS) and Y1 mutants resistant to ACTH-induced desensitization of adenylyl cyclase (Y1DR) were transfected with a gene encoding the mouse beta 2-adrenergic receptor (beta 2-AR). Transfectants expressed beta 2-ARs that were able to stimulate adenylyl cyclase activity and steroid biosynthesis. These transfectants were used to explore the basis for the DR mutation in Y1 cells. The authors demonstrate that beta-adrenergic agonists desensitize the adenylyl cyclase system in transfected Y1DS cells whereas transfected Y1DR cells are resistant to desensitization by beta-adrenergic agonists. The fate of the beta 2-ARs during desensitization was evaluated by photoaffinity labelling with [125I]iodocyanopindolol diazerine. Desensitization of Y1DS transfectants was accompanied by a modest loss in receptor density that was insufficient to account for the complete loss of responsiveness to beta-adrenergic agonists. The extent of receptor loss induced by beta-adrenergic agonists in Y1DR transfectants exceeded that in the Y1DS transfectants indicating that the mutation which protects Y1DR cells from agonist-induced desensitization is prior to receptor down-regulation in the desensitization pathway. From these results we infer that ACTH and isoproterenol desensitize adenylyl cyclase by a common pathway and that receptor loss is not a major component of the desensitization process in these cells
PPAR agonists reduce steatosis in oleic acid-overloaded HepaRG cells
International Nuclear Information System (INIS)
Rogue, Alexandra; Anthérieu, Sébastien; Vluggens, Aurore; Umbdenstock, Thierry; Claude, Nancy; Moureyre-Spire, Catherine de la; Weaver, Richard J.; Guillouzo, André
2014-01-01
Although non-alcoholic fatty liver disease (NAFLD) is currently the most common form of chronic liver disease there is no pharmacological agent approved for its treatment. Since peroxisome proliferator-activated receptors (PPARs) are closely associated with hepatic lipid metabolism, they seem to play important roles in NAFLD. However, the effects of PPAR agonists on steatosis that is a common pathology associated with NAFLD, remain largely controversial. In this study, the effects of various PPAR agonists, i.e. fenofibrate, bezafibrate, troglitazone, rosiglitazone, muraglitazar and tesaglitazar on oleic acid-induced steatotic HepaRG cells were investigated after a single 24-hour or 2-week repeat treatment. Lipid vesicles stained by Oil-Red O and triglycerides accumulation caused by oleic acid overload, were decreased, by up to 50%, while fatty acid oxidation was induced after 2-week co-treatment with PPAR agonists. The greatest effects on reduction of steatosis were obtained with the dual PPARα/γ agonist muraglitazar. Such improvement of steatosis was associated with up-regulation of genes related to fatty acid oxidation activity and down-regulation of many genes involved in lipogenesis. Moreover, modulation of expression of some nuclear receptor genes, such as FXR, LXRα and CAR, which are potent actors in the control of lipogenesis, was observed and might explain repression of de novo lipogenesis. Conclusion: Altogether, our in vitro data on steatotic HepaRG cells treated with PPAR agonists correlated well with clinical investigations, bringing a proof of concept that drug-induced reversal of steatosis in human can be evaluated in in vitro before conducting long-term and costly in vivo studies in animals and patients. - Highlights: • There is no pharmacological agent approved for the treatment of NAFLD. • This study demonstrates that PPAR agonists can reduce fatty acid-induced steatosis. • Some nuclear receptors appear to be potent actors in the control
PPAR agonists reduce steatosis in oleic acid-overloaded HepaRG cells
Energy Technology Data Exchange (ETDEWEB)
Rogue, Alexandra [Inserm UMR 991, 35043 Rennes Cedex (France); Université de Rennes 1, Faculté des Sciences Pharmaceutiques et Biologiques, 35043 Rennes Cedex (France); Biologie Servier, Gidy (France); Anthérieu, Sébastien; Vluggens, Aurore [Inserm UMR 991, 35043 Rennes Cedex (France); Université de Rennes 1, Faculté des Sciences Pharmaceutiques et Biologiques, 35043 Rennes Cedex (France); Umbdenstock, Thierry [Technologie Servier, Orléans (France); Claude, Nancy [Institut de Recherches Servier, Courbevoie (France); Moureyre-Spire, Catherine de la; Weaver, Richard J. [Biologie Servier, Gidy (France); Guillouzo, André, E-mail: Andre.Guillouzo@univ-rennes1.fr [Inserm UMR 991, 35043 Rennes Cedex (France); Université de Rennes 1, Faculté des Sciences Pharmaceutiques et Biologiques, 35043 Rennes Cedex (France)
2014-04-01
Although non-alcoholic fatty liver disease (NAFLD) is currently the most common form of chronic liver disease there is no pharmacological agent approved for its treatment. Since peroxisome proliferator-activated receptors (PPARs) are closely associated with hepatic lipid metabolism, they seem to play important roles in NAFLD. However, the effects of PPAR agonists on steatosis that is a common pathology associated with NAFLD, remain largely controversial. In this study, the effects of various PPAR agonists, i.e. fenofibrate, bezafibrate, troglitazone, rosiglitazone, muraglitazar and tesaglitazar on oleic acid-induced steatotic HepaRG cells were investigated after a single 24-hour or 2-week repeat treatment. Lipid vesicles stained by Oil-Red O and triglycerides accumulation caused by oleic acid overload, were decreased, by up to 50%, while fatty acid oxidation was induced after 2-week co-treatment with PPAR agonists. The greatest effects on reduction of steatosis were obtained with the dual PPARα/γ agonist muraglitazar. Such improvement of steatosis was associated with up-regulation of genes related to fatty acid oxidation activity and down-regulation of many genes involved in lipogenesis. Moreover, modulation of expression of some nuclear receptor genes, such as FXR, LXRα and CAR, which are potent actors in the control of lipogenesis, was observed and might explain repression of de novo lipogenesis. Conclusion: Altogether, our in vitro data on steatotic HepaRG cells treated with PPAR agonists correlated well with clinical investigations, bringing a proof of concept that drug-induced reversal of steatosis in human can be evaluated in in vitro before conducting long-term and costly in vivo studies in animals and patients. - Highlights: • There is no pharmacological agent approved for the treatment of NAFLD. • This study demonstrates that PPAR agonists can reduce fatty acid-induced steatosis. • Some nuclear receptors appear to be potent actors in the control
Combining GLP-1 receptor agonists with insulin
DEFF Research Database (Denmark)
Holst, Jens Juul; Vilsbøll, T
2013-01-01
Due to the increasing prevalence of type 2 diabetes mellitus (T2DM), the emergent trend towards diagnosis in younger patients and the progressive nature of this disease, many more patients than before now require insulin to maintain glycaemic control. However, there is a degree of inertia among...... physicians and patients regarding the initiation and intensification of insulin therapy, in part due to concerns about the associated weight gain and increased risk of hypoglycaemia. Glucagon-like peptide-1 receptor agonists (GLP-1RAs) increase insulin release and suppress glucagon secretion in a glucose......, compared with insulin, the antihyperglycaemic efficacy of GLP-1RAs is limited. The combination of a GLP-1RA and insulin might thus be highly effective for optimal glucose control, ameliorating the adverse effects typically associated with insulin. Data from clinical studies support the therapeutic...
Isotope Effects in the Bonds of beta-CrOOH and beta-CrOOD
DEFF Research Database (Denmark)
Nørlund Christensen, A.; Hansen, P.; Lehmann, M. S.
1976-01-01
Samples of orthorhombic chromium oxide hydroxide, beta -CrOOH, and the deuterated compound, beta -CrOOD, were prepared hydrothermally. The crystal structures were determined by powder profile refinement technique using neutron diffraction data. Unit cells are: beta -CrOOH: a equals 4. 862(2) A, b...... equals 4. 298(a) A, c equals 2. 995(1) A; beta -CrOOD: a equals 4. 873(5) A, b equals 4. 332(7) A, c equals 2. 963(2) A, with Z equals 2. The space group is P2//1nm or Pnnm....
Investigation of the mechanism of radioprotective action of adrenoceptor agonists
International Nuclear Information System (INIS)
Kulinskij, V.I.; Klimova, A.D.; Yashunskij, V.G.; Alpatova, T.V.; 4205700SU)
1986-01-01
α-Adrenoceptor agonists of both main groups, i.e. arylalkylamines and imidazolines, have a pronounced radioprotective effect. Their chemical analogs, which fail to stimulate α-adrenoceptors, do not protect mice. The effect of phenylephrine, adrenaline, and noradrenaline comes into play via α 1 -adrenoceptors and that of clonidine, via α 2 -adrenoceptors and also via α 1 -adrenoceptors. Adrenoceptor agonists can probably manifest their radioprotective action via both subtypes of α-adrenoceptors. Possible intracellular mechanisms of the radioprotective action are discussed
Institute of Scientific and Technical Information of China (English)
无
2003-01-01
The density of liquid Ni-Cr alloy was measured by a modified sessile drop method. The density of liquid Ni-Cr alloywas found to decrease with increasing temperature and Cr concentration in the alloy. The molar volume of liquidNi-Cr alloy increases with increasing the Cr concentration in the alloy. The molar volume of Ni-Cr alloy determinedin the present work shows a positive deviation from the linear molar volume.
Femtosecond Cr:LiSAF and Cr:LiCAF lasers pumped by tapered diode lasers.
Demirbas, Umit; Schmalz, Michael; Sumpf, Bernd; Erbert, Götz; Petrich, Gale S; Kolodziejski, Leslie A; Fujimoto, James G; Kärtner, Franz X; Leitenstorfer, Alfred
2011-10-10
We report compact, low-cost and efficient Cr:Colquiriite lasers that are pumped by high brightness tapered laser diodes. The tapered laser diodes provided 1 to 1.2 W of output power around 675 nm, at an electrical-to-optical conversion efficiency of about 30%. Using a single tapered diode laser as the pump source, we have demonstrated output powers of 500 mW and 410 mW together with slope efficiencies of 47% and 41% from continuous wave (cw) Cr:LiSAF and Cr:LiCAF lasers, respectively. In cw mode-locked operation, sub-100-fs pulse trains with average power between 200 mW and 250 mW were obtained at repetition rates around 100 MHz. Upon pumping the Cr:Colquiriite lasers with two tapered laser diodes (one from each side of the crystal), we have observed scaling of cw powers to 850 mW in Cr:LiSAF and to 650 mW in Cr:LiCAF. From the double side pumped Cr:LiCAF laser, we have also obtained ~220 fs long pulses with 5.4 nJ of pulse energy at 77 MHz repetition rate. These are the highest energy levels reported from Cr:Colquiriite so far at these repetition rates. Our findings indicate that tapered diodes in the red spectral region are likely to become the standard pump source for Cr:Colquiriite lasers in the near future. Moreover, the simplified pumping scheme might facilitate efficient commercialization of Cr:Colquiriite systems, bearing the potential to significantly boost applications of cw and femtosecond lasers in this spectral region (750-1000 nm).
Uche, O K; Ofeimun, J O
2017-12-30
The mechanism of kolaviron-induced vascular smooth muscles (VSMs) responses has not been fullycharacterised. The present study investigated the effect and mode of action of kolaviron a biflavanoid-complex and majorcomponent of Garcinia Kola-fraction on differential contractile responses to agonists-[phenylephrine (PHE) and histamine(HIST)] on VSMs of rabbit isolated aortic rings in K+-free physiological salt solution (KFPSS). Cumulative concentrationresponses to PHE and HIST were examined on 2 mm ring segments of the thoracic aortae which were suspended in 20 mlorgan baths containing physiological salt solution (PSS) for measurement of isometric contractions, at 370C and pH 7.4. Themedium was bubbled with 95% O2, 5% CO2, and rings were given an initial load of 1g. Cumulative contractile responses tothe agonists were studied in normal PSS (control) and following 30 minutes exposure to K+-free PSS and/or 800µg/mLkolaviron. Contractile responses were expressed as percentage of 80 mM K+ contractions in normal PSS. Maximalcontractions (Emax) induced by PHE and HIST compared with high K+ contraction in the various preparations weredifferentially altered following exposure to K+-free or 800µg/mL kolaviron in both intact (+E) and endotheliumdenuded (-E) rings. Based on the efficacy (Emax) and potency (EC50) values for the dose-response curves of the agonists, it isconcluded that enhanced differential contractile responses elicited by agonists in K+-free PSS were significantly attenuatedby kolaviron concentration-dependently. This observation probably suggests the existence of another pathway of kolavironmode of action in vascular smooth muscle reactivity.
Directory of Open Access Journals (Sweden)
Youqing Sun
2018-05-01
Full Text Available Dissimilar CuNiCrSi and CuCrZr butt joints were successfully frictionstirwelded at constant welding speed of 150 mm/min and rotational speed of 1400 rpm with the CuCrZr alloy or the CuNiCrSi alloy located on the advancing side (AS. The microstructure and mechanical properties of joints were investigated. When the CuCrZr alloy was located on the AS, the area of retreating material in the nugget zone was a little bigger. The Cr solute-rich particles were found in the nugget zone on CuCrZr side (CuCrZr-NZ while a larger density of solute-rich particles identified as the concentration of Cr and Si element was found in the nugget zone on CuNiCrSi side (CuNiCrSi-NZ. The Cr precipitates and δ-Ni2Si precipitates were found in the base metal on CuNiCrSi side (CuNiCrSi-BM but only Cr precipitates can be observed in the base metal on CuCrZr side (CuCrZr-BM. Precipitates were totally dissolved into Cu matrix in both CuCrZr-NZ and CuNiCrSi-NZ, which led to a sharp decrease in both micro-hardness and tensile strength from BM to NZ. When the CuNiCrSi was located on the AS, the tensile testing results showed the fracture occurred at the CuCrZr-NZ, while the fracture was found at the mixed zone of CuNiCrSi-NZ and CuCrZr-NZ for the other case.
53Cr NMR study of CuCrO2 multiferroic
Smol'nikov, A. G.; Ogloblichev, V. V.; Verkhovskii, S. V.; Mikhalev, K. N.; Yakubovskii, A. Yu.; Kumagai, K.; Furukawa, Y.; Sadykov, A. F.; Piskunov, Yu. V.; Gerashchenko, A. P.; Barilo, S. N.; Shiryaev, S. V.
2015-11-01
The magnetically ordered phase of the CuCrO2 single crystal has been studied by the nuclear magnetic resonance (NMR) method on 53Cr nuclei in the absence of an external magnetic field. The 53Cr NMR spectrum is observed in the frequency range νres = 61-66 MHz. The shape of the spectrum depends on the delay tdel between pulses in the pulse sequence τπ/2- t del-τπ- t del-echo. The spin-spin and spin-lattice relaxation times have been measured. Components of the electric field gradient, hyperfine fields, and the magnetic moment on chromium atoms have been estimated.
Heterogeneity of Cr in Mytilus edulis: Implications for the Cr isotope system as a paleo-redox proxy
Bruggmann, Sylvie; Klaebe, Robert; Frei, Robert
2017-04-01
Changes in 53Cr/52Cr (δ53Cr) values recorded by biogenic carbonates are emerging as a proxy for variations in the redox state of the Earth's oceans and atmosphere (e.g. [1], [2]). We investigate the ability of modern carbonate shells (Mytilus edulis) to record the δ53Cr composition of ambient seawater in order to assess their utility as a paleo-redox proxy. Samples of cultivated M. edulis from the Kiel Fjord, Germany, were analyzed for their δ53Cr composition and Cr concentrations [Cr] using TIMS. To disentangle the pathway of Cr into the carbonate shell, a series of step-digestions of their organic outer sheaths (periostraca) and their intra-layer composition were performed. Bulk analyses of specimens with intact periostraca returned 16 to 34 ppb Cr with δ53Cr values ranging from 0.28 to 0.65 ± 0.1 (2SE) and thus fall within the range of surface seawater from the Baltic Sea (0.3 - 0.6 \\permil [3]). Partial removal of periostraca resulted in lower [Cr] (5 to 17 ppb) and δ53Cr values (-0.05 ± 0.15 \\permil). These results show a positive correlation between the amount of organic matter present in a sample and both [Cr] and δ53Cr (n = 9). With nearly complete removal of periostraca, the remaining [Cr] is significantly lower (less than 5 ppb) and can only be accessed by incineration of the carbonate shell. The correlation between [Cr], δ53Cr and the amount of periostracum present in bulk samples indicates that a significant proportion of preserved Cr may be associated with the organic outer sheath. The Cr endmember accessed after incineration is less likely associated with the carbonate crystal lattice. Instead, the δ53Cr values obtained after incineration are similar to those reported from terrestrial rocks, suggesting the influence of detrital particles. Alternatively, Cr may be reduced and subsequently re-oxidized during the mineralization of biogenic carbonates [4]. Seasonal changes in primary productivity in seawater may further influence the shell
Directory of Open Access Journals (Sweden)
Luyao Zhao
Full Text Available In this paper, high-throughput RNA-sequencing (RNA-seq was used to search for transcriptional biomarkers for β2-agonists. In combination with drug mechanisms, a smaller group of genes with higher detection accuracy was screened out. Unknown samples were first predicted by this group of genes, and liquid chromatograph tandem mass spectrometer (LC-MS/MS was applied to positive samples to validate the biomarkers. The results of principal component analysis (PCA, hierarchical cluster analysis (HCA and discriminant analysis (DA indicated that the eight genes screened by high-throughput RNA-seq were able to distinguish samples in the experimental group and control group. Compared with the nine genes selected from an earlier literature, 17 genes including these nine genes were proven to have a more satisfactory effect, which validated the accuracy of gene selection by RNA-seq. Then, six key genes were selected from the 17 genes according to the variable importance in projection (VIP value of greater than 1. The test results using the six genes and 17 genes were similar, revealing that the six genes were critical genes. By using the six genes, three positive samples possibly treated with drugs were screened out from 25 unknown samples through DA and partial least squares discriminant analysis (PLS-DA. Then, the three samples were verified by a standard method, and mapenterol was detected in a sample. Therefore, the six genes can be used as biomarkers to detect β2-agonists. Compared with the previous study, accurate detection of β2-agonists abuse using six key genes is an improvement method, which show great significance in the monitoring of β2-agonists abuse in animal husbandry.
Results from CrIS/ATMS Obtained Using an "AIRS Version-6 Like" Retrieval Algorithm
Susskind, Joel; Kouvaris, Louis; Iredell, Lena; Blaisdell, John
2015-01-01
AIRS and CrIS Version-6.22 O3(p) and q(p) products are both superior to those of AIRS Version-6.Monthly mean August 2014 Version-6.22 AIRS and CrIS products agree reasonably well with OMPS, CERES, and witheach other. JPL plans to process AIRS and CrIS for many months and compare interannual differences. Updates to thecalibration of both CrIS and ATMS are still being finalized. We are also working with JPL to develop a joint AIRS/CrISlevel-1 to level-3 processing system using a still to be finalized Version-7 retrieval algorithm. The NASA Goddard DISCwill eventually use this system to reprocess all AIRS and recalibrated CrIS/ATMS. .
Directory of Open Access Journals (Sweden)
Morten S Thomsen
Full Text Available The α7 nicotinic acetylcholine receptor (nAChR is a potential target for the treatment of cognitive deficits in patients with schizophrenia, ADHD and Alzheimer's disease. Here we test the hypothesis that upregulation of α7 nAChR levels underlies the enhanced and sustained procognitive effect of repeated administration of α7 nAChR agonists. We further compare the effect of agonists to that of α7 nAChR positive allosteric modulators (PAMs, which do not induce upregulation of the α7 nAChR. Using the social discrimination test as a measure of short-term memory, we show that the α7 nAChR agonist A-582941 improves short-term memory immediately after repeated (7× daily, but not a single administration. The α7 nAChR PAMs PNU-120596 and AVL-3288 do not affect short-term memory immediately after a single or repeated administration. This demonstrates a fundamental difference in the behavioral effects of agonists and PAMs that may be relevant for clinical development. Importantly, A-582941 and AVL-3288 increase short-term memory 24 hrs after repeated, but not a single, administration, suggesting that repeated administration of both agonists and PAMs may produce sustained effects on cognitive performance. Subsequent [(125I]-bungarotoxin autoradiography revealed no direct correlation between α7 nAChR levels in frontal cortical or hippocampal brain regions and short-term memory with either compound. Additionally, repeated treatment with A-582941 did not affect mRNA expression of RIC-3 or the lynx-like gene products lynx1, lynx2, PSCA, or Ly6H, which are known to affect nAChR function. In conclusion, both α7 nAChR agonists and PAMs exhibit sustained pro-cognitive effects after repeated administration, and altered levels of the α7 nAChR per se, or that of endogenous regulators of nAChR function, are likely not the major cause of this effect.
Directory of Open Access Journals (Sweden)
José Calleja
2012-09-01
Full Text Available Introduction: Attention deficit hyperactivity disorder (ADHD is generally treated with pharmacological interventions; psychostimulants are first choice. Other alternatives have been used such as alpha agonists (clonidine, hence it is important to know its effectiveness and safety. Purpose: To identify, synthesize and evaluate the best available evidence on the effectiveness and safety of alpha agonists in treating ADHD in the 6-19 year-old population. Methods: A systematic review of intervention studies that evaluated effectiveness comparing alpha agonists to methylphenidate was conducted. Outcomes measured were educational performance, psychosocial functioning, quality of life and adverse effects. The following databases were searched up to February 2012 in English and Spanish: PubMed/MEDLINE, Lilacs, Cochrane, DARE and National Guideline Clearinghouse. The articles that met the inclusion criteria were assessed by two researchers independently. Results: Of the 34 studies found initially, three were included, among which a systematic review and two clinical guidelines. Conclusions: Clonidine is considered an effective second and third line treatment for ADHD symptoms, but it is less effective than stimulants. Its use is associated with many side effects.
Phase stability and elastic properties of Cr-V alloys
Gao, M. C.; Suzuki, Y.; Schweiger, H.; Doǧan, Ö. N.; Hawk, J.; Widom, M.
2013-02-01
V is the only element in the periodic table that forms a complete solid solution with Cr and thus is particularly important in alloying strategy to ductilize Cr. This study combines first-principles density functional theory calculations and experiments to investigate the phase stability and elastic properties of Cr-V binary alloys. The cluster expansion study reveals the formation of various ordered compounds at low temperatures that were not previously known. These compounds become unstable due to the configurational entropy of bcc solid solution as the temperature is increased. The elastic constants of ordered and disordered compounds are calculated at both T = 0 K and finite temperatures. The overall trends in elastic properties are in agreement with measurements using the resonant ultrasound spectroscopy method. The calculations predict that addition of V to Cr decreases both the bulk modulus and the shear modulus, and enhances the Poisson’s ratio, in agreement with experiments. Decrease in the bulk modulus is correlated to decrease in the valence electron density and increase in the lattice constant. An enhanced Poisson’s ratio for bcc Cr-V alloys (compared to pure Cr) is associated with an increased density of states at the Fermi level. Furthermore, the difference charge density in the bonding region in the (110) slip plane is highest for pure Cr and decreases gradually as V is added. The present calculation also predicts a negative Cauchy pressure for pure Cr, and it becomes positive upon alloying with V. The intrinsic ductilizing effect from V may contribute, at least partially, to the experimentally observed ductilizing phenomenon in the literature.
Babechuk, Michael G.; Kleinhanns, Ilka C.; Reitter, Elmar; Schoenberg, Ronny
2018-02-01
The stable Cr isotope fractionation preserved in natural substances has been attributed predominantly to Cr(III)-Cr(VI) redox transformations. However, non-redox reaction pathways (e.g., ligand-promoted dissolution, ligand exchange, adsorption of Cr(III)) are liable to contribute to isotopic fractionation in natural systems given that soluble Cr(III)-ligands have been directly documented or modeled in several marine, continental, and hydrothermal environments. This study isolates the stable Cr isotope fractionation accompanying Cl-H2O ligand exchange during the transformation of three aqueous species in the Cr(III)-Cl-H2O system, [CrCl2(H2O)4]+aq (abr. CrCl2+ or S1), [CrCl(H2O)5]2+aq (abr. CrCl2+ or S2), and [Cr(H2O)6]3+aq (abr. Cr3+ or S3), at low pH (≤2). In dilute HCl (0.01 to 1 M), Cr3+ is the kinetically favoured species and transformation of CrCl2+ to CrCl2+ to Cr3+ via 2 steps of dechlorination/hydrolyzation begins immediately upon dissolution of a Cr(III)-Cl solid. Individual species are separated with cation exchange chromatography at different stages of transformation and inter- and intra-species (across an elution peak of one species) isotopic fractionation of up to 1 and 2‰ (δ53/52Cr), respectively, is documented. Comparison of peak elution characteristics with Cr-Cl-H-O isotopologue mass abundances suggests mass-dependent sorting of isotopologues alone cannot explain intra-species fractionation, supporting a previously published proposal that preferential adsorption of light Cr isotopes on the resin is driven by vibrational energy effects. The transformation of CrCl2+ to CrCl2+ is faster than CrCl2+ to Cr3+ and the rates of both transformations increase with solution pH. Preferential reaction of light Cr(III) isotopes into product species occurs during each transformation, consistent with closed-system, kinetic fractionation during Cl-H2O ligand exchange. Inter-species fractionation is assessed using time-series experiments beginning from the
Reduction of Cr(VI) to Cr(III) using silicon nanowire arrays under visible light irradiation
Energy Technology Data Exchange (ETDEWEB)
Fellahi, Ouarda [Institut d' Electronique, de Microélectronique et de Nanotechnologie (IEMN), UMR CNRS 8520, Avenue Poincaré—BP 70478, 59652 Villeneuve d' Ascq Cedex (France); Centre de Recherche en Technologie des Semi-conducteurs pour l' Energétique-CRTSE 02, Bd Frantz Fanon, BP. 140, Alger 7 Merveilles (Algeria); Barras, Alexandre [Institut d' Electronique, de Microélectronique et de Nanotechnologie (IEMN), UMR CNRS 8520, Avenue Poincaré—BP 70478, 59652 Villeneuve d' Ascq Cedex (France); Pan, Guo-Hui [State Key Laboratory of Luminescence and Applications, Changchun Institute of Optics, Fine Mechanics and Physics, Chinese Academy of Sciences, 3888 Dong Nanhu Road, Changchun 130033 (China); Coffinier, Yannick [Institut d' Electronique, de Microélectronique et de Nanotechnologie (IEMN), UMR CNRS 8520, Avenue Poincaré—BP 70478, 59652 Villeneuve d' Ascq Cedex (France); Hadjersi, Toufik [Centre de Recherche en Technologie des Semi-conducteurs pour l' Energétique-CRTSE 02, Bd Frantz Fanon, BP. 140, Alger 7 Merveilles (Algeria); Maamache, Mustapha [Laboratoire de Physique Quantique et Systèmes Dynamiques, Département de Physique, Université de Sétif, Sétif 19000 (Algeria); Szunerits, Sabine [Institut d' Electronique, de Microélectronique et de Nanotechnologie (IEMN), UMR CNRS 8520, Avenue Poincaré—BP 70478, 59652 Villeneuve d' Ascq Cedex (France); and others
2016-03-05
Highlights: • Cr(VI) reduction to Cr(III) using silicon nanowires decorated with Cu nanoparticles. • The reduction takes place at room temperature and neutral pH under visible light. • The photocatalytic reduction was enhanced by addition of adipic or citric acid. - Abstract: We report an efficient visible light-induced reduction of hexavalent chromium Cr(VI) to trivalent Cr(III) by direct illumination of an aqueous solution of potassium dichromate (K{sub 2}Cr{sub 2}O{sub 7}) in the presence of hydrogenated silicon nanowires (H-SiNWs) or silicon nanowires decorated with copper nanoparticles (Cu NPs-SiNWs) as photocatalyst. The SiNW arrays investigated in this study were prepared by chemical etching of crystalline silicon in HF/AgNO{sub 3} aqueous solution. The Cu NPs were deposited on SiNW arrays via electroless deposition technique. Visible light irradiation of an aqueous solution of K{sub 2}Cr{sub 2}O{sub 7} (10{sup −4} M) in presence of H-SiNWs showed that these substrates were not efficient for Cr(VI) reduction. The reduction efficiency achieved was less than 10% after 120 min irradiation at λ > 420 nm. Addition of organic acids such as citric or adipic acid in the solution accelerated Cr(VI) reduction in a concentration-dependent manner. Interestingly, Cu NPs-SiNWs was found to be a very efficient interface for the reduction of Cr(VI) to Cr(III) in absence of organic acids. Almost a full reduction of Cr(VI) was achieved by direct visible light irradiation for 140 min using this photocatalyst.
α-cluster states in {sup 46,54}Cr from double-folding potentials
Energy Technology Data Exchange (ETDEWEB)
Mohr, Peter [Diakonie-Klinikum, Schwaebisch Hall (Germany); Institute for Nuclear Research (Atomki), Debrecen (Hungary)
2017-10-15
α-cluster states in {sup 46}Cr and {sup 54}Cr are investigated in the double-folding model. This study complements a recent similar work by Souza and Miyake, Eur. Phys. J. A 53, 146 (2017), which was based on a specially shaped potential. Excitation energies, reduced widths, intercluster separations, and intra-band transition strengths are calculated and compared to experimental values for the ground state bands in {sup 46}Cr and {sup 54}Cr. The α-cluster potential is also applied to elastic scattering at low and intermediate energies. Here, as a byproduct, a larger radial extent of the neutron density in {sup 50}Ti is found. (orig.)
International Nuclear Information System (INIS)
Chuu, Chih-pin; Chen, Rou-Yu; Hiipakka, Richard A.; Kokontis, John M.; Warner, Karen V.; Xiang, Jialing; Liao, Shutsung
2007-01-01
T0901317 is a potent non-steroidal synthetic liver X receptor (LXR) agonist. T0901317 blocked androgenic stimulation of the proliferation of androgen-dependent LNCaP 104-S cells and androgenic suppression of the proliferation of androgen-independent LNCaP 104-R2 cells, inhibited the transcriptional activation of an androgen-dependent reporter gene by androgen, and suppressed gene and protein expression of prostate specific antigen (PSA), a target gene of androgen receptor (AR) without affecting gene and protein expression of AR. T0901317 also inhibited binding of a radiolabeled androgen to AR, but inhibition was much weaker compared to the effect of the antiandrogens, bicalutamide and hydroxyflutamide. The LXR agonist T0901317, therefore, acts as an antiandrogen in human prostate cancer cells
Hulshof, Janneke W; Vischer, Henry F; Verheij, Mark H P; Fratantoni, Silvina A; Smit, Martine J; de Esch, Iwan J P; Leurs, Rob
2006-11-01
G-protein coupled receptors encoded by viruses represent an unexplored class of potential drug targets. In this study, we describe the synthesis and pharmacological characterization of the first class of inverse agonists acting on the HCMV-encoded receptor US28. It is shown that replacement of the 4-hydroxy group of lead compound 1 with a methylamine group results in a significant 6-fold increase in affinity. Interestingly, increasing the rigidity of the spacer by the introduction of a double bond also leads to a significant increase in binding affinity compared to 1. These novel inverse agonists serve as valuable tools to elucidate the role of constitutive signaling in the pathogenesis of viral infection and may have therapeutic potential as leads for new antiviral drugs.
NEUTRON-INDUCED SWELLING OF Fe-Cr BINARY ALLOYS IN FFTF AT ∼400 DEGREES C
International Nuclear Information System (INIS)
Garner, Francis A.; Greenwood, Lawrence R.; Okita, Taira; Sekimura, Naoto; Wolfer, W. G.
2002-01-01
The purpose of this effort is to determine the influence of dpa rate, He/dpa ratio and composition on the void swelling of simple binary Fe-Cr alloys. Contrary to the behavior of swelling of model fcc Fe-Cr-Ni alloys irradiated in the same FFTF-MOTA experiment, model bcc Fe-Cr alloys do not exhibit a dependence of swelling on dpa rate at approximately 400 degrees C. This is surprising in that an apparent flux-sensitivity was observed in an earlier comparative irradiation of Fe-Cr binaries conducted in EBR-II and FFTF. The difference in behavior is ascribed to the higher helium generation rates of Fe-Cr alloys in EBR-II compared to that of FFTF, and also the fact that lower dpa rates in FFTF are accompanied by progressively lower helium generation rates.
[Effects of GLP-1 receptor agonists on carbohydrate metabolism control].
Fernández-García, José Carlos; Colomo, Natalia; Tinahones, Francisco José
2014-09-01
Glucagon-like peptide-1 (GLP-1) receptor agonists are a new group of drugs for the treatment of type 2 diabetes mellitus (DM2). In the present article, we review the available evidence on the efficacy of GLP-1 receptor agonists as glucose-lowering agents, their place in therapeutic algorithms, and the clinical factors associated with a favorable treatment response. Finally, we describe the clinical characteristics of patients who may benefit from these drugs. Copyright © 2014 Elsevier España, S.L.U. All rights reserved.
Al2 O3:Cr,Ni: a possible thermoluminescent dosemeter
International Nuclear Information System (INIS)
Mariani R, Francisco; Roman B, Alvaro; Saavedra S, Renato; Ibarra S, Angel
1996-01-01
Results from a study on the thermoluminescent (Tl) emission from Al 2 O 3 :Cr,Ni are presented. The measurements were obtained for evaluation of the Al 2 O 3 :Cr,Ni dosimetric properties. Different crystal batches were exposed to two kind of ionizing radiation (X-ray and β - ). The Tl spectrum has a main peak with high thermal and optical stability, deviating from linearity for doses lower than 3.6 Gy. Furthermore, this material shows advantages (thermal resistance, reusability, multiple heating cycles) compared to TLD-100. Measured Al 2 O 3 :Cr,Ni properties indicate that it could be used as a dosemeter. (author)
Nicotine receptor partial agonists for smoking cessation.
Cahill, Kate; Stead, Lindsay F; Lancaster, Tim
2012-04-18
Nicotine receptor partial agonists may help people to stop smoking by a combination of maintaining moderate levels of dopamine to counteract withdrawal symptoms (acting as an agonist) and reducing smoking satisfaction (acting as an antagonist). The primary objective of this review is to assess the efficacy and tolerability of nicotine receptor partial agonists, including cytisine, dianicline and varenicline for smoking cessation. We searched the Cochrane Tobacco Addiction Group's specialised register for trials, using the terms ('cytisine' or 'Tabex' or 'dianicline' or 'varenicline' or 'nicotine receptor partial agonist') in the title or abstract, or as keywords. The register is compiled from searches of MEDLINE, EMBASE, PsycINFO and Web of Science using MeSH terms and free text to identify controlled trials of interventions for smoking cessation and prevention. We contacted authors of trial reports for additional information where necessary. The latest update of the specialised register was in December 2011. We also searched online clinical trials registers. We included randomized controlled trials which compared the treatment drug with placebo. We also included comparisons with bupropion and nicotine patches where available. We excluded trials which did not report a minimum follow-up period of six months from start of treatment. We extracted data on the type of participants, the dose and duration of treatment, the outcome measures, the randomization procedure, concealment of allocation, and completeness of follow-up.The main outcome measured was abstinence from smoking at longest follow-up. We used the most rigorous definition of abstinence, and preferred biochemically validated rates where they were reported. Where appropriate we pooled risk ratios (RRs), using the Mantel-Haenszel fixed-effect model. Two recent cytisine trials (937 people) found that more participants taking cytisine stopped smoking compared with placebo at longest follow-up, with a pooled RR of
Gamma-aminobutyric acid agonists for antipsychotic-induced tardive dyskinesia.
Alabed, Samer; Latifeh, Youssef; Mohammad, Husam Aldeen; Bergman, Hanna
2018-04-17
in the included studies was unclear, mainly due to poor reporting; allocation concealment was not described, generation of the sequence was not explicit, participants and outcome assessors were not clearly blinded. For some studies we were unsure if data were complete, and data were often poorly or selectively reported.Data from six trials showed that there may be a clinically important improvement in TD symptoms after GABA agonist treatment compared with placebo at six to eight weeks follow-up (6 RCTs, n = 258, RR 0.83, CI 0.74 to 0.92; low-quality evidence). Data from five studies showed no difference between GABA agonist treatment and placebo for deterioration of TD symptoms (5 RCTs, n = 136, RR 1.90, CI 0.70 to 5.16; very low-quality evidence). Studies reporting adverse events found a significant effect favouring placebo compared with baclofen, sodium valproate or progabide for dizziness/confusion (3 RCTs, n = 62 RR 4.54, CI 1.14 to 18.11; very low-quality evidence) and sedation/drowsiness (4 RCTS, n = 144, RR 2.29, CI 1.08 to 4.86; very low-quality evidence). Studies reporting on akathisia (RR 1.05, CI 0.32 to 3.49, 2 RCTs, 80 participants), ataxia (RR 3.25, CI 0.36 to 29.73, 2 RCTs, 95 participants), nausea/vomiting (RR 2.61, CI 0.79 to 8.67, 2 RCTs, 64 participants), loss of muscle tone (RR 3.00, CI 0.15 to 59.89, 1 RCT, 10 participants), seizures (RR 3.00, CI 0.24 to 37.67, 1 RCT, 2 participants), hypotension (RR 3.04, CI 0.33 to 28.31, 2 RCTs, 119 participants) found no significant difference between GABA drug and placebo (very low-quality evidence). Evidence on mental state also showed no effect between treatment groups (6 RCTS, n = 121, RR 2.65, CI 0.71 to 9.86; very low-quality evidence) as did data for leaving the study early (around 10% in both groups, 6 RCTS, n = 218, RR 1.47, CI 0.69 to 3.15; very low-quality evidence). No study reported on social confidence, social inclusion, social networks, or personalised quality of life, a group of outcomes
International Nuclear Information System (INIS)
Johnson, Timothy E.; Zhang, Xiaohua; Shi, Shu; Umbenhauer, Diane R.
2005-01-01
Statins and fibrates (weak PPARα agonists) are prescribed for the treatment of lipid disorders. Both drugs cause myopathy, but with a low incidence, 0.1-0.5%. However, combined statin and fibrate therapy can enhance myopathy risk. We tested the myotoxic potential of PPAR subtype selective agonists alone and in combination with statins in a differentiated rat myotube model. A pharmacologically potent experimental PPARα agonist, Compound A, induced myotoxicity as assessed by TUNEL staining at a minimum concentration of 1 nM, while other weaker PPARα compounds, for example, WY-14643, Gemfibrozil and Bezafibrate increased the percentage of TUNEL-positive nuclei at micromolar concentrations. In contrast, the PPARγ agonist Rosiglitazone caused little or no cell death at up to 10 μM and the PPARδ ligand GW-501516 exhibited comparatively less myotoxicity than that seen with Compound A. An experimental statin (Compound B) and Atorvastatin also increased the percentage of TUNEL-positive nuclei and co-treatment with WY-14643, Gemfibrozil or Bezafibrate had less than a full additive effect on statin-induced cell killing. The mechanism of PPARα agonist-induced cell death was different from that of statins. Unlike statins, Compound A and WY-14643 did not activate caspase 3/7. In addition, mevalonate and geranylgeraniol reversed the toxicity caused by statins, but did not prevent the cell killing induced by WY-14643. Furthermore, unlike statins, Compound A did not inhibit the isoprenylation of rab4 or rap1a. Interestingly, Compound A and Compound B had differential effects on ATP levels. Taken together, these observations support the hypothesis that in rat myotube cultures, PPARα agonism mediates in part the toxicity response to PPARα compounds. Furthermore, PPARα agonists and statins cause myotoxicity through distinct and independent pathways
Silva, L.A.S.; Felix, F.B.; Araujo, J.M.D.; Souza, E.V.; Camargo, E.A.; Grespan, R.
2017-01-01
Arthritis is positively associated with the decline of sex hormones, especially estrogen. Tamoxifen (TMX) is a selective estrogen receptor modulator, possessing agonist or antagonistic activity in different tissues. Thus, the objective of this study was to investigate the effect of TMX on the zymosan-induced arthritis model. Female Swiss normal and ovariectomized (OVX) mice were divided into groups and treated for five days with TMX (0.3, 0.9 or 2.7 mg/kg) or 17-β-estradiol (E2, 50 µg/kg). On the fifth day, arthritis was induced and 4 h later, leukocyte migration into joint cavities was evaluated. The neutrophil migration in OVX animals, but not in normal mice, treated with TMX (all tested doses) was significantly decreased compared with mice that received the vehicle (P≤0.05). Similarly, this effect was also demonstrated in the E2-treated group. Therefore, the present study demonstrates that TMX presented agonist effects in inhibiting neutrophil migration and preventing arthritis progression in OVX mice. PMID:29160416
Lithium Insertion in LiCr3O8, NaCr3O8, and KCr3O8 at Room Temperature and at 125°C
DEFF Research Database (Denmark)
Koksbang, R.; Fauteux, D.; Norby, P.
1989-01-01
Lithium insertion and deinsertion reactions have been carried out with LiCr3O8, NaCr3O8, and KCr3O8 chemically andelectrochemically at room temperature and at 125°C. The electrochemical experiments were performed with a nonaqueousliquid electrolyte at room temperature and with a polymer electroly...... is close to 4Li/NaCr3O8 and 1.3Li/KCr3O8.Lithium ion diffusion coefficients are similar for the two compounds in the comparable composition range.Thermally, the fully lithiated compounds appear to be as stable as the pristine materials.......Lithium insertion and deinsertion reactions have been carried out with LiCr3O8, NaCr3O8, and KCr3O8 chemically andelectrochemically at room temperature and at 125°C. The electrochemical experiments were performed with a nonaqueousliquid electrolyte at room temperature and with a polymer electrolyte....... At elevated temperatures, the isostructural compounds NaCr3O8 and KCr3O8 are able to accommodate morethan 4Li/MCr3O8. During this process, minor structural changes are observed. At room temperature, NaCr3O8 and KCr3O8also accommodate Li topotactically, but the maximum number of Li inserted per formula...
Experimental Monitoring of Cr(VI) Bio-reduction Using Electrochemical Geophysics
International Nuclear Information System (INIS)
Birsen Canan; Gary R. Olhoeft; William A. Smith
2007-01-01
Many Department of Energy (DOE) sites are contaminated with highly carcinogenic hexavalent chromium (Cr(VI)). In this research, we explore the feasibility of applying complex resistivity to the detection and monitoring of microbially-induced reduction of hexavalent chromium (Cr(VI)) to a less toxic form (Cr(III)). We hope to measure the change in ionic concentration that occurs during this reduction reaction. This form of reduction promises to be an attractive alternative to more expensive remedial treatment methods. The specific goal of this research is to define the minimum and maximum concentration of the chemical and biological compounds in contaminated samples for which the Cr(VI) - Cr(III) reduction processes could be detected via complex resistivity. There are three sets of experiments, each comprised of three sample columns. The first experiment compares three concentrations of Cr(VI) at the same bacterial cell concentration. The second experiment establishes background samples with, and without, Cr(VI) and bacterial cells. The third experiment examines the influence of three different bacterial cell counts on the same concentration of Cr(VI). A polarization relaxation mechanism was observed between 10 and 50 Hz. The polarization mechanism, unfortunately, was not unique to bio-chemically active samples. Spectral analysis of complex resistivity data, however, showed that the frequency where the phase minimum occurred was not constant for bio-chemically active samples throughout the experiment. A significant shifts in phase minima occurred between 10 to 20 Hz from the initiation to completion of Cr(VI) reduction. This phenomena was quantified using the Cole-Cole model and the Marquardt-Levenberg nonlinear least square minimization method. The data suggests that the relaxation time and the time constant of this relaxation are the Cole-Cole parameters most sensitive to changes in biologically-induced reduction of Cr(VI)
PPARα agonists up-regulate organic cation transporters in rat liver cells
International Nuclear Information System (INIS)
Luci, Sebastian; Geissler, Stefanie; Koenig, Bettina; Koch, Alexander; Stangl, Gabriele I.; Hirche, Frank; Eder, Klaus
2006-01-01
It has been shown that clofibrate treatment increases the carnitine concentration in the liver of rats. However, the molecular mechanism is still unknown. In this study, we observed for the first time that treatment of rats with the peroxisome proliferator activated receptor (PPAR)-α agonist clofibrate increases hepatic mRNA concentrations of organic cation transporters (OCTNs)-1 and -2 which act as transporters of carnitine into the cell. In rat hepatoma (Fao) cells, treatment with WY-14,643 also increased the mRNA concentration of OCTN-2. mRNA concentrations of enzymes involved in carnitine biosynthesis were not altered by treatment with the PPARα agonists in livers of rats and in Fao cells. We conclude that PPARα agonists increase carnitine concentrations in livers of rats and cells by an increased uptake of carnitine into the cell but not by an increased carnitine biosynthesis
THE EFFECT OF RARE EARTH ELEMENTS ON Cr PRECIPITATIONS IN A Cu-0.8WT%Cr ALLOY
Directory of Open Access Journals (Sweden)
Gewang Shuai
2011-05-01
Full Text Available The microstructural evolution of Cu-based alloys during aging was studied using a quantitative metallographic method. Samples were cut from ingots of Cu-0.8wt%Cr and Cu-0.8wt%Cr-RE alloys. These were solution treated at 1000 ºC for 1.5h and subsequently quenched in water, then separately aged at 480 ºC for different durations. The microstructures were observed by optical microscope, and the characteristic geometric parameters of precipitated Cr phase, including volume fraction VV, face density NA, mean diameter and roundness, were measured. These data provided more details about the process of aging. The results showed that precipitation of Cr phase occurred in the form of particles during aging. Rare earth elements promoted the precipitation of Cr phase and dispersed Cr particles. The phenomenon of overaging came earlier in Cu-Cr-RE than in Cu-Cr. In the present work, the optimal aging time at 480 ºC was 2 hrs for the Cu-0.8wt%Cr-RE alloy and 3 hours for the Cu-0.8wt%Cr alloy.
Characterization of 12 GnRH peptide agonists - a kinetic perspective.
Nederpelt, Indira; Georgi, Victoria; Schiele, Felix; Nowak-Reppel, Katrin; Fernández-Montalván, Amaury E; IJzerman, Adriaan P; Heitman, Laura H
2016-01-01
Drug-target residence time is an important, yet often overlooked, parameter in drug discovery. Multiple studies have proposed an increased residence time to be beneficial for improved drug efficacy and/or longer duration of action. Currently, there are many drugs on the market targeting the gonadotropin-releasing hormone (GnRH) receptor for the treatment of hormone-dependent diseases. Surprisingly, the kinetic receptor-binding parameters of these analogues have not yet been reported. Therefore, this project focused on determining the receptor-binding kinetics of 12 GnRH peptide agonists, including many marketed drugs. A novel radioligand-binding competition association assay was developed and optimized for the human GnRH receptor with the use of a radiolabelled peptide agonist, [(125) I]-triptorelin. In addition to radioligand-binding studies, a homogeneous time-resolved FRET Tag-lite™ method was developed as an alternative assay for the same purpose. Two novel competition association assays were successfully developed and applied to determine the kinetic receptor-binding characteristics of 12 high-affinity GnRH peptide agonists. Results obtained from both methods were highly correlated. Interestingly, the binding kinetics of the peptide agonists were more divergent than their affinities with residence times ranging from 5.6 min (goserelin) to 125 min (deslorelin). Our research provides new insights by incorporating kinetic, next to equilibrium, binding parameters in current research and development that can potentially improve future drug discovery targeting the GnRH receptor. © 2015 The British Pharmacological Society.
International Nuclear Information System (INIS)
Chen, Wanglin; Zheng, Jie; Lin, Yue; Kwon, Sikchol; Zhang, Shihong
2015-01-01
Highlights: • The duplex coatings were produced by combination of nitrocarburizing and multi-arc ion plating. • The γ′-phase plays the nucleation sites for the coating nitrides. • The compound layers (CL) considerably enhance mechanical and tribological properties of the duplex PVD coatings. • The main wear mechanisms of the PVD coatings with and without CL are oxidation wear, the combination of spalling, chipping and oxidation wear, respectively. - Abstract: The AlCrN and AlCrTiSiN coatings were produced on the surface of plasma nitrocarburized T10 steels by multi-arc ion plating. The comparison of the microstructures and mechanical properties of the duplex coatings were investigated by means of X-ray diffraction, optical microscope, scanning electron microscope and transmission electron microscope, in association with mechanical property measurement. The results show that the AlCrN coatings with columnar grown are mainly composed of nanocrytalline fcc-(Cr,Al)N phases with {111} preferred orientation, whereas the superlattice and nanocomposite AlCrTiSiN coatings with planar growth mainly consist of nanocrystalline fcc-(Cr,Al)N phases with {100} perfected orientation, hcp-AlN and Si 3 N 4 amorphous phases. The AlCrTiSiN duplex coating with the compound layer reveals higher hardness, adhesion strength, load capacity and lower friction coefficient when compared with the other duplex coatings, which is due to its superlattice and nanocomposite structure. Additionally, these improved properties are related to the appearance of the γ′-phase which plays the nucleation sites for the coating nitrides and provides a strong supporting effect for the AlCrN and AlCrTiSiN coatings. The main wear mechanism of the duplex coatings without compound layer is spalling and chipping wear as well as tribooxidation wear, whereas the main wear mechanism of the duplex coatings with compound layer is tribooxidation wear
Reduction of Cr(VI) in aqueous solution with DC diaphragm glow discharge
International Nuclear Information System (INIS)
Wang, Xiaoyan; Jin, Xinglong; Zhou, Minghua; Chen, Zhenhai; Deng, Kai
2013-01-01
This paper investigated the reduction of Cr(VI) in aqueous solution with direct current diaphragm glow discharge (DGD). The glow discharge sustained around the hole on a quartz tube which divided the electrolyte cell into two parts. The reduction efficiencies of Cr(VI) under different applied voltages, initial conductivities, hole diameters, hole numbers, initial pH values and initial concentrations were systematically studied. The results showed that the reduction efficiency of Cr(VI) increased with the increase of applied voltage, initial conductivity, hole diameter and hole number. The different initial pH values showed less effects on the reduction of Cr(VI). The reduction efficiency decreased with the increasing initial concentration. In addition, the simultaneous reduction of Cr(VI) and decolorization of acid orange (AO) with DGD were also fulfilled. Furthermore, the energy efficiency for Cr(VI) reduction with DGD was calculated and compared with those in photocatalysis and other glow discharge reactor
Energy Technology Data Exchange (ETDEWEB)
Mariani R, Francisco; Roman B, Alvaro; Saavedra S, Renato [Pontificia Univ. Catolica de Chile, Santiago (Chile). Facultad de Fisica; Ibarra S, Angel [Centro de Investigaciones Energeticas, Medioambientales y Tecnologicas (CIEMAT), Madrid (Spain). Seccion Materiales para Fusion
1997-12-31
Results from a study on the thermoluminescent (Tl) emission from Al{sub 2} O{sub 3}:Cr,Ni are presented. The measurements were obtained for evaluation of the Al{sub 2} O{sub 3}:Cr,Ni dosimetric properties. Different crystal batches were exposed to two kind of ionizing radiation (X-ray and {beta}{sup -}). The Tl spectrum has a main peak with high thermal and optical stability, deviating from linearity for doses lower than 3.6 Gy. Furthermore, this material shows advantages (thermal resistance, reusability, multiple heating cycles) compared to TLD-100. Measured Al{sub 2} O{sub 3}:Cr,Ni properties indicate that it could be used as a dosemeter. (author). 5 refs., 4 figs.
Discovery of Azetidinone Acids as Conformationally-Constrained Dual PPARalpha/gamma Agonists
Energy Technology Data Exchange (ETDEWEB)
Wang, W.; Devasthale, P; Farrelly, D; Gu, L; Harrity, T; Cap, M; Chu, C; Kunselman, L; Morgan, N; et. al.
2008-01-01
A novel class of azetidinone acid-derived dual PPAR{alpha}/{gamma} agonists has been synthesized for the treatment of diabetes and dyslipidemia. The preferred stereochemistry in this series for binding and functional agonist activity against both PPARa and PPAR? receptors was shown to be 3S,4S. Synthesis, in vitro and in vivo activities of compounds in this series are described. A high-yielding method for N-arylation of azetidinone esters is also described.
First insights of Cr speciation in leached Portland cement using X-ray spectromicroscopy.
Rose, Jérôme; Bénard, Anne; Susini, Jean; Borschneck, Daniel; Hazemann, Jean-Louis; Cheylan, Pascal; Vichot, Angélique; Bottero, Jean-Yves
2003-11-01
X-ray spectromicroscopy has been successfully applied to determine the evolution of the Cr oxidation state in Portland cement during leaching experiments. To our knowledge, this is the first study that demonstrates the possibility to study the chromium oxidoreduction phenomena in cement materials at natural Cr concentration (approximately 60 ppm) and at the micron scale. Line scans of Cr for Cr(VI) doped (2000 ppm) and undoped samples indicate that the altered layer (0-1000 microm from the surface) is characterized by a lower amount of Cr as compared to the core part, whereas an accumulation appears in the intermediate region (1000-1300 microm). This Cr-rich interface could correspond to an accumulation of ettringite (3CaO x Al2O3 x 3CaSO4 x 32H2O) as reported by previous works. This mineral exhibits the property to incorporate Cr(III) and Cr(VI) by replacement of aluminum and sulfate, respectively, in the structure. The most surprising result concerns the evolution of the Cr(VI)/Cr(tot) ratio along the line spectra, which is constant from the altered layer to the core (both for doped and undoped samples). This means thatthe same amounts of Cr(VI) and Cr(tot) are released during leaching. Even for the undoped sample, Cr(VI) was detected in the altered layer at 40 microm from the surface. This result is not in perfect agreement with literature, which usually states that Cr(VI) is mainly leached out. Although this result must be confirmed, it clearly indicates that Cr(VI) may be less mobile than predicted by models. An attempt is made to identify potential Cr(VI) fixation phases.
Microstructure and Corrosion Behavior of Ni-Alloy/CrN Nanolayered Coatings
Directory of Open Access Journals (Sweden)
Hao-Hsiang Huang
2011-01-01
Full Text Available The Ni-alloy/CrN nanolayered coatings, Ni-Al/CrN and Ni-P/CrN, were deposited on (100 silicon wafer and AISI 420 stainless steel substrates by dual-gun sputtering technique. The influences of the layer microstructure on corrosion behavior of the nanolayered thin films were investigated. The bilayer thickness was controlled approximately 10 nm with a total coating thickness of 1m. The single-layer Ni-alloy and CrN coatings deposited at 350∘C were also evaluated for comparison. Through phase identification, phases of Ni-P and Ni-Al compounds were observed in the single Ni-alloy layers. On the other hand, the nanolayered Ni-P/CrN and Ni-Al/CrN coatings showed an amorphous/nanocrystalline microstructure. The precipitation of Ni-Al and Ni-P intermetallic compounds was suppressed by the nanolayered configuration of Ni-alloy/CrN coatings. Through Tafel analysis, the corr and corr values ranged from –0.64 to –0.33 V and 1.42×10−5 to 1.14×10−6 A/cm2, respectively, were deduced for various coating assemblies. The corrosion mechanisms and related behaviors of the coatings were compared. The coatings with a nanolayered Ni-alloy/CrN configuration exhibited a superior corrosion resistance to single-layer alloy or nitride coatings.
Modeling on Fe-Cr microstructure: evolution with Cr content
International Nuclear Information System (INIS)
Diaz Arroyo, D.; Perlado, J.M.; Hernandez-Mayoral, M.; Caturla, M.J.; Victoria, M.
2007-01-01
Full text of publication follows: The minimum energy configuration of interstitials in the Fe-Cr system, which is the base for the low activation steels being developed in the European fusion reactor materials community, is determined by magnetism. Magnetism plays also a role in the atomic configurations found with increasing Cr content. Results will be presented from a program in which the microstructure evolution produced after heavy ion irradiation in the range from room temperature to 80 K is studied as a function of the Cr content in alloys produced under well controlled conditions, i.e. from high purity elements and with adequate heat treatment. It is expected that these measurements will serve as matrix for model validation. The first step in such modeling sequence is being performed by modeling the evolution of displacement cascades in Fe using the Dudarev -Derlet and Mendeleev potentials for Fe and the Caro potential for Fe-Cr. It is of particular interest to study the evolution of high-energy cascades, where an attempt will be made to clarify the role of the evolution of sub-cascades. Kinetic Monte Carlo (kMC) techniques will be used then to simulate the defect evolution. A new parallel kMC code is being implemented for this purpose. (authors)
Directory of Open Access Journals (Sweden)
Masahiko Ichijo
CCAO. Administration of the S1PR1 selective agonist significantly increased cerebral blood flow (CBF and the diameter of leptomeningeal collateral vessels (42.9 ± 2.6 μm compared with the controls (27.6 ± 5.7 μm; P < 0.01. S1PR1 inverse agonist administration diminished the effect of the S1PR1 agonist (P < 0.001. After pMCAO, S1PR1 agonist pretreated animals showed significantly smaller infarct volume (17.5% ± 4.0% vs. 7.7% ± 4.0%, P < 0.01 and better functional recovery than vehicle-treated controls.These results suggest that S1PR1 is one of the principal regulators of leptomeningeal collateral recruitment at the site of increased shear stress and provide evidence that an S1PR1 selective agonist has a role in promoting collateral growth and preventing of ischemic damage and neurological dysfunction after subsequent stroke in patients with intracranial major artery stenosis or occlusion.
Charpentier, E.; Oost, van der J.; White, M.
2013-01-01
Mature crRNAs are key elements in CRISPR-Cas defense against genome invaders. These short RNAs are composed of unique repeat/spacer sequences that guide the Cas protein(s) to the cognate invading nucleic acids for their destruction. The biogenesis of mature crRNAs involves highly precise processing
Effect of alpha 2-adrenoceptor agonists on gastric pepsin and acid secretion in the rat.
Tazi-Saad, K.; Chariot, J.; Del Tacca, M.; Rozé, C.
1992-01-01
1. The purpose of the present study was to analyze the effects of the alpha 2-adrenoceptor agonists clonidine, guanabenz, detomidine and medetomidine on pepsin secretion in conscious rats provided with gastric chronic fistula and to compare this with acid secretion. 2. Basal interdigestive gastric secretion, which is mainly neurally driven in the rat, and the secretion directly stimulated by the two main stimulants of chief cells, cholecystokinin octapeptide (CCK8) and methacholine, were studied. 3. Basal secretion of pepsin and acid was inhibited by all four drugs with comparable EC50S. 4. CCK-stimulated pepsin and acid secretion was less sensitive than basal pepsin and acid secretion to alpha 2-adrenoceptor inhibition. 5. Methacholine-stimulated pepsin and acid secretion was not changed by clonidine and guanabenz; methacholine-stimulated acid was even marginally increased by clonidine. 6. These results do not favour the presence of alpha 2-receptors on chief cells in the rat stomach. They rather suggest that pepsin inhibition by alpha 2-adrenoceptor agonists is indirect and due to central or peripheral inhibition of the discharge of nerve fibres activating pepsin secretion. PMID:1356566
Wear behavior of Cu-Ag-Cr alloy wire under electrical sliding
International Nuclear Information System (INIS)
Jia, S.G.; Liu, P.; Ren, F.Z.; Tian, B.H.; Zheng, M.S.; Zhou, G.S.
2005-01-01
The wear behavior of a Cu-Ag-Cr alloy contact wire against a copper-base sintered alloy strip was investigated. Wear tests were conducted under laboratory conditions with a special sliding wear apparatus that simulated train motion under electrical current conditions. The initial microstructure of the Cu-Ag-Cr alloy contact wire was analyzed by transmission electron microscopy. Worn surfaces of the Cu-Ag-Cr alloy wire were analyzed by scanning electron microscopy (SEM) and energy dispersive X-ray spectrometry (EDS). The results indicate that the wear rate of the Cu-Ag-Cr wire increased with increasing electrical current and sliding. Within the studied range of electrical current, the wear rate increases with increasing electrical current and sliding speed. Compared with the Cu-Ag contact wire under the same testing conditions, the Cu-Ag-Cr alloy wire has much better wear resistance. Adhesive, abrasive, and electrical erosion wear are the dominant mechanisms during the electrical sliding processes
Directory of Open Access Journals (Sweden)
Herrera Maria
2006-04-01
Full Text Available Abstract Background Platelet activation is crucial in normal hemostasis. Using a clotting system free of external tissue factor, we investigated whether activated Factor VII in combination with platelet agonists increased thrombin generation (TG in vitro. Methods and results TG was quantified by time parameters: lag time (LT and time to peak (TTP, and by amount of TG: peak of TG (PTG and area under thrombin formation curve after 35 minutes (AUC→35min in plasma from 29 healthy volunteers using the calibrated automated thrombography (CAT technique. TG parameters were measured at basal conditions and after platelet stimulation by sodium arachidonate (AA, ADP, and collagen (Col. In addition, the effects of recombinant activated FVII (rFVIIa alone or combined with the other platelet agonists on TG parameters were investigated. We found that LT and TTP were significantly decreased (p 35min were significantly increased (p 35min (but not PTG when compared to platelet rich plasma activated with agonists in the absence of rFVIIa. Conclusion Platelets activated by AA, ADP, Col or rFVIIa triggered TG. This effect was increased by combining rFVIIa with other agonists. Our intrinsic coagulation system produced a burst in TG independent of external tissue factor activity an apparent hemostatic effect with little thrombotic capacity. Thus we suggest a modification in the cell-based model of hemostasis.
Enhancement strategies for Cu(II), Cr(III) and Cr(VI) remediation by a variety of seaweed species.
Murphy, V; Hughes, H; McLoughlin, P
2009-07-15
Various chemical treatments have been applied to six brown, red and green seaweed species with a view to enhancing their metal removal for Cu(II), Cr(III) and Cr(VI). Treatment with acetone resulted in the greatest enhancement for both cationic and anionic species with relatively low mass losses (15-35%), indicating its low risk to biomass operational stability. Cation binding was increased by 69%, while the total Cr removal was augmented by 15%. Cr(VI) binding was shown to be an adsorption-coupled reduction, whereby Cr(VI) was bound to the biomass surface at pH 2 and subsequently reduced to Cr(III). Acetone treatment also resulted in biomasses that were capable of converting up to 83% of Cr(VI) in solution to Cr(III). Blocking of carboxyl and amino functionalities had significant negative effects both on total Cr removal as well as percentage conversion of Cr(VI) to Cr(III). Results therefore indicated the significant role played by these moieties in metal binding to these seaweeds. Potentiometric titrations displayed agreement between the degree of esterification and the decrease in Cu(II) removal for Ulva spp. and Polysiphonia lanosa. FTIR analysis identified changes in biomass functionality and availability after chemical modification, the results of which were in agreement with metal removal studies. In conclusion, these biosorbents represent suitable candidates to replace conventional removal technologies for metal bearing wastewaters, in particular for the detoxification of hazardous Cr(VI) waste streams.
The effect of magnetic ordering on the giant magnetoresistance of Cr-Fe-V and Cr-Fe-Mn
International Nuclear Information System (INIS)
Somsen, Ch.; Acet, M.; Nepecks, G.; Wassermann, E.F.
2000-01-01
Cr-rich Cr 1-x Fe x alloys with compositions in the vicinity of mixed ferromagnetic and antiferromagnetic exchange (x=0.18) exhibit giant magnetoresistance. In order to understand the influence of the antiferromagnetism of Cr on the giant magnetoresistance one can manipulate the antiferromagnetic exchange either by adding vanadium, which destroys the antiferromagnetism of Cr, or by adding manganese, which enhances it. Cr-Fe-V and Cr-Fe-Mn alloys also have Curie temperatures that lie between low temperatures and room temperature in the concentration region where giant magnetoresistance is observed. Therefore, they are also used as samples to study the magnetoresistance as a function of the strength of FM exchange. We discuss these points in the light of temperature and concentration-dependent magnetoresistance experiments on Cr 0.99-x Fe x V 0.01 , Cr 0.96-x Fe x V 0.04 , Cr 0.90-x Fe x Mn 0.10 and Cr 0.55 Fe x Mn 0.45-x alloys. Results indicate that the most favorable condition for a large magnetoresistance in these alloys occurs at temperatures near the Curie temperature
Synthesis, characterization and stability of Cr(III) and Fe(III) hydroxides
Energy Technology Data Exchange (ETDEWEB)
Papassiopi, N.; Vaxevanidou, K.; Christou, C.; Karagianni, E.; Antipas, G.S.E., E-mail: gantipas@metal.ntua.gr
2014-01-15
Highlights: • Fe(III)–Cr(III) hydroxides enhance groundwater quality better than pure Cr(III) compounds. • Crystalline Cr(OH){sub 3}·3H{sub 2}O was unstable, with a solubility higher than 50 μg/l. • Amorphous Cr(OH){sub 3}(am) was stable with a solubility lower than 50 μg/l in the range 5.7 < pH < 11. • For mixed Fe{sub 0.75}Cr{sub 0.25}(OH){sub 3}, the stability region was extended to 4.8 < pH < 13.5. -- Abstract: Chromium is a common contaminant of soils and aquifers and constitutes a major environmental problem. In nature, chromium usually exists in the form of two oxidation states, trivalent, Cr(III), which is relatively innocuous for biota and for the aquatic environment, and hexavalent, Cr(VI) which is toxic, carcinogenic and very soluble. Accordingly, the majority of wastewater and groundwater treatment technologies, include a stage where Cr(VI) is reduced to Cr(III), in order to remove chromium from the aqueous phase and bind the element in the form of environmentally stable solid compounds. In the absence of iron the final product is typically of the form Cr(OH){sub 3}·xH{sub 2}O whereas in the presence of iron the precipitate is a mixed Fe{sub (1−x)}Cr{sub x}(OH){sub 3} phase. In this study, we report on the synthesis, characterisation and stability of mixed (Fe{sub x},Cr{sub 1−x})(OH){sub 3} hydroxides as compared to the stability of Cr(OH){sub 3}. We established that the plain Cr(III) hydroxide, abiding to the approximate molecular formula Cr(OH){sub 3}·3H{sub 2}O, was crystalline, highly soluble, i.e. unstable, with a tendency to transform into the stable amorphous hydroxide Cr(OH){sub 3}(am) phase. Mixed Fe{sub 0.75}Cr{sub 0.25}(OH){sub 3} hydroxides were found to be of the ferrihydrite structure, Fe(OH){sub 3}, and we correlated their solubility to that of a solid solution formed by plain ferrihydrite and the amorphous Cr(III) hydroxide. Both our experimental results and thermodynamic calculations indicated that mixed Fe(III)–Cr
DEFF Research Database (Denmark)
Pless, Stephan Alexander; Lynch, Joseph W
2009-01-01
associated with the closed-flip transition in the alpha1-glycine receptor. We employed voltage-clamp fluorometry to compare ligand-binding domain conformational changes induced by the following agonists, listed from highest to lowest affinity and efficacy: glycine > beta-alanine > taurine. Voltage...
Quantitative CrAssphage PCR Assays for Human Fecal ...
Environmental waters are monitored for fecal pollution to protect public health and water resources. Traditionally, general fecal indicator bacteria are used; however, they cannot distinguish human fecal waste from pollution from other animals. Recently, a novel bacteriophage, crAssphage, was discovered by metagenomic data mining and reported to be abundant in and closely associated with human fecal waste. To confirm bioinformatic predictions, 384 primer sets were designed along the length of the crAssphage genome. Based upon initial screening, two novel crAssphage qPCR assays (CPQ_056 and CPQ_064) were designed and evaluated in reference fecal samples and water matrices. The assays exhibited high specificities (98.6%) when tested against a large animal fecal reference library and were highly abundant in raw sewage and sewage impacted water samples. In addition, CPQ_056 and CPQ_064 assay performance was compared to HF183/BacR287 and HumM2 methods in paired experiments. Findings confirm viral crAssphage qPCR assays perform at a similar level to well established bacterial human-associated fecal source identification technologies. These new viral based assays could become important water quality management and research tools. To inform the public.
Effects of alloying and temperature on the high-temperature oxidation of Cr-Cr{sub 2}Nb
Energy Technology Data Exchange (ETDEWEB)
Tortorelli, P.F.; DeVan, J.H. [Oak Ridge National Lab., TN (United States); Carson, L.J. [Lincoln Univ., PA (United States)
1993-06-01
Effects of alloying additions and temperature on isothermal and cyclic oxidation resistance of Cr-Cr{sub 2}Nb alloys were examined for air exposures. An isothermal exposure temperature of 1100C led to rapid reaction of binary Cr-12 at.% Nb as manifested a high oxidation rate and nonprotective behavior. Generally parabolic kinetics, complicated by some isothermal scale cracking, were observed at 900--1000C. Scale damage was exacerbated by thermal cycling. The addition of 8 at.% Al to Cr-12 at.% Nb did not effect cyclic oxidation resistance, but there was some evidence that scale adherence on Cr-6 at.% Nb-8 at.% Al was better than that for binary Cr-6 at.% Nb. Alloying additions of Al (up to 18 at.%) or Re (2 at.%) did not improve the isothermal oxidation resistance of Cr-12 at.% Nb. However, the tendency for scale damage during both isothermal and thermal cycling exposures suggests that alloying additions that specifically improve scale plasticity or modify growth stresses could be effective for Cr-Nb alloys. 10 refs, 9 figs, 1 tab.
Accumulation and distribution patterns of trivalent 51Cr in rats
International Nuclear Information System (INIS)
Zimakov, I.E.; Sin'kov, V.I.; Zakharova, L.L.
1986-01-01
The effect of stable isotope of trivalent chromium on the behaviour of its radioactive isotope 54 Cr in the feed-animal food chain is studied. It is shown that the doses of stable chromium of 5 mg/kg and less practically exert no influence on the regularities of 51 Cr behaviour in the organism animals statistically the reliable effect on the Cr 51 level in separate organs and tissues of animals is noted at the doses of stable isotope carrier of 20 and 40 mg/kg. To establish the stable carrier effect f 1 and f 2 their values have been compared in case of 51 Cr single intake without carrier and with stable isotope carrier in the amount of 50 mg/kg. In the last case for kidneys the Ff 2 value decreased and became 0.04 whereas for the spleen practically remained the same
Wu, Baoye; Liu, Peng; Wang, Xizhao; Zhang, Fei; Deng, Leimin; Duan, Jun; Zeng, Xiaoyan
2018-05-01
Due to excellent properties, Cr12MoV mold steel, 9Cr18 stainless steel and H13A cemented carbide are widely used in industry. In this paper, the effect of absorption of laser light on ablation efficiency and roughness have been studied using a picosecond pulse Nd:YVO4 laser. The experimental results reveal that laser wavelength, original surface roughness and chemical composition play an important role in controlling ablation efficiency and roughness. Firstly, higher ablation efficiency with lower surface roughness is achieved on the ablation of 9Cr18 at 532, comparing with 1064 nm. Secondly, the ablation efficiency increases while the Ra of the ablated region decreases with the decrease of original surface roughness on ablation of Cr12MoV mold steel at 532 nm. Thirdly, the ablation efficiency of H13A cemented carbide is much higher than 9Cr18 stainless steel and Cr12MoV mold steel at 1064 nm. Scanning electron microscopy images reveals the formation of pores on the surface of 9Cr18 stainless steel and Cr12MoV mold steel at 532 nm while no pores are formed at 1064 nm. As to H13A cemented carbide, worm-like structure is formed at 1064 nm. The synergetic effects of the heat accumulation, plasma shielding and ablation threshold on laser ablation efficiency and machining quality were analyzed and discussed systematically in this paper.
DEFF Research Database (Denmark)
Stensbøl, T B; Jensen, H S; Nielsen, B
2001-01-01
)-Glu) receptors (EC(50)=14 microM), comparable in potency with ATPA (EC(50)=34 microM). Recent findings, that (S)-ATPA is a potent (EC(50)=0.48 microM) and selective agonist at homomerically expressed ionotropic GluR5, prompted us to resolve thio-ATPA using chiral chromatography and pharmacologically characterize...
Alloying effect on hardening of martensite stainless steels of the Fe-Cr-Ni and Fe-Cr-Co systems
International Nuclear Information System (INIS)
Fel'dgandler, Eh.G.; Savkina, L.Ya.
1975-01-01
The effect of alloying elements is considered on the γ → a-transformation and hardening of certain compositions of the ternary Fe-Cr-Ni- and Fe-Cr-Co alloy systems with the martensite structure. In martensite Fe-(10 to 14)% Cr base steels the elements Co, Cu, W, Ni, Mo, Si, Cr decrease, Mn, Si, Mo, Cu increase, and Cr, Ni, Co decrease the temperature of α → γ-transition. The tempering of martensite steels of the Fe-Cr-Ni- and Fe-Cr-Co-systems containing 10 to 14% Cr, 4 to 9% Ni, and 7 to 12% Co does not lead to hardening. Alloyage of the martensite Fe-Cr-Ni-, Fe-Cr-Co- and Fe-Cr-Ni-Co base separately with Mo, W, Si or Cu leads to a hardening during tempering, the hardening being the higher, the higher is the content of Ni and, especially, of Co. The increase in the content of Mo or Si produces the same effect as the increase in the Co content. In on Fe-Cr-Co or Fe-Cr-Ni-Co based steels alloyed with Mo or Si, two temperature ranges of ageing have been revealed which, evidently, have different hardening natures. The compositions studied could serve as the base material for producing maraging stainless steels having a complex variety of properties
Directory of Open Access Journals (Sweden)
ChunYuan Tao
2012-05-01
Full Text Available A new type of grafting chitosan (CTS was synthesized using 2-hydroxyethyl- trimethyl ammonium chloride (HGCTS. The adsorption of Cr(VI on HGCTS was studied. The effect factors on adsorption and the adsorption mechanism were considered. The results indicated that the HGCTS could concentrate and separate Cr(VI at pH 4.0; the adsorption equilibrium time was 80 min; the maximum adsorption capacity was 205 mg/g. The adsorption isotherm and kinetics were investigated, equilibrium data agreed very well with the Langmuir model and the pseudo second-order model could describe the adsorption process better than the pseudo first-order model. A novel method for speciation of Cr(VI and Cr(III in environmental water samples has been developed using HGCTS as adsorbent and FAAS as determination means. The detection limit of this method was 20 ng/L, the relatively standard deviation was 1.2% and the recovery was 99%~105%.
The GABAA receptor agonist THIP is neuroprotective in organotypic hippocampal slice cultures
DEFF Research Database (Denmark)
Kristensen, Bjarne Winther; Noraberg, Jens; Zimmer, Jens
2003-01-01
The potential neuroprotective effects of the GABA(A) receptor agonists THIP (4,5,6,7-tetrahydroisoxazolo[5,4-c]pyridin-3-ol) and muscimol, and the selective GluR5 kainate receptor agonist ATPA ((RS)-2-amino-3-(3-hydroxy-5-tert-butylisoxazol-4-yl)propanoic acid), which activates GABAergic interneu......The potential neuroprotective effects of the GABA(A) receptor agonists THIP (4,5,6,7-tetrahydroisoxazolo[5,4-c]pyridin-3-ol) and muscimol, and the selective GluR5 kainate receptor agonist ATPA ((RS)-2-amino-3-(3-hydroxy-5-tert-butylisoxazol-4-yl)propanoic acid), which activates GABAergic...... interneurons, were examined in hippocampal slice cultures exposed to N-methyl-D-aspartate (NMDA). The NMDA-induced excitotoxicity was quantified by densitometric measurements of propidium iodide (PI) uptake. THIP (100-1000 microM) was neuroprotective in slice cultures co-exposed to NMDA (10 microM) for 48 h......, while muscimol (100-1000 microM) and ATPA (1-3 microM) were without effect. The results demonstrate that direct GABA(A) agonism can mediate neuroprotection in the hippocampus in vitro as previously suggested in vivo....
The stable Cr isotopic compositions of chondrites and silicate planetary reservoirs
Schoenberg, Ronny; Merdian, Alexandra; Holmden, Chris; Kleinhanns, Ilka C.; Haßler, Kathrin; Wille, Martin; Reitter, Elmar
2016-06-01
The depletion of chromium in Earth's mantle (∼2700 ppm) in comparison to chondrites (∼4400 ppm) indicates significant incorporation of chromium into the core during our planet's metal-silicate differentiation, assuming that there was no significant escape of the moderately volatile element chromium during the accretionary phase of Earth. Stable Cr isotope compositions - expressed as the ‰-difference in 53Cr/52Cr from the terrestrial reference material SRM979 (δ53/52CrSRM979 values) - of planetary silicate reservoirs might thus yield information about the conditions of planetary metal segregation processes when compared to chondrites. The stable Cr isotopic compositions of 7 carbonaceous chondrites, 11 ordinary chondrites, 5 HED achondrites and 2 martian meteorites determined by a double spike MC-ICP-MS method are within uncertainties indistinguishable from each other and from the previously determined δ53/52CrSRM979 value of -0.124 ± 0.101‰ for the igneous silicate Earth. Extensive quality tests support the accuracy of the stable Cr isotope determinations of various meteorites and terrestrial silicates reported here. The uniformity in stable Cr isotope compositions of samples from planetary silicate mantles and undifferentiated meteorites indicates that metal-silicate differentiation of Earth, Mars and the HED parent body did not cause measurable stable Cr isotope fractionation between these two reservoirs. Our results also imply that the accretionary disc, at least in the inner solar system, was homogeneous in its stable Cr isotopic composition and that potential volatility loss of chromium during accretion of the terrestrial planets was not accompanied by measurable stable isotopic fractionation. Small but reproducible variations in δ53/52CrSRM979 values of terrestrial magmatic rocks point to natural stable Cr isotope variations within Earth's silicate reservoirs. Further and more detailed studies are required to investigate whether silicate
Gurgle, Holly E; White, Karen; McAdam-Marx, Carrie
2016-01-01
Controversy exists regarding the selection of second-line therapy for patients with type 2 diabetes mellitus (T2DM) who are unable to achieve glycemic control with metformin therapy alone. Newer pharmacologic treatments for T2DM include glucagon-like peptide-1 receptor agonists and sodium-glucose cotransporter 2 inhibitors. Both the classes of medication are efficacious, exhibit positive effects on weight, and are associated with minimal risk of hypoglycemia. The purpose of this review is to compare the clinical trial and real-world effectiveness data of glucagon-like peptide-1 receptor agonists versus sodium-glucose cotransporter 2 inhibitors related to A1c reduction, weight loss, cost-effectiveness, cardiovascular outcomes, and safety in patients with T2DM. This review summarizes comparative evidence for providers who are determining which of the two classes may be the most appropriate for a specific patient.
Neuronal Cx3cr1 Deficiency Protects against Amyloid β-Induced Neurotoxicity
Dworzak, Jenny; Renvoisé, Benoît; Habchi, Johnny; Yates, Emma V.; Combadière, Christophe; Knowles, Tuomas P.; Dobson, Christopher M.; Blackstone, Craig; Paulsen, Ole; Murphy, Philip M.
2015-01-01
Cx3cr1, the receptor for the chemokine Cx3cl1 (fractalkine), has been implicated in the progression and severity of Alzheimer’s disease-like pathology in mice, but the underlying mechanisms remain unclear. A complicating factor is that Cx3cr1 has been demonstrated in both neurons and microglia. Here, we have dissected the differences between neuronal and microglial Cx3cr1, specifically by comparing direct amyloid-β-induced toxicity in cultured, mature, microglia-depleted hippocampal neurons from wild-type and Cx3cr1-/- mice. Wild-type neurons expressed both Cx3cl1 and Cx3cr1 and released Cx3cl1 in response to amyloid-β. Knockout of neuronal Cx3cr1 abated amyloid-β-induced lactate dehydrogenase release. Furthermore, amyloid-β differentially induced depression of pre- and postsynaptic components of miniature excitatory postsynaptic currents, in a peptide conformation-dependent manner. Knockout of neuronal Cx3cr1 abated effects of both amyloid-β conformational states, which were differentiable by aggregation kinetics and peptide morphology. We obtained similar results after both acute and chronic treatment of cultured neurons with the Cx3cr1 antagonist F1. Thus, neuronal Cx3cr1 may impact Alzheimer’s disease-like pathology by modulating conformational state-dependent amyloid-β-induced synaptotoxicity. PMID:26038823
Neuronal Cx3cr1 Deficiency Protects against Amyloid β-Induced Neurotoxicity.
Directory of Open Access Journals (Sweden)
Jenny Dworzak
Full Text Available Cx3cr1, the receptor for the chemokine Cx3cl1 (fractalkine, has been implicated in the progression and severity of Alzheimer's disease-like pathology in mice, but the underlying mechanisms remain unclear. A complicating factor is that Cx3cr1 has been demonstrated in both neurons and microglia. Here, we have dissected the differences between neuronal and microglial Cx3cr1, specifically by comparing direct amyloid-β-induced toxicity in cultured, mature, microglia-depleted hippocampal neurons from wild-type and Cx3cr1-/- mice. Wild-type neurons expressed both Cx3cl1 and Cx3cr1 and released Cx3cl1 in response to amyloid-β. Knockout of neuronal Cx3cr1 abated amyloid-β-induced lactate dehydrogenase release. Furthermore, amyloid-β differentially induced depression of pre- and postsynaptic components of miniature excitatory postsynaptic currents, in a peptide conformation-dependent manner. Knockout of neuronal Cx3cr1 abated effects of both amyloid-β conformational states, which were differentiable by aggregation kinetics and peptide morphology. We obtained similar results after both acute and chronic treatment of cultured neurons with the Cx3cr1 antagonist F1. Thus, neuronal Cx3cr1 may impact Alzheimer's disease-like pathology by modulating conformational state-dependent amyloid-β-induced synaptotoxicity.
Ab initio study of Cr interactions with point defects in bcc Fe
International Nuclear Information System (INIS)
Olsson, P.; Domain, Ch.; Wallenius, J.
2008-01-01
Full text of publication follows. Ferritic martensitic steels are candidate structural materials for fast neutron reactors, and in particular high-Cr reduced-activation steels. In Fe-Cr alloys, Cr plays a major role in the radiation-induced evolution of the mechanical properties. Using ab initio calculations based on density functional theory, the properties of Cr in α-Fe have been investigated. The intrinsic point defect formation energies were found to be larger in model bcc Cr as compared to those in ferromagnetic bcc Fe. The interactions of Cr with point defects (vacancy and self interstitials) have been characterised. Single Cr atoms interact weakly with vacancies but significantly with self-interstitial atoms. Mixed interstitials of any interstitial symmetry are bound. Configurations where two Cr atoms are in nearest neighbour position are generally unfavourable in bcc Fe except when they are a part of a interstitial complex. Mixed interstitials do not have as strong directional stability as pure Fe interstitials have. The effects on the results using the atom description scheme of either the ultrasoft pseudo-potential (USPP) or the projector augmented wave (PAW) formalisms are connected to the differences in local magnetic moments that the two methods predict. As expected for the Fe-Cr system, the results obtained using the PAW method are more reliable than the ones obtained with USPP. (authors)
Nuclear model calculations on cyclotron production of {sup 51}Cr
Energy Technology Data Exchange (ETDEWEB)
Kakavand, Tayeb [Imam Khomeini International Univ., Qazvin (Iran, Islamic Republic of). Dept. of Physics; Aboudzadeh, Mohammadreza [Nuclear Science and Technology Research Institute/AEOI, Karaj (Iran, Islamic Republic of). Agricultural, Medical and Industrial Research School; Farahani, Zahra; Eslami, Mohammad [Zanjan Univ. (Iran, Islamic Republic of). Dept. of Physics
2015-12-15
{sup 51}Cr (T{sub 1/2} = 27.7 d), which decays via electron capture (100 %) with 320 keV gamma emission (9.8 %), is a radionuclide with still a large application in biological studies. In this work, ALICE/ASH and TALYS nuclear model codes along with some adjustments are used to calculate the excitation functions for proton, deuteron, α-particle and neutron induced on various targets leading to the production of {sup 51}Cr radioisotope. The production yields of {sup 51}Cr from various reactions are determined using the excitation function calculations and stopping power data. The results are compared with corresponding experimental data and discussed from point of view of feasibility.
Antineoplastic Effects of PPARγ Agonists, with a Special Focus on Thyroid Cancer.
Ferrari, Silvia Martina; Materazzi, Gabriele; Baldini, Enke; Ulisse, Salvatore; Miccoli, Paolo; Antonelli, Alessandro; Fallahi, Poupak
2016-01-01
Peroxisome Proliferator-Activated Receptor-γ (PPARγ) is a ligand-activated nuclear hormone receptor that functions as transcription factor and plays an important role in lipid metabolism and insulin sensitization. Recent studies have shown that PPARγ is overexpressed in many tumor types, including cancers of breast, lung, pancreas, colon, glioblastoma, prostate and thyroid differentiated/anaplastic cancers. These data suggest a role of PPARγ in tumor development and/or progression. PPARγ is emerging as a growth-limiting and differentiation-promoting factor, and it exerts a tumor suppressor role. Moreover, naturally-occurring and synthetic PPARγ agonists promote growth inhibition and apoptosis. Thiazolidinediones (TZDs) are synthetic agonists of PPARγ that were developed to treat type II diabetes. These compounds also display anticancer effects which appear mainly to be independent of their PPARγ agonist activity. Various preclinical and clinical studies strongly suggest a role for TZDs both alone and in combination with existing chemotherapeutic agents, for the treatment of cancer. Differentiation therapy involves the use of agents with the ability to induce differentiation in cells that have lost this ability, i.e. cancer cells, targeting pathways capable of re-activating blocked terminal differentiation programs. PPARγ agonists have been shown to induce differentiation in solid tumors such as thyroid differentiated/ anaplastic cancers and sarcomas. However, emerging data suggest that chronic use of TZDs is associated with increased risk of adverse cardiovascular events. The exploration of newer PPARγ agonists can help in unveiling the underlying mechanisms of these drugs, providing new molecules that are able to treat cancer, without increasing the cardiovascular risk of neoplastic patients.
The effect of spheroidizing by thermal cycling in low concentration Cr-Mo alloy steel
International Nuclear Information System (INIS)
Yun, H.S.; Kang, C.Y.
1979-01-01
An intensive study was carried out on spheroidizing of pearlite (Sph) and number of spherical carbide in proeutectoid ferrite (No/100) of low concentration Cr-Mo steel with thermal cycling. Physical and mechanical properties of steel containing 0.33 % C with thermal cycling were compared with those of low concentration Cr-Mo steel with thermal cycling. The effect of normal heat treatment and cooling rate on spheroidizing of pearlite and precipitation of fine spherical carbide in the steels were investigated. The results obtained were as follows: 1) Thermal cycling of low concentration Cr-Mo steel promoted the spheroidizing of pearlite compared with that of steel without Cr and Mo to steel had significant effect on spheroidizing of pearlite. 2) Number of fine spherical carbides of low concentration Cr-Mo steel with thermal cycling was over 5 times to that of fine spherical carbides of hypoeutectoid steel with thermal cycling. 3) Spheroidizing of pearlite and number of fine spherical carbide in proeutectoid ferrite of low concentration Cr-Mo steel with increasing thermal cycle and cooling rate. 4) Hardness of steel with thermal cycling was decreased. However, low concentration Cr-Mo steel had little decreasing rate in hardness with increasing thermal cycle on the basis of 100 times in thermal cycle. Therefore, toughness was considered to be increased with increasing spheroidizing of pearlite without changing mechanical properties. (author)
Bicarbonate catalysis of exchange synthesis of [51Cr]Cr(III)-EDTA and other chromium complexes
International Nuclear Information System (INIS)
Aronson, F.L.; Strashun, A.M.; Lopez, C.; Steigman, J.
1993-01-01
Exchange syntheses of trivalent chromium complexes often require heating, thus limiting tagging of heat-sensitive biological compounds with 51 Cr. Bicarbonate at pH 6, accelerates the formation of mM Cr-EDTA. Accordingly, room temperature catalysis with [ 51 Cr]Cr(III) at 10 -7 -10 -8 M was investigated. Complexes were successfully formed with EDTA and iminodiacetic acid (electrophoretic analysis) and acetylacetone and tropolone (analyzed by chloroform extraction). The formation of these complexes normally requires extensive heating. (author)
Foll, Bernard Le; Ciano, Patricia Di; Panlilio, Leigh V.; Goldberg, Steven R.; Ciccocioppo, Roberto
2013-01-01
This review examines the growing literature on the role of peroxisome proliferator-activated receptors (PPARs) in addiction. There are two subtypes of PPAR receptors that have been studied in addiction: PPAR-α and PPAR-γ. The role of each PPAR subtype in common models of addictive behavior, mainly pre-clinical models, is summarized. In particular, studies are reviewed that investigated the effects of PPAR-α agonists on relapse, sensitization, conditioned place preference, withdrawal and drug intake, and effects of PPAR-γ agonists on relapse, withdrawal and drug intake. Finally, studies that investigated the effects of PPAR agonists on neural pathways of addiction are reviewed. Taken together this preclinical data indicates that PPAR agonists are promising new medications for drug addiction treatment. PMID:23614675
Oxidation study of Cr-Ru hard coatings
Energy Technology Data Exchange (ETDEWEB)
Chen, Yung-I, E-mail: yichen@mail.ntou.edu.tw; Kuo, Yu-Chu; Chen, Sin-Min
2012-01-01
Cr-Ru alloy coatings with Cr content ranging from 47 to 83 at.% were deposited at 400 Degree-Sign C by direct current magnetron co-sputtering with a Ti interlayer on silicon substrates. With a total input power of 300 W, the Cr content in the Cr-Ru coatings increased linearly with the increasing input power of Cr. The intermetallic compound phase Cr{sub 2}Ru with columnar structure was identified for the as-deposited Cr{sub 56}Ru{sub 44} and Cr{sub 65}Ru{sub 35} coatings, resulting in an increase of hardness up to 15-16 GPa. To evaluate the performance of Cr-Ru coatings as a protective coating on glass molding dies, the annealing treatment was conducted at 600 Degree-Sign C in a 50 ppm O{sub 2}-N{sub 2} atmosphere. The outward diffusion and preferential oxidization of Cr in the Cr-Ru coatings resulted in the variations of the crystalline structure, chemical composition distribution, and surface hardness after annealing. X-ray diffraction and transmission electron microscopy (TEM) proved that an oxide scale consisting of Cr{sub 2}O{sub 3} formed on the free surface. Scanning electron microscopy and TEM observed the surface morphology and structural variation. The chemical composition depth profiles were analyzed by Auger electron microscopy, verifying the presence of a Cr-depleted zone beneath the oxide scale. The hardness of Cr{sub 56}Ru{sub 44} and Cr{sub 65}Ru{sub 35} coatings decreased to 11-12 GPa after annealing, accompanied by the replacement of the Cr{sub 2}Ru phase by the Ru phase. - Highlights: Black-Right-Pointing-Pointer We prepared crystalline Cr-Ru alloy coatings by direct current magnetron sputtering. Black-Right-Pointing-Pointer Cr-Ru coatings were annealed at 600 Degree-Sign C for 2 h in a 50 ppm O{sub 2}-N{sub 2} atmosphere. Black-Right-Pointing-Pointer Cr diffused outwardly and oxidized to form a stable and protective oxide scale. Black-Right-Pointing-Pointer The original columnar grains recrystallized to polycrystalline grains.
Energy Technology Data Exchange (ETDEWEB)
Johnson, Timothy E [Department of Safety Assessment, Merck Research Laboratories, WP45-319, Merck Research Laboratories, West Point, PA 19486 (United States); Zhang, Xiaohua [Department of Biometrics Research, Merck Research Laboratories, West Point, PA 19486 (United States); Shi, Shu [Department of Safety Assessment, Merck Research Laboratories, WP45-319, Merck Research Laboratories, West Point, PA 19486 (United States); Umbenhauer, Diane R [Department of Safety Assessment, Merck Research Laboratories, WP45-319, Merck Research Laboratories, West Point, PA 19486 (United States)
2005-11-01
Statins and fibrates (weak PPAR{alpha} agonists) are prescribed for the treatment of lipid disorders. Both drugs cause myopathy, but with a low incidence, 0.1-0.5%. However, combined statin and fibrate therapy can enhance myopathy risk. We tested the myotoxic potential of PPAR subtype selective agonists alone and in combination with statins in a differentiated rat myotube model. A pharmacologically potent experimental PPAR{alpha} agonist, Compound A, induced myotoxicity as assessed by TUNEL staining at a minimum concentration of 1 nM, while other weaker PPAR{alpha} compounds, for example, WY-14643, Gemfibrozil and Bezafibrate increased the percentage of TUNEL-positive nuclei at micromolar concentrations. In contrast, the PPAR{gamma} agonist Rosiglitazone caused little or no cell death at up to 10 {mu}M and the PPAR{delta} ligand GW-501516 exhibited comparatively less myotoxicity than that seen with Compound A. An experimental statin (Compound B) and Atorvastatin also increased the percentage of TUNEL-positive nuclei and co-treatment with WY-14643, Gemfibrozil or Bezafibrate had less than a full additive effect on statin-induced cell killing. The mechanism of PPAR{alpha} agonist-induced cell death was different from that of statins. Unlike statins, Compound A and WY-14643 did not activate caspase 3/7. In addition, mevalonate and geranylgeraniol reversed the toxicity caused by statins, but did not prevent the cell killing induced by WY-14643. Furthermore, unlike statins, Compound A did not inhibit the isoprenylation of rab4 or rap1a. Interestingly, Compound A and Compound B had differential effects on ATP levels. Taken together, these observations support the hypothesis that in rat myotube cultures, PPAR{alpha} agonism mediates in part the toxicity response to PPAR{alpha} compounds. Furthermore, PPAR{alpha} agonists and statins cause myotoxicity through distinct and independent pathways.
Hydrogen permeation in FeCrAl alloys for LWR cladding application
Hu, Xunxiang; Terrani, Kurt A.; Wirth, Brian D.; Snead, Lance L.
2015-06-01
FeCrAl, an advanced oxidation-resistant iron-based alloy class, is a highly prevalent candidate as an accident-tolerant fuel cladding material. Compared with traditional zirconium alloy fuel cladding, increased tritium permeation through FeCrAl fuel cladding to the primary coolant is expected, raising potential safety concerns. In this study, the hydrogen permeability of several FeCrAl alloys was obtained using a static permeation test station, which was calibrated and validated using 304 stainless steel. The high hydrogen permeability of FeCrAl alloys leads to concerns with respect to potentially significant tritium release when used for fuel cladding in LWRs. The total tritium inventory inside the primary coolant of a light water reactor was quantified by applying a 1-dimensional steady state tritium diffusion model to demonstrate the dependence of tritium inventory on fuel cladding type. Furthermore, potential mitigation strategies for tritium release from FeCrAl fuel cladding were discussed and indicate the potential for application of an alumina layer on the inner clad surface to serve as a tritium barrier. More effort is required to develop a robust, economical mitigation strategy for tritium permeation in reactors using FeCrAl clad fuel assemblies.
Experiments at SRT Using the NOAA CrIS/ATMS Proxy Data Set
Susskind, Joel; Kouvaris, Louis; Iredell, Lena
2011-01-01
The objectives of the talk are: (1) Assess the performance of NGAS Version-1.5.03.00 CrIS/ATMS retrieval algorithm as delivered by LaRC, modified to include the MW and IR tuning coefficients and new CrIS noise model (a) Percent acceptance (b) RMS and mean differences of T(p) vs. ECMWF truth as a function of % yield (2) Compare performance of NGAS retrieval algorithm with an AIRS Science Team Version-6 like retrieval algorithm modified at Sounder Research Team (SRT) for CrIS/ATMS
Low-field spin dynamics of Cr7Ni and Cr7Ni-Cu-Cr7Ni molecular rings as detected by μsR
Sanna, S.; Arosio, P.; Bordonali, L.; Adelnia, F.; Mariani, M.; Garlatti, E.; Baines, C.; Amato, A.; Sabareesh, K. P.V.; Timco, G.; Winpenny, R. E.P.; Blundell, S. J.; Lascialfari, A.
2017-01-01
Muon spin rotation measurements were used to investigate the spin dynamics of heterometallic Cr7Ni and Cr7Ni-Cu-Cr7Ni molecular clusters. In Cr7Ni the magnetic ions are arranged in a quasiplanar ring and interact via an antiferromagnetic exchange coupling constant J, while Cr7Ni-Cu-Cr7Ni is composed of two Cr7Ni linked by a bridging moiety containing one Cu ion, that induces an inter-ring ferromagnetic interaction J ≪ J. The longitudinal muon relaxation rate λ collected at low magnetic fields...
Atomistic simulation of the influence of Cr on the mobility of the edge dislocation in Fe(Cr) alloys
International Nuclear Information System (INIS)
Hafez Haghighat, S.M.; Terentyev, D.; Schaeublin, R.
2011-01-01
In this work Fe-Cr compounds, as model alloys for the ferritic base steels that are considered as main candidates for the structural materials of the future fusion reactors, are studied using molecular dynamics simulations. The Cr or so-called α' precipitates, which are obstacles to dislocations, affect mechanical properties, leading to hardening and loss of ductility. The flow stress to move an edge dislocation in a Cr solid solution in pure Fe is studied as a function of Cr content. The strength of a nanometric Cr precipitate as obstacle to an edge dislocation in pure Fe is investigated as a function of its Cr content. Results show that with increasing Cr content the precipitate obstacle strength increases, with a strong sensitivity to the local atomic order. Temperature induces a monotonic decrease of the flow stress of the Cr solid solution and of the Cr precipitate obstacle strength.
Xiang, Zhimin; Proneth, Bettina; Dirain, Marvin L; Litherland, Sally A; Haskell-Luevano, Carrie
2010-06-08
The melanocortin-4 receptor (MC4R) is a G-protein-coupled receptor (GPCR) that is expressed in the central nervous system and has a role in regulating feeding behavior, obesity, energy homeostasis, male erectile response, and blood pressure. Since the report of the MC4R knockout mouse in 1997, the field has been searching for links between this genetic biomarker and human obesity and type 2 diabetes. More then 80 single nucleotide polymorphisms (SNPs) have been identified from human patients, both obese and nonobese controls. Many significant studies have been performed examining the pharmacological characteristics of these hMC4R SNPs in attempts to identify a molecular defects/insights that might link a genetic factor to the obese phenotype observed in patients possessing these mutations. Our laboratory has previously reported the pharmacological characterization of 40 of these polymorphic hMC4 receptors with multiple endogenous and synthetic ligands. The goal of the current study is to perform a similar comprehensive side-by-side characterization of 30 additional human hMC4R with single nucleotide polymorphisms using multiple endogenous agonists [alpha-, beta-, and gamma(2)-melanocyte stimulating hormones (MSH) and adrenocorticotropin (ACTH)], the antagonist agouti-related protein hAGRP(87-132), and synthetic agonists [NDP-MSH, MTII, and the tetrapeptide Ac-His-dPhe-Arg-Trp-NH(2) (JRH887-9)]. These in vitro data, in some cases, provide a putative molecular link between dysfunctional hMC4R's and human obesity. These 30 hMC4R SNPs include R7H, R18H, R18L, S36Y, P48S, V50M, F51L, E61K, I69T, D90N, S94R, G98R, I121T, A154D, Y157S, W174C, G181D, F202L, A219 V, I226T, G231S, G238D, N240S, C271R, S295P, P299L, E308K, I317V, L325F, and 750DelGA. All but the N240S hMC4R were identified in obese patients. Additionally, we have characterized a double I102T/V103I hMC4R. In addition to the pharmacological characterization, the hMC4R variants were evaluated for cell surface
Agonist-induced desensitization of human β3-adrenoceptors expressed in human embryonic kidney cells
Michel-Reher, Martina B.; Michel, Martin C.
2013-01-01
β3-Adrenoceptors are resistant to agonist-induced desensitization in some cell types but susceptible in others including transfected human embryonic kidney (HEK) cells. Therefore, we have studied cellular and molecular changes involved in agonist-induced β3-adrenoceptor desensitization in HEK cells.
Development of specific dopamine D-1 agonists and antagonists
International Nuclear Information System (INIS)
Sakolchai, S.
1987-01-01
To develop potentially selective dopamine D-1 agonists and to investigate on the structural requirement for D-1 activity, the derivatives of dibenzocycloheptadiene are synthesized and pharmacologically evaluated. The target compounds are 5-aminomethyl-10,11-dihydro-1,2-dihydroxy-5H-dibenzo[a,d]cycloheptene hydrobromide 10 and 9,10-dihydroxy-1,2,3,7,8,12b-hexahydrobenzo[1,2]cyclohepta[3,4,5d,e]isoquinoline hydrobromide 11. In a dopamine-sensitive rat retinal adenylate cyclase assay, a model for D-1 activity, compound 10 is essentially inert for both agonist and antagonist activity. In contrast, compound 11 is approximately equipotent to dopamine in activation of the D-1 receptor. Based on radioligand and binding data, IC 50 of compound 11 for displacement of 3 H-SCH 23390, a D-1 ligand, is about 7 fold less than that for displacement of 3 H-spiperone, a D-2 ligand. These data indicate that compound 11 is a potent selective dopamine D-1 agonist. This study provides a new structural class of dopamine D-1 acting agent: dihydroxy-benzocycloheptadiene analog which can serve as a lead compound for further drug development and as a probe for investigation on the nature of dopamine D-1 receptor
Serotonin 2A receptor agonist binding in the human brain with [C]Cimbi-36
DEFF Research Database (Denmark)
Ettrup, A.; da Cunha-Bang, S.; McMahon, Barry P.
2014-01-01
[C]Cimbi-36 was recently developed as a selective serotonin 2A (5-HT) receptor agonist radioligand for positron emission tomography (PET) brain imaging. Such an agonist PET radioligand may provide a novel, and more functional, measure of the serotonergic system and agonist binding is more likely ....... Thus, we here describe [C]Cimbi-36 as the first agonist PET radioligand to successfully image and quantify 5-HT receptors in the human brain.Journal of Cerebral Blood Flow & Metabolism advance online publication, 30 April 2014; doi:10.1038/jcbfm.2014.68....... than antagonist binding to reflect 5-HT levels in vivo. Here, we show data from a first-in-human clinical trial with [C]Cimbi-36. In 29 healthy volunteers, we found high brain uptake and distribution according to 5-HT receptors with [C]Cimbi-36 PET. The two-tissue compartment model using arterial input...
Effect of CrO3 Sealing Time on Anodized A12024-T3
Korda, Akhmad A.; Hidayat, R. Z.
2016-08-01
The effect of CrO3 sealing time on anodized aluminum alloy has been investigated. A1 2024-T3 were used as substrate. Anodizing was carried out using chromic acid. CrO3 sealing was conducted in CrO3 solution for 30, 60, 90, 120 and 150 minutes. As comparison, other specimens were also prepared as anodized and boiled water sealing. Thickness of the coating was observed by optical microscope. Anodized and sealing layer was analyzed by X- ray diffraction. The hardness of as anodized, boiled water sealing and CrO3 sealing were compared. The highest hardness is achieved by CrO3 sealed specimen and followed by boiled water sealing and as anodized specimens. The longer the processes of CrO3 sealing the higher layer thickness and therefore the higher hardness of the oxide layer. The best resistance to electrolyte penetration is achieved by the CrO3 sealed specimen followed by boiled water sealed and as anodized specimens. The higher thickness of oxide layer, the higher the resistance against electrolyte penetration.
Effect of CrO_3 Sealing Time on Anodized A12024-T3
International Nuclear Information System (INIS)
Korda, Akhmad A; Hidayat, R Z
2016-01-01
The effect of CrO_3 sealing time on anodized aluminum alloy has been investigated. A1 2024-T3 were used as substrate. Anodizing was carried out using chromic acid. CrO_3 sealing was conducted in CrO_3 solution for 30, 60, 90, 120 and 150 minutes. As comparison, other specimens were also prepared as anodized and boiled water sealing. Thickness of the coating was observed by optical microscope. Anodized and sealing layer was analyzed by X- ray diffraction. The hardness of as anodized, boiled water sealing and CrO_3 sealing were compared. The highest hardness is achieved by CrO_3 sealed specimen and followed by boiled water sealing and as anodized specimens. The longer the processes of CrO3 sealing the higher layer thickness and therefore the higher hardness of the oxide layer. The best resistance to electrolyte penetration is achieved by the CrO_3 sealed specimen followed by boiled water sealed and as anodized specimens. The higher thickness of oxide layer, the higher the resistance against electrolyte penetration. (paper)
International Nuclear Information System (INIS)
Mosymow, E.; Glaum, R.; Kremer, R.K.
2014-01-01
The two new phosphates LiCr II 4 (PO 4 ) 3 and Li 5 Cr II 2 Cr III (PO 4 ) 4 are discovered as equilibrium phases (ϑ=800 °C) in the quarternary system Li/Cr/P/O. Their crystal structures have been determined from single-crystal X-ray diffraction data (LiCr II 4 (PO 4 ) 3 : violet-blue, Pnma (no. 62), Z=4, a=6.175(1) Å, b=14.316(3) Å, c=10.277(2) Å, 100 parameters, R 1 =0.028, wR 2 =0.08, 2060 unique reflections with F o >4σ(F o ); Li 5 Cr II 2 Cr III (PO 4 ) 4 : greyish-green, P1 ¯ (no. 2), Z=1, a=4.9379(7) Å, b=7.917(2) Å, c=8.426(2) Å, α=109.98(2)°, β=90.71(1)°, γ=104.91(1)°, 131 parameters, R 1 =0.022, wR 2 =0.067, 1594 unique reflections with F o >4σ(F o )). Li 5 Cr II 2 Cr III (PO 4 ) 4 adopts an hitherto unknown structure type. The crystal structure of LiCr II 4 (PO 4 ) 3 is isotypic to that of NaCd II 4 (PO 4 ) 3 and related to that of the mineral silicocarnotite Ca 5 (PO 4 ) 2 (SiO 4 ). Significant disorder between Li + and Cr 2+ is observed for both crystal structures. The oxidation states assigned to chromium in these two phosphates are in agreement with UV/vis/NIR absorption spectra and magnetic susceptibility data recorded for both compounds. Instead of “LiCr II PO 4 ” mixtures of LiCr II 4 (PO 4 ) 3 , Li 5 Cr II 2 Cr III (PO 4 ) 4 , Cr 2 O 3 , and CrP are observed at equilibrium. Instead of “Li 2 Cr II P 2 O 7 ” four-phase mixtures consisting of Li 9 Cr III 3 (P 2 O 7 ) 3 (PO 4 ) 2 , Li 3 Cr III 2 (PO 4 ) 3 , LiCrP 2 O 7 , and CrP were obtained. - Graphical abstract: Investigations on the equilibrium relations in the system Li/Cr/P/O revealed the two hitherto unknown phosphates Li 5 Cr II 2 Cr III (PO 4 ) 4 and LiCr II 4 (PO 4 ) 3 . They form instead of “LiCr II PO 4 ”. The crystal structures, magnetic behavior and optical spectra of these phosphates are reported. - Highlights: • The two new phosphates Li 5 Cr II 2 Cr III (PO 4 ) 4 and LiCr II 4 (PO 4 ) 3 have been characterized. • Optical spectra and paramagnetism of
The study of Cr3+/Cr2+ redox system by polarographic method
Directory of Open Access Journals (Sweden)
S. A. Pokhmyolkina
2014-08-01
of redox Cr+3/ Cr+2. The specific reaction rate found by extrapolating the straight line constructed in the lgK = f (E coordinates to the equilibrium potential Ep. Equilibrium potential found by the Eyring method as half-wave potential for the reversible waves.We have constructed the initial currents of irreversible waves, considering that the beginning of irreversible and reversible waves practically coincide. Specific reaction rate (K is associated with activation energy given by: lgK= lg(ВТ/h∙ δ – ΔF/2,3RT, where: B is the Boltzmann constant, T is temperature Kelvin , h - Planck constant , δ - the distance between ions 2 ∙ 10-8 cm , R - universal gas constant , ΔF- changing activation energy. Substituting the values of the constants in the equation, we obtain an expression for calculating the activation energy: ΔF = 6,86∙103 – 1,35∙103lgК. An important characteristic of irreversible processes is the change in entropy, as the derivative of the entropy increment in time (diS / dt = ΔS. This quantity can be expressed in terms of current strength (J and overvoltage (η: ΔS = (diS / dt = 1 / T ∙ J η. In polarographic it indicates that the electrochemical process is complicated as compared with delivery of reactant to the electrode. With increasing temperature, we saw insignificant changes in the kinetic characteristics of both anodic and cathodic reduction of chromium salts. Obviously, accelerate the process of discharging ions prevents complication. Conclusion. This indicates a different state of ions of bivalent and trivalent chromium in solution and various ways of the electrode processes.
Measurement of indoor radon concentration by CR-39 track detector
International Nuclear Information System (INIS)
Yamamoto, Masayoshi; Yoneda, Shigeru; Nakanishi, Takashi.
1990-01-01
A convenient and cheap method for measuring indoor radon ( 222 Rn) concentration with a CR-39 track detector is described. The detector consisted of two sheets of CR-39 enclosed separately in two plastic pots : one covered by a filter (cup method) and another no covering (bare method). The bare method was used here to supplement the cup method. To compare with the result of the CR-39 detector, alpha-ray spectrometry was carried out with a Si(Au) detector in a controlled radon exposure chamber. Indoor radon concentration measured in 133 houses in several districts of Ishikawa Prefecture have been found to range from 6 Bq/m 3 to as high as 113 Bq/m 3 with a median value of 24 Bq/m 3 . The problems to measure indoor radon concentration using the CR-39 detector are also discussed with emphasis on the position of setting the detector in the room and the possible thoron contribution to the detector. (author)
Microstructure and elevated temperature stability of 9-12% Cr steels
Energy Technology Data Exchange (ETDEWEB)
Dogan, Omer N.; Hawk, Jeffrey A.
2005-02-01
Medium Cr steels have been used in fossil fired power plants for many years because of their excellent high temperature stability and mechanical properties. As the desire to increase the efficiency of power plants continues, the operating temperature (>650C) continues to go up. Currently available low and medium Cr containing steels will not withstand the new operating temperature and must be reassessed in terms of their solid-solution and precipitation strengthening schemes. Three medium Cr steels were developed to investigate high temperature alloy strengthening strategies: 0.08C-(9-12)Cr-1.2Ni-0.7Mo-3.0Cu-3.0Co-0.5Ti. The microstructure of the alloy will be described in the as-cast and thermo-mechanically worked states. In addition, the effect on microstructure from long-term high temperature exposure will also be discussed. Finally, the overall stability of these steels will be compared against currently available power plant steels.
Experiences with new and improved oil quenched CrMoV rotor materials
International Nuclear Information System (INIS)
Ewald, J.; Keienburg, K.H.; Wiemann, W.; Sauer, D.L.
1987-01-01
The improvement gained with 1% CrMoNiV rotors of modern manufacturing processes are described. It was possible to raise the creep strength as well as the toughness level. The aim of this paper is to present representative data from older 1% CrMoNiV rotors and to compare them with test results from rotors of modern steel making technology and with improved chemical composition. The results prove, that the todays oil quenched version of the 1% CrMoNiV rotor material represents a good compromise with respect to creep rupture and (fracture) toughness behaviour. In addition the 1% CrMoNiV-steels have a stable microstructure which implements minor changes of properties during long term service
The effects of the dopamine agonist rotigotine on hemispatial neglect following stroke
Gorgoraptis, Nikos; Mah, Yee-Haur; Machner, Bjoern; Singh-Curry, Victoria; Malhotra, Paresh; Hadji-Michael, Maria; Cohen, David; Simister, Robert; Nair, Ajoy; Kulinskaya, Elena; Ward, Nick; Greenwood, Richard; Husain, Masud
2012-01-01
Hemispatial neglect following right-hemisphere stroke is a common and disabling disorder, for which there is currently no effective pharmacological treatment. Dopamine agonists have been shown to play a role in selective attention and working memory, two core cognitive components of neglect. Here, we investigated whether the dopamine agonist rotigotine would have a beneficial effect on hemispatial neglect in stroke patients. A double-blind, randomized, placebo-controlled ABA design was used, ...
International Nuclear Information System (INIS)
Brady, M.P.; Tortorelli, P.F.
1998-01-01
The oxidation behavior of Cr(X) solid solution (Cr ss ) and Cr 2 X Laves phases (X = Nb, Ta) was studied individually and in combination at 950--1,100 C in air. The Cr ss phase was significantly more oxidation resistant than the Cr 2 X Laves phase. At 950 C, two-phase alloys of Cr-Cr 2 Nb and Cr-Cr 2 Ta exhibited in-situ internal oxidation, in which remnants of the Cr 2 X Laves phase were incorporated into a growing chromia scale. At 1,100 C, the Cr-Cr 2 Nb alloys continued to exhibit in-situ internal oxidation, which resulted in extensive O/N penetration into the alloy ahead of the alloy-scale interface and catastrophic failure during cyclic oxidation. IN contrast, the Cr-Cr 2 Ta alloys exhibited a transition to selective Cr oxidation and the formation of a continuous chromia scale. The oxidation mechanism is interpreted in terms of multiphase oxidation theory
Determination of Cr(VI) in wood specimen: A XANES study at the Cr K edge
International Nuclear Information System (INIS)
Strub, E.; Plarre, R.; Radtke, M.; Reinholz, U.; Riesemeier, H.; Schoknecht, U.; Urban, K.; Juengel, P.
2008-01-01
The content of chromium in different oxidation states in chromium-treated wood was studied with XANES (X-ray absorption near-edge structure) measurements at the Cr K absorption edge. It could be shown that wood samples treated with Cr(VI) (pine and beech) did still contain a measurable content of Cr(VI) after four weeks conditioning. If such wood samples were heat exposed for 2 h with 135 deg. C prior conditioning, Cr(VI) was no longer detected by XANES, indicating a complete reduction to chromium (III)
Magnetic properties and crystal texture of Co alloy thin films prepared on double bias Cr
Deng, Y.; Lambeth, D. N.; Lee, L.-L.; Laughlin, D. E.
1993-05-01
A double layer Cr film structure has been prepared by sputter depositing Cr on single crystal Si substrates first without substrate bias and then with various substrate bias voltages. Without substrate bias, Cr{200} texture grows on Si at room temperature; thus the first Cr layer acts like a seed Cr layer with the {200} texture, and the second Cr layer, prepared with substrate bias, tends to replicate the {200} texture epitaxially. CoCrTa and CoNiCr films prepared on these double Cr underlayers, therefore, tend to have a {112¯0} texture with their c-axes oriented in the plane of the film. At the same time, the bias sputtering of the second Cr layer increases the coercivity of the subsequently deposited magnetic films significantly. Comparison studies of δM curves show that the use of the double Cr underlayers reduces the intergranular exchange interactions. The films prepared on the Si substrates have been compared with the films prepared on canasite and glass substrates. It has also been found that the magnetic properties are similar for films on canasite and on glass.
Development of the dentistry alloy Ni-Cr-Nb; Desenvolvimento de ligas odontologicas Ni-Cr-Nb
Energy Technology Data Exchange (ETDEWEB)
Souza, M.A.; Ramos, A.S.; Hashimoto, T.M., E-mail: mari_sou@hotmail.co [UNESP/FEG, Guaratingueta, SP (Brazil). Fac. de Engenharia. Dept. de Materiais e Tecnologia
2010-07-01
This work reports on the structural characterization of Ni-Cr-Mo and Ni-Cr-Nb alloys produced by arc melting. Samples were characterized by means of optical microscopy, X-ray diffraction, scanning electron microscopy, and EDS analysis. Results indicated that the arc melting process was efficient to produce homogeneous structures in Ni-Cr-Mo and Ni-Cr-Nb alloys. The nickel dissolved large amounts of Cr, Mo and Nb, which was detected by EDS analysis and X-ray diffraction. The alloy containing molybdenum indicated the presence of structure based on Ni{sub SS}, while that the alloys containing niobium presented primary grains of Ni{sub SS} and precipitates formed by the simultaneous transformation of the Ni and Ni{sub 3}Nb phases. (author)
Oxidation resistance of CrN/(Cr,V)N hard coatings deposited by DC magnetron sputtering
Energy Technology Data Exchange (ETDEWEB)
Panjan, P., E-mail: peter.panjan@ijs.si [Jožef Stefan Institute, Jamova 39, 1000 Ljubljana (Slovenia); Drnovšek, A.; Kovač, J.; Gselman, P. [Jožef Stefan Institute, Jamova 39, 1000 Ljubljana (Slovenia); Bončina, T. [University of Maribor, Faculty of Mechanical Engineering, Smetanova 17, 2000 Maribor (Slovenia); Paskvale, S.; Čekada, M.; Kek Merl, D.; Panjan, M. [Jožef Stefan Institute, Jamova 39, 1000 Ljubljana (Slovenia)
2015-09-30
In recent years vanadium-doped hard coatings have become available as possible candidates for self-lubrication at high temperatures. Their low coefficient of friction has mainly been attributed to the formation of the V{sub 2}O{sub 5} phase. However, the formation of vanadium oxides must be controlled by the out-diffusion of vanadium in order to achieve the combination of a low coefficient of friction and good mechanical properties for the protective coatings. In this work the application of a nanolayer of CrN/(Cr,V)N hard coating was proposed as a way to better control the out-diffusion of vanadium, while the topmost chromium oxide layer acts as barrier for the vanadium diffusion. However, the aim of this investigation was not only to focus on the formation of the oxide layer. Special attention was given to the oxidation process that takes place at the growth defects, where we observed a strong diffusion of vanadium taking place. The CrN/(Cr,V)N nanolayer coatings were deposited by DC unbalanced magnetron sputtering in an CC800/9 (CemeCon) industrial unit. The vanadium concentration in the (Cr,V)N layers was varied in the range 1.0–11.5 at.%. - Highlights: • Oxidation processes of CrN/(Cr,V)N nanolayers with vanadium content were investigated. • The CrN/(Cr,V)N hard layers were oxidized at high temperature in O2 atm. • The top chromium oxide layer acts as a diffusion barrier for vanadium ions during oxidation. • Important role of growth defects during the oxidation process is demonstrated.
Oxidation resistance of CrN/(Cr,V)N hard coatings deposited by DC magnetron sputtering
International Nuclear Information System (INIS)
Panjan, P.; Drnovšek, A.; Kovač, J.; Gselman, P.; Bončina, T.; Paskvale, S.; Čekada, M.; Kek Merl, D.; Panjan, M.
2015-01-01
In recent years vanadium-doped hard coatings have become available as possible candidates for self-lubrication at high temperatures. Their low coefficient of friction has mainly been attributed to the formation of the V_2O_5 phase. However, the formation of vanadium oxides must be controlled by the out-diffusion of vanadium in order to achieve the combination of a low coefficient of friction and good mechanical properties for the protective coatings. In this work the application of a nanolayer of CrN/(Cr,V)N hard coating was proposed as a way to better control the out-diffusion of vanadium, while the topmost chromium oxide layer acts as barrier for the vanadium diffusion. However, the aim of this investigation was not only to focus on the formation of the oxide layer. Special attention was given to the oxidation process that takes place at the growth defects, where we observed a strong diffusion of vanadium taking place. The CrN/(Cr,V)N nanolayer coatings were deposited by DC unbalanced magnetron sputtering in an CC800/9 (CemeCon) industrial unit. The vanadium concentration in the (Cr,V)N layers was varied in the range 1.0–11.5 at.%. - Highlights: • Oxidation processes of CrN/(Cr,V)N nanolayers with vanadium content were investigated. • The CrN/(Cr,V)N hard layers were oxidized at high temperature in O2 atm. • The top chromium oxide layer acts as a diffusion barrier for vanadium ions during oxidation. • Important role of growth defects during the oxidation process is demonstrated.
International Nuclear Information System (INIS)
Berschauer, F.
1989-01-01
Various substituted phenylethanolamines, acting on the sympathetic nervous system, have been shown to increase protein retention (via decreased proteolysis) and reduce fat deposition (via increased lipolysis and reduced lipogenesis) in ruminants and monogastrics. Research with finishing lambs in developed countries show various beta-adrenergic agonists to improve growth rate (by 18%), feed conversion (by 12%) and carcass quality (28% increase in area of longissimus dorsi and 33% reduction in subcutaneous fat). Similar effects of beta-agonists on carcass composition of well fed cattle have been reported. The effects of beta-agonists on livestock in developing countries of the tropics have not yet been investigated, but their effects in increasing metabolic rate suggest that treated ruminants would be more vulnerable to hot environments. Beta-agonists appear to improve nitrogen retention to a greater extent in breeds with a lower potential for muscle growth. In view of this, they might be particularly effective in improving nitrogen retention in tropical breeds which have a low growth potential. This aspect, together with the response of undernourished animals in the developing countries, needs investigation. Beta-adrenergic agonists are not yet registered for use in animal production, but product licenses for some of them are expected to be granted soon. (author). 31 refs, 1 fig., 12 tabs
A crítica feminista na mira da crítica A crítica feminista na mira da crítica
Directory of Open Access Journals (Sweden)
Rita Terezinha Schmidt
2008-04-01
Full Text Available This essay presents a dialogue with some texts that appeared in an anthology of critical writings about “Brazilian feminisms,” problematizing them and thus providing a productive discussion about the production of knowledge about and by feminist criticism in Brazil. Este artigo apresenta um diálogo com textos presentes em uma antologia crítica sobre “feminismos brasileiros”, problematizando-os e, por conseguinte, gerando uma discussão produtiva acerca da produção de conhecimento sobre e pela crítica feminista no Brasil.
Synthesis and characterization of Cr doped CoFe2O4
Verma, Kavita; Patel, K. R.; Ram, Sahi; Barbar, S. K.
2016-05-01
Polycrystalline samples of pure and Cr-doped cobalt ferrite (CoFe2O4 and CoCrFeO4) were prepared by solid state reaction route method. X-ray diffraction pattern infers that both the samples are in single phase with Fd3m space group. Slight reduction in the lattice parameter of CoCrFeO4 has been observed as compared to CoFe2O4. The dielectric dispersion has been explained on the basis of Fe2+ ↔ Fe3+ hopping mechanism. The polarizations at lower frequencies are mainly attributed to electronic exchange between Fe2+ ↔ Fe3+ ions on the octahedral site in the ferrite lattice. In the present system a part from n-type charge carrier (Fe3+/Fe2+), the presence of (Co3+/Co2+) ions give rise to p-type charge carrier. Therefore in addition to n-type charge carrier, the local displacement of p-type charge carrier in direction of external electric field also contributes to net polarization. However, the dielectric constant and loss tangent of CoCrFeO4 are found to be lower than CoFe2O4 and is attributed to the availability of ferrous ion. CoCrFeO4 have less amount of ferrous ion available for polarization as compared to that of CoFe2O4. The impedance spectra reveal a grain interior contribution to the conduction process.
International Nuclear Information System (INIS)
Griffith, R.V.
1987-01-01
CR39 proton sensitive track detectors were greeted by the radiation protection community at the end of the last decade as a major breakthrough for personnel neutron dosimetry. A number of laboratories eagerly began research on application of CR39 to their dosimetry needs. However, in the last two or three years the enthusiasm has subsided, and many health physicists have stopped working with the material. The number of participants using CR39 in the Oak Ridge National Laboratory Personnel Intercomparison Studies dropped from six in 1985 to three in 1986. On a national level, the Federal Republic of Germany with researchers active in CR39 research recently adopted an albedo system as their national standard. In contrast, the United States Department of Energy (DOE) is supporting development of a CR39 based combination dosimeter to meet Department wide dosimetry needs. The English National Radiological Protection Board (NRPB) now features the use of CR39 in the NRPB PADC(CR39). There has obviously been a range of experiences with CR39 in the dosimetry community. Why has this been the case, and what is the proper role for CR39 in personnel neutron dosimetry. 12 refs., 2 figs., 1 tab
Ni-Cr thin film resistor fabrication for GaAs monolithic microwave integrated circuits
International Nuclear Information System (INIS)
Vinayak, Seema; Vyas, H.P.; Muraleedharan, K.; Vankar, V.D.
2006-01-01
Different Ni-Cr alloys were sputter-deposited on silicon nitride-coated GaAs substrates and covered with a spin-coated polyimide layer to develop thin film metal resistors for GaAs monolithic microwave integrated circuits (MMICs). The contact to the resistors was made through vias in the polyimide layer by sputter-deposited Ti/Au interconnect metal. The variation of contact resistance, sheet resistance (R S ) and temperature coefficient of resistance (TCR) of the Ni-Cr resistors with fabrication process parameters such as polyimide curing thermal cycles and surface treatment given to the wafer prior to interconnect metal deposition has been studied. The Ni-Cr thin film resistors exhibited lower R S and higher TCR compared to the as-deposited Ni-Cr film that was not subjected to thermal cycles involved in the MMIC fabrication process. The change in resistivity and TCR values of Ni-Cr films during the MMIC fabrication process was found to be dependent on the Ni-Cr alloy composition
Directory of Open Access Journals (Sweden)
Matthias J Duechs
Full Text Available Severe asthma is characterised by persistent inflammation, hyperreactivity and remodeling of the airways. No efficient treatment is available, this is particularly the case for steroid resistant phenotypes. Our aim therefore was to develop a preclinical model showing characteristics of severe human asthma including steroid insensitivity. Mice were first sensitized with ovalbumin, extracts of cockroach or house dust mite followed by a challenge period of seven weeks. Further to this, an additional group of mice was sensitized with all three allergens and then challenged with allergen alternating weekly between allergens. All three allergens applied separately to the mice induced comparably strong Th2-type airway inflammation, airway hyperreactivity and airway remodeling, which was characterised by fibrosis and increased smooth muscle thickness. In contrast, application of all three allergens together resulted in a greater Th2 response and increased airway hyperreactivity and a stronger albeit not significant remodeling phenotype compared to using HDM or CRA. In this triple allergen model dexamethasone application, during the last 4 weeks of challenge, showed no suppressive effects on any of these parameters in this model. In contrast, both TLR7 agonist resiquimod and TLR9 agonist CpG-ODN reduced allergen-specific IgE, eosinophils, and collagen I in the lungs. The TLR9 agonist also reduced IL-4 and IL-5 whilst increasing IFN-γ and strongly IL-10 levels in the lungs, effects not seen with the TLR7 agonist. However, neither TLR agonist had any effect on airway hyperreactivity and airway smooth muscle mass. In conclusion we have developed a severe asthma model, which is steroid resistant and only partially sensitive to TLR7 and TLR9 agonist treatment. This model may be particular useful to test new potential therapeutics aiming at treating steroid resistant asthma in humans and investigating the underlying mechanisms responsible for steroid
Electronic and magnetic properties of SmCrSb3 and GdCrSb3: A first principles study
International Nuclear Information System (INIS)
Sandeep; Ghimire, M.P.; Thapa, R.K.
2011-01-01
The density of states (DOS) and the magnetic moments of SmCrSb 3 and GdCrSb 3 have been studied by first principles full-potential linearized augmented plane wave (FP-LAPW) method based on density functional theory (DFT). For the exchange-correlation potential, the local-spin density approximations with correlation energy (LSDA+U) method have been used. Total and partial DOS have been computed using the WIEN2k code. DOS result shows the exchange-splittings of Cr-3d and rare-earth (R) 4f states electrons, which are responsible for the ground state ferromagnetic (FM) behavior of the systems. The FM behavior of these systems is strongly influenced by the average number of Cr-3d and Sm (Gd) 4f-electrons. The effective moment of SmCrSb 3 is found to be 7.07 μ B while for GdCrSb 3 it is 8.27 μ B . The Cr atom plays a significant role on the magnetic properties due to the hybridization between Cr-3d and Sb-5p states. - Highlights: → DOS and the magnetic moments of SmCrSb 3 and GdCrSb 3 are studied by full-FP-LAPW method. → Exchange splitting of eg and t2g of Cr-3d states and the rare-earth 4f state electrons are responsible for ground state ferromagnetism. → Rare-earth magnetic moments are greater than Cr moment indicating presence of 4f states.
Anti-wetting Cu/Cr coating with micro-posts array structure fabricated by electrochemical approaches
International Nuclear Information System (INIS)
Zhou, Yufeng; Hang, Tao; Li, Feng; Li, Ming
2013-01-01
Microposts structured Cu/Cr multilayer coating was prepared by a simple two-step approach combining electroless and electro deposition. Surface morphologies of the as-prepared Cu/Cr multilayer coating characterized by field emission scanning electron microscopy show that this multilayer coating exhibits micro-posts arrayed structure with a layer of Cr uniformly covering the circular conical surface of Cu micro-cones array. The wettability test shows that the contact angle of Cu/Cr multilayer surface with water drop can be greater than 140° by optimizing the electrodeposition time of Cr. The mechanism of hydrophobicity of both the micro-cones arrayed and micro-posts arrayed structures was briefly discussed by comparing two different wetting modes. Due to its good anti-wetting property and unique structure, the micro-posts arrayed Cu/Cr multilayer coating is expected for extensive practical applications.
Directory of Open Access Journals (Sweden)
Robab Davar
2015-08-01
Full Text Available Background: There is no doubt that luteal phase support is essential to enhance the reproductive outcome in IVF cycles. In addition to progesterone and human chorionic gonadotropin, several studies have described GnRH agonists as luteal phase support to improve implantation rate, pregnancy rate and live birth rate, whereas other studies showed dissimilar conclusions. All of these studies have been done in fresh IVF cycles. Objective: To determine whether an additional GnRH agonist administered at the time of implantation for luteal phase support in frozen-thawed embryo transfer (FET improves the embryo developmental potential. Materials and Methods: This is a prospective controlled trial study in 200 FET cycles, patients were randomized on the day of embryo transfer into group 1 (n=100 to whom a single dose of GnRH agonist (0.1 mg triptorelin was administered three days after transfer and group 2 (n=100, who did not receive agonist. Both groups received daily vaginal progesterone suppositories plus estradiol valerate 6 mg daily. Primary outcome measure was clinical pregnancy rate. Secondary outcome measures were implantation rate, chemical, ongoing pregnancy rate and abortion rate. Results: A total of 200 FET cycles were analyzed. Demographic data and embryo quality were comparable between two groups. No statistically significant difference in clinical and ongoing pregnancy rates was observed between the two groups (26% versus 21%, p=0.40 and 21% versus 17%, p=0.37, respectively. Conclusion: Administration of a subcutaneous GnRH agonist at the time of implantation does not increase clinical or ongoing pregnancy.
Innate Immune Responses to TLR2 and TLR4 Agonists Differ between Baboons, Chimpanzees and Humans
Brinkworth, Jessica F.; Pechenkina, Ekaterina A.; Silver, Jack; Goyert, Sanna M.
2012-01-01
Background African catarrhine primates differ in bacterial disease susceptibility. Methods Human, chimpanzee, and baboon blood was stimulated with TLR-detected bacterial agonists and cytokine/chemokine induction assessed by real-time pcr. Results Humans and chimpanzees shared similar cytokine/chemokine responses, while baboon cytokine/chemokine induction differed. Generally, responses were agonist-independent. Conclusions These primates tend to generate species rather than agonist–specific responses to bacterial agonists. PMID:22978822
HFO operation with CR injection
Energy Technology Data Exchange (ETDEWEB)
Poensgen, Christian [MAN-Diesel und Turbo SE, Augsburg (Germany)
2011-07-01
In 1996 MAN Diesel and Turbo SE started the development of a CR-system for medium speed engines for HFO operation up to fuel viscosity of 700 cSt. 2004 the first field test engine, a 7L 32/40 GenSet was put into service as a retrofit and collected up to now more than 20.000 running hours operated on HFO on a large container vessel. Meanwhile several L32/40 CR GenSets, L32/44 CR, V48/60 CR and L21/31 CR engines collected more than 100000 running hours in HFO operation before MAN Diesel started up the serial production of the new 32/44 CR and 48/60 CR engines. All of these engines are still in service. The paper will give an overview about the field experience and countermeasures which were necessary to develop a reliable product which fulfills the customers' demands concerning low fuel oil consumption, invisible smoke over the whole load range, low emission levels and maintenance costs. The experience was made in a wide range of applications such as GenSet, Cruise Vessel main propulsion and ferry main propulsion running 24h/day. The field test engines reached an availability of more than 90% per year. The paper also will point out the win/win situation for the the manufacturer and customer to participate in the development of the CR technology. For customers satisfaction MAN Diesel provides help for easy handling like online access per satellite connection, easy leakage detection and operator training at site or at the new built academies. The flexibility of the CR-system is the base frame for the future development of engines which fulfills IMO TIER II and IMO TIER III with high efficiency. The necessary reliability, a must, has been proven in the field under real conditions. (orig.)
Uchiyama, Masaaki; Shimizu, Akira; Masuda, Yukinari; Nagasaka, Shinya; Fukuda, Yuh; Takahashi, Hiroshi
2013-01-01
We clarified the effects of an ophthalmic solution of a peroxisome proliferator-activated receptor gamma (PPARγ) agonist on corneal inflammation and wound healing after alkali burn injury in rats. After alkali exposure, either an ophthalmic solution with 0.1% pioglitazone hydrochloride (the PPARγ group) or vehicle (the vehicle group) was topically applied to the cornea until day 14. Histological, immunohistochemical, and real-time reverse transcription polymerase chain reaction analysis were performed. After alkali injury, PPARγ expression increased, with the infiltration of many inflammatory cells. The infiltration of neutrophils and macrophages started from the corneal limbus within 6 h, and developed in the corneal center by day 7, with associated neovascularization. The accumulation of α-smooth muscle actin-positive myofibroblasts and the deposition of type III collagen were noted on day 14. The histological changes were suppressed significantly by treatment with the ophthalmic solution of the PPARγ agonist. In addition, the number of infiltrating M2 macrophages in the cornea was increased by PPARγ agonist treatment. In real-time reverse transcription polymerase chain reaction analysis, the messenger ribonucleic acid expression levels of interleukin-1β (IL-1β), IL-6, IL-8, monocyte chemoattractant protein-1, tumor necrosis factor-α, transforming growth factor beta 1, and vascular endothelial growth factor-A were decreased in the PPARγ group compared to the vehicle group in the early periods of corneal inflammation. The ophthalmic solution of the PPARγ agonist inhibited inflammation, decreased the fibrotic reaction, and prevented neovascularization in the cornea from the early phase after alkali burn injury. The ophthalmic solution of the PPARγ agonist may provide a new treatment strategy with useful clinical applications for corneal inflammation and wound healing.
Energy Technology Data Exchange (ETDEWEB)
Geribola, Gulherme Altomari
2014-07-01
Niobium and niobium based alloys are currently used in many industrial applications because they offer excellent resistance to degradation in various corrosive environments. These media include gaseous atmospheres at high temperatures such as those found in existing coal gasifying plants in power plants for energy generation. These atmospheres are complex gas mixtures that contain sulfur and oxygen, among other compounds. Sulphides are thermodynamically less stable, have lower melting points and often have larger deviations from stoichiometry compared to the corresponding oxides. Although there are studies regarding the use of refractory metals in high temperature sulphidizing atmospheres, the use of niobium compounds has not been adequately evaluated and there is very little studies available in the literature about its use as a protective coating. The aim of this study was to evaluate the effect of a niobium film, deposited by magnetron sputtering on the isothermal sulphidation behavior of Fe-20Cr and Fe-20Cr-1Y alloys. The sulphidation tests were carried out at 500, 600 and 700 deg C for 2h in H{sub 2}/2% H2S atmosphere. The sulphidation resistance was determined by mass gain per unit area. The sulphidation behavior of the coated and uncoated alloys was similar at 500 deg C, and none of the alloys scaled. At 700 deg C FeCr alloy scaled in the form of a fine powder, while the reaction product formed on the alloy FeCrY scaled in the form of plates. The effect of niobium became pronounced at 700 deg C. The reaction product layer formed on the coated alloy was thinner and more plastic than that formed on the uncoated alloy. The mass gain per unit area of the coated alloys decreased significantly and they did not scaled. (author)
'Scan GFR' as an alternative to 51Cr-EDTA clearance
International Nuclear Information System (INIS)
Osman, E.A.; Clarke, M.B.; Barrett, J.J.; Parsons, V.; Dulwich Hospital, London
1989-01-01
In this report 39 patients had their GFR assessed by 51 Cr-EDTA in a single shot-multiple sampling technique and also by measuring the quantitative renal uptake of 99m Tc-DTPA during a standard renal imaging test. The results showed a correlation coefficient of 0.96 between the two techniques. By using linear regression analysis the GFR was derived from the % renal uptake of DTPA in a further series of 24 patients in whom the 51 Cr-EDTA method was also employed. The two methods were compared and showed a correlation coefficient of 0.94 with a mean GFR difference of 7 ± 4.5 ml/min over a 51 Cr-EDTA range of 38-150 ml/min. (orig.) [de
Maruyama, Tatsuya; Onda, Kenichi; Hayakawa, Masahiko; Matsui, Tetsuo; Takasu, Toshiyuki; Ohta, Mitsuaki
2009-06-01
In the search for potent and selective human beta3-adrenergic receptor (AR) agonists as potential drugs for the treatment of obesity and noninsulin-dependent (type II) diabetes, a novel series of acetanilide-based analogues were prepared and their biological activities were evaluated at the human beta3-, beta2-, and beta1-ARs. Among these compounds, 2-pyridylacetanilide (2f), pyrimidin-2-ylacetanilide (2u), and pyrazin-2-ylacetanilide (2v) derivatives exhibited potent agonistic activity at the beta3-AR with functional selectivity over the beta1- and beta2-ARs. In particular, compound 2u was found to be the most potent and selective beta3-AR agonist with an EC(50) value of 0.11 microM and no agonistic activity for either the beta1- or beta2-AR. In addition, 2f, 2u, and 2v showed significant hypoglycemic activity in a rodent diabetic model.
Young, R. B.; Bridge, K. Y.
2003-01-01
Several beta-adrenergic receptor (bAR) agonists are known to cause hypertrophy of skeletal muscle tissue. Accordingly, five bAR agonists encompassing a range in activity from strong to weak were evaluated for their ability to stimulate CAMP accumulation in embryonic chicken skeletal muscle cells in culture. Two strong agonists (epinephrine and isoproterenol), one moderate agonist (albuterol), and two weak agonists known to cause hypertrophy in animals (clenbuterol and cimaterol) were studied. Dose response curves were determined over six orders of magnitude in concentration for each agonist, and values were determined for their maximum stimulation of CAMP synthesis rate (Bmax) and the agonist concentration at which 50% stimulation of CAMP synthesis (EC50) occurred. Bmax values decreased in the following order: isoproterenol, epinephrine, albuterol, cimaterol, clenbuterol. Cimaterol and clenbuterol at their Bmax concentrations were approximately 15-fold weaker than isoproterenol in stimulating the rate of CAMP synthesis. When cimaterol and clenbuterol were added to culture media at concentrations known to cause significant muscle hypertrophy in animals, there was no detectable effect on stimulation of CAMP synthesis. Finally, these same levels of cimaterol and clenbuterol did not antagonize the stimulation of CAMP by either epinephrine or isoproterenol.
International Nuclear Information System (INIS)
Liu, Qiang; Yang, Qiu Hong; Zhao, Guang Gen; Lu, Shen Zhou; Zhang, Hao Jia
2013-01-01
Highlights: •Polycrystalline Cr:α-Al 2 O 3 transparent ceramics were obtained with vacuum sintering method. •The influence of different concentration of Cr 2 O 3 on the thermoluminescence and optical stimulated luminescence properties of Cr:α-Al 2 O 3 transparent ceramics was studied. •It had a main peak at 503 K of very high intensity and linear concentration dependence up to high concentration. •It showed so interesting results with high TL sensitivity and high stability of OSL signal that Cr:α-Al 2 O 3 transparent ceramics might be a promising material in TL dosimetry and replace Cr:α-Al 2 O 3 crystals. -- Abstract: Polycrystalline Cr:α-Al 2 O 3 transparent ceramics were fabricated by conventional solid-state processing under vacuum condition. The SEM microstructure photographs of Cr:α-Al 2 O 3 transparent ceramics doped with different content of Cr 2 O 3 were investigated. The absorption, emission spectra, thermoluminescence and optical stimulated luminescence of Cr:α-Al 2 O 3 transparent ceramics were comparable to those of Cr:α-Al 2 O 3 crystals. The influence of different concentration of Cr 2 O 3 on the thermoluminescence and optical stimulated luminescence properties of Cr:α-Al 2 O 3 transparent ceramics was discussed. It showed so interesting results with high TL sensitivity and high stability of OSL signal that Cr:α-Al 2 O 3 transparent ceramics might be a promising material in TL dosimetry and replace Cr:α-Al 2 O 3 crystals
International Nuclear Information System (INIS)
Shen, Ying-Shuian; Wang, Shan-Li; Huang, Shiuh-Tsuen; Tzou, Yu-Min; Huang, Jang-Hung
2010-01-01
In this study, the removal mechanism of Cr(VI) from water by coconut coir (CC) was investigated using X-ray photoelectron spectroscopy (XPS), Cr K-edge X-ray absorption near edge structure (XANES) and FTIR spectroscopy. The results showed that, upon reaction with CC at pH 3, Cr(VI) was reduced to Cr(III), which was either bound to CC or released back into solution. As revealed by the FTIR spectra of CC before and after reacting with Cr(VI), the phenolic methoxyl and hydroxyl groups of lignin in CC are the dominant drivers of Cr(VI) reduction, giving rise to carbonyl and carboxyl groups on CC. These functional groups can subsequently provide binding sites for Cr(III) resulting from Cr(VI) reduction. In conjunction with forming complexes with carbonyl and carboxyl groups, the formation of Cr(III) hydroxide precipitate could also readily occur as revealed by the linear combination fitting of the Cr K-edge XANES spectrum using a set of reference compounds. The phenolic groups in lignin are responsible for initiating Cr(VI) reduction, so lignocellulosic materials containing a higher amount of phenolic groups are expected to be more effective scavengers for removal of Cr(VI) from the environment.
Energy Technology Data Exchange (ETDEWEB)
Shen, Ying-Shuian [Department of Soil and Environmental Sciences, National Chung Hsing University, 250 Kuo Kuang Road, Taichung 40227, Taiwan (China); Wang, Shan-Li, E-mail: slwang@nchu.edu.tw [Department of Soil and Environmental Sciences, National Chung Hsing University, 250 Kuo Kuang Road, Taichung 40227, Taiwan (China); Huang, Shiuh-Tsuen [Department of Soil and Environmental Sciences, National Chung Hsing University, 250 Kuo Kuang Road, Taichung 40227, Taiwan (China); Department of Science Application and Dissemination, National Taichung University, Taichung, Taiwan (China); Tzou, Yu-Min; Huang, Jang-Hung [Department of Soil and Environmental Sciences, National Chung Hsing University, 250 Kuo Kuang Road, Taichung 40227, Taiwan (China)
2010-07-15
In this study, the removal mechanism of Cr(VI) from water by coconut coir (CC) was investigated using X-ray photoelectron spectroscopy (XPS), Cr K-edge X-ray absorption near edge structure (XANES) and FTIR spectroscopy. The results showed that, upon reaction with CC at pH 3, Cr(VI) was reduced to Cr(III), which was either bound to CC or released back into solution. As revealed by the FTIR spectra of CC before and after reacting with Cr(VI), the phenolic methoxyl and hydroxyl groups of lignin in CC are the dominant drivers of Cr(VI) reduction, giving rise to carbonyl and carboxyl groups on CC. These functional groups can subsequently provide binding sites for Cr(III) resulting from Cr(VI) reduction. In conjunction with forming complexes with carbonyl and carboxyl groups, the formation of Cr(III) hydroxide precipitate could also readily occur as revealed by the linear combination fitting of the Cr K-edge XANES spectrum using a set of reference compounds. The phenolic groups in lignin are responsible for initiating Cr(VI) reduction, so lignocellulosic materials containing a higher amount of phenolic groups are expected to be more effective scavengers for removal of Cr(VI) from the environment.
Shen, Ying-Shuian; Wang, Shan-Li; Huang, Shiuh-Tsuen; Tzou, Yu-Min; Huang, Jang-Hung
2010-07-15
In this study, the removal mechanism of Cr(VI) from water by coconut coir (CC) was investigated using X-ray photoelectron spectroscopy (XPS), Cr K-edge X-ray absorption near edge structure (XANES) and FTIR spectroscopy. The results showed that, upon reaction with CC at pH 3, Cr(VI) was reduced to Cr(III), which was either bound to CC or released back into solution. As revealed by the FTIR spectra of CC before and after reacting with Cr(VI), the phenolic methoxyl and hydroxyl groups of lignin in CC are the dominant drivers of Cr(VI) reduction, giving rise to carbonyl and carboxyl groups on CC. These functional groups can subsequently provide binding sites for Cr(III) resulting from Cr(VI) reduction. In conjunction with forming complexes with carbonyl and carboxyl groups, the formation of Cr(III) hydroxide precipitate could also readily occur as revealed by the linear combination fitting of the Cr K-edge XANES spectrum using a set of reference compounds. The phenolic groups in lignin are responsible for initiating Cr(VI) reduction, so lignocellulosic materials containing a higher amount of phenolic groups are expected to be more effective scavengers for removal of Cr(VI) from the environment. 2010 Elsevier B.V. All rights reserved.
Nicotine receptor partial agonists for smoking cessation
Directory of Open Access Journals (Sweden)
Kate Cahill
Full Text Available BACKGROUND: Nicotine receptor partial agonists may help people to stop smoking by a combination of maintaining moderate levels of dopamine to counteract withdrawal symptoms (acting as an agonist and reducing smoking satisfaction (acting as an antagonist. OBJECTIVES: The primary objective of this review is to assess the efficacy and tolerability of nicotine receptor partial agonists, including cytisine, dianicline and varenicline for smoking cessation. SEARCH METHODS: We searched the Cochrane Tobacco Addiction Group's specialised register for trials, using the terms ('cytisine' or 'Tabex' or 'dianicline' or 'varenicline' or 'nicotine receptor partial agonist' in the title or abstract, or as keywords. The register is compiled from searches of MEDLINE, EMBASE, PsycINFO and Web of Science using MeSH terms and free text to identify controlled trials of interventions for smoking cessation and prevention. We contacted authors of trial reports for additional information where necessary. The latest update of the specialized register was in December 2011. We also searched online clinical trials registers. SELECTION CRITERIA: We included randomized controlled trials which compared the treatment drug with placebo. We also included comparisons with bupropion and nicotine patches where available. We excluded trials which did not report a minimum follow-up period of six months from start of treatment. DATA COLLECTION AND ANALYSIS: We extracted data on the type of participants, the dose and duration of treatment, the outcome measures, the randomization procedure, concealment of allocation, and completeness of follow-up. The main outcome measured was abstinence from smoking at longest follow-up. We used the most rigorous definition of abstinence, and preferred biochemically validated rates where they were reported. Where appropriate we pooled risk ratios (RRs, using the Mantel-Haenszel fixed-effect model. MAIN RESULTS: Two recent cytisine trials (937 people
Muscarinic Receptor Agonists and Antagonists
Directory of Open Access Journals (Sweden)
David R. Kelly
2001-02-01
Full Text Available A comprehensive review of pharmacological and medical aspects of the muscarinic class of acetylcholine agonists and antagonists is presented. The therapeutic benefits of achieving receptor subtype selectivity are outlined and applications in the treatment of Alzheimer’s disease are discussed. A selection of chemical routes are described, which illustrate contemporary methodology for the synthesis of chiral medicinal compounds (asymmetric synthesis, chiral pool, enzymes. Routes to bicyclic intrannular amines and intramolecular Diels-Alder reactions are highlighted.
Nitrate Enhanced Microbial Cr(VI) Reduction-Final Report
Energy Technology Data Exchange (ETDEWEB)
John F. Stolz
2011-06-15
proteins (Gmet_2478 and Gmet_1641) were up-regulated with exposure to Cr(VI). A nine-heme cytochrome C was purified that could reduce nitrite and could be oxidized by Cr(VI). For D. desulfuricans, we found that confirmed that Cr(VI) induced a prolonged lag period when Cr(VI) was reduced. Over three hundred proteins were unequivocally identified by LC/MS-MS and a significant number of down-regulated proteins for which the levels were changed >2 fold compared to control. Sulfite reductase levels were similar, however, nitrate and nitrite reductase were down-regulated. The supernatant of spent cultures was found to contain a filterable, heat stable compound that rapidly reduced Cr(VI). In addition, desulfoviridin was purified from nitrate grown cells and shown to have nitrite reductase activity that was inhibited by Cr(VI). For S. barnesii, periplasmic nitrate reductase (Nap), nitrite reductase (Nrf), and the metalloid reductase (Rar) were purified and characterized. The supernatant of spent cultures was also found to contain a filterable, heat stable compound that rapidly reduced Cr(VI) but that Rar also reduced Cr(VI). Our results from specific aims 1 through 3 indicate that for G. metallireducens, Cr(VI) inhibits nitrate respiration as it oxidizes cytochromes involved in nitrate respiration. Iron reduction is apparently not affected and the inhibitory affects of Cr(VI) may be attenuated by the addition of sufficient Fe(III) to generate Fe(II) that abiotically reduces the chromium. For S. barnesii, although the enzyme assays indicate that the components of the respiratory pathway for nitrate (e.g. Nap and Nrf) are inhibited by chromate, the organism has a mechanism to prevent this from actually occurring. Our current hypothesis is that the non-specific metalloid reductase (Rar) is providing resistance by reducing the Cr(VI). The strategy here would be to enhance its growth and metabolism in the natural setting. Lactate is a suitable electron donor for S. barnesii but other
Haffmans, J; De Kloet, R; Dzoljic, M R
1984-06-04
The glucose utilization during specific delta opiate agonist-induced epileptiform phenomena, determined by the [14C]2-deoxyglucose technique (2-DG), was examined in various rat brain areas at different time intervals. The peak in EEG spiking response and the most intensive 2-DG uptake occurred 5 min after intraventricular (i.v.t.) administration of the delta opiate receptor agonist. The most pronounced 2-DG uptake at this time interval can be observed in the subiculum, including the CA1 hippocampal area, frontal cortex and central amygdala. A general decrease of glucose consumption, compared to control values, is observed after 10 min, in all regions, with exception of the subiculum. Since functional activity and 2-DG uptake are correlated, we suggest that the subiculum and/or CA1 area, are probably the brain regions most involved in the enkephalin-induced epileptic phenomena.
Córdova-Sintjago, Tania C.; Liu, Yue; Booth, Raymond G.
2015-02-01
To understand molecular determinants for ligand activation of the serotonin 5-HT2C G protein-coupled receptor (GPCR), a drug target for obesity and neuropsychiatric disorders, a 5-HT2C homology model was built according to an adrenergic β2 GPCR (β2AR) structure and validated using a 5-HT2B GPCR crystal structure. The models were equilibrated in a simulated phosphatidyl choline membrane for ligand docking and molecular dynamics studies. Ligands included (2S, 4R)-(-)-trans-4-(3'-bromo- and trifluoro-phenyl)-N,N-dimethyl-1,2,3,4-tetrahydronaphthalene-2-amine (3'-Br-PAT and 3'-CF3-PAT), a 5-HT2C agonist and inverse agonist, respectively. Distinct interactions of 3'-Br-PAT and 3'-CF3-PAT at the wild-type (WT) 5-HT2C receptor model were observed and experimental 5-HT2C receptor mutagenesis studies were undertaken to validate the modelling results. For example, the inverse agonist 3'-CF3-PAT docked deeper in the WT 5-HT2C binding pocket and altered the orientation of transmembrane helices (TM) 6 in comparison to the agonist 3'-Br-PAT, suggesting that changes in TM orientation that result from ligand binding impact function. For both PATs, mutation of 5-HT2C residues S3.36, T3.37, and F5.47 to alanine resulted in significantly decreased affinity, as predicted from modelling results. It was concluded that upon PAT binding, 5-HT2C residues T3.37 and F5.47 in TMs 3 and 5, respectively, engage in inter-helical interactions with TMs 4 and 6, respectively. The movement of TMs 5 and 6 upon agonist and inverse agonist ligand binding observed in the 5-HT2C receptor modelling studies was similar to movements reported for the activation and deactivation of the β2AR, suggesting common mechanisms among aminergic neurotransmitter GPCRs.
Dang, Dien; Cunnington, David; Swieca, John
2011-01-01
The Restless Legs Syndrome is a common sensorimotor disorder, typically amenable to treatment with dopamine agonist therapy. Dopamine agonists have been associated with emergent impulse control disorders (ICDs) when used in patients with Parkinson disease, and ICDs have now been reported in individuals with RLS on dopamine agonist therapy. Our aim was to characterize cases of emergent ICDs in Australian patients with focus on the dopamine agonists implicated and the social significance of ICDs. A series of RLS patients on dopamine agonist therapy were identified with ICDs over a 2-year period. Additional cases of ICDs were found using a mailout questionnaire designed to capture those with high impulsivity. These patients were assessed using the Barratt Impulsiveness Scale, Version 11, and a modified Minnesota Impulse Disorders Interview. Case records and medication schedules were evaluated. Twelve cases of patients with de novo ICDs were found with a range of impulsive behaviors including pathological gambling, kleptomania, compulsive shopping, and hypersexuality. Criminality, suicidality, and marital discord also were featured. These occurred over a wide range of latencies and l-dopa exposures. This group of Australian RLS patients with ICDs display high levels of impulsivity and is the first to use the BIS-11 questionnaire in this setting. Impulse control disorders can occur over a wide range of dopamine agonist therapy types and dose exposures. Impulse control disorder tendencies may persist, despite withdrawal of dopamine agonists. The emergence of ICDs needs careful consideration in light of their potentially devastating financial, social, and marital consequences.
Energy Technology Data Exchange (ETDEWEB)
Ott, Larry J. [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Howell, Michael [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Robb, Kevin R. [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States)
2017-08-01
Iron-chromium-aluminum (FeCrAl) alloys are being considered as advanced fuel cladding concepts with enhanced accident tolerance. At high temperatures, FeCrAl alloys have slower oxidation kinetics and higher strength compared with zirconium-based alloys. FeCrAl could be used for fuel cladding and spacer or mixing vane grids in light water reactors and/or as channel box material in boiling water reactors (BWRs). There is a need to assess the potential gains afforded by the FeCrAl accident-tolerant-fuel (ATF) concept over the existing zirconium-based materials employed today. To accurately assess the response of FeCrAl alloys under severe accident conditions, a number of FeCrAl properties and characteristics are required. These include thermophysical properties as well as burst characteristics, oxidation kinetics, possible eutectic interactions, and failure temperatures. These properties can vary among different FeCrAl alloys. Oak Ridge National Laboratory has pursued refined values for the oxidation kinetics of the B136Y FeCrAl alloy (Fe-13Cr-6Al wt %). This investigation included oxidation tests with varying heating rates and end-point temperatures in a steam environment. The rate constant for the low-temperature oxidation kinetics was found to be higher than that for the commercial APMT FeCrAl alloy (Fe-21Cr-5Al-3Mo wt %). Compared with APMT, a 5 times higher rate constant best predicted the entire dataset (root mean square deviation). Based on tests following heating rates comparable with those the cladding would experience during a station blackout, the transition to higher oxidation kinetics occurs at approximately 1,500°C. A parametric study varying the low-temperature FeCrAl oxidation kinetics was conducted for a BWR plant using FeCrAl fuel cladding and channel boxes using the MELCOR code. A range of station blackout severe accident scenarios were simulated for a BWR/4 reactor with Mark I containment. Increasing the FeCrAl low-temperature oxidation rate
Assembly of high-affinity insulin receptor agonists and antagonists from peptide building blocks
Schäffer, Lauge; Brissette, Renee E.; Spetzler, Jane C.; Pillutla, Renuka C.; Østergaard, Søren; Lennick, Michael; Brandt, Jakob; Fletcher, Paul W.; Danielsen, Gillian M.; Hsiao, Ku-Chuan; Andersen, Asser S.; Dedova, Olga; Ribel, Ulla; Hoeg-Jensen, Thomas; Hansen, Per Hertz; Blume, Arthur J.; Markussen, Jan; Goldstein, Neil I.
2003-01-01
Insulin is thought to elicit its effects by crosslinking the two extracellular α-subunits of its receptor, thereby inducing a conformational change in the receptor, which activates the intracellular tyrosine kinase signaling cascade. Previously we identified a series of peptides binding to two discrete hotspots on the insulin receptor. Here we show that covalent linkage of such peptides into homodimers or heterodimers results in insulin agonists or antagonists, depending on how the peptides are linked. An optimized agonist has been shown, both in vitro and in vivo, to have a potency close to that of insulin itself. The ability to construct such peptide derivatives may offer a path for developing agonists or antagonists for treatment of a wide variety of diseases. PMID:12684539
Xiang, Zhimin; Proneth, Bettina; Dirain, Marvin L.; Litherland, Sally A.; Haskell-Luevano, Carrie
2010-01-01
The melanocortin-4 receptor (MC4R) is a G-protein coupled receptor (GPCR) that is expressed in the central nervous system and has a role in regulating feeding behavior, obesity, energy homeostasis, male erectile response, and blood pressure. Since the report of the MC4R knockout mouse in 1997, the field has been searching for links between this genetic bio marker and human obesity and type 2 diabetes. More then 80 single nucleotide polymorphisms (SNPs) have been identified from human patients, both obese and non-obese controls. Many significant studies have been performed examining the pharmacological characteristics of these hMC4R SNPs in attempts to identify a molecular defects/insights that might link a genetic factor to the obese phenotype observed in patients possessing these mutations. Our laboratory has previously reported the pharmacological characterization of 40 of these polymorphic hMC4 receptors with multiple endogenous and synthetic ligands. The goal of the current study is to perform a similar comprehensive side-by-side characterization of 30 additional human hMC4R with single nucleotide polymorphisms using multiple endogenous agonists [α-, β, γ2-melanocyte stimulating hormones (MSH) and adrenocorticotropin (ACTH)], the antagonist agouti-related protein hAGRP(87-132), and synthetic agonists [NDP-MSH, MTII, and the tetrapeptide Ac-His-DPhe-Arg-Trp-NH2 (JRH887-9)]. These in vitro data, in some cases, provide a putative molecular link between dysfunctional hMC4R's and human obesity. These 30 hMC4R SNPs include R7H, R18H, R18L, S36Y, P48S, V50M, F51L, E61K, I69T, D90N, S94R, G98R, I121T, A154D, Y157S, W174C, G181D, F202L, A219V, I226T, G231S, G238D, N240S, C271R, S295P, P299L, E308K, I317V, L325F and 750DelGA. All but the N240S hMC4R were identified in obese patients. Additionally, we have characterized a double I102T/V103I hMC4R. In addition to the pharmacological characterization, the hMC4R variants were evaluated for cell surface expression by flow
Tear gasses CN, CR, and CS are potent activators of the human TRPA1 receptor
International Nuclear Information System (INIS)
Brone, Bert; Peeters, Pieter J.; Marrannes, Roger; Mercken, Marc; Nuydens, Ronny; Meert, Theo; Gijsen, Harrie J.M.
2008-01-01
The TRPA1 channel is activated by a number of pungent chemicals, such as allylisothiocyanate, present in mustard oil and thiosulfinates present in garlic. Most of the known activating compounds contain reactive, electrophilic chemical groups, reacting with cysteine residues in the active site of the TRPA1 channel. This covalent modification results in activation of the channel and has been shown to be reversible for several ligands. Commonly used tear gasses CN, CR and CS are also pungent chemicals, and in this study we show that they are extremely potent and selective activators of the human TRPA1 receptor. To our knowledge, these are the most potent TRPA1 agonists known to date. The identification of the molecular target for these tear gasses may open up possibilities to alleviate the effects of tear gasses via treatment with TRPA1 antagonists. In addition these results may contribute to the basic knowledge of the TRPA1 channel that is gaining importance as a pharmacological target
Wear resistance of nano- and micro-crystalline diamond coatings onto WC-Co with Cr/CrN interlayers
Energy Technology Data Exchange (ETDEWEB)
Polini, Riccardo [Dipartimento di Scienze e Tecnologie Chimiche, Universita di Roma Tor Vergata, Via della Ricerca Scientifica, 1, Rome, 00133 (Italy); Barletta, Massimiliano, E-mail: barletta@ing.uniroma2.i [Dipartimento di Ingegneria Meccanica, Universita di Roma Tor Vergata, Via del Politecnico, 1, Rome, 00133 (Italy); Cristofanilli, Giacomo [Dipartimento di Scienze e Tecnologie Chimiche, Universita di Roma Tor Vergata, Via della Ricerca Scientifica, 1, Rome, 00133 (Italy)
2010-12-30
Cr/CrN bi-layers have been used recently to promote the growth of high quality Hot Filament Chemical Vapour Deposition (HFCVD) diamond coatings onto Co-cemented tungsten carbide (WC-6 wt.%Co) substrates. In the present investigation, the influence of the crystalline size of the diamond coatings on their wear endurance is looked into. Nano- (NDC) and micro-crystalline Diamond Coatings (MDC) were deposited by HFCVD onto untreated and Fluidized Bed (FB) treated Cr/CrN interlayers. NDCs, characterized by a cauliflower-like morphology, showed improved wear resistance. However, the superimposition of NDCs onto Cr/CrN interlayers micro-corrugated by FB treatment was found to be the most promising choice, leading to the formation of highly adherent and wear resistant coatings.
Directory of Open Access Journals (Sweden)
Jun-Bean Park
Full Text Available The role and underlying mechanisms of rosiglitazone, a peroxisome proliferator-activated receptor-gamma (PPAR-γ agonist, on myocardial infarction are poorly understood. We investigated the effects of this PPAR-γ agonist on the expression of tissue factor (TF, a primary molecule for thrombosis, and elucidated its underlying mechanisms. The PPAR-γ agonist inhibited TF expression in response to TNF-α in human umbilical vein endothelial cells, human monocytic leukemia cell line, and human umbilical arterial smooth muscle cells. The overexpression of TF was mediated by increased phosphorylation of mitogen-activated protein kinase (MAPK, which was blocked by the PPAR-γ agonist. The effective MAPK differed depending on each cell type. Luciferase and ChIP assays showed that transcription factor, activator protein-1 (AP-1, was a pivotal target of the PPAR-γ agonist to lower TF transcription. Intriguingly, two main drugs for drug-eluting stent, paclitaxel or rapamycin, significantly exaggerated thrombin-induced TF expression, which was also effectively blocked by the PPAR-γ agonist in all cell types. This PPAR-γ agonist did not impair TF pathway inhibitor (TFPI in three cell types. In rat balloon injury model (Sprague-Dawley rats, n = 10/group with continuous paclitaxel infusion, the PPAR-γ agonist attenuated TF expression by 70±5% (n = 4; P<0.0001 in injured vasculature. Taken together, rosiglitazone reduced TF expression in three critical cell types involved in vascular thrombus formation via MAPK and AP-1 inhibitions. Also, this PPAR-γ agonist reversed the paclitaxel-induced aggravation of TF expression, which suggests a possibility that the benefits might outweigh its risks in a group of patients with paclitaxel-eluting stent implanted.
Directory of Open Access Journals (Sweden)
Robert Ronal Widjaya
2012-04-01
Full Text Available In this research it has been done characterization on Cr/Bentonit and Zeolit HZSM-5 catalysts for ethanol catalytic process to biogasoline (equal to gasoline. Cr/Bentonit has high acidity and resistant to a lot of moisture, so in addition to being able to processing feed which a lot of moisture (>15% from ethanol-water mixture, also it is not easy deactivated. Cr/Bentonit which is then used as the catalyst material on the process of ethanol conversion to be biogasoline and the result was compared with catalyst HZSM-5 zeolite. Several characterization methods: X-ray diffraction, Brunauer Emmett Teller (BET, thermogravimetry analysis (TGA, and catalyst activity tests using catalytic Muffler instrument and gas chromatography-mass spectrometry (GC-MS for product analysis were performed on both catalysts. From acidity measurement, it is known that acidity level of Cr/Bentonit is the highest and also from XRD result, it is known there is shift for 2theta in Cr/Bentonit, which indicates that Cr-pillar in the Bentonite can have interaction. It is also supported by BET data that shows the addition of specific surface are in Cr/Bentonite compared with natural Bentonite before pillarization. Futhermore catalyst activity test produced the results, analyzed by GC-MS, identified as butanol and also possibly formed hexanol, decane, dodecane, undecane, which are all included in gasoline range (C4 until C12.
Impact behavior of 9-Cr and 12-Cr ferritic steels after low-temperature irradiation
International Nuclear Information System (INIS)
Klueh, R.L.; Vitek, J.M.; Corwin, W.R.; Alexander, D.J.
1987-01-01
Miniature Charpy impact specimens of 9Cr-1MoVNb and 12Cr-1MoVW steels and these steels with 1 and 2% Ni were irradiated in the High-Flux Isotope Reactor (HFIR) at 50 0 C to displacement damage levels of up to 9 dpa. Nickel was added to study the effect of transmutation helium. Irradiation caused an increase in the ductile-brittle transition temperature (DBTT). The 9Cr-1MoVNb steels, with and without nickel, showed a larger shift than the 12Cr-1MoVW steels, with and without nickel. The results indicated that helium also increased the DBTT. The same steels were previously irradiated at higher temperatures. From the present and past tests, the effect of irradiation temperature on the DBTT behavior can be evaluated. For the 9Cr-1MoVNb steel, there is a continuous decrease in the magnitude of the DBTT increase up to an irradiation temperature of about 400 0 C, after which the shift drops rapidly to zero at about 450 0 C. The DBTT of the 12Cr-1MoVW steel shows a maximum increase at an irradiation temperature of about 400 0 C and less of an increase at either higher or lower irradiation temperatures
DEFF Research Database (Denmark)
Iliodromiti, Stamatina; Lan, Vuong Thi Ngoc; Tuong, Ho Manh
2013-01-01
Conventional luteal support packages are inadequate to facilitate a fresh transfer after GnRH agonist (GnRHa) trigger in patients at high risk of developing ovarian hyperstimulation syndrome (OHSS). By providing intensive luteal-phase support with oestradiol and progesterone satisfactory implanta......Conventional luteal support packages are inadequate to facilitate a fresh transfer after GnRH agonist (GnRHa) trigger in patients at high risk of developing ovarian hyperstimulation syndrome (OHSS). By providing intensive luteal-phase support with oestradiol and progesterone satisfactory...... implantation rates can be sustained. The objective of this study was to assess the live-birth rate and incidence of OHSS after GnRHa trigger and intensive luteal steroid support compared to traditional hCG trigger and conventional luteal support in OHSS high risk Asian patients....
Metabolic Effects of CX3CR1 Deficiency in Diet-Induced Obese Mice.
Directory of Open Access Journals (Sweden)
Rachana Shah
Full Text Available The fractalkine (CX3CL1-CX3CR1 chemokine system is associated with obesity-related inflammation and type 2 diabetes, but data on effects of Cx3cr1 deficiency on metabolic pathways is contradictory. We examined male C57BL/6 Cx3cr1-/- mice on chow and high-fat diet to determine the metabolic effects of Cx3cr1 deficiency. We found no difference in body weight and fat content or feeding and energy expenditure between Cx3cr1-/- and WT mice. Cx3cr1-/- mice had reduced glucose intolerance assessed by intraperitoneal glucose tolerance tests at chow and high-fat fed states, though there was no difference in glucose-stimulated insulin values. Cx3cr1-/- mice also had improved insulin sensitivity at hyperinsulinemic-euglycemic clamp, with higher glucose infusion rate, rate of disposal, and hepatic glucose production suppression compared to WT mice. Enhanced insulin signaling in response to acute intravenous insulin injection was demonstrated in Cx3cr1-/- by increased liver protein levels of phosphorylated AKT and GSK3β proteins. There were no differences in adipose tissue macrophage populations, circulating inflammatory monocytes, adipokines, lipids, or inflammatory markers. In conclusion, we demonstrate a moderate and reproducible protective effect of Cx3cr1 deficiency on glucose intolerance and insulin resistance.
AGONISTIC BEHAVIOR OF LABORATORY MICE
Directory of Open Access Journals (Sweden)
D. Cinghiţă
2005-01-01
Full Text Available In this work we study agonistic behavior of laboratory white mice when they are kept in captivity. For all this experimental work we used direct observation of mice, in small lists, because we need a reduced space to emphasize characteristics of agonistic behavior. Relations between members of the same species that live in organized groups are based in most cases on hierarchical structure. Relations between leader and subservient, decided by fighting, involve a thorough observation between individuals. Each member of a group has its own place on the ierarchical scale depending on resultes of fhights – it can be leader or it can be subsurvient, depending on if it wines or looses the fight. Once hierarchical scale made, every animal will adjust its behavior. After analyzing the obtained data we have enough reasons to believe that after fights the winner, usually, is the massive mouse, but it is also very important the sexual ripeness, so the immature male will be beaten. The leader male had a big exploring area and it checks up all territory.The females can be more aggressive, its fights are more brutal, than male fights are, when they fight for supremacy, but in this case fights are not as frequent as in the case of males. Always the superior female, on hierarchical scale, shows males its own statute, so the strongest genes will be perpetuated.
Tribological Behavior of Al-Cr Coating Obtained by Dgpsm and IIP Composite Technology
Luo, Xixi; Yao, Zhengjun; Zhang, Pingze; Zhou, Keyin; Chen, Yu; Tao, Xuewei
An Al-Cr composite alloyed layer composed of an Al enriched layer, a Cr enriched layer and a transition layer from the surface to the bulk along the cross-section was deposited on a 45# steel substrate by composite technology, where Cr was deposited using double glow plasma surface metallurgy (DGPSM), and Al was then implanted by ion implantation (IIP) to achieve higher micro-hardness and excellent abrasive resistance. The composite alloyed layer is approximately 5μm, and as metallurgical adherence to the substrate. The phases are Al8Cr5, Fe2AlCr, Cr23C6, Cr (Al) and Fe (Cr, Al) solid solution. The wear resistance tests were performed under various rotational speed (i.e. 280, 560 and 840r/min) with silicon nitride balls as the counterface material at ambient temperature. The Al-Cr composite alloyed layer exhibits excellent wear resistance when the speed is 280r/min with a friction coefficient as low as 0.3, which is attributed to Al8Cr5 in the Al implanted layer that withstands abrasive wear. Better wear resistance (friction coefficient: 0.254) at 560r/min is resulted from the formation of a high micro-hardness zone, and an oxidation layer with lubrication capacity. In addition, the composite alloyed layer suffers severe oxidative wear and adhesive wear at 840r/min due to the increment of the frictional heating. When compared to the 45# steel substrate, the enhanced wear resistance of the Al-Cr composite alloyed layer demonstrates the viable method developed in this work.
PENGAMBILAN LOGAM CR6+ DAN CR TOTAL DARI LIMBAH INDUSTRI ELEKTROPLATING SECARA ELEKTROKOGULASI
Directory of Open Access Journals (Sweden)
Muhammad Nizar Pahlevi
2012-10-01
Full Text Available Electroplating industry is a metal coating industry by way of metal precipitate coatings on metal or plastic which is done so that the electrolytic waste containing heavy metals. Electrocoagulation is a process of merging clumps resulting from the flux of electrical current (DC for the extraction of metal compounds contained in wastewater. In this process of reduction and oxidation reactions occur. Where the metal is reduced and the positive electrode (Al will be oxidized to (Al (OH 3 which serves as a coagulant. The purpose of this research to study methods of electrocoagulation using aluminum electrodes and the influence of the length of time stirring and stirring speed of decision-CR6+ levels and total Cr. This electrocoagulation electroplating wastewater with electricity so that the ions are absorbed by the coagulant in waste binder in the release of the electrode and causes the bond between the metal ions with coagulant. Variation of stirrer speed of 200, 400 and 600 rpm, whereas the long stirring time 25, 50 and 75 minutes. Based on test results, after an analysis showed a significant reduction of the levels of total CR6 + and Cr in the electroplating wastes. CR6+ to obtain a decrease of 95.1% at minute 50 and the stirrer speed of 200 rpm, whereas the total Cr obtained a decrease of 82.69% at minute 75 and a stirrer speed of 600 rpm.
Sidhu, Hazoor Singh; Sidhu, Buta Singh; Prakash, S.
2006-12-01
The purpose of this study is to analyze and compare the mechanical properties and microstructure details at the interface of high-velocity oxyfuel (HVOF)-sprayed NiCr-coated boiler tube steels, namely ASTM-SA-210 grade A1, ASTM-SA213-T-11, and ASTM-SA213-T-22. Coatings were developed by two different techniques, and in these techniques liquefied petroleum gas was used as the fuel gas. First, the coatings were characterized by metallographic, scanning electron microscopy/energy-dispersive x-ray analysis, x-ray diffraction, surface roughness, and microhardness, and then were subjected to erosion testing. An attempt has been made to describe the transformations taking place during thermal spraying. It is concluded that the HVOF wire spraying process offers a technically viable and cost-effective alternative to HVOF powder spraying process for applications in an energy generation power plant with a point view of life enhancement and to minimize the tube failures because it gives a coating having better resistance to erosion.
Park, Jung-Woo; Kamenetsky, Vadim; Campbell, Ian; Park, Gyuseung; Hanski, Eero; Pushkarev, Evgeny
2017-11-01
Recent experimental studies and in situ LA-ICP-MS analysis on natural Cr-spinel have shown that Rh and IPGEs (Ir-group platinum group elements: Ru, Ir, Os) are enriched in the lattice of Cr-spinel. However, the factors controlling the partitioning behaviour of these elements are not well constrained. In this study, we report the Rh, IPGE, and trace element contents in primitive Cr-spinel, measured by LA-ICP-MS, from nine volcanic suites covering various tectonic settings including island arc picrites, boninites, large igneous province picrites and mid-ocean ridge basalts. The aim is to understand the factors controlling the enrichment of Rh and IPGEs in Cr-spinels, to estimate empirical partition coefficients between Cr-spinel and silicate melts, and to investigate the role of Cr-spinel fractional crystallization on the PGE geochemistry of primitive magmas during the early stages of fractional crystallization. There are systematic differences in trace elements, Rh and IPGEs in Cr-spinels from arc-related magmas (Arc Group Cr-spinel), intraplate magmas (Intraplate Group Cr-spinel), and mid-ocean ridge magmas (MORB Group Cr-spinel). Arc Group Cr-spinels are systematically enriched in Sc, Co and Mn and depleted in Ni compared to the MORB Group Cr-spinels. Intraplate Group Cr-spinels are distinguished from the Arc Group Cr-spinels by their high Ni contents. Both the Arc and Intraplate Group Cr-spinels have total Rh and IPGE contents of 22-689 ppb whereas the MORB Group Cr-spinels are depleted in Rh and IPGE (total time-resolved spectra of LA-ICP-MS data for Cr-spinels mostly show constant count rates for trace element and Rh and IPGEs, suggesting homogeneous distribution of these elements in Cr-spinels. The PGE spikes observed in several Cr-spinels were interpreted to be PGE-bearing mineral inclusions and excluded from calculating the PGE contents of the Cr-spinels. On primitive mantle normalized diagrams the Arc Group Cr-spinels are characterized by a fractionated
Microchemical effects in irradiated Fe–Cr alloys as revealed by atomistic simulation
Energy Technology Data Exchange (ETDEWEB)
Malerba, L., E-mail: lmalerba@sckcen.be [Structural Materials Modelling and Microstructure Unit, SMA/NMS, Studiecentrum voor Kernenergie, Centre d’Etudes de l’Energie Nucléaire (SCK-CEN), Boeretang 200, 2400 Mol (Belgium); Bonny, G.; Terentyev, D. [Structural Materials Modelling and Microstructure Unit, SMA/NMS, Studiecentrum voor Kernenergie, Centre d’Etudes de l’Energie Nucléaire (SCK-CEN), Boeretang 200, 2400 Mol (Belgium); Zhurkin, E.E. [Experimental Nuclear Physics Department, K-89, Faculty of Physics and Mechanics, Saint-Petersburg State Polytechnical University, 29 Polytekhnicheskaya Str., 195251 St. Petersburg (Russian Federation); Hou, M. [Physique des Solides Irradiés et des Nanostructures CP234, Faculté des Sciences, Université Libre de Bruxelles, Bd du Triomphe, B-1050 Bruxelles (Belgium); Vörtler, K.; Nordlund, K. [Association EURATOM-Tekes, Department of Physics, P.O. Box 43, FI-00014, University of Helsinki (Finland)
2013-11-15
Neutron irradiation produces evolving nanostructural defects in materials, that affect their macroscopic properties. Defect production and evolution is expected to be influenced by the chemical composition of the material. In turn, the accumulation of defects in the material results in microchemical changes, which may induce further changes in macroscopic properties. In this work we review the results of recent atomic-level simulations conducted in Fe–Cr alloys, as model materials for high-Cr ferritic–martensitic steels, to address the following questions: 1. Is the primary damage produced in displacement cascades influenced by the Cr content? If so, how? 2. Does Cr change the stability of radiation-produced defects? 3. Is the diffusivity of cascade-produced defects changed by Cr content? 4. How do Cr atoms redistribute under irradiation inside the material under the action of thermodynamic driving forces and radiation-defect fluxes? It is found that the presence of Cr does not influence the type of damage created by displacement cascades, as compared to pure Fe, while cascades do contribute to redistributing Cr, in the same direction as thermodynamic driving forces. The presence of Cr does change the stability of point-defects: the effect is weak in the case of vacancies, stronger in the case of self-interstitials. In the latter case, Cr increases the stability of self-interstitial clusters, especially those so small to be invisible to the electron microscope. Cr reduces also significantly the diffusivity of self-interstitials and their clusters, in a way that depends in a non-monotonic way on Cr content, as well as on cluster size and temperature; however, the effect is negligible on the mobility of self-interstitial clusters large enough to become visible dislocation loops. Finally, Cr-rich precipitate formation is favoured in the tensile region of edge dislocations, while it appears not to be influenced by screw dislocations; prismatic dislocation loops
Structural Determinants for the Binding of Morphinan Agonists to the μ-Opioid Receptor.
Directory of Open Access Journals (Sweden)
Xiaojing Cong
Full Text Available Atomistic descriptions of the μ-opioid receptor (μOR noncovalently binding with two of its prototypical morphinan agonists, morphine (MOP and hydromorphone (HMP, are investigated using molecular dynamics (MD simulations. Subtle differences between the binding modes and hydration properties of MOP and HMP emerge from the calculations. Alchemical free energy perturbation calculations show qualitative agreement with in vitro experiments performed in this work: indeed, the binding free energy difference between MOP and HMP computed by forward and backward alchemical transformation is 1.2±1.1 and 0.8±0.8 kcal/mol, respectively, to be compared with 0.4±0.3 kcal/mol from experiment. Comparison with an MD simulation of μOR covalently bound with the antagonist β-funaltrexamine hints to agonist-induced conformational changes associated with an early event of the receptor's activation: a shift of the transmembrane helix 6 relative to the transmembrane helix 3 and a consequent loss of the key R165-T279 interhelical hydrogen bond. This finding is consistent with a previous proposal suggesting that the R165-T279 hydrogen bond between these two helices indicates an inactive receptor conformation.
Microbial conversion of Cr (VI) in to Cr (III) in industrial effluent ...
African Journals Online (AJOL)
These bacterial strains also take up and reduce Cr (VI) present in industrial effluents, and their reduction potential was not significantly affected in the presence of different metallic salts. Key Words: Cr (VI) reduction, bacteria, industrial effluent, heavy metals. African Journal of Biotechnology Vol.3(11) 2004: 610-617 ...
Treatment of Obesity-Related Complications with Novel Classes of Naturally Occurring PPAR Agonists.
Bassaganya-Riera, Josep; Guri, Amir J; Hontecillas, Raquel
2011-01-01
The prevalence of obesity and its associated comorbidities has grown to epidemic proportions in the US and worldwide. Thus, developing safe and effective therapeutic approaches against these widespread and debilitating diseases is important and timely. Activation of peroxisome proliferator-activated receptors (PPARs) α, γ, and δ through several classes of pharmaceuticals can prevent or treat a variety of metabolic and inflammatory diseases, including type II diabetes (T2D). Thus, PPARs represent important molecular targets for developing novel and better treatments for a wide range of debilitating and widespread obesity-related diseases and disorders. However, available PPAR γ agonistic drugs such as Avandia have significant adverse side effects, including weight gain, fluid retention, hepatotoxicity, and congestive heart failure. An alternative to synthetic agonists of PPAR γ is the discovery and development of naturally occurring and safer nutraceuticals that may be dual or pan PPAR agonists. The purpose of this paper is to summarize the health effects of three plant-derived PPAR agonists: abscisic acid (ABA), punicic acid (PUA), and catalpic acid (CAA) in the prevention and treatment of chronic inflammatory and metabolic diseases and disorders.
[51Cr]EDTA intestinal permeability in children with cow's milk intolerance
International Nuclear Information System (INIS)
Schrander, J.J.; Unsalan-Hooyen, R.W.; Forget, P.P.; Jansen, J.
1990-01-01
Making use of [ 51 Cr]EDTA as a permeability marker, we measured intestinal permeability in a group of 20 children with proven cow's milk intolerance (CMI), a group of 17 children with similar complaints where CMI was excluded (sick controls), and a group of 12 control children. [ 51 Cr]EDTA test results (mean +/- SD) were 6.85 +/- 3.64%, 3.42 +/- 0.94%, and 2.61 +/- 0.67% in the group with CMI, the sick control, and the control group, respectively. When compared to both control groups, patients with cow's milk intolerance (CMI) showed a significantly increased small bowel permeability. We conclude that the [ 51 Cr]EDTA test can be helpful for the diagnosis of cow's milk intolerance
Emerging GLP-1 receptor agonists
DEFF Research Database (Denmark)
Lund, Asger; Knop, Filip K; Vilsbøll, Tina
2011-01-01
and liraglutide, as well as the emerging GLP-1R agonists including the long-acting compounds. Expert opinion: An emerging therapeutic trend toward initial or early combination therapy with metformin- and incretin-based therapy is anticipated for patients with type 2 diabetes. GLP-1-based therapy has so far proven...... development may improve the effects of GLP-1 even further with optimized pharmacokinetic profiles resulting in fewer side effects. Meta-analyses have shown promising effects on cardiovascular disease and data from ongoing multicenter trials with cardiovascular endpoints are expected in 2015....
Phase Evolution in and Creep Properties of Nb-Rich Nb-Si-Cr Eutectics
Gang, Florian; Kauffmann, Alexander; Heilmaier, Martin
2018-03-01
In this work, the Nb-rich ternary eutectic in the Nb-Si-Cr system has been experimentally determined to be Nb-10.9Si-28.4Cr (in at. pct). The eutectic is composed of three main phases: Nb solid solution (Nbss), β-Cr2Nb, and Nb9(Si,Cr)5. The ternary eutectic microstructure remains stable for several hundred hours at a temperature up to 1473 K (1200 °C). At 1573 K (1300 °C) and above, the silicide phase Nb9(Si,Cr)5 decomposes into α-Nb5Si3, Nbss, and β-Cr2Nb. Under creep conditions at 1473 K (1200 °C), the alloy deforms by dislocation creep while the major creep resistance is provided by the silicide matrix. If the silicide phase is fragmented and, thus, its matrix character is destroyed by prior heat treatment [ e.g., at 1773 K (1500 °C) for 100 hours], creep is mainly controlled by the Laves phase β-Cr2Nb, resulting in increased minimum strain rates. Compared to state of the art Ni-based superalloys, the creep resistance of this three-phase eutectic alloy is significantly higher.
Directory of Open Access Journals (Sweden)
Merk Martina
2011-09-01
Full Text Available Abstract Background Active dendritic cell (DC immunization protocols are rapidly gaining interest as therapeutic options in patients with acute myeloid leukemia (AML. Here we present for the first time a GMP-compliant 3-day protocol for generation of monocyte-derived DCs using different synthetic Toll-like receptor (TLR agonists in intensively pretreated patients with AML. Methods Four different maturation cocktails were compared for their impact on cell recovery, phenotype, cytokine secretion, migration, and lymphocyte activation in 20 AML patients and 25 healthy controls. Results Maturation cocktails containing the TLR7/8 agonists R848 or CL075, with and without the addition of the TLR3 agonist poly(I:C, induced DCs that had a positive costimulatory profile, secreted high levels of IL-12(p70, showed chemotaxis to CCR7 ligands, had the ability to activate NK cells, and efficiently stimulated antigen-specific CD8+ T cells. Conclusions Our results demonstrate that this approach translates into biologically improved DCs, not only in healthy controls but also in AML patients. This data supports the clinical application of TLR-matured DCs in patients with AML for activation of innate and adaptive immune responses.
Local administration of a hedgehog agonist accelerates fracture healing in a mouse model
International Nuclear Information System (INIS)
Kashiwagi, Miki; Hojo, Hironori; Kitaura, Yoshiaki; Maeda, Yujiro; Aini, Hailati; Takato, Tsuyoshi; Chung, Ung-il; Ohba, Shinsuke
2016-01-01
Bone fracture healing is processed through multiple biological stages including the transition from cartilaginous callus to bony callus formation. Because of its specific, temporal and indispensable functions demonstrated by mouse genetic studies, Hedgehog (Hh) signaling is one of the most potent signaling pathways involved in these processes, but the effect of Hh-signaling activation by small compounds on the repair process had not yet been addressed. Here we examined therapeutic effects of local and one shot-administration of the Hh agonist known as smoothened agonist (SAG) on bone fracture healing in a mouse model. A quantitative analysis with three-dimensional micro-computed tomography showed that SAG administration increased the size of both the cartilaginous callus and bony callus at 14 days after the surgery. A histological analysis showed that SAG administration increased the number of cells expressing a proliferation marker and a chondrocyte marker in cartilaginous callus as well as the cells expressing an osteoblast marker in bony callus. These results indicate that the SAG administration resulted in an enhancement of callus formation during bone fracture healing, which is at least in part mediated by an increase in chondrocyte proliferation in cartilaginous callus and the promotion of bone formation in bony callus. Therapeutic strategies with a SAG-mediated protocol may thus be useful for the treatment of bone fractures. - Highlights: • Local administration of a Hh agonist accelerates callus formation. • The Hh agonist administration promotes chondrocyte proliferation in the soft callus. • The Hh agonist administration increases osteoblast formation in the hard callus.
Energy Technology Data Exchange (ETDEWEB)
Roy, Ram Vinod; Pratheeshkumar, Poyil; Son, Yong-Ok; Wang, Lei [Center for Research on Environmental Disease, University of Kentucky, 1095 VA Drive, Lexington, KY 40536 (United States); Department of Toxicology and Cancer Biology, College of Medicine, University of Kentucky, 1095 VA Drive, Lexington, KY 40536 (United States); Hitron, John Andrew [Center for Research on Environmental Disease, University of Kentucky, 1095 VA Drive, Lexington, KY 40536 (United States); Divya, Sasidharan Padmaja; Zhang, Zhuo [Department of Toxicology and Cancer Biology, College of Medicine, University of Kentucky, 1095 VA Drive, Lexington, KY 40536 (United States); Shi, Xianglin, E-mail: xshi5@email.uky.edu [Center for Research on Environmental Disease, University of Kentucky, 1095 VA Drive, Lexington, KY 40536 (United States)
2016-09-15
Hexavalent chromium (Cr(VI)) is classified as a human carcinogen. Cr(VI) has been associated with adenocarcinomas and squamous cell carcinoma of the lung. The present study shows that acute Cr(VI) treatment in human bronchial epithelial cells (BEAS-2B) increased inflammatory responses (TNF-α, COX-2, and NF-кB/p65) and expression of Nrf2. Cr(VI)-induced generation of reactive oxygen species (ROS) are responsible for increased inflammation. Despite the fact that Nrf2 is a master regulator of response to oxidative stress, silencing of Nrf2 in the acute Cr(VI) treatment had no effect on Cr(VI)-induced inflammation. In contrast, in Cr(VI)-transformed (CrT) cells, Nrf2 is constitutively activated. Knock-down of this protein resulted in decreased inflammation, while silencing of SOD2 and CAT had no effect in the expression of these inflammatory proteins. Results obtained from the knock-down of Nrf2 in CrT cells are very different from the results obtained in the acute Cr(VI) treatment. In BEAS-2B cells, knock-down of Nrf2 had no effect in the inflammation levels, while in CrT cells a decrease in the expression of inflammation markers was observed. These results indicate that before transformation, ROS plays a critical role while Nrf2 not in Cr(VI)-induced inflammation, whereas after transformation (CrT cells), Nrf2 is constitutively activated and this protein maintains inflammation while ROS not. Constitutively high levels of Nrf2 in CrT binds to the promoter regions of COX-2 and TNF-α, leading to increased inflammation. Collectively, our results demonstrate that before cell transformation ROS are important in Cr(VI)-induced inflammation and after transformation a constitutively high level of Nrf2 is important. - Highlights: • Cr(VI)-induced ROS increased inflammation, while Nrf2 had no effect. • In the CrT cells knock-down of Nrf2 resulted in decreased inflammation. • Mechanistic differences in regulating Cr(VI)-induced inflammation.
Ambrose, Ashley R; Alsahli, Mohammed A; Kurmani, Sameer A; Goodall, Alison H
2018-07-01
On activation platelets release microRNAs and extracellular vesicles (EV) into circulation. The release of EV from platelets has been shown to be dependent on the agonist; in this study, we investigated whether the microRNA profile or EV released from platelets was also agonist specific. Washed platelets from healthy subjects were maximally stimulated with agonists specific for the receptors for collagen (Glycoprotein VI (GPVI)), thrombin (PAR1/PAR4), or ADP (P2Y1/P2Y12) with/without inhibiting secondary mediators, using aspirin to block cyclooxygenase-1 and apyrase to remove ADP. The released microRNAs were profiled using TaqMan microRNA microarray cards. Platelet-derived EV (pdEV) were characterized by size (Nanoparticle Tracking Analysis, NTA), for procoagulant activity (Annexin-V binding and support of thrombin generation), and for the EV markers CD63 and HSP70. Platelet activation triggered the release of 57-79 different microRNAs, dependent upon agonist, with a core of 46 microRNAs observed with all agonists. There was a high level of correlation between agonists (r 2 > 0.98; p 0.98; p < 0.0001). The 46 microRNAs seen in all samples are predicted to have significant effects on the translation of proteins involved in endocytosis, cell cycle control, and differentiation. MiR-223-3p was the most abundant in all samples and has previously been implicated in myeloid lineage development and demonstrated to have anti-inflammatory effects. Stimulation through GPVI produced a pdEV population with significantly more procoagulant activity than the other agonists. Apyrase significantly reduced microRNA and pdEV release, while aspirin had little effect. These data suggest that all tested agonists trigger the release of a similar microRNA profile while the procoagulant activity of the pdEV was agonist dependent. ADP was shown to play an important role in the release of both microRNAs and pdEV.
The Effect of Radiator on CR-39 Registration of Fast Neutrons
International Nuclear Information System (INIS)
El-Badrya, B.A.; Hegazya, T.M.; Morsya, A.A.; Zaki, M.F.
2008-01-01
Three different configurations of a personal neutron dosimeter using CR-39 plastic detector were placed in Plastiplast pouch composed from inside to outside of Aluminum ( 27 Al, 40 Ξ m), polyethylene (PE, 20 Ξ m), Cellulose Nitrate (CN, 40 Ξ m). One dosimeter was composed of a CR-39 detector and a PE radiator (1 mm thick), another of two CR-39 detectors with one serving as radiator, and the other of CR-39 alone (without radiator). These dosimeters have been irradiated with fast neutrons of average energy 4.5 MeV with neutron fluence ranging from 5.5 x 10 6 to 0.5 x 10 8 cm - 2 emitted from 241 Am-Be neutron source. The polymeric materials have been chosen on the basis of their hydrogen contents, which are as followed: CR-39, 48%, Polyethylene, 66.7% and CN, 32% by atomic ratio to produce protons via (n, p) elastic scattering with hydrogen and increasing the detection efficiency of CR-39. After irradiation, the dose equivalent response of the detectors has been studied by using conventional etching for two periods, 6h and 8h for these configurations. The thicknesses and compositions of the radiators are chosen so as to suppress the CR-39 response below 4 MeV by preventing the recoils of hydrogen nuclei, out of the hydrogen-rich radiators (PE, CR-39), from reaching the post-etch surface of the detector. Track counting was performed using an automated system. It was found that the dosemeter responses were linear as a function of a neutron equivalent dose and that the CR-39 detector has the same response with radiator or without radiator and thus appears as a promising fast neutron dosimeter. The results are discussed and compared with the literature
Energy Technology Data Exchange (ETDEWEB)
McCormick, Patrick N. [Institute of Medical Science, University of Toronto, Toronto, Ontario, M5S 1A8 (Canada)], E-mail: patrick.mccormick@camhpet.ca; Kapur, Shitij [Department of Psychiatry, University of Toronto, Toronto, Ontario, M5S 1A8 (Canada); PET Center, Center for Addiction and Mental Health, Toronto, Ontario, M5T 1R8 (Canada); Seeman, Philip [Department of Psychiatry, University of Toronto, Toronto, Ontario, M5S 1A8 (Canada); Department of Pharmacology, University of Toronto, Toronto, Ontario, M5S 1A8 (Canada); Wilson, Alan A. [Department of Psychiatry, University of Toronto, Toronto, Ontario, M5S 1A8 (Canada); PET Center, Center for Addiction and Mental Health, Toronto, Ontario, M5T 1R8 (Canada)
2008-01-15
Introduction: In vitro, the dopamine D2 receptor exists in two states, with high and low affinity for agonists. The high-affinity state is the physiologically active state thought to be involved in dopaminergic illnesses such as schizophrenia. The positron emission tomography radiotracer [{sup 11}C](+)-PHNO ([{sup 11}C](+)-4-propyl-3,4,4a,5,6,10b-hexahydro-2H-naphtho[1,2-b][1,4] oxazin-9-o l), being a D2 agonist, should selectively label the high-affinity state at tracer dose and therefore be more susceptible to competition by agonist as compared to the antagonist [{sup 3}H]raclopride, which binds to both affinity states. Methods: We tested this prediction using ex vivo dual-radiotracer experiments in conscious rats. D2 antagonists (haloperidol or clozapine), a partial agonist (aripiprazole), a full agonist [(-)-NPA] or the dopamine-releasing drug amphetamine (AMPH) were administered to rats prior to an intravenous coinjection of [{sup 11}C](+)-PHNO and [{sup 3}H]raclopride. Rats were sacrificed 60 min after radiotracer injection. Striatum, cerebellum and plasma samples were counted for {sup 11}C and {sup 3}H. The specific binding ratio {l_brace}SBR, i.e., [%ID/g (striatum)-%ID/g (cerebellum)]/(%ID/g (cerebellum){r_brace} was used as the outcome measure. Results: In response to D2 antagonists, partial agonist or full agonist, [{sup 11}C](+)-PHNO and [{sup 3}H]raclopride SBRs responded indistinguishably in terms of both ED{sub 50} and Hill slope (e.g., (-)-NPA ED{sub 50} values are 0.027 and 0.023 mg/kg for [{sup 11}C](+)-PHNO and [{sup 3}H]raclopride, respectively). In response to AMPH challenge, [{sup 11}C](+)-PHNO and [{sup 3}H]raclopride SBRs were inhibited to the same degree. Conclusions: We have shown that the SBRs of [{sup 11}C](+)-PHNO- and [{sup 3}H]raclopride do not differ in their response to agonist challenge. These results do not support predictions of the in vivo binding behavior of a D2 agonist radiotracer and cast some doubt on the in vivo
Beta agonists in livestock feed: status, health concerns, and international trade.
Centner, T J; Alvey, J C; Stelzleni, A M
2014-09-01
Since the U.S. Food and Drug Administration approved ractopamine hydrochloride and zilpaterol hydrochloride in animal feeds, usage of those compounds has been a topic of worldwide debate. Ractopamine and zilpaterol are β-adrenergic agonists used as veterinary drugs to increase weight gain in certain animals raised for food. The Joint FAO/WHO Expert Committee on Food Additives (JECFA) established maximum residue limits for ractopamine, which were adopted by the Codex Alimentarius Commission (Codex). No maximum residue limits for zilpaterol have been adopted by JECFA, and new reports of animal mobility issues confront the use of this feed additive. However, many countries disagree with the Codex standards and are restricting or banning meat products containing β agonists. The bans by major importers of U.S. meat products have prompted some to advocate that the United States use the World Trade Organization dispute settlement body. This paper looks at the developments to provide a fuller accounting of what the issues may mean to U.S. firms selling meat products containing residues of β agonists.
Directory of Open Access Journals (Sweden)
A. E. Pradas-del-Real
2013-06-01
Full Text Available Chromium released into the environment from industrial activities has become an important environmental concern. Silene vulgaris has been proven to be tolerant to many heavy metals, so it is considered an interesting species in the revegetation and restoration of polluted soils, but no information is available about its response to Cr. The objective of this work was to study uptake and influence on plant growth of Cr(III and Cr(VI in six genotypes (four hermaphrodites and two females of S. vulgaris from different sites of Madrid (Spain. Plants were treated for 12 days with 60 µM of Cr(III or Cr(VI in semihydroponics. Dry weights, soil-plant analysis development values (SPAD reading with chlorophylls and micronutrient and total Cr concentrations were determined. Metal uptake was higher in presence of Cr(VI than of Cr(III and poorly translocated to the shoots. In both cases S. vulgaris did not show visual toxicity symptoms, biomass reduction, or differences among SPAD values as consequence of Cr additions. However genotypes SV36 and SV38 showed Fe and Mn imbalance. This is the first report on the relatively good performance of hermaphrodite and female S. vulgaris genotypes in Cr uptake and physiological traits, but further studies will be necessary to elucidate the mechanisms by which the gender may influence these variables. S. vulgaris presented high diversity at genotypic level; the treatment with hexavalent Cr increased the differences among genotypes so the use of cuttings from an homogeneous genotype seems to be an adequate method for the study of this species.
Energy Technology Data Exchange (ETDEWEB)
Aubry, E. [Nipson Technology, 12 Avenue des Trois chênes, Techn’Hom 3, Belfort 90000 (France); Liu, T. [Institut Jean Lamour, UMR 7198 CNRS-Université de Lorraine, Vandoeuvre-lès-Nancy 54506 (France); Billard, A. [IRTES-LERMPS EA 7274, UTBM, Site de Montbéliard, Belfort Cedex 90010 (France); Dekens, A. [Institut Jean Lamour, UMR 7198 CNRS-Université de Lorraine, Vandoeuvre-lès-Nancy 54506 (France); Perry, F. [PVDco, 30 rue de Badménil, Baccarat 54120 (France); Mangin, S.; Hauet, T. [Institut Jean Lamour, UMR 7198 CNRS-Université de Lorraine, Vandoeuvre-lès-Nancy 54506 (France)
2017-01-15
The crystalline and magnetic properties of micron thick magnetron sputtered Co{sub 1−x}Cr{sub x} and Co{sub 1−x}Ni{sub x} alloy films are analyzed in the view of their implementation as semi-hard magnets. All of the tested films crystallize in an hcp lattice, at least up to 35 at% of alloying elements (Cr or Ni). The structural study shows that the ratio of hcp phase with [0001] axis orientated perpendicular to the film as compared with in-plane orientation increases (resp. decreases), when Ni (resp. Cr) concentration increases independently of the post-annealing temperature. The orientation of the magnetization results from the competition between the demagnetization field which tends to align the magnetization in plane and the crystalline anisotropy which tends to maintain the magnetization along the [0001] axis. Interestingly, we find that, although Co and Ni are very similar atoms, Co{sub 1−x}Ni{sub x} alloys crystalline anisotropy can be strongly increased and reach up to twice the anisotropy of the best Co{sub 1−x}Cr{sub x} alloy, while maintaining a magnetization at saturation above 1200 kA/m. The thermal stability of the structural and magnetic properties of both alloys is demonstrated for an annealing temperature up to 300 °C. - Highlights: • Sputtered CoCr and CoNi films are analyzed for their semi-hard magnetic properties. • CoNi alloys exhibits higher saturation magnetization and crystalline anisotropy. • These evolutions can be directly correlated to the quality of hcp crystal orientation. • Thermal stability of structural and magnetic properties is demonstrated up to 300 °C.
Microstructures of neutron-irradiated Fe-12Cr-XMn (X=15-30) ternary alloys
International Nuclear Information System (INIS)
Miyahara, K.; Hosoi, Y.; Garner, F.A.
1992-01-01
The objective of this effort is to determine the factors which control the stability of irradiated alloys proposed for reduced activation applications. The Fe-Cr-Mn alloy system is being studied as an alternative to the Fe-Cr-Ni system because of the need to reduce long-term radioactivation in fusion-power devices. In this study, four Fe-12Cr-XMn (X =15, 20, 25, 30 wt%) alloys were irradiated in the Fast Flux Test Facility to 20 dpa at 643K and 40 dpa at 679, 793, and 873K to investigate the influence of manganese content on void swelling and phase stability. The results confirm and expand the results of earlier studies that indicate that the Fe-Cr-Mn system is relatively unstable compared to that of the Fe-Cr-Ni system, with alpha and sigma phases forming as a consequence of thermal aging or high temperature irradiation
Influence of a niobium coating on sulfidation resistance of FeCr and FeCrY alloys
International Nuclear Information System (INIS)
Geribola, Gulherme Altomari
2014-01-01
Niobium and niobium based alloys are currently used in many industrial applications because they offer excellent resistance to degradation in various corrosive environments. These media include gaseous atmospheres at high temperatures such as those found in existing coal gasifying plants in power plants for energy generation. These atmospheres are complex gas mixtures that contain sulfur and oxygen, among other compounds. Sulphides are thermodynamically less stable, have lower melting points and often have larger deviations from stoichiometry compared to the corresponding oxides. Although there are studies regarding the use of refractory metals in high temperature sulphidizing atmospheres, the use of niobium compounds has not been adequately evaluated and there is very little studies available in the literature about its use as a protective coating. The aim of this study was to evaluate the effect of a niobium film, deposited by magnetron sputtering on the isothermal sulphidation behavior of Fe-20Cr and Fe-20Cr-1Y alloys. The sulphidation tests were carried out at 500, 600 and 700 deg C for 2h in H 2 /2% H2S atmosphere. The sulphidation resistance was determined by mass gain per unit area. The sulphidation behavior of the coated and uncoated alloys was similar at 500 deg C, and none of the alloys scaled. At 700 deg C FeCr alloy scaled in the form of a fine powder, while the reaction product formed on the alloy FeCrY scaled in the form of plates. The effect of niobium became pronounced at 700 deg C. The reaction product layer formed on the coated alloy was thinner and more plastic than that formed on the uncoated alloy. The mass gain per unit area of the coated alloys decreased significantly and they did not scaled. (author)