WorldWideScience

Sample records for agc viiia protein

  1. Modification of tobacco plant development by sense and antisense expression of the tomato viroid-induced AGC VIIIa protein kinase PKV suggests involvement in gibberellin signaling

    OpenAIRE

    Zhao Yan; Hammond Rosemarie W

    2009-01-01

    Abstract Background The serine-threonine protein kinase gene, designated pkv (protein kinase- viroid induced) was previously found to be transcriptionally activated in tomato plants infected with the plant pathogen Potato spindle tuber viroid (PSTVd). These plants exhibited symptoms of stunting, and abnormal development of leaf, root, and vascular tissues. The encoded protein, PKV, is a novel member of the AGC VIIIa group of signal-transducing protein kinases; however, the role of PKV in plan...

  2. Modification of tobacco plant development by sense and antisense expression of the tomato viroid-induced AGC VIIIa protein kinase PKV suggests involvement in gibberellin signaling

    Directory of Open Access Journals (Sweden)

    Zhao Yan

    2009-08-01

    Full Text Available Abstract Background The serine-threonine protein kinase gene, designated pkv (protein kinase- viroid induced was previously found to be transcriptionally activated in tomato plants infected with the plant pathogen Potato spindle tuber viroid (PSTVd. These plants exhibited symptoms of stunting, and abnormal development of leaf, root, and vascular tissues. The encoded protein, PKV, is a novel member of the AGC VIIIa group of signal-transducing protein kinases; however, the role of PKV in plant development is unknown. In this communication, we report the phenotypic results of over expression and silencing of pkv in transgenic tobacco. Results Over expression of pkv in Nicotiana tabacum cv. Xanthi (tobacco resulted in stunting, reduced root formation, and delay in flowering, phenotypes similar to symptoms of PSTVd infection of tomato. In addition, homozygous T2 tobacco plants over expressing PKV were male sterile. Antisense expression of pkv, on the other hand, resulted in plants that were taller than non-transformed plants, produced an increased number of flowers, and were fertile. Exogenous application of GA3 stimulated stem elongation in the stunted, sense-expressing plants. PKV sense and antisense expression altered transcript levels of GA biosynthetic genes and genes involved in developmental and signaling pathways, but not genes involved in salicylic acid- or jasmonic acid-dependent pathways. Our data provide evidence suggesting that PKV plays an important role in a GA signaling pathway that controls plant height and fertility. Conclusion We have found that the over expression of the tomato protein kinase PKV resulted in stunting, modified vascular tissue development, reduced root formation, and male sterility in tobacco, and we propose that PKV regulates plant development by functioning in critical signaling pathways involved in gibberellic acid metabolism.

  3. Detailed Mechanisms of the Inactivation of Factor VIIIa by Activated Protein C in the Presence of Its Cofactors, Protein S and Factor V*

    OpenAIRE

    Gale, Andrew J.; Cramer, Thomas J.; Rozenshteyn, Diana; Cruz, Jason R.

    2008-01-01

    Factor VIIIa is inactivated by a combination of two mechanisms. Activation of factor VIII by thrombin results in a heterotrimeric factor VIIIa that spontaneously inactivates due to dissociation of the A2 subunit. Additionally, factor VIIIa is cleaved by the anticoagulant serine protease, activated protein C, at two cleavage sites, Arg336 in the A1 subunit and Arg562 in the A2 subunit. We previously characterized an engineered variant of factor VIII which contains a dis...

  4. Myotonin protein-kinase [AGC]n trinucleotide repeat in seven nonhuman primates

    Energy Technology Data Exchange (ETDEWEB)

    Novelli, G.; Sineo, L.; Pontieri, E. [Catholic Univ. of Rome (Italy)]|[Univ. of Milan (Italy)]|[Univ. Florence (Italy)] [and others

    1994-09-01

    Myotonic dystrophy (DM) is due to a genomic instability of a trinucleotide [AGC]n motif, located at the 3{prime} UTR region of a protein-kinase gene (myotonin protein kinase, MT-PK). The [AGC] repeat is meiotically and mitotically unstable, and it is directly related to the manifestations of the disorder. Although a gene dosage effect of the MT-PK has been demonstrated n DM muscle, the mechanism(s) by which the intragenic repeat expansion leads to disease is largely unknown. This non-standard mutational event could reflect an evolutionary mechanism widespread among animal genomes. We have isolated and sequenced the complete 3{prime}UTR region of the MT-PK gene in seven primates (macaque, orangutan, gorilla, chimpanzee, gibbon, owl monkey, saimiri), and examined by comparative sequence nucleotide analysis the [AGC]n intragenic repeat and the surrounding nucleotides. The genomic organization, including the [AGC]n repeat structure, was conserved in all examined species, excluding the gibbon (Hylobates agilis), in which the [AGC]n upstream sequence (GGAA) is replaced by a GA dinucleotide. The number of [AGC]n in the examined species ranged between 7 (gorilla) and 13 repeats (owl monkeys), with a polymorphism informative content (PIC) similar to that observed in humans. These results indicate that the 3{prime}UTR [AGC] repeat within the MT-PK gene is evolutionarily conserved, supporting that this region has important regulatory functions.

  5. PIN protein phosphorylation by plant AGC3 kinases and its role in polar auxin transport

    NARCIS (Netherlands)

    Huang, Fang

    2010-01-01

    Polar cell-to-cell transport of plant hormone auxin mediated by plasma membrane (PM)-localized PIN-FORMED (PIN) auxin efflux carriers generates auxin gradients that provide positional information for various plant developmental processes. The apical-basal polar localization of the PIN proteins that

  6. Genetic analysis of ectopic growth suppression during planar growth of integuments mediated by the Arabidopsis AGC protein kinase UNICORN

    Directory of Open Access Journals (Sweden)

    Enugutti Balaji

    2013-01-01

    Full Text Available Abstract Background The coordination of growth within a tissue layer is of critical importance for tissue morphogenesis. For example, cells within the epidermis undergo stereotypic cell divisions that are oriented along the plane of the layer (planar growth, thereby propagating the layered epidermal structure. Little is known about the developmental control that regulates such planar growth in plants. Recent evidence suggested that the Arabidopsis AGC VIII protein kinase UNICORN (UCN maintains planar growth by suppressing the formation of ectopic multicellular protrusions in several floral tissues including integuments. In the current model UCN controls this process during integument development by directly interacting with the ABERRANT TESTA SHAPE (ATS protein, a member of the KANADI (KAN family of transcription factors, thereby repressing its activity. Here we report on the further characterization of the UCN mechanism. Results Phenotypic analysis of flowers of ucn-1 plants impaired in floral homeotic gene activity revealed that any of the four floral whorls could produce organs carrying ucn-1 protrusions. The ectopic outgrowths of ucn integuments did not accumulate detectable signals of the auxin and cytokinin reporters DR5rev::GFP and ARR5::GUS, respectively. Furthermore, wild-type and ucn-1 seedlings showed similarly strong callus formation upon in vitro culture on callus-inducing medium. We also show that ovules of ucn-1 plants carrying the dominant ats allele sk21-D exhibited more pronounced protrusion formation. Finally ovules of ucn-1 ett-1 double mutants and ucn-1 ett-1 arf4-1 triple mutants displayed an additive phenotype. Conclusions These data deepen the molecular insight into the UCN-mediated control of planar growth during integument development. The presented evidence indicates that UCN downstream signaling does not involve the control of auxin or cytokinin homeostasis. The results also reveal that UCN interacts with ATS

  7. AGC-2 Disassembly Report

    Energy Technology Data Exchange (ETDEWEB)

    William Windes

    2014-05-01

    The Next Generation Nuclear Plant (NGNP) Graphite Research and Development (R&D) Program is currently measuring irradiated material properties for predicting the behavior and operating performance of new nuclear graphite grades available for use within the cores of new very high temperature reactor designs. The Advanced Graphite Creep (AGC) experiment, consisting of six irradiation capsules, will generate irradiated graphite performance data for NGNP reactor operating conditions. The AGC experiment is designed to determine the changes to specific material properties such as thermal diffusivity, thermal expansion, elastic modulus, mechanical strength, irradiation induced dimensional change rate, and irradiation creep for a wide variety of nuclear grade graphite types over a range of high temperature, and moderate doses. A series of six capsules containing graphite test specimens will be used to expose graphite test samples to a dose range from 1 to 7 dpa at three different temperatures (600, 900, and 1200°C) as described in the Graphite Technology Development Plan. Since irradiation induced creep within graphite components is considered critical to determining the operational life of the graphite core, some of the samples will also be exposed to an applied load to determine the creep rate for each graphite type under both temperature and neutron flux. All six AGC capsules in the experiment will be irradiated in the Advanced Test Reactor (ATR). AGC-1 and AGC-2 will be irradiated in the south flux trap and AGC-3–AGC-6 will be irradiated in the east flux trap. The change in flux traps is due to NGNP irradiation priorities requiring the AGC experiment to be moved to accommodate Fuel irradiation experiments. After irradiation, all six AGC capsules will be cooled in the ATR Canal, sized for shipment, and shipped to the Materials and Fuels Complex (MFC) where the capsule will be disassembled in the Hot Fuel Examination Facility (HFEF). During disassembly, the metallic

  8. MENINGKATKAN KETERAMPILAN BERBICARA SISWA KELAS VIIIA MADRASAH TSANAWIYA AL KHAIRAAT TARAKAN DENGAN MODEL DISKUSI KELAS STRATEGI BUZZ GROUP

    OpenAIRE

    Sayid Ali

    2011-01-01

    Sayid Ali. “Meningkatkan Keterampilan Berbicara Siswa Kelas VIII-A Madrasah Tsanawiyah Al Khairaat Tarakan dengan Model Diskusi Kelas Strategi Buzz Group”. Penelitian skripsi ini bertujuan untuk meningkatkan kualitas pembelajaran, dan keterampilan berbicara siswa yang masih rendah dalam proses pembelajaran bahasa Indonesia di kelas VIII-A Madrasah Tsanawiyah Al Khairaat Tarakan. Pemecahan rendahnya keterampilan berbicara siswa di kelas VIII-A Madrasah Tsanawiyah Al Khairaat ...

  9. AGC-3 Graphite Preirradiation Data Analysis Report

    Energy Technology Data Exchange (ETDEWEB)

    William Windes; David Swank; David Rohrbaugh; Joseph Lord

    2013-09-01

    This report describes the specimen loading order and documents all pre-irradiation examination material property measurement data for the graphite specimens contained within the third Advanced Graphite Capsule (AGC-3) irradiation capsule. The AGC-3 capsule is third in six planned irradiation capsules comprising the Advanced Graphite Creep (AGC) test series. The AGC test series is used to irradiate graphite specimens allowing quantitative data necessary for predicting the irradiation behavior and operating performance of new nuclear graphite grades to be generated which will ascertain the in-service behavior of the graphite for pebble bed and prismatic Very High Temperature Reactor (VHTR) designs. The general design of AGC-3 test capsule is similar to the AGC-2 test capsule, material property tests were conducted on graphite specimens prior to loading into the AGC-3 irradiation assembly. However the 6 major nuclear graphite grades in AGC-2 were modified; two previous graphite grades (IG-430 and H-451) were eliminated and one was added (Mersen’s 2114 was added). Specimen testing from three graphite grades (PCEA, 2114, and NBG-17) was conducted at Idaho National Laboratory (INL) and specimen testing for two grades (IG-110 and NBG-18) were conducted at Oak Ridge National Laboratory (ORNL) from May 2011 to July 2013. This report also details the specimen loading methodology for the graphite specimens inside the AGC-3 irradiation capsule. The AGC-3 capsule design requires "matched pair" creep specimens that have similar dose levels above and below the neutron flux profile mid-plane to provide similar specimens with and without an applied load. This document utilized the neutron flux profile calculated for the AGC-3 capsule design, the capsule dimensions, and the size (length) of the selected graphite and silicon carbide samples to create a stacking order that can produce "matched pairs" of graphite samples above and below the AGC-3 capsule elevation mid-point to

  10. AGC-2 Graphite Preirradiation Data Analysis Report

    Energy Technology Data Exchange (ETDEWEB)

    William Windes; W. David Swank; David Rohrbaugh; Joseph Lord

    2013-08-01

    This report described the specimen loading order and documents all pre-irradiation examination material property measurement data for the graphite specimens contained within the second Advanced Graphite Capsule (AGC-2) irradiation capsule. The AGC-2 capsule is the second in six planned irradiation capsules comprising the Advanced Graphite Creep (AGC) test series. The AGC test series is used to irradiate graphite specimens allowing quantitative data necessary for predicting the irradiation behavior and operating performance of new nuclear graphite grades to be generated which will ascertain the in-service behavior of the graphite for pebble bed and prismatic Very High Temperature Reactor (VHTR) designs. Similar to the AGC-1 specimen pre-irradiation examination report, material property tests were conducted on specimens from 18 nuclear graphite types but on an increased number of specimens (512) prior to loading into the AGC-2 irradiation assembly. All AGC-2 specimen testing was conducted at Idaho National Laboratory (INL) from October 2009 to August 2010. This report also details the specimen loading methodology for the graphite specimens inside the AGC-2 irradiation capsule. The AGC-2 capsule design requires “matched pair” creep specimens that have similar dose levels above and below the neutron flux profile mid-plane to provide similar specimens with and without an applied load. This document utilized the neutron flux profile calculated for the AGC-2 capsule design, the capsule dimensions, and the size (length) of the selected graphite and silicon carbide samples to create a stacking order that can produce “matched pairs” of graphite samples above and below the AGC-2 capsule elevation mid-point to provide specimens with similar neutron dose levels.

  11. Pulse-width-modulated attenuator for AGC

    Science.gov (United States)

    Macconnell, J. W.

    1979-01-01

    Automatic-gain-control (AGC) circuit regulates gain of intermediate-frequency and radio-frequency signals over wide dynamic range with high linearity and very low phase shift. Device has potential uses in radio and television receivers, signal distribution systems, and test and measurement instruments.

  12. AGC 226067: A possible interacting low-mass system

    CERN Document Server

    Adams, E A K; Rhode, K L; Janesh, W F; Janowiecki, S; Leisman, L; Giovanelli, R; Haynes, M P; Oosterloo, T A; Salzer, J J; Zaidi, T

    2015-01-01

    We present Arecibo, GBT, VLA and WIYN/pODI observations of the ALFALFA source AGC 226067. Originally identified as an ultra-compact high velocity cloud and candidate Local Group galaxy, AGC 226067 is spatially and kinematically coincident with the Virgo cluster, and the identification by multiple groups of an optical counterpart with no resolved stars supports the interpretation that this systems lies at the Virgo distance (D=17 Mpc). The combined observations reveal that the system consists of multiple components: a central HI source associated with the optical counterpart (AGC 226067), a smaller HI-only component (AGC 229490), a second optical component (AGC 229491), and extended low surface brightness HI. Only ~1/4 of the single-dish HI emission is associated with AGC 226067; as a result, we find M_HI/L_g ~ 6 Msun/Lsun, which is lower than previous work. At D=17 Mpc, AGC 226067 has an HI mass of 1.5 x 10^7 Msun and L_g = 2.4 x 10^6 Lsun, AGC 229490 (the HI-only component) has M_HI = 3.6 x 10^6 Msun, and AG...

  13. AGC198606: A gas-bearing dark matter minihalo?

    CERN Document Server

    Adams, E A K; Janesh, W F; Janowiecki, S; Oosterloo, T A; Rhode, K L; Giovanelli, R; Haynes, M P; Salzer, J J; Sternberg, A; Cannon, J M; Munoz, R R

    2014-01-01

    We present neutral hydrogen (HI) imaging observations with the Westerbork Synthesis Radio Telescope of AGC198606, an HI cloud discovered in the ALFALFA 21cm survey. This object is of particular note as it is located 16 km/s and 1.2 degrees from the gas-bearing ultra-faint dwarf galaxy Leo T while having a similar HI linewidth and approximately twice the flux density. The HI imaging observations reveal a smooth, undisturbed HI morphology with a full extent of 23'x16' at the 5x10^18 atoms cm^-2 level. The velocity field of AGC198606 shows ordered motion with a gradient of ~25 km/s across ~20'. The global velocity dispersion is 9.3 km/s with no evidence for a narrow spectral component. No optical counterpart to AGC198606 is detected. The distance to AGC198606 is unknown, and we consider several different scenarios: physical association with Leo T, a minihalo at a distance of ~150 kpc based on the models of Faerman et al. (2013), and a cloud in the Galactic halo. At a distance of 420 kpc, AGC198606 would have an ...

  14. AGC-3 IRRADIATION DATA QUALIFICATION FINAL REPORT

    Energy Technology Data Exchange (ETDEWEB)

    Hull, Laurence

    2014-08-01

    All thermocouples functioned throughout the AGC-3 experiment. There was one interval between Dec 18, 2012 and Dec 20, 2012 where 10 NULL values were reported for various thermocouples. These NULL values were deleted from the database. All temperature data are Qualified. During Oct and Nov 2013, 135,849 helium and argon gas flow values were below 0. These negative gas flow values are not correct and are Failed. The remaining argon, helium, and total gas flow data are within expected ranges and are Qualified. Total gas flow was approximately 50 sccm through the capsule. Helium gas flow was briefly increased to 100 sccm during reactor shutdowns. At the start of the experiment, moisture in the outflow gas line was stuck at a constant value of 335.6174 ppmv for the first cycle. When the capsule was reinstalled in the reactor for Cycle 154B, a new moisture filter was installed. Moisture data from Cycle 152B are Failed. All moisture data from the final three cycles are Qualified. Graphite creep specimens were subjected to one of two loads, 393 lbf or 589 lbf. The experiment plan included three loads, but problems with gas leaks in the rams applying the load to the stacks resulted in lower loads being applied to some of the stacks. While the loads applied are not the loads in the plan, the loads were consistently applied throughout the experiment. Therefore the reported loads are accurate and can be used in analysis of graphite creep. Loads were consistently within 5% of the specified values throughout the experiment. Stack displacement increased consistently throughout the experiment with total displacement ranging from 1 to 1.25 inches. No anomalous values were identified. During reactor outages, a set of pneumatic rams was used to raise the stacks of graphite creep specimens to ensure the specimens had not become stuck within the test train. This stack raising was performed three times; all stacks were raised successfully each time. The load and displacement data are

  15. AGC-3 Experiment Irradiation Monitoring Data Qualification Final Report

    Energy Technology Data Exchange (ETDEWEB)

    Laurence Hull

    2014-10-01

    The Graphite Technology Development Program will run a series of six experiments to quantify the effects of irradiation on nuclear grade graphite. The third experiment, Advanced Graphite Creep 3 (AGC 3), began with Advanced Test Reactor (ATR) Cycle 152B on November 27, 2012, and ended with ATR Cycle 155B on April 23, 2014. This report documents qualification of AGC 3 experiment irradiation monitoring data for use by the Very High Temperature Reactor (VHTR) Technology Development Office (TDO) Program for research and development activities required to design and license the first VHTR nuclear plant. Qualified data meet the requirements for data collection and use as described in the experiment planning and quality assurance documents. Failed data do not meet the requirements. Trend data may not meet the requirements, but may still provide some useable information. All thermocouples (TCs) functioned throughout the AGC 3 experiment. There was one interval between December 18, 2012, and December 20, 2012, where 10 NULL values were reported for various TCs. These NULL values were deleted from the Nuclear Data Management and Analysis System database. All temperature data are Qualified for use by the VHTR TDO Program. Argon, helium, and total gas flow data were within expected ranges and are Qualified for use by the VHTR TDO Program. Total gas flow was approximately 50 sccm through the AGC 3 experiment capsule. Helium gas flow was briefly increased to 100 sccm during ATR shutdowns. At the start of the AGC 3 experiment, moisture in the outflow gas line was stuck at a constant value of 335.6174 ppmv for the first cycle (Cycle 152B). When the AGC 3 experiment capsule was reinstalled in ATR for Cycle 154B, a new moisture filter was installed. Moisture data from Cycle 152B are Failed. All moisture data from the final three cycles (Cycles 154B, 155A, and 155B) are Qualified for use by the VHTR TDO Program.

  16. AGC-2 Specimen Post Irradiation Data Package Report

    Energy Technology Data Exchange (ETDEWEB)

    Windes, William Enoch [Idaho National Lab. (INL), Idaho Falls, ID (United States); Swank, W. David [Idaho National Lab. (INL), Idaho Falls, ID (United States); Rohrbaugh, David T. [Idaho National Lab. (INL), Idaho Falls, ID (United States); Cottle, David L. [Idaho National Lab. (INL), Idaho Falls, ID (United States)

    2015-08-01

    This report documents results of the post-irradiation examination material property testing of the creep, control, and piggyback specimens from the irradiation creep capsule Advanced Graphite Creep (AGC)-2 are reported. This is the second of a series of six irradiation test trains planned as part of the AGC experiment to fully characterize the neutron irradiation effects and radiation creep behavior of current nuclear graphite grades. The AGC-2 capsule was irradiated in the Idaho National Laboratory Advanced Test Reactor at a nominal temperature of 600°C and to a peak dose of 5 dpa (displacements per atom). One-half of the creep specimens were subjected to mechanical stresses (an applied stress of either 13.8, 17.2, or 20.7 MPa) to induce irradiation creep. All post-irradiation testing and measurement results are reported with the exception of the irradiation mechanical strength testing, which is the last destructive testing stage of the irradiation testing program. Material property tests were conducted on specimens from 15 nuclear graphite grades using a similar loading configuration as the first AGC capsule (AGC-1) to provide easy comparison between the two capsules. However, AGC-2 contained an increased number of specimens (i.e., 487 total specimens irradiated) and replaced specimens of the minor grade 2020 with the newer grade 2114. The data reported include specimen dimensions for both stressed and unstressed specimens to establish the irradiation creep rates, mass and volume data necessary to derive density, elastic constants (Young’s modulus, shear modulus, and Poisson’s ratio) from ultrasonic time-of-flight velocity measurements, Young’s modulus from the fundamental frequency of vibration, electrical resistivity, and thermal diffusivity and thermal expansion data from 100–500°C. No data outliers were determined after all measurements were completed. A brief statistical analysis was performed on the irradiated data and a limited comparison between

  17. Economic assessment model architecture for AGC/AVLIS selection

    International Nuclear Information System (INIS)

    The economic assessment model architecture described provides the flexibility and completeness in economic analysis that the selection between AGC and AVLIS demands. Process models which are technology-specific will provide the first-order responses of process performance and cost to variations in process parameters. The economics models can be used to test the impacts of alternative deployment scenarios for a technology. Enterprise models provide global figures of merit for evaluating the DOE perspective on the uranium enrichment enterprise, and business analysis models compute the financial parameters from the private investor's viewpoint

  18. A high-performance low-power CMOS AGC for GPS application

    International Nuclear Information System (INIS)

    A wide tuning range, low power CMOS automatic gain control (AGC) with a simple architecture is proposed. The proposed AGC is composed of a variable gain amplifier (VGA), a comparator and a charge pump, and the dB-linear gain is controlled by the charge pump. The AGC was implemented in a 0.18 μm CMOS technology. The dynamic range of the VGA is more than 55 dB, the bandwidth is 30 MHz, and the gain error is lower than ±1.5 dB over the full temperature and gain ranges. It is designed for GPS application and is fed from a single 1.8 V power supply. The AGC power consumption is less than 5 mW, and the area of the AGC is 700 x 450 μm2. (semiconductor integrated circuits)

  19. Role of Hydrophobic Mutations on the Binding Affinity and Stability of Blood Coagulation Factor VIIIa: A Computational Molecular Dynamics and Free-Energy Analysis

    OpenAIRE

    Venkateswarlu, Divi

    2014-01-01

    Factor VIIIa is a non-covalently bound hetero-trimer among A1, A2 and A3-C1-C2 domains and an essential co-factor for factor IXa enzyme during proteolytic activation of factor X zymogen. The relatively weak interactions between A2 and the interface A1/A3 domains dampen the functional stability of FVIIIa in plasma and results in rapid degradation. We studied the mutational effect of three charged residues (Asp519, Glu665 and Asp666) to several hydrophobic residues by molecular dynamics simulat...

  20. The Extremely Metal-Poor Dwarf Galaxy AGC 198691

    Science.gov (United States)

    Hirschauer, Alec S.; Salzer, John Joseph; Cannon, John M.; Skillman, Evan D.; SHIELD II Team

    2016-01-01

    We present spectroscopic observations of the nearby dwarf irregular galaxy AGC 198691. This object is part of the Survey of HI in Extremely Low-Mass Dwarfs (SHIELD) sample, which consists of ultra-low HI mass galaxies discovered by the Arecibo Legacy Fast-Acting ALFA (ALFALFA) survey. SHIELD is a multi-configuration Expanded Very Large Array (EVLA) study of the neutral gas content and dynamics of galaxies with HI masses in the range of 106-107 M⊙. Our spectral data were obtained using the new high-throughput KPNO Ohio State Multi-Object Spectrograph (KOSMOS) on the Mayall 4-m telescope as part of a systematic study of the nebular abundances in the SHIELD galaxy sample. These observations enable measurement of the temperature sensitive [OIII]λ4363 line and hence the determination of a "direct" oxygen abundance for AGC 198691. We find this system to be an extremely metal-deficient (XMD) galaxy with an oxygen abundance comparable to such objects as I Zw 18, SBS 0335-052W, Leo P, and DDO 68 - the lowest metallicity star-forming systems known. It is worth noting that two of the five lowest-abundance galaxies currently recognized were discovered via the ALFALFA blind HI survey. These XMD galaxies are potential analogues to the first star-forming systems, which through hierarchical accretion processes built up the large galaxies we observe today in the local Universe. Detailed analysis of such XMD systems offers observational constraint to models of galactic evolution and star formation histories to allow a better understanding of the processes that govern the chemical evolution of low-mass galaxies.

  1. A Robust Distributed Multipoint Fiber Optic Gas Sensor System Based on AGC Amplifier Structure.

    Science.gov (United States)

    Zhu, Cunguang; Wang, Rende; Tao, Xuechen; Wang, Guangwei; Wang, Pengpeng

    2016-01-01

    A harsh environment-oriented distributed multipoint fiber optic gas sensor system realized by automatic gain control (AGC) technology is proposed. To improve the photoelectric signal reliability, the electronic variable gain can be modified in real time by an AGC closed-loop feedback structure to compensate for optical transmission loss which is caused by the fiber bend loss or other reasons. The deviation of the system based on AGC structure is below 4.02% when photoelectric signal decays due to fiber bending loss for bending radius of 5 mm, which is 20 times lower than the ordinary differential system. In addition, the AGC circuit with the same electric parameters can keep the baseline intensity of signals in different channels of the distributed multipoint sensor system at the same level. This avoids repetitive calibrations and streamlines the installation process. PMID:27483267

  2. A sensitive glucose biosensor based on Ag@C core–shell matrix

    Energy Technology Data Exchange (ETDEWEB)

    Zhou, Xuan; Dai, Xingxin; Li, Jianguo [College of Chemistry, Chemical engineering and Materials Science, Soochow University, Suzhou, Jiangsu 215123 (China); Long, Yumei, E-mail: yumeilong@suda.edu.cn [College of Chemistry, Chemical engineering and Materials Science, Soochow University, Suzhou, Jiangsu 215123 (China); The Key Lab of Health Chemistry and Molecular Diagnosis of Suzhou (China); Li, Weifeng, E-mail: liweifeng@suda.edu.cn [College of Chemistry, Chemical engineering and Materials Science, Soochow University, Suzhou, Jiangsu 215123 (China); Tu, Yifeng [College of Chemistry, Chemical engineering and Materials Science, Soochow University, Suzhou, Jiangsu 215123 (China); The Key Lab of Health Chemistry and Molecular Diagnosis of Suzhou (China)

    2015-04-01

    Nano-Ag particles were coated with colloidal carbon (Ag@C) to improve its biocompatibility and chemical stability for the preparation of biosensor. The core–shell structure was evidenced by transmission electron microscope (TEM) and the Fourier transfer infrared (FTIR) spectra revealed that the carbon shell is rich of function groups such as − OH and − COOH. The as-prepared Ag@C core–shell structure can offer favorable microenvironment for immobilizing glucose oxidase and the direct electrochemistry process of glucose oxidase (GOD) at Ag@C modified glassy carbon electrode (GCE) was realized. The modified electrode exhibited good response to glucose. Under optimum experimental conditions the biosensor linearly responded to glucose concentration in the range of 0.05–2.5 mM, with a detection limit of 0.02 mM (S/N = 3). The apparent Michaelis–Menten constant (K{sub M}{sup app}) of the biosensor is calculated to be 1.7 mM, suggesting high enzymatic activity and affinity toward glucose. In addition, the GOD-Ag@C/Nafion/GCE shows good reproducibility and long-term stability. These results suggested that core–shell structured Ag@C is an ideal matrix for the immobilization of the redox enzymes and further the construction of the sensitive enzyme biosensor. - Highlights: • Enhanced direct electrochemistry of GOD was achieved at Ag@C modified electrode. • A novel glucose biosensor based on Ag@C core–shell structure was developed. • The designed GOD-Ag@C/Nafion/GCE biosensor showed favorable analysis properties. • The biosensor is easy to prepare and can be applied for real sample assay.

  3. A sensitive glucose biosensor based on Ag@C core–shell matrix

    International Nuclear Information System (INIS)

    Nano-Ag particles were coated with colloidal carbon (Ag@C) to improve its biocompatibility and chemical stability for the preparation of biosensor. The core–shell structure was evidenced by transmission electron microscope (TEM) and the Fourier transfer infrared (FTIR) spectra revealed that the carbon shell is rich of function groups such as − OH and − COOH. The as-prepared Ag@C core–shell structure can offer favorable microenvironment for immobilizing glucose oxidase and the direct electrochemistry process of glucose oxidase (GOD) at Ag@C modified glassy carbon electrode (GCE) was realized. The modified electrode exhibited good response to glucose. Under optimum experimental conditions the biosensor linearly responded to glucose concentration in the range of 0.05–2.5 mM, with a detection limit of 0.02 mM (S/N = 3). The apparent Michaelis–Menten constant (KMapp) of the biosensor is calculated to be 1.7 mM, suggesting high enzymatic activity and affinity toward glucose. In addition, the GOD-Ag@C/Nafion/GCE shows good reproducibility and long-term stability. These results suggested that core–shell structured Ag@C is an ideal matrix for the immobilization of the redox enzymes and further the construction of the sensitive enzyme biosensor. - Highlights: • Enhanced direct electrochemistry of GOD was achieved at Ag@C modified electrode. • A novel glucose biosensor based on Ag@C core–shell structure was developed. • The designed GOD-Ag@C/Nafion/GCE biosensor showed favorable analysis properties. • The biosensor is easy to prepare and can be applied for real sample assay

  4. ALFALFA Discovery of the Most Metal-Poor Gas-Rich Galaxy Known: AGC 198691

    CERN Document Server

    Hirschauer, Alec S; Skillman, Evan D; Berg, Danielle; McQuinn, Kristen B W; Cannon, John M; Gordon, Alex J R; Haynes, Martha P; Giovanelli, Riccardo; Adams, Elizabeth A K; Janowiecki, Steven; Rhode, Katherine L; Pogge, Richard W; Croxall, Kevin V; Aver, Erik

    2016-01-01

    We present spectroscopic observations of the nearby dwarf galaxy AGC 198691. This object is part of the Survey of HI in Extremely Low-Mass Dwarfs (SHIELD) project, which is a multi-wavelength study of galaxies with HI masses in the range of 10$^{6}$-10$^{7.2}$~M$_{\\odot}$ discovered by the ALFALFA survey. We have obtained spectra of the lone HII region in AGC 198691 with the new high-throughput KPNO Ohio State Multi-Object Spectrograph (KOSMOS) on the Mayall 4-m as well as with the Blue Channel spectrograph on the MMT 6.5-m telescope. These observations enable the measurement of the temperature-sensitive [OIII]$\\lambda$4363 line and hence the determination of a "direct" oxygen abundance for AGC 198691. We find this system to be an extremely metal-deficient (XMD) system with an oxygen abundance of 12+log(O/H) = 7.02 $\\pm$ 0.03, making AGC 198691 the lowest-abundance star-forming galaxy known in the local universe. Two of the five lowest-abundance galaxies known have been discovered by the ALFALFA blind HI surv...

  5. ALFALFA Discovery of the Most Metal-poor Gas-rich Galaxy Known: AGC 198691

    Science.gov (United States)

    Hirschauer, Alec S.; Salzer, John J.; Skillman, Evan D.; Berg, Danielle; McQuinn, Kristen B. W.; Cannon, John M.; Gordon, Alex J. R.; Haynes, Martha P.; Giovanelli, Riccardo; Adams, Elizabeth A. K.; Janowiecki, Steven; Rhode, Katherine L.; Pogge, Richard W.; Croxall, Kevin V.; Aver, Erik

    2016-05-01

    We present spectroscopic observations of the nearby dwarf galaxy AGC 198691. This object is part of the Survey of H i in Extremely Low-Mass Dwarfs project, which is a multi-wavelength study of galaxies with H i masses in the range of 106–107.2 M ⊙, discovered by the Arecibo Legacy Fast ALFA (ALFALFA) survey. We have obtained spectra of the lone H ii region in AGC 198691 with the new high-throughput KPNO Ohio State Multi-Object Spectrograph on the Mayall 4 m, as well as with the Blue Channel spectrograph on the MMT 6.5 m telescope. These observations enable the measurement of the temperature-sensitive [O iii]λ4363 line and hence the determination of a “direct” oxygen abundance for AGC 198691. We find this system to be an extremely metal-deficient (XMD) system with an oxygen abundance of 12+log(O/H) = 7.02 ± 0.03, making AGC 198691 the lowest-abundance star-forming galaxy known in the local universe. Two of the five lowest-abundance galaxies known have been discovered by the ALFALFA blind H i survey; this high yield of XMD galaxies represents a paradigm shift in the search for extremely metal-poor galaxies.

  6. SHIELD II: AGC 198507 - An Extremely Rare Low-Mass Galaxy Interaction?

    Science.gov (United States)

    Nikolina Borg Stevens, Karin; Cannon, John M.; McNichols, Andrew; McQuinn, Kristen B.; Teich, Yaron; SHIELD II Team

    2016-01-01

    The "Survey of HI in Extremely Low-mass Dwarfs II" ("SHIELD II") is a multiwavelength, legacy-class observational campaign that is facilitating the study of both internal and global evolutionary processes in low-mass dwarf galaxies discovered by the Arecibo Legacy Fast ALFA (ALFALFA) survey. New HST imaging of one of these sample galaxies, AGC 198507, has revealed it to be a very rare interacting system; to our knowledge this is one of only a few known interactions in this extreme mass range. WSRT imaging indicates that the bulk of the HI is associated with the more luminous AGC 198507, while low surface brightness gas extends toward and coincides with the less luminous companion, which is separated by roughly 1.5 kpc from AGC 198507. Here we present new VLA B configuration HI imaging that allows us to localize the HI gas, to examine the rotational dynamics of AGC 198507, and to study the nature of star formation in this unique low-mass interacting system.Support for this work was provided by NSF grant AST-1211683 to JMC at Macalester College, and by NASA through grant GO-13750 from the Space Telescope Science Institute, which is operated by AURA, Inc., under NASA contract NAS5-26555.

  7. Designing Structure-Dependent MPC-Based AGC Schemes Considering Network Topology

    Directory of Open Access Journals (Sweden)

    Young-Sik Jang

    2015-04-01

    Full Text Available This paper presents the important features of structure-dependent model predictive control (MPC-based approaches for automatic generation control (AGC considering network topology. Since power systems have various generators under different topologies, it is necessary to reflect the characteristics of generators in power networks and the control system structures in order to improve the dynamic performance of AGC. Specifically, considering control system structures is very important because not only can the topological problems be reduced, but also a computing system for AGC in a bulk-power system can be realized. Based on these considerations, we propose new schemes in the proposed controller for minimizing inadvertent line flows and computational burden, which strengthen the advantages of MPC-based approach for AGC. Analysis and simulation results in the IEEE 39-bus model system show different dynamic behaviors among structure-dependent control schemes and possible improvements in computational burden via the proposed control scheme while system operators in each balancing area consider physical load reference ramp constraints among generators.

  8. ELECTROHYDRAULIC SYSTEM FOR AUTOMATIC GAGE CONTROL (AGC FOR TANDEM COLD MILL PLANT IN SARTID SMEDEREVO

    Directory of Open Access Journals (Sweden)

    Slobodan Stefanovic

    2013-01-01

    Full Text Available Electro hydraulic servosystem for the AGC has better characteristics than electromechanic (fivetimesgreater speed of rolling, greater speed of positioning ,smaller dead–zone, smaller time of roll gap adjusting start, smaller time of maximum speed reaching,greater unloading speed.

  9. Mechanism for activation of the growth factor-activated AGC kinases by turn motif phosphorylation

    DEFF Research Database (Denmark)

    Hauge, Camilla; Antal, Torben L; Hirschberg, Daniel; Doehn, Ulrik; Thorup, Katrine; Idrissova, Leila; Hansen, Klaus; Jensen, Ole N; Jørgensen, Thomas J; Biondi, Ricardo M; Frödin, Morten

    2007-01-01

    The growth factor/insulin-stimulated AGC kinases share an activation mechanism based on three phosphorylation sites. Of these, only the role of the activation loop phosphate in the kinase domain and the hydrophobic motif (HM) phosphate in a C-terminal tail region are well characterized. We invest...

  10. Role of hydrophobic mutations on the binding affinity and stability of blood coagulation factor VIIIa: a computational molecular dynamics and free-energy analysis.

    Science.gov (United States)

    Venkateswarlu, Divi

    2014-07-18

    Factor VIIIa is a non-covalently bound hetero-trimer among A1, A2 and A3-C1-C2 domains and an essential co-factor for factor IXa enzyme during proteolytic activation of factor X zymogen. The relatively weak interactions between A2 and the interface A1/A3 domains dampen the functional stability of FVIIIa in plasma and results in rapid degradation. We studied the mutational effect of three charged residues (Asp519, Glu665 and Asp666) to several hydrophobic residues by molecular dynamics simulations. Analysis of the binding free energy by MM-PBSA and MM-GBSA methods shows that the mutation of Asp519 and Glu665 residues to either Val or Ala enhance the A2 domain binding affinity in agreement with the experimental site-specific mutagenesis data. Mutation of Asp666 to Val, Tyr, Met and Phe showed largest improvement in the A2-domain binding among the eight hydrophobic mutants studied. Our studies suggest that the enrichment of hydrophobic interactions in the buried surface regions of A2 domain plays crucial role in improving the overall stability of FVIIIa. PMID:24952158

  11. Study on the failure mechanism of Ag-Ce contacts in DC level

    Institute of Scientific and Technical Information of China (English)

    MENG Fan-bin; LU Jian-guo; LU Ning-yi; CHEN Zhi-chao; CHEN Qi

    2007-01-01

    Nominal contact resistance, minimum erosion and material transfer are required with low cost materials working in a wide currents range for DC relays. Ag-Ni contact materials have low contact resistance, but the erosion and material transfer are large at high current level. Ag-SnO2 contact materials have good anti-welding properties and resistance to arc erosion, but they have large contact resistance during working and are easily block SnO2 from flocking together on the surface at low current level.In this paper, the failure mechanisms of Ag-Ce contact material were studied. The surface morphologies of the contacts after electrical endurance test for Ag-Ce contact material were compared with that of Ag-Ni and Ag-SnO2 contact materials. The effect of Ce on the surface morphologies of the contacts after electrical endurance test was analyzed.

  12. Mucin AgC10 from Trypanosoma cruzi Interferes with L-Selectin-Mediated Monocyte Adhesion

    OpenAIRE

    Alcaide, P.; Lim, Y. C.; Luscinskas, F. W.; Fresno, M

    2010-01-01

    The protozoan parasite Trypanosoma cruzi has evolved sophisticated systems to evade the immune response. An important requirement for a productive immune response is recruitment of the appropriate immune cells from the bloodstream to the sites of infection. Here, we show that a mucin expressed and secreted by the metacyclic infective form of T. cruzi, AgC10, is able to interfere with L-selectin-mediated monocyte adhesion. Thus, incubation of U937 monocytic cells stably expressing L-selectin (...

  13. LS-SVM Based AGC of an Asynchronous Power System with Dynamic Participation from DFIG Based Wind Turbines

    Directory of Open Access Journals (Sweden)

    Gulshan Sharma

    2014-08-01

    Full Text Available Modern power systems are large and interconnected with growing trends to integrate wind energy to the power system and meet the ever rising energy demand in an economical manner. The penetration of wind energy has motivated power engineers and researchers to investigate the dynamic participation of Doubly Fed Induction Generators (DFIG based wind turbines in Automatic Generation Control (AGC services. However, with dynamic participation of DFIG, the AGC problem becomes more complex and under these conditions classical AGC are not suitable. Therefore, a new non-linear Least Squares Support Vector Machines (LS-SVM based regulator for solution of AGC problem is proposed in this study. The proposed AGC regulator is trained for a wide range of operating conditions and load changes using an off-line data set generated from the robust control technique. A two-area power system connected via parallel AC/DC tie-lines with DFIG based wind turbines in each area is considered to demonstrate the effectiveness of the proposed AGC regulator and compared with results obtained using Multi-Layer Perceptron (MLP neural networks and conventional PI regulators under various operating conditions and load changes.

  14. NV Energy Large-Scale Photovoltaic Integration Study: Intra-Hour Dispatch and AGC Simulation

    Energy Technology Data Exchange (ETDEWEB)

    Lu, Shuai; Etingov, Pavel V.; Meng, Da; Guo, Xinxin; Jin, Chunlian; Samaan, Nader A.

    2013-01-02

    The uncertainty and variability with photovoltaic (PV) generation make it very challenging to balance power system generation and load, especially under high penetration cases. Higher reserve requirements and more cycling of conventional generators are generally anticipated for large-scale PV integration. However, whether the existing generation fleet is flexible enough to handle the variations and how well the system can maintain its control performance are difficult to predict. The goal of this project is to develop a software program that can perform intra-hour dispatch and automatic generation control (AGC) simulation, by which the balancing operations of a system can be simulated to answer the questions posed above. The simulator, named Electric System Intra-Hour Operation Simulator (ESIOS), uses the NV Energy southern system as a study case, and models the system’s generator configurations, AGC functions, and operator actions to balance system generation and load. Actual dispatch of AGC generators and control performance under various PV penetration levels can be predicted by running ESIOS. With data about the load, generation, and generator characteristics, ESIOS can perform similar simulations and assess variable generation integration impacts for other systems as well. This report describes the design of the simulator and presents the study results showing the PV impacts on NV Energy real-time operations.

  15. AGC Tuning Of TCPS Based Hydrothermal System under Open Market Scenario with Particle Swarm Optimization

    Directory of Open Access Journals (Sweden)

    C. Srinivasa Rao

    2008-06-01

    Full Text Available This paper demonstrates the analysis of Automatic generation control (AGC of a two-area interconnected thyristor controlled phase shifter (TCPS based hydrothermal system in the continuous mode under open market scenario. Further the use of particle swarm optimization in optimizing the value of integral controller has also been reported. The effects of nonlinearities like deadband and generation rate constraint on the system have also been investigated. Open transmission access and the evolving of more socialized companies for generation, transmission and distribution affects the formulation of AGC problem. So the traditional AGC two-area system is modified to take into account the effect of bilateral contracts on the dynamics. A control strategy using TCPS is proposed to provide active control of system frequency. Gain settings of the integral controllers without and with TCPS are optimized using the particle swarm optimization following a step load disturbance in either of the areas. The results reported in this paper demonstrate the effectiveness of the particle swarm optimizer (PSO in the tuning of value of integral controller. The enhancement in the dynamic response of the power system is verified through simulation results.

  16. Capacitive deionization of seawater effected by nano Ag and Ag@C on graphene.

    Science.gov (United States)

    Cai, P-F; Su, C-J; Chang, W-T; Chang, F-C; Peng, C-Y; Sun, I-W; Wei, Y-L; Jou, C-J; Wang, H Paul

    2014-08-30

    Drinking water shortage has become worse in recent decades. A new capacitive deionization (CDI) method for increasing water supplies through the effective desalination of seawater has been developed. Silver as nano Ag and Ag@C which was prepared by carbonization of the Ag(+)-β-cyclodextrin complex at 573 K for 30 min can add the antimicrobial function into the CDI process. The Ag@C and Ag nanoparticles dispersed on reduced graphene oxide (Ag@C/rGO and nano Ag/rGO) were used as the CDI electrodes. The nano Ag/rGO and Ag@C/rGO electrodes can reduce the charging resistant, and enhance the electrosorption capability. Better CDI efficiencies with the nano Ag/rGO and Ag@C/rGO electrodes can therefore be obtained. When reversed the voltage, the electrodes can be recovered up to 90% within 5 min. This work presents the feasibility for the nano Ag and Ag@C on rGO electrodes applied in CDI process to produce drinking water from seawater or saline water. PMID:24928455

  17. Activated protein C promotes breast cancer cell migration through interactions with EPCR and PAR-1

    OpenAIRE

    Beaulieu, Lea M.; Church, Frank C.

    2006-01-01

    Activated protein C (APC) is a serine protease that regulates thrombin (IIa) production through inactivation of blood coagulation factors Va and VIIIa. APC also has non-hemostatic functions related to inflammation, proliferation, and apoptosis through various mechanisms. Using two breast cancer cell lines, MDA-MB-231 and MDA-MB-435, we investigated the role of APC in cell chemotaxis and invasion. Treatment of cells with increasing APC concentrations (1–50 μg/ml) increased invasion and chemota...

  18. AGC controlled scintillation probe for industrial application; Sonda scyntylacyjna do zastosowan przemyslowych stabilizowana ukladem ARW

    Energy Technology Data Exchange (ETDEWEB)

    Mirowicz, J.; Machaj, B.

    1997-12-31

    The instrument to measure Am-241 and Cs-137 radiation consisting of scintillation probe, two measuring channels and a photomultiplier automatic gain control circuit was investigated in respect to its operating stability and measuring errors. The instability of the count rate does not exceed 0.15 % of the PM gain variation {+-}50 % relative to nominal one. The effective time constant of the AGC loop {<=}1 sec, and after the mains is interrupted and switched again the instrument restarts its operation and stabilizes the PM gain in the period not longer than 10 sec since the moment the mains is switched on. (author). 3 refs, 7 figs, 7 tabs.

  19. Synthesis and Characterization of Ag/Ce1-xMnxO2-δ Oxidation Catalysts

    Directory of Open Access Journals (Sweden)

    David Alami

    2013-06-01

    Full Text Available The aim of this work was to obtain samples of Ag - doped manganese-cerium mixed oxides and explore their characteristics. Six catalysts were prepared by the co-precipitation process followed by impregnation method for Ag incorporation. These catalysts were characterized in particular by means of TEM, XRD, TPR and examined on the reaction of hydrogen peroxide catalytic decomposition. The samples obtained were solid solution nanoparticle agglomerates with irregular surface morphology. The results pointed out that the highest activity in oxidation reactions should possess Ag/Ce0.23Mn0.77O2-δ catalyst.  © 2013 BCREC UNDIP. All rights reservedReceived: 2nd April 2013; Revised: 11st May 2013; Accepted: 24th May 2013[How to Cite: Alami, D., Bulavin, V. (2013. Synthesis and Characterization of Ag/Ce1-xMnxO2-δ Oxidation Catalysts. Bulletin of Chemical Reaction Engineering & Catalysis, 8 (1: 83-88. (doi:10.9767/bcrec.8.1.4718.83-88][Permalink/DOI: http://dx.doi.org/10.9767/bcrec.8.1.4718.83-88] | View in  |

  20. A Novel Fuzzy RPID Controller for Multiarea AGC with IABC Optimization

    Directory of Open Access Journals (Sweden)

    Javad Javidan

    2013-01-01

    Full Text Available An Interactive Artificial Bee Colony (IABC Optimization based fuzzy (IABCF to tune optimal gains of a Robust Proportional Integral Derivative (RPID controller is proposed for the solution of multiarea automatic generation control (AGC simulation problem in a restructured power system. One of the important problems in the proposed method is the exact tuning of the RPID parameters for achieving the desired level of robust performance. The problem of robustly tuning of RPID based AGC design is formulated as an optimization problem according to the time domain-based objective function, which is solved by the IABC technique that has a strong ability to find the most optimistic results. The robustness and effectiveness of the proffered method are shown on a two and four areas deregulated power system with possible contracted scenarios under large load demand and area disturbances in comparison with the other methods through FD and ITAE performance indices. The evaluation results show that the proposed control strategy achieves good robust performance for worldwide experience of automatic generation control in restructured systems parameters and load changes in the presence of system nonlinearities.

  1. Spin-orbit effects, VSEPR theory, and the electronic structures of heavy and superheavy group IVA hydrides and group VIIIA tetrafluorides. A partial role reversal for elements 114 and 118

    International Nuclear Information System (INIS)

    Relativistic effective core potentials and spin-orbit operators are used in relativistic configuration interaction calculations to explore the effects of spin-orbit coupling on the electronic structures of atoms and molecules of elements 114 and 118. The monohydrides of group IVA and the tetrafluorides of group VIIIA are examined in order to provide examples of trends within families among the various periods. The spin-orbit effect is found to play a dominant role in the determination of atomic and molecular properties. Several nonintuitive consequences of spin-orbit coupling are presented, including the depiction of element 114 as a closed-shell noble atom and the suggestion that the VSEPR theory in inadequate to describe the geometry of the rare gas tetrafluoride, (118)F4

  2. Plant AGC protein kinases orient auxin-mediated differential growth and organogenesis

    NARCIS (Netherlands)

    Galván Ampudia, Carlos Samuel

    2009-01-01

    In view of their predominant sessile lifestyle, plants need to be able to adapt to changes in their environment. Environmental signals such as light and gravity modulate plant growth and architecture by redirecting polar cell-to-cell transport of auxin, thus causing changes in the distribution of th

  3. Plasma protein S contains zinc essential for efficient activated protein C-independent anticoagulant activity and binding to factor Xa, but not for efficient binding to tissue factor pathway inhibitor

    OpenAIRE

    Heeb, Mary J.; Prashun, Duane; Griffin, John H; Bouma, Bonno N.

    2009-01-01

    Protein S (PS) is a cofactor for activated protein C (APC), which inactivates coagulation factors (F) Va and VIIIa. Deficiency of protein C or PS is associated with risk of thrombosis. We found that PS also has APC-independent anticoagulant activity (PS-direct) and directly inhibits thrombin generated by FXa/FVa (prothrombinase complex). Here we report that PS contains Zn2+ that is required for PS-direct and that is lost during certain purification procedures. Immunoaffinity-purified PS conta...

  4. Controlling Wind Turbines for Secondary Frequency Regulation: An Analysis of AGC Capabilities Under New Performance Based Compensation Policy: Preprint

    Energy Technology Data Exchange (ETDEWEB)

    Aho, J.; Pao, L. Y.; Fleming, P.; Ela, E.

    2015-02-01

    As wind energy becomes a larger portion of the world's energy portfolio there has been an increased interest for wind turbines to control their active power output to provide ancillary services which support grid reliability. One of these ancillary services is the provision of frequency regulation, also referred to as secondary frequency control or automatic generation control (AGC), which is often procured through markets which recently adopted performance-based compensation. A wind turbine with a control system developed to provide active power ancillary services can be used to provide frequency regulation services. Simulations have been performed to determine the AGC tracking performance at various power schedule set-points, participation levels, and wind conditions. The performance metrics used in this study are based on those used by several system operators in the US. Another metric that is analyzed is the damage equivalent loads (DELs) on turbine structural components, though the impacts on the turbine electrical components are not considered. The results of these single-turbine simulations show that high performance scores can be achieved when there is sufficient wind resource available. The capability of a wind turbine to rapidly and accurately follow power commands allows for high performance even when tracking rapidly changing AGC signals. As the turbine de-rates to meet decreased power schedule set-points there is a reduction in the DELs, and the participation in frequency regulation has a negligible impact on these loads.

  5. Comparison between the Strength Levels of Baseline Nuclear-Grade Graphite and Graphite Irradiated in AGC-2

    Energy Technology Data Exchange (ETDEWEB)

    Carroll, Mark Christopher [Idaho National Laboratory (INL), Idaho Falls, ID (United States)

    2015-07-01

    This report details the initial comparison of mechanical strength properties between the cylindrical nuclear-grade graphite specimens irradiated in the second Advanced Graphite Creep (AGC-2) experiment with the established baseline, or unirradiated, mechanical properties compiled in the Baseline Graphite Characterization program. The overall comparative analysis will describe the development of an appropriate test protocol for irradiated specimens, the execution of the mechanical tests on the AGC-2 sample population, and will further discuss the data in terms of developing an accurate irradiated property distribution in the limited amount of irradiated data by leveraging the considerably larger property datasets being captured in the Baseline Graphite Characterization program. Integrating information on the inherent variability in nuclear-grade graphite with more complete datasets is one of the goals of the VHTR Graphite Materials program. Between “sister” specimens, or specimens with the same geometry machined from the same sub-block of graphite from which the irradiated AGC specimens were extracted, and the Baseline datasets, a comprehensive body of data will exist that can provide both a direct and indirect indication of the full irradiated property distributions that can be expected of irradiated nuclear-grade graphite while in service in a VHTR system. While the most critical data will remain the actual irradiated property measurements, expansion of this data into accurate distributions based on the inherent variability in graphite properties will be a crucial step in qualifying graphite for nuclear use as a structural material in a VHTR environment.

  6. Comparison between the Strength Levels of Baseline Nuclear-Grade Graphite and Graphite Irradiated in AGC-2

    International Nuclear Information System (INIS)

    This report details the initial comparison of mechanical strength properties between the cylindrical nuclear-grade graphite specimens irradiated in the second Advanced Graphite Creep (AGC-2) experiment with the established baseline, or unirradiated, mechanical properties compiled in the Baseline Graphite Characterization program. The overall comparative analysis will describe the development of an appropriate test protocol for irradiated specimens, the execution of the mechanical tests on the AGC-2 sample population, and will further discuss the data in terms of developing an accurate irradiated property distribution in the limited amount of irradiated data by leveraging the considerably larger property datasets being captured in the Baseline Graphite Characterization program. Integrating information on the inherent variability in nuclear-grade graphite with more complete datasets is one of the goals of the VHTR Graphite Materials program. Between 'sister' specimens, or specimens with the same geometry machined from the same sub-block of graphite from which the irradiated AGC specimens were extracted, and the Baseline datasets, a comprehensive body of data will exist that can provide both a direct and indirect indication of the full irradiated property distributions that can be expected of irradiated nuclear-grade graphite while in service in a VHTR system. While the most critical data will remain the actual irradiated property measurements, expansion of this data into accurate distributions based on the inherent variability in graphite properties will be a crucial step in qualifying graphite for nuclear use as a structural material in a VHTR environment.

  7. Polymer Assisted Core-shell Ag-C nanoparticles Synthesis via Green hydrothermal Technique

    Science.gov (United States)

    Williams, James; Mishra, Sanjay

    2009-03-01

    Core-Shell Ag-C nanoparticles were synthesized in the presence of glucose through a one-pot green hydrothermal wet chemical process. An aqueous solution of glucose and Ag nitrate was hydrothermally treated to produce porous carbonaceous shell over silver core nanoparticles. The growth of carbon shells was regulated by either of the polymers (poly) vinyl pyrrolidone (PVP) or poly vinyl alcohol (PVA). The two polymers were compared to take a measure of different tunable sizes of cores, and shells. The effects of hydrothermal temperature, time, and concentration of reagents on the final formation of nanostructures were studied using UV-vis extinction spectra, transmission electron microscope, and Raman spectroscopy. The polymer molecules were found to be incorporated into carbonaceous shell. The resulting opacity of the shell was found to be hydrothermal time and temperature dependent. The shell structure was found to be more uniform with PVP than PVA. Furthermore, the polymer concentration was found to influence size and shape of the core-silver particles as well. The core-shelled nanoparticles have surfaces with organic groups capable of assembling with different reagents that could be useful in drug-delivery, optical nanodevices or biochemistry.

  8. Transient response and stability of the AGC-PI closed-loop controlled MEMS vibratory gyroscopes

    International Nuclear Information System (INIS)

    This paper presents a detailed study on the transient response and stability of the automatic gain control (AGC) with a proportion-integral (PI) controller for a MEMS vibratory gyroscope, which constructs a closed-loop control system to make the gyroscope achieve a constant amplitude vibration at its resonant frequency. The nonlinear mathematical model for the control system is established by applying the averaging and linearization method, which is evaluated through numerical simulations. The stability and convergence characteristics of the whole loop are investigated by using the phase plane method and Routh–Hurwitz criterion. The analysis provides a quantitative methodology for selecting the system parameters to approach stability and an optimal transient response. The negative impact induced by drift of the resonant frequency and Q-factor is also discussed. Simulation results predicted by the model are shown to be in close agreement with the experimental results carried out on a doubly decoupled bulk micromachined gyroscope. By optimizing the control parameters, the measured rising time is less than 100 ms without obvious overshoot. The setting time of the whole loop is less than 200 ms with the relative fluctuation of velocity amplitude within approximately 16 ppm for an hour. The resulting overall performance of the gyroscope is tested under atmospheric pressure. The resonant frequencies and the Q-factor of the drive mode and sense mode are 2.986 kHz, 213 and 3.199 kHz, 233, respectively. The gyroscope achieves a scale factor of 27.6 mV/deg/s with nonlinearity less than 120 ppm in the full-scale range of 800° s−1. The threshold of sensitivity is measured to be about 0.005° s−1 with noise equivalent angular rate evaluated to be 0.001°/s/Hz1/2

  9. Transient response and stability of the AGC-PI closed-loop controlled MEMS vibratory gyroscopes

    Science.gov (United States)

    Cui, J.; Chi, X. Z.; Ding, H. T.; Lin, L. T.; Yang, Z. C.; Yan, G. Z.

    2009-12-01

    This paper presents a detailed study on the transient response and stability of the automatic gain control (AGC) with a proportion-integral (PI) controller for a MEMS vibratory gyroscope, which constructs a closed-loop control system to make the gyroscope achieve a constant amplitude vibration at its resonant frequency. The nonlinear mathematical model for the control system is established by applying the averaging and linearization method, which is evaluated through numerical simulations. The stability and convergence characteristics of the whole loop are investigated by using the phase plane method and Routh-Hurwitz criterion. The analysis provides a quantitative methodology for selecting the system parameters to approach stability and an optimal transient response. The negative impact induced by drift of the resonant frequency and Q-factor is also discussed. Simulation results predicted by the model are shown to be in close agreement with the experimental results carried out on a doubly decoupled bulk micromachined gyroscope. By optimizing the control parameters, the measured rising time is less than 100 ms without obvious overshoot. The setting time of the whole loop is less than 200 ms with the relative fluctuation of velocity amplitude within approximately 16 ppm for an hour. The resulting overall performance of the gyroscope is tested under atmospheric pressure. The resonant frequencies and the Q-factor of the drive mode and sense mode are 2.986 kHz, 213 and 3.199 kHz, 233, respectively. The gyroscope achieves a scale factor of 27.6 mV/deg/s with nonlinearity less than 120 ppm in the full-scale range of 800° s-1. The threshold of sensitivity is measured to be about 0.005° s-1 with noise equivalent angular rate evaluated to be 0.001°/s/Hz1/2.

  10. ArF excimer laser-induced deposition of Ag/C nanocomposite thin films in the presence of n-Hexane

    International Nuclear Information System (INIS)

    Highlights: • A new excimer laser ablation process was proposed to fabricate Ag/C thin film. • The size of Ag nanoparticles is ranging from 5 to 20 nm. • The ratios of Ag to C can be controlled by adjusting the pressure of n-Hexane. • The graphite-like structure of carbonaceous products was confirmed. - Abstract: Ag/C nanocomposite thin films with different Ag/C molar ratios have been prepared using ArF excimer laser-induced ablation process and silver target under n-Hexane atmosphere. The morphology, crystal structure and composition of as-deposited Ag/C nanocomposite thin films were investigated with high resolution electronic microscopic techniques (including scanning electron microscopy and transmission electron microscopy) and energy-dispersive X-ray spectroscopy, respectively. Laser Raman spectroscopy and Fourier transform infrared spectroscopy techniques were also applied to characterize the final carbonaceous products generated from n-Hexane under laser ablation process. The optical emission of the plume caused by the interaction between excimer laser and silver target in the presence of n-Hexane was studied to understand the possible reaction process. The UV–vis absorption of as-deposited Ag/C thin films, which is attributed to the surface plasmonic excitation, was also investigated in the present work

  11. Flexible Ag-C60 nano-biosensors based on surface plasmon coupled emission for clinical and forensic applications.

    Science.gov (United States)

    Mulpur, Pradyumna; Yadavilli, Sairam; Mulpur, Praharsha; Kondiparthi, Neeharika; Sengupta, Bishwambhar; Rao, Apparao M; Podila, Ramakrishna; Kamisetti, Venkataramaniah

    2015-10-14

    The relatively low sensitivity of fluorescence detection schemes, which are mainly limited by the isotropic nature of fluorophore emission, can be overcome by utilizing surface plasmon coupled emission (SPCE). In this study, we demonstrate directional emission from fluorophores on flexible Ag-C60 SPCE sensor platforms for point-of-care sensing, in healthcare and forensic sensing scenarios, with at least 10 times higher sensitivity than traditional fluorescence sensing schemes. Adopting the highly sensitive Ag-C60 SPCE platform based on glass and novel low-cost flexible substrates, we report the unambiguous detection of acid-fast Mycobacterium tuberculosis (Mtb) bacteria at densities as low as 20 Mtb mm(-2); from non-acid-fast bacteria (e.g., E. coli and S. aureus), and the specific on-site detection of acid-fast sperm cells in human semen samples. In combination with the directional emission and high-sensitivity of SPCE platforms, we also demonstrate the utility of smartphones that can replace expensive and cumbersome detectors to enable rapid hand-held detection of analytes in resource-limited settings; a much needed critical advance to biosensors, for developing countries. PMID:26345678

  12. La liberalización educativa en el marco del AGCS/GATS: Analizando el estado actual de las negociaciones. Educational liberalization under the AGCS/GATS: Analyzing the current state of negotiations

    Directory of Open Access Journals (Sweden)

    Antoni Verger

    2006-03-01

    Full Text Available En este artículo se analizan los factores que inciden en la liberalización comercial del sector de servicios educativos en el marco del Acuerdo General de Comercio Servicios (AGCS. Para ello se examina con detalle la metodología de la negociación del Acuerdo y se revisan los compromisos consolidados por los países miembros de la OMC en materia de servicios educativos. También se analizan los resultados provisionales de la vigente ronda de servicios (GATS2000 la cual se encuentra todavía en proceso de negociación. Las fuentes de datos primarias a partir de las cuales se interpretan los resultados de las negociaciones del AGCS consisten en entrevistas a diferentes delegaciones de los países miembros de la OMC, documentos de posición de algunas delegaciones y documentos de análisis del Consejo de Comercio de Servicios de la OMC The aim of this article is to analyze the factors that influence the commercial liberalization of educational services in the General Agreement of Trade in Services (GATS framework. First at all, we examine closely the negotiation methodology of the Agreement, as well as we check the commitments of the WTO members in the educational sector. On the other hand we analyze the provisional results of the last round of services (GATS2000 which is still being negotiated. The primary data sources are interviews to different delegations of the countries members of the WTO, documents of position of some delegations and documents of analysis of the “Council of Trade in Services” of the WTO.

  13. A novel quasi-oppositional harmony search algorithm for AGC optimization of three-area multi-unit power system after deregulation

    Directory of Open Access Journals (Sweden)

    Chandan Kumar Shiva

    2016-03-01

    Full Text Available The present work addresses a decentralized, well tested three-area multi-unit power system for its automatic generation control (AGC after deregulation which is characterized by price-based market operation. To match with the actual deregulated environment, as prevailing in the real one, the market structure is kept generic enough enabling to capture all possibilities occurring in real-time day-to-day power environment. In accordance to the modifications, as done in the investigated three-area power system model, the concerned objective is to intensify the deregulated AGC operation followed by load disturbances. At the present platform, three different classes of case study results are postulated for the studied test system. The first two illustrate the behavior of unilateral and bilateral based power contract transactions while the third one considers the contract violation case as it exists in present time. The contractual agreement, instituted by DISCO participation matrix, is initialized to address the power transaction contracts. In this work, a novel quasi-oppositional harmony search (QOHS algorithm is explored and presented its significances in deregulated AGC operation. In the second phase of investigation, fast acting Sugeno fuzzy logic technique is explored for on-line, off-nominal operating conditions. For analysis purpose, both the qualitative and the quantitative aspects of the proposed QOHS are presented in reference to genetic algorithm (GA. Additionally, the sensitivity analysis is also performed to evaluate the performance of the proposed QOHS based controller. Simulation work reveals that the proposed QOHS may be, effectively, worked out to order to improve the deregulated AGC performance. It is also being observed that the proposed QOHS outperforms the GA in sense of deregulated AGC operation of power system.

  14. AGC kinases regulate phosphorylation and activation of eukaryotic translation initiation factor 4B

    NARCIS (Netherlands)

    van Gorp, A. G. M.; van der Vos, K. E.; Brenkman, A. B.; Bremer, A.; van den Broek, N.; Zwartkruis, F.; Hershey, J. W.; Burgering, B. M. T.; Calkhoven, C. F.; Coffer, P. J.

    2009-01-01

    Eukaryotic translation initiation factor 4B (eIF4B) plays a critical role during the initiation of protein synthesis and its activity can be regulated by multiple phosphorylation events. In a search for novel protein kinase B (PKB/c-akt) substrates, we identified eIF4B as a potential target. Using a

  15. Asymptomatic type B right atrial thrombus in a case with protein S deficiency

    Directory of Open Access Journals (Sweden)

    Rajinder Singh Rawat

    2014-01-01

    Full Text Available Thirty seven year old asymptomatic male underwent routine medical examination which revealed an abnormal mass in the right atrium. Family history was not suggestive of any cardiac or malignant disease. Detailed investigation detected deficiency of protein S, which is a vitamin K dependent protein and a cofactor for activated protein C mediated cleavage of factor Va and VIIIa. The deficiency of protein S predisposes to venous thrombosis. Further investigation revealed that it was an organized calcified thrombus in right atrium occupying almost whole of the cavity. Various approaches including surgical excision, thrombolysis and anticoagulation has been used to manage such thrombosis. However therapeutic approach is still a question of debate. Atriotomy and excision of mass was done using cardiopulmonary bypass.

  16. The AGC computer control system of a plate rolling mill%首钢中厚板轧机AGC计算机控制系统

    Institute of Scientific and Technical Information of China (English)

    张殿华; 王君; 李建平; 张其生; 赵胜国; 刘仁辅

    2001-01-01

    介绍了首钢中厚板轧钢厂3340mm中厚板轧机液压AGC系统工艺参数和计算机系统的硬件配置和传感器配置,给出了轧机弹跳模型和液压缸HCC的控制原理和液压缸的系统频率响应特性,描述了本系统所采用的头部锁定AGC和绝对AGC的控制策略,并对支撑辊偏心补偿、油膜厚度补偿等厚度控制补偿方法进行了说明。%Based on the hydraulic AGC modernization project of the Capital Iron and Steel Company 3340mm plate mill, this paper presents the computers system and sensors configuration. The mill stiff model and mill hydraulic cylinder control (HCC) principle and its frequency response performance are given. The lockup AGC and absolute AGC are discussed. At end of this paper, the backup rolls eccentric compensation and oil film compensation and other compensations are presented.

  17. Regulation of the interaction between protein kinase C-related protein kinase 2 (PRK2) and its upstream kinase, 3-phosphoinositide-dependent protein kinase 1 (PDK1)

    DEFF Research Database (Denmark)

    Dettori, Rosalia; Sonzogni, Silvina; Meyer, Lucas;

    2009-01-01

    The members of the AGC kinase family frequently exhibit three conserved phosphorylation sites: the activation loop, the hydrophobic motif (HM), and the zipper (Z)/turn-motif (TM) phosphorylation site. 3-Phosphoinositide-dependent protein kinase 1 (PDK1) phosphorylates the activation loop of...... numerous AGC kinases, including the protein kinase C-related protein kinases (PRKs). Here we studied the docking interaction between PDK1 and PRK2 and analyzed the mechanisms that regulate this interaction. In vivo labeling of recombinant PRK2 by (32)P(i) revealed phosphorylation at two sites, the...... the mechanism that negatively regulates the docking interaction of PRK2 to the upstream kinase PDK1 is directly linked to the activation mechanism of PRK2 itself. Finally, our results indicate that the mechanisms underlying the regulation of the interaction between PRK2 and PDK1 are specific for PRK2...

  18. One-dimensional Chain Topology in [Ag(C6H6NCl)2](ClO4),Generated through Weak Interaction between Molecules

    Institute of Scientific and Technical Information of China (English)

    孙道峰; 曹荣; 梁玉仓; 洪茂椿; 苏伟平

    2001-01-01

    The mononuclear complex [Ag(C6H6NC1)2](C1O4) has been prepared and structurally analyzed by single-crystal X-ray diffraction. The complex crystallizes in the monoclinic system, space group C2/c with unit cell parameters: a=15.5314(2), b=8.0247(8),c=15.3701 (2)A. β =118.832(2)°, V=1678.2(3)A3, Z=4, Mr=462.46, Dc=1.830Mg/m3, F(000)=912,μt (MoKa) = 1.694cm-1. The final R and wR are 0.0472 and 0.1272 for 1484 observed reflections with I≥3σ (Ⅰ). The Ag atom is coordinated by two nitrogen atoms of 4-chloromethyl-pyridine in a linear coordination geometry. Each molecule is further linked by the weak interaction between the C1 and Ag atoms to form a one-dimensional chain structure with Ag-C1 distance of 3.240(A).

  19. Negative staining and immunoelectron microscopy of adhesion-deficient mutants of Streptococcus salivarius reveal that the adhesive protein antigens are separate classes of cell surface fibril.

    Science.gov (United States)

    Weerkamp, A H; Handley, P S; Baars, A; Slot, J W

    1986-01-01

    The subcellular distribution of the cell wall-associated protein antigens of Streptococcus salivarius HB, which are involved in specific adhesive properties of the cells, was studied. Mutants which had lost the adhesive properties and lacked the antigens at the cell surface were compared with the parent strain. Immunoelectron microscopy of cryosections of cells labeled with affinity-purified, specific antisera and colloidal gold-protein A complexes was used to locate the antigens. Antigen C (AgC), a glycoprotein involved in attachment to host surfaces, was mainly located in the fibrillar layer outside the cell wall. A smaller amount of label was also found throughout the cytoplasmic area in the form of small clusters of gold particles, which suggests a macromolecular association. Mutant HB-7, which lacks the wall-associated AgC, accumulated AgC reactivity intracellularly. Intracellular AgC was often found associated with isolated areas of increased electron density, but sometimes seemed to fill the entire interior of the cell. Antigen B (AgB), a protein responsible for interbacterial coaggregation, was also located in the fibrillar layer, although its distribution differed from that of the wall-associated AgC since AgB was found predominantly in the peripheral areas. A very small amount of label was also found in the cytoplasmic area as discrete gold particles. Mutant HB-V5, which lacks wall-associated AgB, was not labeled in the fibrillar coat, but showed the same weak intracellular label as the parent strain. Immunolabeling with serum against AgD, another wall-associated protein but of unknown function, demonstrated its presence in the fibrillar layer of strain HB. Negatively stained preparations of whole cells of wild-type S. salivarius and mutants that had lost wall-associated AgB or AgC revealed that two classes of short fibrils are carried on the cell surface at the same time. AgB and AgC are probably located on separate classes of short, protease

  20. Allosteric regulation of protein kinase PKCζ by the N-terminal C1 domain and small compounds to the PIF-pocket

    DEFF Research Database (Denmark)

    Lopez-Garcia, Laura A; Schulze, Jörg O; Fröhner, Wolfgang;

    2011-01-01

    Protein kinases are key mediators of cellular signaling, and therefore, their activities are tightly controlled. AGC kinases are regulated by phosphorylation and by N- and C-terminal regions. Here, we studied the molecular mechanism of inhibition of atypical PKCζ and found that the inhibition by ...

  1. Synthesis of single-crystal α-MnO2 nanotubes-loaded Ag@C core-shell matrix and their application for electrochemical sensing of nonenzymatic hydrogen peroxide.

    Science.gov (United States)

    Zhang, Sai; Zheng, Jianbin

    2016-10-01

    A nonenzymatic hydrogen peroxide sensor was fabricated by combing the crystal α-MnO2 nanotubes and Ag@C core-shell matrix with their own superior characteristics. The morphology, size and electrochemical of the sensing interface materials and the relationship between the electrical catalytic properties and sensor response performance were also studied, established a new method for the detection of hydrogen peroxide (H2O2). The structure and morphology of hollow tubular-like MnO2 and MnO2-Ag@C film were characterized by scanning electron micrograph (SEM), transmission electron microscopy (TEM) and X-ray diffraction. The electrochemical properties of the sensor were explored by cyclic voltammetry and amperometry. The investigation showed that the MnO2-Ag@C at the sensor exhibited a high electrocatalytic activity towards electroreduction of hydrogen peroxide; and under the optimal conditions, the linear ranges of hydrogen peroxide were 0.5μM to 5.7mM with a low detection limit of 0.17μM (S/N=3) and high sensitivity of 127.2μAmM(-1)cm(-2). Compared with other nonenzymatic hydrogen peroxide sensor, the fabricated sensor own lower detection limit, demonstrating that MnO2-Ag@C nanocomposite film will be a new promising platform for the construction of hydrogen peroxide sensors. PMID:27474303

  2. 一种带AGC功能的RGC输入前置放大器设计%Design of a RGC input pre-amplifier with AGC

    Institute of Scientific and Technical Information of China (English)

    后永奇; 杨建红

    2013-01-01

    This paper designs an RGC input pre-amplifier with AGC function of optical receiver based on 0.18 μm CMOS technology.The structure of circuits is the voltage parallel negative feedback.Its input stage is an RGC structure to expand bandwidth,which solves contradiction between wide bandwidth and high trans-impedance.The output stage is a single-to-differential structure.And in order to solve the contradiction between the dynamic range and high trans-impedance or low noise,the AGC circuit is used.Finally,the SIMC 0.18 μm technology library is selected to simulate.The results show that this circuit structure has good frequency characteristics and the equivalent current input curve,when input optical power of optical receiver is-10 dBm,the power supply voltage is 1.8 V,and the parasitic capacitance CD of the optical detector is 0.5 pF.%基于标准CMOS 0.18 μm工艺,设计了一种带AGC功能的光接收机RGC输入前置放大器.该放大器采用电压并联负反馈结构;输入级采用RGC结构以拓展带宽,从而解决了宽带宽与高跨阻之间的矛盾;输出级接入单端转差分结构,使输出的信号能直接输入到后续的主放大器中;嵌入自动增益控制技术AGC,以解决输入动态范围与高跨阻、低噪声之间的矛盾.同时,选用SIMC0.18 μm工艺库进行了模拟仿真.结果显示,当光接收机输入光功率为-10 dBm、电源电压为1.8V、光检测器的寄生电容为0.5 pF时,此放大器具有良好的等效电流输入曲线和幅频特性.

  3. Dissociation of activated protein C functions by elimination of protein S cofactor enhancement.

    LENUS (Irish Health Repository)

    Harmon, Shona

    2008-11-07

    Activated protein C (APC) plays a critical anticoagulant role in vivo by inactivating procoagulant factor Va and factor VIIIa and thus down-regulating thrombin generation. In addition, APC bound to the endothelial cell protein C receptor can initiate protease-activated receptor-1 (PAR-1)-mediated cytoprotective signaling. Protein S constitutes a critical cofactor for the anticoagulant function of APC but is not known to be involved in regulating APC-mediated protective PAR-1 signaling. In this study we utilized a site-directed mutagenesis strategy to characterize a putative protein S binding region within the APC Gla domain. Three single amino acid substitutions within the APC Gla domain (D35T, D36A, and A39V) were found to mildly impair protein S-dependent anticoagulant activity (<2-fold) but retained entirely normal cytoprotective activity. However, a single amino acid substitution (L38D) ablated the ability of protein S to function as a cofactor for this APC variant. Consequently, in assays of protein S-dependent factor Va proteolysis using purified proteins or in the plasma milieu, APC-L38D variant exhibited minimal residual anticoagulant activity compared with wild type APC. Despite the location of Leu-38 in the Gla domain, APC-L38D interacted normally with endothelial cell protein C receptor and retained its ability to trigger PAR-1 mediated cytoprotective signaling in a manner indistinguishable from that of wild type APC. Consequently, elimination of protein S cofactor enhancement of APC anticoagulant function represents a novel and effective strategy by which to separate the anticoagulant and cytoprotective functions of APC for potential therapeutic gain.

  4. L'AGCS i la Política de l'Educació: Anàlisi dels Factors de Liberalització en l'Educació Superior

    OpenAIRE

    Verger, Antoni

    2007-01-01

    Consultable des del TDX Títol obtingut de la portada digitalitzada L'Acord General de Comerç de Serveis (AGCS) introdueix complexitat en l'escenari de governança global de l'educació. Des de que aquest acord fou creat en el marc de l'Organització Mundial del Comerç (OMC) a l'any 1995, una sèrie d'actors i lògiques no-convencionals en el món de l'educació es troben involucrades en activitats de regulació educativa. El sistema de regles de l'AGCS pressiona per una liberalització comercial...

  5. Systém vzdělávání pracovníků ve společnosti AGC Flat Glass Czech, a.s.

    OpenAIRE

    Křivanová, Jana

    2011-01-01

    The thesis deals with the workers' education of the company AGC Flat Glass Czech a.s. The first part describes the theoretical aspects of education and development of the employees in the firm -- the process of education, educational methods, trends in human resource development, efficiency and costs of training, the plans of succession. Further it characterizes the current state of education and development of the individuals from the perspective of the Czech Republic, and compares the resul...

  6. The Application and Improvement of AGC on Jingtang 1580 Production Line%AGC在京唐1580生产线的应用及改进

    Institute of Scientific and Technical Information of China (English)

    王志明; 王亚敏

    2014-01-01

    Based on the analysis of the cause for roll eccentricity in rolling process and its influence to the strip thickness, this thesis discusses the roll eccentricity compensation method, and then deduces the primary outcome and analyzes its mechanism. The research outcome is applied to Jingtang 1580 production line actual automatic strip thickness control system (AGC), and through practice, this kind of control method is proved to have better accuracy.%分析了轧制过程中轧辊偏心产生的原因以及对带钢厚度的影响,增加了轧辊偏心补偿的方法,然后推导了主要结果并分析了其机理,并应用于京唐1580生产线实际的带钢厚度自动控制系统(AGC),通过实践,此种形式控制方式具有较好的精确性。

  7. Structure of Human G Protein-Coupled Receptor Kinase 2 in Complex with the Kinase Inhibitor Balanol

    Energy Technology Data Exchange (ETDEWEB)

    Tesmer, John J.G.; Tesmer, Valerie M.; Lodowski, David T.; Steinhagen, Henning; Huber, Jochen (Sanofi); (Michigan); (Texas)

    2010-07-19

    G protein-coupled receptor kinase 2 (GRK2) is a pharmaceutical target for the treatment of cardiovascular diseases such as congestive heart failure, myocardial infarction, and hypertension. To better understand how nanomolar inhibition and selectivity for GRK2 might be achieved, we have determined crystal structures of human GRK2 in complex with G{beta}{gamma} in the presence and absence of the AGC kinase inhibitor balanol. The selectivity of balanol among human GRKs is assessed.

  8. Research of improved immune algorithm for economic AGC unit dispatch%AGC机组调配经济性的改进免疫算法研究

    Institute of Scientific and Technical Information of China (English)

    王建国; 丛聪; 韩娜; 吴林峰

    2013-01-01

    对于电力市场的买卖双方,成交电量及价格直接关系到厂网的经济效益。采用考虑机组调节容量和调节速度约束条件的机组数学模型,提出了一种解决电力系统AGC(自动发电控制)机组调配问题的改进免疫算法。采用启发式方法产生初始解,对参调机组与参调容量进行双层优化,使优化调度问题的收敛速度和效率有了显著的提高。通过实际系统的算例分析以及与常用算法的效果比较,验证了本算法在优化机组调配经济性方面应用的优越性及有效性。%For buyers and sellers in the electricity market, the economic benefits are directly related to the turnover and price. This paper uses the unit mathematical model which considers regulating capacity and regulating speed as the constraints to propose an improved double layer immune algorithm to solve the problem of dispatch for the AGC (automatic generation control) units. Heuristic strategy is adopted to generate initial solution to optimize the dispatching units and the capacity, which speeds up the convergence and improves the efficiency. An example analysis of an actual system and a comparison with the common algorithm show that this algorithm is a new effective optimization algorithm for solving units dispatch problem. This work is supported by National Natural Science Foundation of China (No. 51176028).

  9. Firefly algorithm optimized fuzzy PID controller for AGC of multi-area multi-source power systems with UPFC and SMES

    Directory of Open Access Journals (Sweden)

    Pratap Chandra Pradhan

    2016-03-01

    Full Text Available In this paper, a Firefly Algorithm (FA optimized fuzzy PID controller is proposed for Automatic Generation Control (AGC of multi-area multi-source power system. Initially, a two area six units power system is used and the gains of the fuzzy PID controller are optimized employing FA optimization technique using an ITAE criterion. The superiority of the proposed FA optimized fuzzy PID controller has been demonstrated by comparing the results with some recently published approaches such as optimal control and Differential Evolution (DE optimized PID controller for the identical interconnected power system. Then, physical constraints such as Time Delay (TD, reheat turbine and Generation Rate Constraint (GRC are included in the system model and the superiority of FA is demonstrated by comparing the results over DE, Gravitational Search Algorithm (GSA and Genetic Algorithm (GA optimization techniques for the same interconnected power system. Additionally, a Unified Power Flow Controller (UPFC is placed in the tie-line and Superconducting Magnetic Energy Storage (SMES units are considered in both areas. Simulation results show that the system performances are improved significantly with the proposed UPFC and SMES units. Sensitivity analysis of the system is performed by varying the system parameters and operating load conditions from their nominal values. It is observed that the optimum gains of the proposed controller need not be reset even if the system is subjected to wide variation in loading condition and system parameters. Finally, the effectiveness of the proposed controller design is verified by considering different types of load patterns.

  10. The gene encoding vitamin K-dependent anticoagulant protein S is expressed in multiple rabbit organs as demonstrated by northern blotting, in situ hybridization, and immunohistochemistry.

    Science.gov (United States)

    He, X; Shen, L; Bjartell, A; Dahlbäck, B

    1995-01-01

    Vitamin K-dependent protein S is an anticoagulant plasma protein that functions as a co-factor to activated protein C in the degradation of coagulation factors Va and VIIIa. We investigated the tissue/cellular distribution of protein S synthesis by Northern blotting, in situ hybridization, and immunohistochemistry. Northern blotting together with in situ hybridization, using specific oligodeoxynucleotide probes, demonstrated protein S mRNA in liver, lung, testis, epididymis, ovary, uterus, and brain. In the reproductive system, protein S mRNA was present in the cytoplasm of Leydig cells, interstitial cells of the ovary, epithelial cells of the epididymis, and in the endometrium, including endometrial mucous glandular membrane in the myometrium. Bronchial epithelial cells and alveolar macrophages were positive in the respiratory system. In the central nervous system, pyramidal neurons in the cerebral cortex and in the hippocampal region, and dentate fascia neurons gave strongly positive signals. Immunohistochemistry with monoclonal antibodies yielded a staining pattern that correlated well with results of in situ hybridization. In conclusion, results from Northern blotting, in situ hybridization, and immunohistochemistry suggested that rabbit protein S is expressed in several extrahepatic tissues. The presence of protein S transcripts in these fully differentiated cells suggests a cell type-specific gene expression which may be related to local anticoagulation or to other as yet unknown protein S functions. PMID:7822769

  11. Characterization of the protein C activator Protac from the venom of the southern copperhead (Agkistrodon contortrix) snake.

    Science.gov (United States)

    Stocker, K; Fischer, H; Meier, J; Brogli, M; Svendsen, L

    1987-01-01

    A single chain glycopeptide with a molecular weight of approximately 37,000, an isoelectric point of 3.0 +/- 0.2 and a carbohydrate content of approximately 20% was isolated from the venom of the southern copperhead Agkistrodon contortrix contortrix. It was capable of converting zymogen protein C in plasma of man and various vertebrates into its activated form, a serine proteinase which exerts an anticoagulant effect. Conversion of the zymogen protein C into the active proteinase was demonstrated by measuring the prolongation of the activated partial thromboplastin time due to proteolytic degradation of factors Va and VIIIa by the activation product, as well as by direct measurement of the generated enzyme activity by means of a synthetic chromogenic substrate. Intravenous injection of the venom protein C activator into rabbits caused prolonged activated partial thromboplastin time. Repeated subcutaneous injections led to formation of an antibody which formed, with purified protein C activator as well as with crude A. contortrix venom, a precipitating complex devoid of protein C activator potency. As revealed by activity measurements and by immunodiffusion experiments, the venoms of various A. contortrix, A. bilineatus subspecies contain similar protein C activators. PMID:3590209

  12. Oil Film Compensation Control of Hydraulic AGC System in Tandem Cold Rolling Mill%冷连轧机液压AGC系统油膜补偿控制

    Institute of Scientific and Technical Information of China (English)

    孙孟辉; 王益群

    2011-01-01

    Since the request to the quality of cold rolling sheet strips is higher, the hydraulic AGC ( Automatic Gauge Control) has become the indispensable means which improves the product precision of cold rolling strips. However, to the tandem cold rolling mill which backup roll adopts the oil film bearing, the thickness of oil film changes with different rolling force and rolling velocity, which influences the exit thickness of strips and brings the thickness deviation. Especially for the tandem cold rolling mill, the accumulative deviation of every stand enlarges more the deviation of steel product. The oil film compensation model, which adapted to the practical control, was regressed from the data measured from production locale, aiming at one 5-stand tandem cold rolling mill as object. The control strategy was brought forward, which adapted to the distributed computer control. All of them were applied in the practical rolling process for compensation of changes in thickness of oil film. The experimental result indicates that length of out-toler-ance and value of out-tolerance between head and tail of steel product are reduced notably.%由于对冷轧薄板质量要求的提高,液压AGC已经成为提高冷轧带钢成品精度必不可少的手段.然而对于支撑辊采用油膜轴承的冷连轧机来说,其轴承油膜厚度随着轧制力和轧制速度的变化而变化,这将影响轧件的轧出厚度,造成厚差.尤其对冷连轧机,各机架的累积误差会使成品带的超差更加严重.以某五机架冷连轧机为研究对象,由生产现场实测数据回归出适合于实际控制的油膜补偿模型,提出适合于分布式计算机控制的控制策略,并将其应用于实际轧制过程中对油膜厚度变化进行补偿.实验结果表明:加入油膜补偿控制后,成品带钢厚差带头带尾超差段有较为显著的减少,且超差值也有所降低.

  13. 先进AGC及汽温控制系统在1000 MW超超临界机组的应用%The Application of Advanced AGC and Steam Temperature Control System in 1 000 MW Ultra Supercritical Units

    Institute of Scientific and Technical Information of China (English)

    郑卫东; 柳卫荣; 李晓燕; 李捍华

    2013-01-01

    This paper introduces the application and commissioning of Advanced AGC and Steam Temperature Control System of 1 000 MW Ultra Supercritical Units project in Huaneng Yuhuan Power Plant and analyzes the existing problems in using traditional PID control system in domestic thermal power plants and the appli-cation prospect of the advantage control system. The paper puts forward a scheme for AGC and temperature optimization control in large generating units , which handles the instability of steam temperature of thermal power plant and load-varying operating condition.%介绍了“1000 MW超超临界机组先进AGC及汽温控制系统”项目在华能玉环发电厂的应用及调试情况,分析了传统PID控制系统在国内火电厂运用存在的问题和先进控制系统的运用前景。提出了大型机组AGC及汽温优化控制的方案,解决了火电厂汽温、变负荷工况参数不稳的问题。

  14. Research of wind power and water power complementary power generation system based on AGC%基于AGC的风力、水力互补发电系统的研究

    Institute of Scientific and Technical Information of China (English)

    郭明文

    2015-01-01

    随着我国居民人口数增加,用电量增加,随之而来的就是电网规模的扩张,传统的电网已经无法满足高用电量的需求,因此需要引进更加智能的发电系统,自动发电控制(AGC)应运而生,并且在现阶段开发的电网中起着越来越重要的作用.具有这种功能的系统使得发电机以最经济的方式运行,从而保证了电力系统稳定.%With theincrease of population and the increase of electricity consumption,which is the expansion of the scale of power network,the traditional power grid has been unable to meet the demand of high power consumption.Therefore,the introduction of a more intelligent power generation system,automatic generation control (AGC)came into being,and plays a more and more important role in the development of the network at this stage.With this function,the system is running in the most economical way to ensure the stability of the power system.

  15. 一种应用于 AGC的可编程 CMOS指数函数发生器%A Programmable Generator of CMOS Exponential Function for AGC Applications

    Institute of Scientific and Technical Information of China (English)

    吴明权; 李志军

    2015-01-01

    在无线接收机中,要达到在不同的信号功率下,AGC环路都具有相同的瞬态响应和确切的环路建立时间, VGA的增益需要按照指数规律变化.因此基于差分跨导电路、平方电路及乘法器提出了一种应用于AGC的可编程CMOS指数函数发生器.该函数发生器采用了四阶泰勒近似方法,通过控制外部偏置电压可以精确逼近不同指数函数.采用 TSMC 0.5μm CMOS集成工艺对电路进行 PSPICE仿真测试,结果表明,输入范围-1.54≤ x≤3.15,输出动态范围达到40 dB ,误差在±0.5 dB之内,且可以实现不同指数函数的编程,非常适合应用于高性能AGC系统的实现.%In the wireless receiver ,in order to ensure that AGC loop has the same transient response and the exact settling time ,when signal power are different ,the VGA gain is realized according to the exponential changes . Therefore ,a programmable CMOS exponential function generator for AGC applications are presented ,which is based on the differential transconductor circuit ,square circuit and multiplier .The method of the fourth‐order Taylor approximation is adopted in the function generator , and the different exponent function can be approximated accurately by the controlled external offset voltage .The proposed circuit is simulated and analyzed by PSPICE with TSMC 0 .5μm CMOS technology parameters ,the results show that a nearly 40 dB output dynamic range is obtained with the error less than ± 0 .5 dB over an input range-1 .54≤ x≤3 .15 ,and the different exponent function can be implemented and programmed , which are very suitable for application to the high performance AGC system implementation .

  16. 3-Phosphoinositide-dependent protein kinase-1 as an emerging target in the management of breast cancer

    International Nuclear Information System (INIS)

    It should be noted that 3-phosphoinositide-dependent protein kinase-1 (PDK1) is a protein encoded by the PDPK1 gene, which plays a key role in the signaling pathways activated by several growth factors and hormones. PDK1 is a crucial kinase that functions downstream of phosphoinositide 3-kinase activation and activates members of the AGC family of protein kinases, such as protein kinase B (Akt), protein kinase C (PKC), p70 ribosomal protein S6 kinases, and serum glucocorticoid-dependent kinase, by phosphorylating serine/threonine residues in the activation loop. AGC kinases are known to play crucial roles in regulating physiological processes relevant to metabolism, growth, proliferation, and survival. Changes in the expression and activity of PDK1 and several AGC kinases have been linked to human diseases including cancer. Recent data have revealed that the alteration of PDK1 is a critical component of oncogenic phosphoinositide 3-kinase signaling in breast cancer, suggesting that inhibition of PDK1 can inhibit breast cancer progression. Indeed, PDK1 is highly expressed in a majority of human breast cancer cell lines and both PDK1 protein and messenger ribonucleic acid are overexpressed in a majority of human breast cancers. Furthermore, overexpression of PDK1 is sufficient to transform mammary epithelial cells. PDK1 plays an essential role in regulating cell migration, especially in the context of phosphatase and tensin homologue deficiency. More importantly, downregulation of PDK1 levels inhibits migration and experimental metastasis of human breast cancer cells. Thus, targeting PDK1 may be a valuable anticancer strategy that may improve the efficacy of chemotherapeutic strategies in breast cancer patients. In this review, we summarize the evidence that has been reported to support the idea that PDK1 may be a key target in breast cancer management

  17. Research on Computer Control of Process Optimization Level in Hydraulic AGC System of Cold Rolling Mill%冷带轧机液压AGC系统过程优化级计算机控制

    Institute of Scientific and Technical Information of China (English)

    孙孟辉; 王益群

    2015-01-01

    冷带轧机的轧制过程是较为复杂的物理过程,因此液压AGC(Automatic Gauge Control)系统对冷带轧机成品带钢的厚度精度起着重要的作用。针对300可逆冷带轧机,进行了过程优化级计算机控制的研究,开发出了液压AGC系统的过程优化级计算机控制系统。液压AGC系统的过程优化级计算机控制,可以实现轧制规程的计算、过程控制级所需设定值的设定、轧制过程数据的采集以及人机界面的显示等功能。同时,进行了轧制试验。%Rolling process of the cold rolling mill is a complicated physical process, so the hydraulic AGC system is very important to the thickness precision of strips of cold rolling mill. In this paper, the computer control of process optimization level was researched, and the computer control system of process optimization level was developed, aiming at 300 reverse cold rolling mill. By the computer control of process optimization level of the hydraulic AGC, it can realize the calculation of rolling schedule, the set of setting value needed by the process control level, the data acquisition of rolling process and the display of human-computer interface. At the same time, the rolling experiment was carried out, and the experiment result implied that it could eliminate the thickness error of strips effectively, adopting the provided computer control's strategy of the process optimization level.

  18. A Method for AGC Reserve Capacity Analysis Considering Photovoltaic Power Fluctuation Characteristics%考虑光伏发电功率波动性的AGC备用容量分析方法

    Institute of Scientific and Technical Information of China (English)

    陈逍潇; 张粒子; 杨萌; 朱翊

    2015-01-01

    A spectrum analyzing method based on the autoregressive (AR) model is proposed to analyze the fluctuation characteristics of photovoltaic (PV) power.In order to obtain data with sufficient resolution,the PV array output is simulated based on meteorological data from the National Renewable Energy Laboratory (NREL) of America,which is used to analyze the fluctuation characteristics of PV power stations on different time scales and spatial scales,and determining the time scale on which the photovoltaic power fluctuation component is concentrated.Research shows that PV power fluctuations on different time scales are significantly affected by weather.With the expansion of PV power station scale,the whole output of different PV power stations tends to be smooth.In addition,PV power output fluctuation is mainly concentrated on the 5 min time scale.On this basis,the performance of fitting the probability distribution of PV power fluctuation on the critical time scale with t-distribution is verified.The power fluctuation component on the critical time scale is separated by a rolling average method.Finally,the automatic generation control(AGC)reserve demand caused by PV power grid-connection is quantitatively analyzed.%提出了基于自回归模型的频谱分析方法来分析光伏发电功率的波动特性。为获取足够分辨率的数据,以美国可再生能源实验室(NREL)的气象数据模拟仿真光伏阵列的出力,并用于分析不同时间尺度和空间尺度的光伏发电站的波动特性,确定光伏发电波动分量集中的时间尺度。研究表明,不同时间尺度的光伏发电波动量受天气影响显著,且随着光伏电站的规模扩大,不同光伏电站的整体出力也趋于平滑;此外,光伏发电波动主要集中在5 min 的时间尺度。在此基础上,验证了采用t 分布拟合关键时间尺度光伏发电波动量的概率分布效果良好,通过滚动平均法分离关键时间尺度的功率

  19. Functional characterization of the protein C A267T mutation: evidence for impaired secretion due to defective intracellular transport

    Directory of Open Access Journals (Sweden)

    Tjeldhorn Lena

    2010-09-01

    Full Text Available Abstract Background Activated protein C (PC is a serine protease that regulates blood coagulation by inactivating coagulation factors Va and VIIIa. PC deficiency is an autosomally inherited disorder associated with a high risk of recurrent venous thrombosis. The aim of the study was to explore the mechanisms responsible for severe PC deficiency in a patient with the protein C A267T mutation by in-vitro expression studies. Results Huh7 and CHO-K1 cells were transiently transfected with expression vectors containing wild-type (WT PC and mutated PC (A267T PC cDNAs. PC mRNA levels were assessed by qRT-PCR and the PC protein levels were measured by ELISA. The mRNA levels of WT PC and A267T PC were similar, while the intracellular protein level of A267T PC was moderately decreased compared to WT PC. The secretion of A267T PC into the medium was severely impaired. No differences in molecular weights were observed between WT and A267T PC before and after treatment with endo-β-N-acetylglucosaminidase. Proteasomal and lysosomal degradations were examined using lactacystin and bafilomycin, respectively, and revealed that A267T PC was slightly more susceptible for proteasomal degradation than WT PC. Intracellular co-localization analysis indicated that A267T PC was mainly located in the endoplasmic reticulum (ER, whereas WT PC was observed in both ER and Golgi. Conclusions In contrast to what has been reported for other PC mutants, intracellular degradation of A267T PC was not the main/dominant mechanism underlying the reduced intracellular and secretion levels of PC. Our results indicate that the A267T mutation most likely caused misfolding of PC, which might lead to increased retention of the mutated PC in ER.

  20. Investigation of an AGC for Audio Applications

    DEFF Research Database (Denmark)

    Haerizadeh, Seyediman; Jørgensen, Ivan Harald Holger; Marker-Villumsen, Niels;

    2015-01-01

    glitches at the output turning into audible sound effects. In order to find this minimum gain step size both objective and subjective evaluation methods have been used. The investigations show that the objective measures indicate a lower limit for the step size where the sound artefacts are no longer...

  1. Expression of Mismatch Repair Proteins in Early and Advanced Gastric Cancer in Poland.

    Science.gov (United States)

    Karpińska-Kaczmarczyk, Katarzyna; Lewandowska, Magdalena; Ławniczak, Małgorzata; Białek, Andrzej; Urasińska, Elżbieta

    2016-01-01

    BACKGROUND Mutations in DNA of mismatch repair (MMR) genes result in failure to repair errors that occur during DNA replication in microsatellites, resulting in accumulation of frameshift mutations in these genes and leading to DNA mismatch replication errors and microsatellite instability. Gastric cancers (GCs) with high MSI (MSI-H) are a well-defined subset of carcinomas showing distinctive clinicopathological features. In this study we investigated the rate of MSI and the correlation between MSI status and clinicopathological features of GC. MATERIAL AND METHODS The study included 107 patients with GCs: 61 with advanced gastric cancers (AGC) and 46 with early gastric cancer (EGC). MSI deficiency in GCs was assessed by the immunohistochemical analysis of expression of MMR proteins - MLH1, MSH2, MSH6, and PMS2 - using formalin-fixed and paraffin-embedded tissue. RESULTS A total of 6 (5.6%) MSI-H were observed. The loss of MMR proteins expression was associated with the intestinal type of GC in Lauren classification, and tubular and papillary architecture in WHO classification. There was no statistically significant association between negative MMR expression and other selected clinical parameters: age, sex, tumor location, depth of invasion (EGC and AGC), lymph nodes status, presence of the ulceration, and lymphocytic infiltrate. CONCLUSIONS In the present era of personalized medicine, the histological type of GC and MMR proteins status in cancer cells are very important for the proper surveillance of patients with familial GC and sporadic GCs, as well as for selecting the proper follow-up and treatment. Larger collaborative studies are needed to verify the features of MSI-H GCs in Poland. PMID:27527654

  2. Expression of Mismatch Repair Proteins in Early and Advanced Gastric Cancer in Poland

    Science.gov (United States)

    Karpińska-Kaczmarczyk, Katarzyna; Lewandowska, Magdalena; Ławniczak, Małgorzata; Białek, Andrzej; Urasińska, Elżbieta

    2016-01-01

    Background Mutations in DNA of mismatch repair (MMR) genes result in failure to repair errors that occur during DNA replication in microsatellites, resulting in accumulation of frameshift mutations in these genes and leading to DNA mismatch replication errors and microsatellite instability. Gastric cancers (GCs) with high MSI (MSI-H) are a well-defined subset of carcinomas showing distinctive clinicopathological features. In this study we investigated the rate of MSI and the correlation between MSI status and clinicopathological features of GC. Material/Methods The study included 107 patients with GCs: 61 with advanced gastric cancers (AGC) and 46 with early gastric cancer (EGC). MSI deficiency in GCs was assessed by the immunohistochemical analysis of expression of MMR proteins – MLH1, MSH2, MSH6, and PMS2 – using formalin-fixed and paraffin-embedded tissue. Results A total of 6 (5.6%) MSI-H were observed. The loss of MMR proteins expression was associated with the intestinal type of GC in Lauren classification, and tubular and papillary architecture in WHO classification. There was no statistically significant association between negative MMR expression and other selected clinical parameters: age, sex, tumor location, depth of invasion (EGC and AGC), lymph nodes status, presence of the ulceration, and lymphocytic infiltrate. Conclusions In the present era of personalized medicine, the histological type of GC and MMR proteins status in cancer cells are very important for the proper surveillance of patients with familial GC and sporadic GCs, as well as for selecting the proper follow-up and treatment. Larger collaborative studies are needed to verify the features of MSI-H GCs in Poland. PMID:27527654

  3. 3-Phosphoinositide-Dependent protein Kinase-1 (PDK1) inhibitors: A review from patent literature

    Science.gov (United States)

    Barile, Elisa; De, Surya K.; Pellecchia, Maurizio

    2016-01-01

    PDK1 (3-Phosphoinositide-dependent kinase 1) is a key member of the AGC protein kinase family. It plays an important role in a variety of cellular functions, leading to the activation of the PI3K signaling pathway, an event often associated with the onset and progression of several human cancers. Numerous recent observations suggest that PDK1 inhibitors may provide novel opportunities for the development of effective classes of therapeutics. On these premises, recent years have witnessed an increased effort by medicinal chemists to develop novel scaffolds to derive potent and selective PDK1 inhibitors. The intent of this review is to update the reader on the recent patent literature covering applications published between June 2008 and September 2011 that report on PDK1 inhibitors. PMID:24236780

  4. Membrane Interaction of the Factor VIIIa Discoidin Domains in Atomistic Detail

    DEFF Research Database (Denmark)

    Madsen, Jesper Jonasson; Ohkubo, Y. Zenmei; Peters, Günther H.J.; Faber, Johan H.; Tajkhorshid, Emad; Olsen, Ole H.

    2015-01-01

    chain leading the first spike. A tight interaction with one lipid per domain, similar to what has been suggested for the homologous FVa C2, is characterized. Finally, we rationalize known FVIII antibody epitopes and the scarcity of documented hemophilic missense mutations related to improper membrane...

  5. The Value of C-Reactive Protein and Procalcitonin in Febrile Neutropenia

    Directory of Open Access Journals (Sweden)

    Solmaz Çelebi

    2009-06-01

    Full Text Available Aim: Febrile neutropenia is the major cause of mortality and morbidity in cancer patients. For this reason, early diagnosis of severe infections and appropriate antimicrobial therapy are very important. The aim of this study was to investigate the difference between C-reactive protein (CRP and procalcitonin in determining the sepsis and its severity. Materials and Method: A total of 30 children (35 episodes with febrile neutropenia who were hospitalized in the Uludag University, Pediatric Hematology and Oncology Unit were included in this prospective study. The blood samples for CRP and procalcitonin were collected daily between 0 to 5th days. Serum CRP and procalcitonin levels were compared with culture positivity, prolonged fever, mucositis and absolute granulosit count (AGC. Results: A total of 16 patients (56% diagnosed with acute leukemia and, 14 patients (46% having solid tumours were evaluated. In sequential analysis of febrile episodes, both the median of procalcitonin and the CRP concentrations showed the same tendency and there was no significant correlation between them (r=0.2, p>0.05. There was no significant association between CRP and procalcitonin among those having positive culture and mucositis. However, CRP values at the 3rd, 4th and 5th days were significantly higher in the patients with AGC100/mm3. Similarly, CRP values were significantly higher at the 1st, 2nd, 3rd and 4th days among the patients having prolonged fever. Conclusion: Our study suggests that there is no difference between CRP and procalcitonin in determining sepsis and its severity. Although procalcitonin is a valuable acute phase reactant in non-neutropenic patients, larger prospective investigations are needed to show the prognostic value of procalcitonin in neutropenic patients. (Journal of Current Pediatrics 2009; 7: 7-12

  6. Regulation of polar auxin transport by protein and lipid kinases.

    Science.gov (United States)

    Armengot, Laia; Marquès-Bueno, Maria Mar; Jaillais, Yvon

    2016-07-01

    The directional transport of auxin, known as polar auxin transport (PAT), allows asymmetric distribution of this hormone in different cells and tissues. This system creates local auxin maxima, minima, and gradients that are instrumental in both organ initiation and shape determination. As such, PAT is crucial for all aspects of plant development but also for environmental interaction, notably in shaping plant architecture to its environment. Cell to cell auxin transport is mediated by a network of auxin carriers that are regulated at the transcriptional and post-translational levels. Here we review our current knowledge on some aspects of the 'non-genomic' regulation of auxin transport, placing an emphasis on how phosphorylation by protein and lipid kinases controls the polarity, intracellular trafficking, stability, and activity of auxin carriers. We describe the role of several AGC kinases, including PINOID, D6PK, and the blue light photoreceptor phot1, in phosphorylating auxin carriers from the PIN and ABCB families. We also highlight the function of some receptor-like kinases (RLKs) and two-component histidine kinase receptors in PAT, noting that there are probably RLKs involved in co-ordinating auxin distribution yet to be discovered. In addition, we describe the emerging role of phospholipid phosphorylation in polarity establishment and intracellular trafficking of PIN proteins. We outline these various phosphorylation mechanisms in the context of primary and lateral root development, leaf cell shape acquisition, as well as root gravitropism and shoot phototropism. PMID:27242371

  7. Multiple implications of 3-phosphoinositide-dependent protein kinase 1 in human cancer

    Institute of Scientific and Technical Information of China (English)

    Keum-Jin; Yang; Jongsun; Park

    2010-01-01

    3-phosphoinositide-dependent protein kinase-1(PDK1) is a central mediator of cellular signaling between phosphoinositide-3 kinase and various intracellular serine/threonine kinases,including protein kinase B,p70 ribosomal S6 kinase,serum and glucocorticoid-inducible kinase,and protein kinase C.PDK1 activates members of the AGC family of protein kinases by phosphorylating serine/threonine residues in the activation loop.Here,we review the regulatory mechanisms of PDK1 and its roles in cancer.PDK1 is activated by autophosphorylation in the activation loop and other serine residues,as well as by phosphorylation of Tyr-9 and Tyr-373/376.Src appears to recognize PDK1 following tyrosine phosphorylation.The role of heat shock protein 90 in regulating PDK1 stability and PDK1-Src complex formation are also discussed.Furthermore,we summarize the subcellular distribution of PDK1.Finally,an important role for PDK1 in cancer chemotherapy is proposed.In conclusion,a better understanding of its molecular regulatory mechanisms in various signaling pathways will help to explain how PDK1 acts as an oncogenic kinase in various cancers,and will contribute to the development of novel cancer chemotherapies.

  8. Protein Foods

    Science.gov (United States)

    ... Text Size: A A A Listen En Español Protein Foods Foods high in protein such as fish, ... the vegetarian proteins, whether they have carbohydrate. Best Protein Choices The best choices are: Plant-based proteins ...

  9. Protein-protein interactions

    DEFF Research Database (Denmark)

    Byron, Olwyn; Vestergaard, Bente

    2015-01-01

    Responsive formation of protein:protein interaction (PPI) upon diverse stimuli is a fundament of cellular function. As a consequence, PPIs are complex, adaptive entities, and exist in structurally heterogeneous interplays defined by the energetic states of the free and complexed protomers. The...

  10. : Protein flexibility

    OpenAIRE

    Bornot, Aurélie; Offmann, Bernard; De Brevern, Alexandre

    2007-01-01

    Protein structures and protein structural models are great tools to reach protein function and provide very relevant information for drug design. Nevertheless, protein structures are not rigid entities. Cutting-edge bioinformatics methods tend to take into account the flexibility of these macromolecules. We present new approaches used to define protein structure flexibility.

  11. Associations of C-Reactive Protein, Granulocytes and Granulocyte-to-Lymphocyte Ratio with Mortality from Breast Cancer in Non-Institutionalized American Women.

    Directory of Open Access Journals (Sweden)

    Wahyu Wulaningsih

    Full Text Available Inflammation may play a role in breast cancer, but evidence in the general population is lacking. We investigated the association between serum inflammatory markers (C-reactive protein (CRP, absolute granulocyte count (AGC and granulocyte-to-lymphocyte (G/L ratio and breast cancer (BCa mortality in American women while accounting for adiposity. From the Third National Health and Nutrition Examination Survey (NHANES III we selected all women aged 20+ without any known history of cancer (n = 7,780. Multivariable Cox regression models were used to assess CRP, AGC and G/L ratio in relation to mortality from BCa, all cancer, cardiovascular disease and all causes. Stratification analyses by body mass index (BMI and waist circumference were performed to investigate the effect of adiposity on this association. During a mean follow-up of 167 months, 44 women died from BCa. After adjustments for BMI and waist circumference, only G/L ratio was associated to risk of BCa death (e.g. HR: 2.35, 95% CI: 1.36-4.06 for the 3rd compared to the 1st tertile, Ptrend = 0.01. Except for a borderline interaction between CRP categories and obesity by BMI, no statistically significant interaction between markers and categories of BMI or waist circumference was observed. All three markers were associated with mortality from cardiovascular disease and all causes. Our findings support a role of inflammation in BCa mortality which may involve mechanisms apart from obesity, and potential usefulness of GLR as a marker in assessing inflammation and cancer.

  12. Total protein

    Science.gov (United States)

    The total protein test measures the total amount of two classes of proteins found in the fluid portion of your ... nutritional problems, kidney disease or liver disease . If total protein is abnormal, you will need to have more ...

  13. Interfacial Protein-Protein Associations

    OpenAIRE

    Langdon, Blake B.; Kastantin, Mark; Walder, Robert; Schwartz, Daniel K.

    2013-01-01

    While traditional models of protein adsorption focus primarily on direct protein-surface interactions, recent findings suggest that protein-protein interactions may play a central role. Using high-throughput intermolecular resonance energy transfer (RET) tracking, we directly observed dynamic, protein-protein associations of bovine serum albumin on poly(ethylene glycol) modified surfaces. The associations were heterogeneous and reversible, and associating molecules resided on the surface for ...

  14. AGC-1 Experiment and Final Preliminary Design Report

    Energy Technology Data Exchange (ETDEWEB)

    Robert L. Bratton; Tim Burchell

    2006-08-01

    This report details the experimental plan and design as of the preliminary design review for the Advanced Test Reactor Graphite Creep-1 graphite compressive creep capsule. The capsule will contain five graphite grades that will be irradiated in the Advanced Test Reactor at the Idaho National Laboratory to determine the irradiation induced creep constants. Seven other grades of graphite will be irradiated to determine irradiated physical properties. The capsule will have an irradiation temperature of 900 C and a peak irradiation dose of 5.8 x 10{sup 21} n/cm{sup 2} [E > 0.1 MeV], or 4.2 displacements per atom.

  15. Transverse feedback: high intensity operation, AGC, IGC, lessons for 2012

    CERN Document Server

    Höfle, W

    2012-01-01

    The transverse damper system (ADT) plays an important role in the preservation of the beam transverse emittance and for damping of oscillations driven by the coupled bunch instability. An overview of the ADT system will be presented with an emphasis on the important feedback loop parameters as they change from injection through the ramp into collision. The dedicated setting - up procedure required for the different bunch intensities and bunch spacings will be explained. During the 2011 run the injection and abort gap cleaning became operational at injection energy. Preparations for cleaning at 3.5 TeV as well as batch selective transverse blow - up were completed and preliminarily tested. Plans for 2012 include study and potential improvement of the system impulse response to improve the 'selectivity' of the cleaning and blow - up facility. The ADT also provides bunch - by - bunch observation, which was extensively used during the run and MDs, and will be further upgraded during the next year.

  16. Molecular Mechanism of Selectivity among G Protein-Coupled Receptor Kinase 2 Inhibitors

    Energy Technology Data Exchange (ETDEWEB)

    Thal, David M.; Yeow, Raymond Y.; Schoenau, Christian; Huber, Jochen; Tesmer, John J.G. (Sanofi); (Michigan)

    2012-07-11

    G protein-coupled receptors (GPCRs) are key regulators of cell physiology and control processes ranging from glucose homeostasis to contractility of the heart. A major mechanism for the desensitization of activated GPCRs is their phosphorylation by GPCR kinases (GRKs). Overexpression of GRK2 is strongly linked to heart failure, and GRK2 has long been considered a pharmaceutical target for the treatment of cardiovascular disease. Several lead compounds developed by Takeda Pharmaceuticals show high selectivity for GRK2 and therapeutic potential for the treatment of heart failure. To understand how these drugs achieve their selectivity, we determined crystal structures of the bovine GRK2-G{beta}{gamma} complex in the presence of two of these inhibitors. Comparison with the apoGRK2-G{beta}{gamma} structure demonstrates that the compounds bind in the kinase active site in a manner similar to that of the AGC kinase inhibitor balanol. Both balanol and the Takeda compounds induce a slight closure of the kinase domain, the degree of which correlates with the potencies of the inhibitors. Based on our crystal structures and homology modeling, we identified five amino acids surrounding the inhibitor binding site that we hypothesized could contribute to inhibitor selectivity. However, our results indicate that these residues are not major determinants of selectivity among GRK subfamilies. Rather, selectivity is achieved by the stabilization of a unique inactive conformation of the GRK2 kinase domain.

  17. Total protein

    Science.gov (United States)

    ... page: //medlineplus.gov/ency/article/003483.htm Total protein To use the sharing features on this page, please enable JavaScript. The total protein test measures the total amount of two classes ...

  18. Protein Structure

    Science.gov (United States)

    Asmus, Elaine Garbarino

    2007-01-01

    Individual students model specific amino acids and then, through dehydration synthesis, a class of students models a protein. The students clearly learn amino acid structure, primary, secondary, tertiary, and quaternary structure in proteins and the nature of the bonds maintaining a protein's shape. This activity is fun, concrete, inexpensive and…

  19. Tau protein

    DEFF Research Database (Denmark)

    Frederiksen, Jette Lautrup Battistini; Kristensen, Kim; Bahl, Jmc;

    2011-01-01

    Background: Tau protein has been proposed as biomarker of axonal damage leading to irreversible neurological impairment in MS. CSF concentrations may be useful when determining risk of progression from ON to MS. Objective: To investigate the association between tau protein concentration and 14...... the Department of Neurology of Glostrup Hospital, University of Copenhagen, Denmark, were included. CSF samples were analysed for tau protein and 14-3-3 protein, and clinical and paraclinical information was obtained from medical records. Results: The study shows a significantly increased...... concentration of tau protein in CSF from patients with relapsing-remitting MS and patients monosymptomatic at onset who progressed to MS, but interestingly no increased tau protein concentration in monosymptomatic ON. The concentration of tau protein was significantly correlated to Expanded Disability Status...

  20. Protein politics

    OpenAIRE

    Vijver, Marike

    2005-01-01

    This study is part of the program of the interdisciplinary research group Profetas (protein foods, environment, technology and society). Profetas consists of technological, environmental and socio-economic research projects on protein food systems which result in the development of scenarios and strategies for guiding a shift towards a more plant protein based diet. The different research projects focus on the goal of identifying viable options for a more sustainable food system. Profetas aro...

  1. Principles of protein-protein interactions.

    OpenAIRE

    Jones, S; Thornton, J. M.

    1996-01-01

    This review examines protein complexes in the Brookhaven Protein Databank to gain a better understanding of the principles governing the interactions involved in protein-protein recognition. The factors that influence the formation of protein-protein complexes are explored in four different types of protein-protein complexes--homodimeric proteins, heterodimeric proteins, enzyme-inhibitor complexes, and antibody-protein complexes. The comparison between the complexes highlights differences tha...

  2. Protein-Protein Interaction Databases

    DEFF Research Database (Denmark)

    Szklarczyk, Damian; Jensen, Lars Juhl

    2015-01-01

    of research are explored. Here we present an overview of the most widely used protein-protein interaction databases and the methods they employ to gather, combine, and predict interactions. We also point out the trade-off between comprehensiveness and accuracy and the main pitfall scientists have to be aware...

  3. TORC1 and TORC2 work together to regulate ribosomal protein S6 phosphorylation in Saccharomyces cerevisiae.

    Science.gov (United States)

    Yerlikaya, Seda; Meusburger, Madeleine; Kumari, Romika; Huber, Alexandre; Anrather, Dorothea; Costanzo, Michael; Boone, Charles; Ammerer, Gustav; Baranov, Pavel V; Loewith, Robbie

    2016-01-15

    Nutrient-sensitive phosphorylation of the S6 protein of the 40S subunit of the eukaryote ribosome is highly conserved. However, despite four decades of research, the functional consequences of this modification remain unknown. Revisiting this enigma in Saccharomyces cerevisiae, we found that the regulation of Rps6 phosphorylation on Ser-232 and Ser-233 is mediated by both TOR complex 1 (TORC1) and TORC2. TORC1 regulates phosphorylation of both sites via the poorly characterized AGC-family kinase Ypk3 and the PP1 phosphatase Glc7, whereas TORC2 regulates phosphorylation of only the N-terminal phosphosite via Ypk1. Cells expressing a nonphosphorylatable variant of Rps6 display a reduced growth rate and a 40S biogenesis defect, but these phenotypes are not observed in cells in which Rps6 kinase activity is compromised. Furthermore, using polysome profiling and ribosome profiling, we failed to uncover a role of Rps6 phosphorylation in either global translation or translation of individual mRNAs. Taking the results together, this work depicts the signaling cascades orchestrating Rps6 phosphorylation in budding yeast, challenges the notion that Rps6 phosphorylation plays a role in translation, and demonstrates that observations made with Rps6 knock-ins must be interpreted cautiously. PMID:26582391

  4. The Protein Kinase CK2 Mediates Cross-Talk between Auxin- and Salicylic Acid-Signaling Pathways in the Regulation of PINOID Transcription.

    Science.gov (United States)

    Armengot, Laia; Caldarella, Eleonora; Marquès-Bueno, Maria Mar; Martínez, M Carmen

    2016-01-01

    The protein kinase CK2 is a ubiquitous and highly conserved enzyme, the activity of which is vital for eukaryotic cells. We recently demonstrated that CK2 modulates salicylic acid (SA) homeostasis in Arabidopsis thaliana, and that functional interplay between CK2 and SA sustains transcriptional expression of PIN-FORMED (PIN) genes. In this work, we show that CK2 also plays a key role in the transcriptional regulation of PINOID (PID), an AGC protein kinase that modulates the apical/basal localization of auxin-efflux transporters. We show that PID transcription is up-regulated by auxin and by SA and that CK2 is involved in both pathways. On the one hand, CK2 activity is required for proteosome-dependent degradation of AXR3, a member of the AUX/IAA family of auxin transcriptional repressors that must be degraded to activate auxin-responsive gene expression. On the other hand, the role of CK2 in SA homeostasis and, indirectly, in SA-driven PID transcription, was confirmed by using Arabidopsis NahG transgenic plants, which cannot accumulate SA. In conclusion, our results evidence a role for CK2 as a functional link in the negative cross-talk between auxin- and SA-signaling. PMID:27275924

  5. The Protein Kinase CK2 Mediates Cross-Talk between Auxin- and Salicylic Acid-Signaling Pathways in the Regulation of PINOID Transcription.

    Directory of Open Access Journals (Sweden)

    Laia Armengot

    Full Text Available The protein kinase CK2 is a ubiquitous and highly conserved enzyme, the activity of which is vital for eukaryotic cells. We recently demonstrated that CK2 modulates salicylic acid (SA homeostasis in Arabidopsis thaliana, and that functional interplay between CK2 and SA sustains transcriptional expression of PIN-FORMED (PIN genes. In this work, we show that CK2 also plays a key role in the transcriptional regulation of PINOID (PID, an AGC protein kinase that modulates the apical/basal localization of auxin-efflux transporters. We show that PID transcription is up-regulated by auxin and by SA and that CK2 is involved in both pathways. On the one hand, CK2 activity is required for proteosome-dependent degradation of AXR3, a member of the AUX/IAA family of auxin transcriptional repressors that must be degraded to activate auxin-responsive gene expression. On the other hand, the role of CK2 in SA homeostasis and, indirectly, in SA-driven PID transcription, was confirmed by using Arabidopsis NahG transgenic plants, which cannot accumulate SA. In conclusion, our results evidence a role for CK2 as a functional link in the negative cross-talk between auxin- and SA-signaling.

  6. Whey Protein

    Science.gov (United States)

    ... quality of life in people with mitochondrial diseases. Ovarian cysts (Polycystic ovarian syndrome). Early research suggests that taking ... weight, fat mass, and cholesterol in people with ovarian cysts. However, whey protein does not improve blood sugar ...

  7. PPARδ activation acts cooperatively with 3-phosphoinositide-dependent protein kinase-1 to enhance mammary tumorigenesis.

    Directory of Open Access Journals (Sweden)

    Claire B Pollock

    Full Text Available Peroxisome proliferator-activated receptorδ (PPARδ is a transcription factor that is associated with metabolic gene regulation and inflammation. It has been implicated in tumor promotion and in the regulation of 3-phosphoinositide-dependent kinase-1 (PDK1. PDK1 is a key regulator of the AGC protein kinase family, which includes the proto-oncogene AKT/PKB implicated in several malignancies, including breast cancer. To assess the role of PDK1 in mammary tumorigenesis and its interaction with PPARδ, transgenic mice were generated in which PDK1 was expressed in mammary epithelium under the control of the MMTV enhancer/promoter region. Transgene expression increased pT308AKT and pS9GSK3β, but did not alter phosphorylation of mTOR, 4EBP1, ribosomal protein S6 and PKCα. The transgenic mammary gland also expressed higher levels of PPARδ and a gene expression profile resembling wild-type mice maintained on a diet containing the PPARδ agonist, GW501516. Both wild-type and transgenic mice treated with GW501516 exhibited accelerated rates of tumor formation that were more pronounced in transgenic animals. GW501516 treatment was accompanied by a distinct metabolic gene expression and metabolomic signature that was not present in untreated animals. GW501516-treated transgenic mice expressed higher levels of fatty acid and phospholipid metabolites than treated wild-type mice, suggesting the involvement of PDK1 in enhancing PPARδ-driven energy metabolism. These results reveal that PPARδ activation elicits a distinct metabolic and metabolomic profile in tumors that is in part related to PDK1 and AKT signaling.

  8. Protein Crystallization

    Science.gov (United States)

    Chernov, Alexander A.

    2005-01-01

    Nucleation, growth and perfection of protein crystals will be overviewed along with crystal mechanical properties. The knowledge is based on experiments using optical and force crystals behave similar to inorganic crystals, though with a difference in orders of magnitude in growing parameters. For example, the low incorporation rate of large biomolecules requires up to 100 times larger supersaturation to grow protein, rather than inorganic crystals. Nucleation is often poorly reproducible, partly because of turbulence accompanying the mixing of precipitant with protein solution. Light scattering reveals fluctuations of molecular cluster size, its growth, surface energies and increased clustering as protein ages. Growth most often occurs layer-by-layer resulting in faceted crystals. New molecular layer on crystal face is terminated by a step where molecular incorporation occurs. Quantitative data on the incorporation rate will be discussed. Rounded crystals with molecularly disordered interfaces will be explained. Defects in crystals compromise the x-ray diffraction resolution crucially needed to find the 3D atomic structure of biomolecules. The defects are immobile so that birth defects stay forever. All lattice defects known for inorganics are revealed in protein crystals. Contribution of molecular conformations to lattice disorder is important, but not studied. This contribution may be enhanced by stress field from other defects. Homologous impurities (e.g., dimers, acetylated molecules) are trapped more willingly by a growing crystal than foreign protein impurities. The trapped impurities induce internal stress eliminated in crystals exceeding a critical size (part of mni for ferritin, lysozyme). Lesser impurities are trapped from stagnant, as compared to the flowing, solution. Freezing may induce much more defects unless quickly amorphysizing intracrystalline water.

  9. Arabinogalactan proteins

    DEFF Research Database (Denmark)

    Knoch, Eva; Dilokpimol, Adiphol; Geshi, Naomi

    2014-01-01

    Arabinogalactan proteins (AGPs) are a highly diverse class of cell surface proteoglycans that are commonly found in most plant species. AGPs play important roles in many cellular processes during plant development, such as reproduction, cell proliferation, pattern formation and growth, and in plant...

  10. Prediction of Protein-Protein Interactions Related to Protein Complexes Based on Protein Interaction Networks

    OpenAIRE

    Peng Liu; Lei Yang; Daming Shi; Xianglong Tang

    2015-01-01

    A method for predicting protein-protein interactions based on detected protein complexes is proposed to repair deficient interactions derived from high-throughput biological experiments. Protein complexes are pruned and decomposed into small parts based on the adaptive k-cores method to predict protein-protein interactions associated with the complexes. The proposed method is adaptive to protein complexes with different structure, number, and size of nodes in a protein-protein interaction net...

  11. Grafting of protein-protein binding sites

    Institute of Scientific and Technical Information of China (English)

    2000-01-01

    A strategy for grafting protein-protein binding sites is described. Firstly, key interaction residues at the interface of ligand protein to be grafted are identified and suitable positions in scaffold protein for grafting these key residues are sought. Secondly, the scaffold proteins are superposed onto the ligand protein based on the corresponding Ca and Cb atoms. The complementarity between the scaffold protein and the receptor protein is evaluated and only matches with high score are accepted. The relative position between scaffold and receptor proteins is adjusted so that the interface has a reasonable packing density. Then the scaffold protein is mutated to corresponding residues in ligand protein at each candidate position. And the residues having bad steric contacts with the receptor proteins, or buried charged residues not involved in the formation of any salt bridge are mutated. Finally, the mutated scaffold protein in complex with receptor protein is co-minimized by Charmm. In addition, we deduce a scoring function to evaluate the affinity between mutated scaffold protein and receptor protein by statistical analysis of rigid binding data sets.

  12. Detecting overlapping protein complexes in protein-protein interaction networks

    OpenAIRE

    Nepusz, Tamás; Yu, Haiyuan; Paccanaro, Alberto

    2012-01-01

    We introduce clustering with overlapping neighborhood expansion (ClusterONE), a method for detecting potentially overlapping protein complexes from protein-protein interaction data. ClusterONE-derived complexes for several yeast data sets showed better correspondence with reference complexes in the Munich Information Center for Protein Sequence (MIPS) catalog and complexes derived from the Saccharomyces Genome Database (SGD) than the results of seven popular methods. The results also showed a...

  13. EDITORIAL: Precision proteins Precision proteins

    Science.gov (United States)

    Demming, Anna

    2010-06-01

    Since the birth of modern day medicine, during the times of Hippocrates in ancient Greece, the profession has developed from the rudimentary classification of disease into a rigorous science with an inspiring capability to treat and cure. Scientific methodology has distilled clinical diagnostic tools from the early arts of prognosis, which used to rely as much on revelation and prophecy, as intuition and judgement [1]. Over the past decade, research into the interactions between proteins and nanosystems has provided some ingenious and apt techniques for delving into the intricacies of anatomical systems. In vivo biosensing has emerged as a vibrant field of research, as much of medical diagnosis relies on the detection of substances or an imbalance in the chemicals in the body. The inherent properties of nanoscale structures, such as cantilevers, make them well suited to biosensing applications that demand the detection of molecules at very low concentrations. Measurable deflections in cantilevers functionalised with antibodies provide quantitative indicators of the presence of specific antigens when the two react. Such developments have roused mounting interest in the interactions of proteins with nanostructures, such as carbon nanotubes [3], which have demonstrated great potential as generic biomarkers. Plasmonic properties are also being exploited in sensing applications, such as the molecular sentinel recently devised by researchers in the US. The device uses the plasmonic properties of a silver nanoparticle linked to a Raman labelled hairpin DNA probe to signal changes in the probe geometry resulting from interactions with substances in the environment. Success stories so far include the detection of two specific genes associated with breast cancer [4]. A greater understanding of how RNA interference regulates gene expression has highlighted the potential of using this natural process as another agent for combating disease in personalized medicine. However, the

  14. Internal duplication and sequence homology in factors V and VIII.

    OpenAIRE

    Fass, D.N.; Hewick, R M; Knutson, G J; Nesheim, M. E.; Mann, K.G.

    1985-01-01

    Blood coagulation factors V and VIII each serve cofactor functions with different vitamin K-dependent serine proteases of the coagulation cascade. Physical, physiologic, and kinetic data suggest analogous structures and functions for these two proteins. Proteolytically activated factor V (factor Va) is required for the efficient production of thrombin from prothrombin by factor Xa. Similarly, activated factor VIII (factor VIIIa) performs its cofactor activity with factor IXa to produce the ac...

  15. Protein Crystal Based Nanomaterials

    Science.gov (United States)

    Bell, Jeffrey A.; VanRoey, Patrick

    2001-01-01

    This is the final report on a NASA Grant. It concerns a description of work done, which includes: (1) Protein crystals cross-linked to form fibers; (2) Engineering of protein to favor crystallization; (3) Better knowledge-based potentials for protein-protein contacts; (4) Simulation of protein crystallization.

  16. Shotgun protein sequencing.

    Energy Technology Data Exchange (ETDEWEB)

    Faulon, Jean-Loup Michel; Heffelfinger, Grant S.

    2009-06-01

    A novel experimental and computational technique based on multiple enzymatic digestion of a protein or protein mixture that reconstructs protein sequences from sequences of overlapping peptides is described in this SAND report. This approach, analogous to shotgun sequencing of DNA, is to be used to sequence alternative spliced proteins, to identify post-translational modifications, and to sequence genetically engineered proteins.

  17. Protein-protein complexation in bioluminescence

    OpenAIRE

    Titushin, Maxim S.; Feng, Yingang; Lee, John; Vysotski, Eugene S.; Liu, Zhi-jie

    2011-01-01

    In this review we summarize the progress made towards understanding the role of protein-protein interactions in the function of various bioluminescence systems of marine organisms, including bacteria, jellyfish and soft corals, with particular focus on methodology used to detect and characterize these interactions. In some bioluminescence systems, protein-protein interactions involve an “accessory protein” whereby a stored substrate is efficiently delivered to the bioluminescent enzyme lucife...

  18. Protein folding, protein homeostasis, and cancer

    Institute of Scientific and Technical Information of China (English)

    John H. Van Drie

    2011-01-01

    Proteins fold into their functional 3-dimensional structures from a linear amino acid sequence. In vitro this process is spontaneous; while in vivo it is orchestrated by a specialized set of proteins, called chaperones. Protein folding is an ongoing cellular process, as cellular proteins constantly undergo synthesis and degradation. Here emerging links between this process and cancer are reviewed. This perspective both yields insights into the current struggle to develop novel cancer chemotherapeutics and has implications for future chemotherapy discovery.

  19. Protein-Protein Interaction Analysis by Docking

    OpenAIRE

    Stephan Ederer; Florian Fink; Wolfram Gronwald

    2009-01-01

    Based on a protein-protein docking approach we have developed a procedure to verify or falsify protein-protein interactions that were proposed by other methods such as yeast-2-hybrid assays. Our method currently utilizes intermolecular energies but can be expanded to incorporate additional terms such as amino acid based pair-potentials. We show some early results that demonstrate the general applicability of our approach.

  20. Protein-losing enteropathy

    Science.gov (United States)

    ... this page: //medlineplus.gov/ency/article/007338.htm Protein-losing enteropathy To use the sharing features on this page, please enable JavaScript. Protein-losing enteropathy is an abnormal loss of protein ...

  1. Protein and Heart Health

    Science.gov (United States)

    ... Recognition & Awards Healthy Workplace Food and Beverage Toolkit Protein and Heart Health Updated:May 5,2015 Protein ... said. What’s the harm in getting too much protein? The main problem is that often the extra ...

  2. SPIDer: Saccharomyces protein-protein interaction database

    Directory of Open Access Journals (Sweden)

    Li Zhenbo

    2006-12-01

    Full Text Available Abstract Background Since proteins perform their functions by interacting with one another and with other biomolecules, reconstructing a map of the protein-protein interactions of a cell, experimentally or computationally, is an important first step toward understanding cellular function and machinery of a proteome. Solely derived from the Gene Ontology (GO, we have defined an effective method of reconstructing a yeast protein interaction network by measuring relative specificity similarity (RSS between two GO terms. Description Based on the RSS method, here, we introduce a predicted Saccharomyces protein-protein interaction database called SPIDer. It houses a gold standard positive dataset (GSP with high confidence level that covered 79.2% of the high-quality interaction dataset. Our predicted protein-protein interaction network reconstructed from the GSPs consists of 92 257 interactions among 3600 proteins, and forms 23 connected components. It also provides general links to connect predicted protein-protein interactions with three other databases, DIP, BIND and MIPS. An Internet-based interface provides users with fast and convenient access to protein-protein interactions based on various search features (searching by protein information, GO term information or sequence similarity. In addition, the RSS value of two GO terms in the same ontology, and the inter-member interactions in a list of proteins of interest or in a protein complex could be retrieved. Furthermore, the database presents a user-friendly graphical interface which is created dynamically for visualizing an interaction sub-network. The database is accessible at http://cmb.bnu.edu.cn/SPIDer/index.html. Conclusion SPIDer is a public database server for protein-protein interactions based on the yeast genome. It provides a variety of search options and graphical visualization of an interaction network. In particular, it will be very useful for the study of inter-member interactions

  3. Presence of variations in ribosomal protein L16 corresponding to susceptibility of enterococci to oligosaccharides (avilamycin and evernimicin)

    DEFF Research Database (Denmark)

    Aarestrup, Frank Møller; Jensen, Lars Bogø

    2000-01-01

    .faecium isolates had sequences that were similar to those of the type strains. All resistant E.faecalis isolates contained the same base pair variation [CGT (Arg-56) --> CAT (His-56)]. The same variation and two additional variations [ATC (Ile-52) --> ACC (Thr-52) and ATC (Ile-52) --> AGC (Ser-52)] were found in...

  4. PIC: Protein Interactions Calculator

    OpenAIRE

    Tina, KG; Bhadra, R.; Srinivasan, N.

    2007-01-01

    Interactions within a protein structure and interactions between proteins in an assembly are essential considerations in understanding molecular basis of stability and functions of proteins and their complexes. There are several weak and strong interactions that render stability to a protein structure or an assembly. Protein Interactions Calculator (PIC) is a server which, given the coordinate set of 3D structure of a protein or an assembly, computes various interactions such as disulphide bo...

  5. Drugging Membrane Protein Interactions.

    Science.gov (United States)

    Yin, Hang; Flynn, Aaron D

    2016-07-11

    The majority of therapeutics target membrane proteins, accessible on the surface of cells, to alter cellular signaling. Cells use membrane proteins to transduce signals into cells, transport ions and molecules, bind cells to a surface or substrate, and catalyze reactions. Newly devised technologies allow us to drug conventionally "undruggable" regions of membrane proteins, enabling modulation of protein-protein, protein-lipid, and protein-nucleic acid interactions. In this review, we survey the state of the art of high-throughput screening and rational design in drug discovery, and we evaluate the advances in biological understanding and technological capacity that will drive pharmacotherapy forward against unorthodox membrane protein targets. PMID:26863923

  6. PREFACE: Protein protein interactions: principles and predictions

    Science.gov (United States)

    Nussinov, Ruth; Tsai, Chung-Jung

    2005-06-01

    Proteins are the `workhorses' of the cell. Their roles span functions as diverse as being molecular machines and signalling. They carry out catalytic reactions, transport, form viral capsids, traverse membranes and form regulated channels, transmit information from DNA to RNA, making possible the synthesis of new proteins, and they are responsible for the degradation of unnecessary proteins and nucleic acids. They are the vehicles of the immune response and are responsible for viral entry into the cell. Given their importance, considerable effort has been centered on the prediction of protein function. A prime way to do this is through identification of binding partners. If the function of at least one of the components with which the protein interacts is known, that should let us assign its function(s) and the pathway(s) in which it plays a role. This holds since the vast majority of their chores in the living cell involve protein-protein interactions. Hence, through the intricate network of these interactions we can map cellular pathways, their interconnectivities and their dynamic regulation. Their identification is at the heart of functional genomics; their prediction is crucial for drug discovery. Knowledge of the pathway, its topology, length, and dynamics may provide useful information for forecasting side effects. The goal of predicting protein-protein interactions is daunting. Some associations are obligatory, others are continuously forming and dissociating. In principle, from the physical standpoint, any two proteins can interact, but under what conditions and at which strength? The principles of protein-protein interactions are general: the non-covalent interactions of two proteins are largely the outcome of the hydrophobic effect, which drives the interactions. In addition, hydrogen bonds and electrostatic interactions play important roles. Thus, many of the interactions observed in vitro are the outcome of experimental overexpression. Protein disorder

  7. Protein sequence comparison and protein evolution

    Energy Technology Data Exchange (ETDEWEB)

    Pearson, W.R. [Univ. of Virginia, Charlottesville, VA (United States). Dept. of Biochemistry

    1995-12-31

    This tutorial was one of eight tutorials selected to be presented at the Third International Conference on Intelligent Systems for Molecular Biology which was held in the United Kingdom from July 16 to 19, 1995. This tutorial examines how the information conserved during the evolution of a protein molecule can be used to infer reliably homology, and thus a shared proteinfold and possibly a shared active site or function. The authors start by reviewing a geological/evolutionary time scale. Next they look at the evolution of several protein families. During the tutorial, these families will be used to demonstrate that homologous protein ancestry can be inferred with confidence. They also examine different modes of protein evolution and consider some hypotheses that have been presented to explain the very earliest events in protein evolution. The next part of the tutorial will examine the technical aspects of protein sequence comparison. Both optimal and heuristic algorithms and their associated parameters that are used to characterize protein sequence similarities are discussed. Perhaps more importantly, they survey the statistics of local similarity scores, and how these statistics can both be used to improve the selectivity of a search and to evaluate the significance of a match. They them examine distantly related members of three protein families, the serine proteases, the glutathione transferases, and the G-protein-coupled receptors (GCRs). Finally, the discuss how sequence similarity can be used to examine internal repeated or mosaic structures in proteins.

  8. Prediction of Protein-Protein Interactions Using Protein Signature Profiling

    Institute of Scientific and Technical Information of China (English)

    Mahmood; A.; Mahdavi; Yen-Han; Lin

    2007-01-01

    Protein domains are conserved and functionally independent structures that play an important role in interactions among related proteins. Domain-domain inter- actions have been recently used to predict protein-protein interactions (PPI). In general, the interaction probability of a pair of domains is scored using a trained scoring function. Satisfying a threshold, the protein pairs carrying those domains are regarded as "interacting". In this study, the signature contents of proteins were utilized to predict PPI pairs in Saccharomyces cerevisiae, Caenorhabditis ele- gans, and Homo sapiens. Similarity between protein signature patterns was scored and PPI predictions were drawn based on the binary similarity scoring function. Results show that the true positive rate of prediction by the proposed approach is approximately 32% higher than that using the maximum likelihood estimation method when compared with a test set, resulting in 22% increase in the area un- der the receiver operating characteristic (ROC) curve. When proteins containing one or two signatures were removed, the sensitivity of the predicted PPI pairs in- creased significantly. The predicted PPI pairs are on average 11 times more likely to interact than the random selection at a confidence level of 0.95, and on aver- age 4 times better than those predicted by either phylogenetic profiling or gene expression profiling.

  9. Urine Protein and Urine Protein to Creatinine Ratio

    Science.gov (United States)

    ... limited. Home Visit Global Sites Search Help? Urine Protein and Urine Protein to Creatinine Ratio Share this page: Was this page helpful? Also known as: 24-Hour Urine Protein; Urine Total Protein; Urine Protein to Creatinine Ratio; ...

  10. Protein- protein interaction detection system using fluorescent protein microdomains

    Science.gov (United States)

    Waldo, Geoffrey S.; Cabantous, Stephanie

    2010-02-23

    The invention provides a protein labeling and interaction detection system based on engineered fragments of fluorescent and chromophoric proteins that require fused interacting polypeptides to drive the association of the fragments, and further are soluble and stable, and do not change the solubility of polypeptides to which they are fused. In one embodiment, a test protein X is fused to a sixteen amino acid fragment of GFP (.beta.-strand 10, amino acids 198-214), engineered to not perturb fusion protein solubility. A second test protein Y is fused to a sixteen amino acid fragment of GFP (.beta.-strand 11, amino acids 215-230), engineered to not perturb fusion protein solubility. When X and Y interact, they bring the GFP strands into proximity, and are detected by complementation with a third GFP fragment consisting of GFP amino acids 1-198 (strands 1-9). When GFP strands 10 and 11 are held together by interaction of protein X and Y, they spontaneous association with GFP strands 1-9, resulting in structural complementation, folding, and concomitant GFP fluorescence.

  11. Structural properties of fibrillar proteins isolated from the cell surface and cytoplasm of Streptococcus salivarius (K+) cells and nonadhesive mutants.

    Science.gov (United States)

    Weerkamp, A H; van der Mei, H C; Liem, R S

    1986-01-01

    Most Streptococcus salivarius (K+) cells contain two protein antigens with different adhesive functions. The subcellular distribution and some structural properties of purified proteins were studied. Antigen B (AgB), a protein involved in interbacterial coaggregation with gram-negative bacteria, was present in the cell wall fraction only of the wild-type strain and was absent from the cells of a nonadhesive mutant. Antigen C (AgC), a glycoprotein involved in host-associated adhesive functions, was predominantly associated with the cell wall of the wild-type strain (AgCw), but accumulated in high amounts in the cytoplasmic fraction (AgCin) of mutants lacking the wall-associated form. AgB, AgCw, and AgCin had molecular weights of 380,000, 250,000 to 320,000, and 488,000, respectively, upon gel electrophoresis under nondenaturing conditions. In the presence of sodium dodecyl sulfate and beta-mercaptoethanol the molecular weights were only slightly lower, suggesting that the free, isolated molecules exist as monomers under native conditions. AgCin readily stained with periodate-Schiff reagent, indicating a significant content of carbohydrate, similar to AgCw. Circular dichroism spectra showed that about 45% of the amino acids of AgCw were involved in alpha-helical coiled structures. AgB had a significantly lower proportion of ordered coiled structure. Electron microscopic observations of low-angle-shadowed preparations of purified antigens showed that they were flexible, thin rods with thickened or globular ends. Measurements corrected for shadow thickness showed lengths of 184 nm (AgB), 112 nm (AgCin), and 87 nm (AgCw). Treatment of AgCw with protease destroyed the fibrillar core, but seemed not to affect the globular ends. Comparison of the results with the localization of the antigens in wild-type and specific mutant strains suggested that each antigen molecule may represent a single, characteristic surface fibril with a specific adhesive capacity. Images PMID

  12. IGSF9 Family Proteins

    DEFF Research Database (Denmark)

    Hansen, Maria; Walmod, Peter Schledermann

    2013-01-01

    The Drosophila protein Turtle and the vertebrate proteins immunoglobulin superfamily (IgSF), member 9 (IGSF9/Dasm1) and IGSF9B are members of an evolutionarily ancient protein family. A bioinformatics analysis of the protein family revealed that invertebrates contain only a single IGSF9 family gene......, whereas vertebrates contain two to four genes. In cnidarians, the gene appears to encode a secreted protein, but transmembrane isoforms of the protein have also evolved, and in many species, alternative splicing facilitates the expression of both transmembrane and secreted isoforms. In most species, the...... longest isoforms of the proteins have the same general organization as the neural cell adhesion molecule family of cell adhesion molecule proteins, and like this family of proteins, IGSF9 family members are expressed in the nervous system. A review of the literature revealed that Drosophila Turtle...

  13. Surface Mediated Protein Disaggregation

    Science.gov (United States)

    Radhakrishna, Mithun; Kumar, Sanat K.

    2014-03-01

    Preventing protein aggregation is of both biological and industrial importance. Biologically these aggregates are known to cause amyloid type diseases like Alzheimer's and Parkinson's disease. Protein aggregation leads to reduced activity of the enzymes in industrial applications. Inter-protein interactions between the hydrophobic residues of the protein are known to be the major driving force for protein aggregation. In the current paper we show how surface chemistry and curvature can be tuned to mitigate these inter-protein interactions. Our results calculated in the framework of the Hydrophobic-Polar (HP) lattice model show that, inter-protein interactions can be drastically reduced by increasing the surface hydrophobicity to a critical value corresponding to the adsorption transition of the protein. At this value of surface hydrophobicity, proteins lose inter-protein contacts to gain surface contacts and thus the surface helps in reducing the inter-protein interactions. Further, we show that the adsorption of the proteins inside hydrophobic pores of optimal sizes are most efficient both in reducing inter-protein contacts and simultaneously retaining most of the native-contacts due to strong protein-surface interactions coupled with stabilization due to the confinement. Department of Energy (Grant No DE-FG02-11ER46811).

  14. Discover protein sequence signatures from protein-protein interaction data

    Directory of Open Access Journals (Sweden)

    Haasl Ryan J

    2005-11-01

    Full Text Available Abstract Background The development of high-throughput technologies such as yeast two-hybrid systems and mass spectrometry technologies has made it possible to generate large protein-protein interaction (PPI datasets. Mining these datasets for underlying biological knowledge has, however, remained a challenge. Results A total of 3108 sequence signatures were found, each of which was shared by a set of guest proteins interacting with one of 944 host proteins in Saccharomyces cerevisiae genome. Approximately 94% of these sequence signatures matched entries in InterPro member databases. We identified 84 distinct sequence signatures from the remaining 172 unknown signatures. The signature sharing information was then applied in predicting sub-cellular localization of yeast proteins and the novel signatures were used in identifying possible interacting sites. Conclusion We reported a method of PPI data mining that facilitated the discovery of novel sequence signatures using a large PPI dataset from S. cerevisiae genome as input. The fact that 94% of discovered signatures were known validated the ability of the approach to identify large numbers of signatures from PPI data. The significance of these discovered signatures was demonstrated by their application in predicting sub-cellular localizations and identifying potential interaction binding sites of yeast proteins.

  15. Polymer Directed Protein Assemblies

    Directory of Open Access Journals (Sweden)

    Patrick van Rijn

    2013-05-01

    Full Text Available Protein aggregation and protein self-assembly is an important occurrence in natural systems, and is in some form or other dictated by biopolymers. Very obvious influences of biopolymers on protein assemblies are, e.g., virus particles. Viruses are a multi-protein assembly of which the morphology is dictated by poly-nucleotides namely RNA or DNA. This “biopolymer” directs the proteins and imposes limitations on the structure like the length or diameter of the particle. Not only do these bionanoparticles use polymer-directed self-assembly, also processes like amyloid formation are in a way a result of directed protein assembly by partial unfolded/misfolded biopolymers namely, polypeptides. The combination of proteins and synthetic polymers, inspired by the natural processes, are therefore regarded as a highly promising area of research. Directed protein assembly is versatile with respect to the possible interactions which brings together the protein and polymer, e.g., electrostatic, v.d. Waals forces or covalent conjugation, and possible combinations are numerous due to the large amounts of different polymers and proteins available. The protein-polymer interacting behavior and overall morphology is envisioned to aid in clarifying protein-protein interactions and are thought to entail some interesting new functions and properties which will ultimately lead to novel bio-hybrid materials.

  16. Protein Dynamics in an RNA Binding Protein

    Science.gov (United States)

    Hall, Kathleen

    2006-03-01

    Using ^15N NMR relaxation measurements, analyzed with the Lipari-Szabo formalism, we have found that the human U1A RNA binding protein has ps-ns motions in those loops that make contact with RNA. Specific mutations can alter the extent and pattern of motions, and those proteins inevitably lose RNA binding affinity. Proteins with enhanced mobility of loops and termini presumably lose affinity due to increased conformational sampling by those parts of the protein that interact directly with RNA. There is an entropic penalty associated with locking down those elements upon RNA binding, in addition to a loss of binding efficiency caused by the increased number of conformations adopted by the protein. However, in addition to local conformational heterogeneity, analysis of molecular dynamics trajectories by Reorientational Eigenmode Dynamics reveals that loops of the wild type protein undergo correlated motions that link distal sites across the binding surface. Mutations that disrupt correlated motions result in weaker RNA binding, implying that there is a network of interactions across the surface of the protein. (KBH was a Postdoctoral Fellow with Al Redfield from 1985-1990). This work was supported by the NIH (to KBH) and NSF (SAS).

  17. Anisotropic Contributions to Protein-Protein Interactions.

    Science.gov (United States)

    Quang, Leigh J; Sandler, Stanley I; Lenhoff, Abraham M

    2014-02-11

    The anisotropy of shape and functionality of proteins complicates the prediction of protein-protein interactions. We examine the distribution of electrostatic and nonelectrostatic contributions to these interactions for two globular proteins, lysozyme and chymosin B, which differ in molecular weight by about a factor of 2. The interaction trends for these proteins are computed in terms of contributions to the osmotic second virial coefficient that are evaluated using atomistic models of the proteins. Our emphasis is on identifying the orientational configurations that contribute most strongly to the overall interactions due to high-complementarity interactions, and on calculating the effect of ionic strength on such interactions. The results emphasize the quantitative importance of several features of protein interactions, notably that despite differences in their frequency of occurrence, configurations differing appreciably in interaction energy can contribute meaningfully to overall interactions. However, relatively small effects due to charge anisotropy or specific hydration can affect the overall interaction significantly only if they contribute to strongly attractive configurations. The results emphasize the necessity of accounting for detailed anisotropy to capture actual experimental trends, and the sensitivity of even very detailed atomistic models to subtle solution contributions. PMID:26580057

  18. Protein Data Bank (PDB)

    Data.gov (United States)

    U.S. Department of Health & Human Services — The Protein Data Bank (PDB) archive is the single worldwide repository of information about the 3D structures of large biological molecules, including proteins and...

  19. [Protein-losing enteropathy].

    Science.gov (United States)

    Amiot, A

    2015-07-01

    Protein-losing enteropathy is a rare syndrome of gastrointestinal protein loss. The primary causes can be classified into lymphatic leakage due to increased interstitial pressure and increased leakage of protein-rich fluids due to erosive or non-erosive gastrointestinal disorders. The diagnosis of protein-losing enteropathy should be considered in patients with chronic diarrhea and peripheral oedema. The diagnosis of protein-losing enteropathy is most commonly based on the determination of fecal alpha-1 antitrypsin clearance. Most protein-losing enteropathy cases are the result of either lymphatic obstruction or a variety of gastrointestinal disorders and cardiac diseases, while primary intestinal lymphangiectasia (Waldmann's disease) is less common. Treatment of protein-losing enteropathy targets the underlying disease but also includes dietary modification, such as high-protein and low-fat diet along with medium-chain triglyceride supplementation. PMID:25618488

  20. Protein (Cyanobacteria): 360792 [

    Lifescience Database Archive (English)

    Full Text Available YP_007146453.1 1117:17211 1161:2741 1162:3098 56106:1490 142864:1490 56107:1490 putative stress ... protein (general stress ... protein 26) Cylindrospermum stagnale PCC 7417 MTTS ...

  1. Hydrodynamic effects in proteins

    Science.gov (United States)

    Szymczak, Piotr; Cieplak, Marek

    2011-01-01

    Experimental and numerical results pertaining to flow-induced effects in proteins are reviewed. Special emphasis is placed on shear-induced unfolding and on the role of solvent mediated hydrodynamic interactions in the conformational transitions in proteins.

  2. Hydrodynamic effects in proteins

    Energy Technology Data Exchange (ETDEWEB)

    Szymczak, Piotr [Institute of Theoretical Physics, Faculty of Physics, University of Warsaw, Hoza 69, 00-681 Warsaw (Poland); Cieplak, Marek, E-mail: piotr.szymczak@fuw.edu.pl [Institute of Physics, Polish Academy of Sciences, Aleja Lotnikow 32/46, 02-668 Warsaw (Poland)

    2011-01-26

    Experimental and numerical results pertaining to flow-induced effects in proteins are reviewed. Special emphasis is placed on shear-induced unfolding and on the role of solvent mediated hydrodynamic interactions in the conformational transitions in proteins. (topical review)

  3. Protein electrophoresis - serum

    Science.gov (United States)

    ... this page: //medlineplus.gov/ency/article/003540.htm Protein electrophoresis - serum To use the sharing features on ... JavaScript. This lab test measures the types of protein in the fluid (serum) part of a blood ...

  4. Protein: CAD [Trypanosomes Database

    Lifescience Database Archive (English)

    Full Text Available CAD carbamoyl-phosphate synthetase 2, aspartate transcarbamylase, and dihydroorotaseCAD trifunct ... ional protein carbamoylphosphate synthetase 2/aspartate transcarb ... amylase/dihydroorotasemultifunctional protein ... CAD H.sapiens 47458828 18105007 790 P27708 CAD_(ge ...

  5. Learning about Proteins

    Science.gov (United States)

    ... need from peanuts alone, but if you have peanut butter on whole-grain bread, you're set. Likewise, ... protein in a day: 2 tablespoons (15 milliliters) peanut butter (7 grams protein) 1 cup (240 milliliters) low- ...

  6. Electrophoretic Separation of Proteins

    OpenAIRE

    Chakavarti, Bulbul; Chakavarti, Deb

    2008-01-01

    Electrophoresis is used to separate complex mixtures of proteins (e.g., from cells, subcellular fractions, column fractions, or immunoprecipitates), to investigate subunit compositions, and to verify homogeneity of protein samples. It can also serve to purify proteins for use in further applications. In polyacrylamide gel electrophoresis, proteins migrate in response to an electrical field through pores in a polyacrylamide gel matrix; pore size decreases with increasing acrylamide concentrati...

  7. Simulations of protein folding

    International Nuclear Information System (INIS)

    We have developed a simple, phenomenological, Monte-Carlo code that predicts the three-dimensional structure of globular proteins from the DNA sequences that define them. We have applied this code to two small proteins, the villin headpiece (1VII) and colel rop (1ROP). Our code folds both proteins to within 5 A rms of their native structures

  8. Destabilized bioluminescent proteins

    Science.gov (United States)

    Allen, Michael S.; Rakesh, Gupta; Gary, Sayler S.

    2007-07-31

    Purified nucleic acids, vectors and cells containing a gene cassette encoding at least one modified bioluminescent protein, wherein the modification includes the addition of a peptide sequence. The duration of bioluminescence emitted by the modified bioluminescent protein is shorter than the duration of bioluminescence emitted by an unmodified form of the bioluminescent protein.

  9. Protein domain prediction

    NARCIS (Netherlands)

    Ingolfsson, Helgi; Yona, Golan

    2008-01-01

    Domains are considered to be the building blocks of protein structures. A protein can contain a single domain or multiple domains, each one typically associated with a specific function. The combination of domains determines the function of the protein, its subcellular localization and the interacti

  10. CSF total protein

    Science.gov (United States)

    CSF total protein is a test to determine the amount of protein in your spinal fluid, also called cerebrospinal fluid (CSF). ... The normal protein range varies from lab to lab, but is typically about 15 to 60 mg/dL. Note: mg/dL = ...

  11. Modeling Protein Domain Function

    Science.gov (United States)

    Baker, William P.; Jones, Carleton "Buck"; Hull, Elizabeth

    2007-01-01

    This simple but effective laboratory exercise helps students understand the concept of protein domain function. They use foam beads, Styrofoam craft balls, and pipe cleaners to explore how domains within protein active sites interact to form a functional protein. The activity allows students to gain content mastery and an understanding of the…

  12. Protein - Which is Best?

    Science.gov (United States)

    Hoffman, Jay R; Falvo, Michael J

    2004-09-01

    Protein intake that exceeds the recommended daily allowance is widely accepted for both endurance and power athletes. However, considering the variety of proteins that are available much less is known concerning the benefits of consuming one protein versus another. The purpose of this paper is to identify and analyze key factors in order to make responsible recommendations to both the general and athletic populations. Evaluation of a protein is fundamental in determining its appropriateness in the human diet. Proteins that are of inferior content and digestibility are important to recognize and restrict or limit in the diet. Similarly, such knowledge will provide an ability to identify proteins that provide the greatest benefit and should be consumed. The various techniques utilized to rate protein will be discussed. Traditionally, sources of dietary protein are seen as either being of animal or vegetable origin. Animal sources provide a complete source of protein (i.e. containing all essential amino acids), whereas vegetable sources generally lack one or more of the essential amino acids. Animal sources of dietary protein, despite providing a complete protein and numerous vitamins and minerals, have some health professionals concerned about the amount of saturated fat common in these foods compared to vegetable sources. The advent of processing techniques has shifted some of this attention and ignited the sports supplement marketplace with derivative products such as whey, casein and soy. Individually, these products vary in quality and applicability to certain populations. The benefits that these particular proteins possess are discussed. In addition, the impact that elevated protein consumption has on health and safety issues (i.e. bone health, renal function) are also reviewed. Key PointsHigher protein needs are seen in athletic populations.Animal proteins is an important source of protein, however potential health concerns do exist from a diet of protein

  13. Highly thermostable fluorescent proteins

    Science.gov (United States)

    Bradbury, Andrew M.; Waldo, Geoffrey S.; Kiss, Csaba

    2011-03-22

    Thermostable fluorescent proteins (TSFPs), methods for generating these and other stability-enhanced proteins, polynucleotides encoding such proteins, and assays and method for using the TSFPs and TSFP-encoding nucleic acid molecules are provided. The TSFPs of the invention show extremely enhanced levels of stability and thermotolerance. In one case, for example, a TSFP of the invention is so stable it can be heated to 99.degree. C. for short periods of time without denaturing, and retains 85% of its fluorescence when heated to 80.degree. C. for several minutes. The invention also provides a method for generating stability-enhanced variants of a protein, including but not limited to fluorescent proteins.

  14. Protein hydration and dynamics

    International Nuclear Information System (INIS)

    Inelastic neutron scattering can measure the protein thermal fluctuations under the physiological aqueous environment, especially it is powerful to observe the low-energy protein dynamics in THz region, which are revealed theoretically to be coupled with solvations. Neutron enables the selective observation of protein and hydration water by deuteration. The complementary analysis with molecular dynamics simulation is also effective for the study of protein hydration. Some examples of the application toward the understanding of molecular basis of protein functions will be introduced. (author)

  15. Protein crystallization with paper

    Science.gov (United States)

    Matsuoka, Miki; Kakinouchi, Keisuke; Adachi, Hiroaki; Maruyama, Mihoko; Sugiyama, Shigeru; Sano, Satoshi; Yoshikawa, Hiroshi Y.; Takahashi, Yoshinori; Yoshimura, Masashi; Matsumura, Hiroyoshi; Murakami, Satoshi; Inoue, Tsuyoshi; Mori, Yusuke; Takano, Kazufumi

    2016-05-01

    We developed a new protein crystallization method that incorporates paper. A small piece of paper, such as facial tissue or KimWipes, was added to a drop of protein solution in the traditional sitting drop vapor diffusion technique, and protein crystals grew by incorporating paper. By this method, we achieved the growth of protein crystals with reducing osmotic shock. Because the technique is very simple and the materials are easy to obtain, this method will come into wide use for protein crystallization. In the future, it could be applied to nanoliter-scale crystallization screening on a paper sheet such as in inkjet printing.

  16. Protein and vegetarian diets.

    Science.gov (United States)

    Marsh, Kate A; Munn, Elizabeth A; Baines, Surinder K

    2013-08-19

    A vegetarian diet can easily meet human dietary protein requirements as long as energy needs are met and a variety of foods are eaten. Vegetarians should obtain protein from a variety of plant sources, including legumes, soy products, grains, nuts and seeds. Eggs and dairy products also provide protein for those following a lacto-ovo-vegetarian diet. There is no need to consciously combine different plant proteins at each meal as long as a variety of foods are eaten from day to day, because the human body maintains a pool of amino acids which can be used to complement dietary protein. The consumption of plant proteins rather than animal proteins by vegetarians may contribute to their reduced risk of chronic diseases such as diabetes and heart disease. PMID:25369930

  17. Protein kinesis: The dynamics of protein trafficking and stability

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1995-12-31

    The purpose of this conference is to provide a multidisciplinary forum for exchange of state-of-the-art information on protein kinesis. This volume contains abstracts of papers in the following areas: protein folding and modification in the endoplasmic reticulum; protein trafficking; protein translocation and folding; protein degradation; polarity; nuclear trafficking; membrane dynamics; and protein import into organelles.

  18. Protein Electrophoresis/Immunofixation Electrophoresis

    Science.gov (United States)

    ... be limited. Home Visit Global Sites Search Help? Protein Electrophoresis Immunofixation Electrophoresis Share this page: Was this page helpful? Also known as: Serum Protein Electrophoresis; Protein ELP; SPE; SPEP; Urine Protein Electrophoresis; ...

  19. Protein: FEB6 [TP Atlas

    Lifescience Database Archive (English)

    Full Text Available FEB6 Photoresponse regulatory proteins HD1 SE1 Zinc finger protein HD1 Protein CONSTANS-like, Pr ... otein HEADING DATE 1, Protein PHOTOPERIOD SENSITIVITY ... 1 39947 Oryza sativa subsp. japonica 4340746 Q9FDX ...

  20. Identifying novel protein phenotype annotations by hybridizing protein-protein interactions and protein sequence similarities.

    Science.gov (United States)

    Chen, Lei; Zhang, Yu-Hang; Huang, Tao; Cai, Yu-Dong

    2016-04-01

    Studies of protein phenotypes represent a central challenge of modern genetics in the post-genome era because effective and accurate investigation of protein phenotypes is one of the most critical procedures to identify functional biological processes in microscale, which involves the analysis of multifactorial traits and has greatly contributed to the development of modern biology in the post genome era. Therefore, we have developed a novel computational method that identifies novel proteins associated with certain phenotypes in yeast based on the protein-protein interaction network. Unlike some existing network-based computational methods that identify the phenotype of a query protein based on its direct neighbors in the local network, the proposed method identifies novel candidate proteins for a certain phenotype by considering all annotated proteins with this phenotype on the global network using a shortest path (SP) algorithm. The identified proteins are further filtered using both a permutation test and their interactions and sequence similarities to annotated proteins. We compared our method with another widely used method called random walk with restart (RWR). The biological functions of proteins for each phenotype identified by our SP method and the RWR method were analyzed and compared. The results confirmed a large proportion of our novel protein phenotype annotation, and the RWR method showed a higher false positive rate than the SP method. Our method is equally effective for the prediction of proteins involving in all the eleven clustered yeast phenotypes with a quite low false positive rate. Considering the universality and generalizability of our supporting materials and computing strategies, our method can further be applied to study other organisms and the new functions we predicted can provide pertinent instructions for the further experimental verifications. PMID:26728152

  1. Sensitizing properties of proteins

    DEFF Research Database (Denmark)

    Poulsen, Lars K.; Ladics, Gregory S; McClain, Scott;

    2014-01-01

    The scope of allergy risk is diverse considering the myriad ways in which protein allergenicity is affected by physiochemical characteristics of proteins. The complexity created by the matrices of foods and the variability of the human immune system add additional challenges to understanding the...... relationship between sensitization potential and allergy disease. To address these and other issues, an April 2012 international symposium was held in Prague, Czech Republic, to review and discuss the state-of-the-science of sensitizing properties of protein allergens. The symposium, organized by the Protein...... scientists from academia, government, and industry participated in the symposium. Experts provided overviews on known mechanisms by which proteins in food may cause sensitization, discussed experimental models to predict protein sensitizing potential, and explored whether such experimental techniques may be...

  2. NMR of unfolded proteins

    Indian Academy of Sciences (India)

    Amarnath Chtterjee; Ashutosh Kumar; Jeetender Chugh; Sudha Srivastava; Neel S Bhavesh; Ramakrishna V Hosur

    2005-01-01

    In the post-genomic era, as more and more genome sequences are becoming known and hectic efforts are underway to decode the information content in them, it is becoming increasingly evident that flexibility in proteins plays a crucial role in many of the biological functions. Many proteins have intrinsic disorder either wholly or in specific regions. It appears that this disorder may be important for regulatory functions of the proteins, on the one hand, and may help in directing the folding process to reach the compact native state, on the other. Nuclear magnetic resonance (NMR) has over the last two decades emerged as the sole, most powerful technique to help characterize these disordered protein systems. In this review, we first discuss the significance of disorder in proteins and then describe the recent developments in NMR methods for their characterization. A brief description of the results obtained on several disordered proteins is presented at the end.

  3. Computational Protein Design

    DEFF Research Database (Denmark)

    Johansson, Kristoffer Enøe

    to a central method that enables new developments. For example, novel enzymes with functions not found in natural proteins have been de novo designed to give enough activity for experimental optimization. This thesis presents the current state-of-the-art within computational design methods together......Proteins are the major functional group of molecules in biology. The impact of protein science on medicine and chemical productions is rapidly increasing. However, the greatest potential remains to be realized. The fi eld of protein design has advanced computational modeling from a tool of support...... with a novel method based on probability theory. With the aim of assembling a complete pipeline for protein design, this work touches upon several aspects of protein design. The presented work is the computational half of a design project where the other half is dedicated to the experimental part of...

  4. Protein Models Comparator

    CERN Document Server

    Widera, Paweł

    2011-01-01

    The process of comparison of computer generated protein structural models is an important element of protein structure prediction. It has many uses including model quality evaluation, selection of the final models from a large set of candidates or optimisation of parameters of energy functions used in template free modelling and refinement. Although many protein comparison methods are available online on numerous web servers, their ability to handle a large scale model comparison is often very limited. Most of the servers offer only a single pairwise structural comparison, and they usually do not provide a model-specific comparison with a fixed alignment between the models. To bridge the gap between the protein and model structure comparison we have developed the Protein Models Comparator (pm-cmp). To be able to deliver the scalability on demand and handle large comparison experiments the pm-cmp was implemented "in the cloud". Protein Models Comparator is a scalable web application for a fast distributed comp...

  5. Protein oxidation and peroxidation.

    Science.gov (United States)

    Davies, Michael J

    2016-04-01

    Proteins are major targets for radicals and two-electron oxidants in biological systems due to their abundance and high rate constants for reaction. With highly reactive radicals damage occurs at multiple side-chain and backbone sites. Less reactive species show greater selectivity with regard to the residues targeted and their spatial location. Modification can result in increased side-chain hydrophilicity, side-chain and backbone fragmentation, aggregation via covalent cross-linking or hydrophobic interactions, protein unfolding and altered conformation, altered interactions with biological partners and modified turnover. In the presence of O2, high yields of peroxyl radicals and peroxides (protein peroxidation) are formed; the latter account for up to 70% of the initial oxidant flux. Protein peroxides can oxidize both proteins and other targets. One-electron reduction results in additional radicals and chain reactions with alcohols and carbonyls as major products; the latter are commonly used markers of protein damage. Direct oxidation of cysteine (and less commonly) methionine residues is a major reaction; this is typically faster than with H2O2, and results in altered protein activity and function. Unlike H2O2, which is rapidly removed by protective enzymes, protein peroxides are only slowly removed, and catabolism is a major fate. Although turnover of modified proteins by proteasomal and lysosomal enzymes, and other proteases (e.g. mitochondrial Lon), can be efficient, protein hydroperoxides inhibit these pathways and this may contribute to the accumulation of modified proteins in cells. Available evidence supports an association between protein oxidation and multiple human pathologies, but whether this link is causal remains to be established. PMID:27026395

  6. Proteins at interfaces

    OpenAIRE

    Evers, Florian

    2011-01-01

    Protein adsorption is a fundamental and ubiquitous phenomenon, which has severe implications in the fields of biomaterials as well as bio- and nanotechnology, e.g., in drug delivery, biofouling, the biocompatibility of implants, food chemistry, and biosensors. Therefore, the mechanisms of protein adsorption and controlling the interfacial affinity of proteins have become intriguing and interdisciplinary research topics. In this work, X-ray and neutron reflectometry are the main...

  7. Protein-surfactant interactions

    OpenAIRE

    Valstar, Ank

    2000-01-01

    Protein-surfactant interactions in aqueous media have been investigated. The globular proteins lysozyme and bovine serum albumin (BSA) served as model proteins. Several ionic and non-ionic surfactants were used. Fluorescence probe measurements showed that at low sodium dodecyl sulfate (SDS) concentration (< 0.1 M) one micelle-like SDS cluster is bound to lysozyme. From dynamic light scattering (DLS) results it was observed that lysozyme in the complex does not correspond to the fully unfol...

  8. Pressure cryocooling protein crystals

    Science.gov (United States)

    Kim, Chae Un; Gruner, Sol M.

    2011-10-04

    Preparation of cryocooled protein crystal is provided by use of helium pressurizing and cryocooling to obtain cryocooled protein crystal allowing collection of high resolution data and by heavier noble gas (krypton or xenon) binding followed by helium pressurizing and cryocooling to obtain cryocooled protein crystal for collection of high resolution data and SAD phasing simultaneously. The helium pressurizing is carried out on crystal coated to prevent dehydration or on crystal grown in aqueous solution in a capillary.

  9. Biofilm Matrix Proteins

    OpenAIRE

    Fong, Jiunn N. C.; Yildiz, Fitnat H.

    2015-01-01

    Proteinaceous components of the biofilm matrix include secreted extracellular proteins, cell surface adhesins and protein subunits of cell appendages such as flagella and pili. Biofilm matrix proteins play diverse roles in biofilm formation and dissolution. They are involved in attaching cells to surfaces, stabilizing the biofilm matrix via interactions with exopolysaccharide and nucleic acid components, developing three-dimensional biofilm architectures, and dissolving biofilm matrix via enz...

  10. Ribosome-inactivating proteins

    OpenAIRE

    Walsh, Matthew J; Dodd, Jennifer E; Hautbergue, Guillaume M.

    2013-01-01

    Ribosome-inactivating proteins (RIPs) were first isolated over a century ago and have been shown to be catalytic toxins that irreversibly inactivate protein synthesis. Elucidation of atomic structures and molecular mechanism has revealed these proteins to be a diverse group subdivided into two classes. RIPs have been shown to exhibit RNA N-glycosidase activity and depurinate the 28S rRNA of the eukaryotic 60S ribosomal subunit. In this review, we compare archetypal RIP family members with oth...

  11. Trisulfides in Proteins

    DEFF Research Database (Denmark)

    Nielsen, Rasmus W.; Tachibana, Christine; Hansen, Niels Erik;

    2011-01-01

    post-translational modification, and the number of proteins in which a trisulfide has been unambiguously identified is small. Nevertheless, we believe that its prevalence may be underestimated, particularly with the increasing evidence for significant pools of sulfides in living tissues and their...... possible roles in cellular metabolism. This review focuses on examples of proteins that are known to contain a trisulfide bridge, and gives an overview of the chemistry of trisulfide formation, and the methods by which it is detected in proteins....

  12. Staining Proteins in Gels

    OpenAIRE

    Gallagher, Sean; Chakavarti, Deb

    2008-01-01

    Following separation by electrophoretic methods, proteins in a gel can be detected by several staining methods. This unit describes protocols for detecting proteins by four popular methods. Coomassie blue staining is an easy and rapid method. Silver staining, while more time consuming, is considerably more sensitive and can thus be used to detect smaller amounts of protein. Fluorescent staining is a popular alternative to traditional staining procedures, mainly because it is more sensitive th...

  13. Acanthamoeba castellanii STAT protein.

    Science.gov (United States)

    Kicinska, Anna; Leluk, Jacek; Jarmuszkiewicz, Wieslawa

    2014-01-01

    STAT (signal transducers and activators of transcription) proteins are one of the important mediators of phosphotyrosine-regulated signaling in metazoan cells. We described the presence of STAT protein in a unicellular, free-living amoebae with a simple life cycle, Acanthamoeba castellanii. A. castellanii is the only, studied to date, Amoebozoan that does not belong to Mycetozoa but possesses STATs. A sequence of the A. castellanii STAT protein includes domains similar to those of the Dictyostelium STAT proteins: a coiled coil (characteristic for Dictyostelium STAT coiled coil), a STAT DNA-binding domain and a Src-homology domain. The search for protein sequences homologous to A. castellanii STAT revealed 17 additional sequences from lower eukaryotes. Interestingly, all of these sequences come from Amoebozoa organisms that belong to either Mycetozoa (slime molds) or Centramoebida. We showed that there are four separated clades within the slime mold STAT proteins. The A. castellanii STAT protein branches next to a group of STATc proteins from Mycetozoa. We also demonstrate that Amoebozoa form a distinct monophyletic lineage within the STAT protein world that is well separated from the other groups. PMID:25338074

  14. Acanthamoeba castellanii STAT protein.

    Directory of Open Access Journals (Sweden)

    Anna Kicinska

    Full Text Available STAT (signal transducers and activators of transcription proteins are one of the important mediators of phosphotyrosine-regulated signaling in metazoan cells. We described the presence of STAT protein in a unicellular, free-living amoebae with a simple life cycle, Acanthamoeba castellanii. A. castellanii is the only, studied to date, Amoebozoan that does not belong to Mycetozoa but possesses STATs. A sequence of the A. castellanii STAT protein includes domains similar to those of the Dictyostelium STAT proteins: a coiled coil (characteristic for Dictyostelium STAT coiled coil, a STAT DNA-binding domain and a Src-homology domain. The search for protein sequences homologous to A. castellanii STAT revealed 17 additional sequences from lower eukaryotes. Interestingly, all of these sequences come from Amoebozoa organisms that belong to either Mycetozoa (slime molds or Centramoebida. We showed that there are four separated clades within the slime mold STAT proteins. The A. castellanii STAT protein branches next to a group of STATc proteins from Mycetozoa. We also demonstrate that Amoebozoa form a distinct monophyletic lineage within the STAT protein world that is well separated from the other groups.

  15. Consensus protein design

    Science.gov (United States)

    Porebski, Benjamin T.; Buckle, Ashley M.

    2016-01-01

    A popular and successful strategy in semi-rational design of protein stability is the use of evolutionary information encapsulated in homologous protein sequences. Consensus design is based on the hypothesis that at a given position, the respective consensus amino acid contributes more than average to the stability of the protein than non-conserved amino acids. Here, we review the consensus design approach, its theoretical underpinnings, successes, limitations and challenges, as well as providing a detailed guide to its application in protein engineering. PMID:27274091

  16. Engineering therapeutic protein disaggregases

    Science.gov (United States)

    Shorter, James

    2016-01-01

    Therapeutic agents are urgently required to cure several common and fatal neurodegenerative disorders caused by protein misfolding and aggregation, including amyotrophic lateral sclerosis (ALS), Parkinson’s disease (PD), and Alzheimer’s disease (AD). Protein disaggregases that reverse protein misfolding and restore proteins to native structure, function, and localization could mitigate neurodegeneration by simultaneously reversing 1) any toxic gain of function of the misfolded form and 2) any loss of function due to misfolding. Potentiated variants of Hsp104, a hexameric AAA+ ATPase and protein disaggregase from yeast, have been engineered to robustly disaggregate misfolded proteins connected with ALS (e.g., TDP-43 and FUS) and PD (e.g., α-synuclein). However, Hsp104 has no metazoan homologue. Metazoa possess protein disaggregase systems distinct from Hsp104, including Hsp110, Hsp70, and Hsp40, as well as HtrA1, which might be harnessed to reverse deleterious protein misfolding. Nevertheless, vicissitudes of aging, environment, or genetics conspire to negate these disaggregase systems in neurodegenerative disease. Thus, engineering potentiated human protein disaggregases or isolating small-molecule enhancers of their activity could yield transformative therapeutics for ALS, PD, and AD. PMID:27255695

  17. Simulations of Protein Folding

    CERN Document Server

    Cahill, M; Cahill, K E; Cahill, Michael; Fleharty, Mark; Cahill, Kevin

    2000-01-01

    We have developed a simple, phenomenological, Monte-Carlo code that predicts the three-dimensional structure of globular proteins from the DNA sequences that define them. We have applied this code to two small proteins, the villin headpiece (1VII) and cole1 rop (1ROP). Our code folded the 36-residue villin headpiece to a mean rms distance of less than 5 A from its native structure as revealed by NMR; it folded a 56-residue fragment of the protein cole1 rop to within 11 A of its native structure. The denatured starting configurations of these two proteins were, respectively, 29 A and 55 A distant from their native structures.

  18. Ultrafiltration of pegylated proteins

    Science.gov (United States)

    Molek, Jessica R.

    There is considerable clinical interest in the use of "second-generation" therapeutics produced by conjugation of a native protein with various polymers including polyethylene glycol (PEG). PEG--protein conjugates, so-called PEGylated proteins, can exhibit enhanced stability, half-life, and bioavailability. One of the challenges in the commercial production of PEGylated proteins is the purification required to remove unreacted polymer, native protein, and in many cases PEGylated proteins with nonoptimal degrees of conjugation. The overall objective of this thesis was to examine the use of ultrafiltration for the purification of PEGylated proteins. This included: (1) analysis of size-based separation of PEGylated proteins using conventional ultrafiltration membranes, (2) use of electrically-charged membranes to exploit differences in electrostatic interactions, and (3) examination of the effects of PEGylation on protein fouling. The experimental results were analyzed using appropriate theoretical models, with the underlying physical properties of the PEGylated proteins evaluated using size exclusion chromatography, capillary electrophoresis, dynamic light scattering, and reverse phase chromatography. PEGylated proteins were produced by covalent attachment of activated PEG to a protein via primary amines on the lysine residues. A simple model was developed for the reaction kinetics, which was used to explore the effect of reaction conditions and mode of operation on the distribution of PEGylated products. The effective size of the PEGylated proteins was evaluated using size exclusion chromatography, with appropriate correlations developed for the size in terms of the molecular weight of the native protein and attached PEG. The electrophoretic mobility of the PEGylated proteins were evaluated by capillary electrophoresis with the data in good agreement with a simple model accounting for the increase in protein size and the reduction in the number of protonated amine

  19. How Many Protein-Protein Interactions Types Exist in Nature?

    OpenAIRE

    Garma, Leonardo; Mukherjee, Srayanta; Mitra, Pralay; Zhang, Yang

    2012-01-01

    Protein quaternary structure universe” refers to the ensemble of all protein-protein complexes across all organisms in nature. The number of quaternary folds thus corresponds to the number of ways proteins physically interact with other proteins. This study focuses on answering two basic questions: Whether the number of protein-protein interactions is limited and, if yes, how many different quaternary folds exist in nature. By all-to-all sequence and structure comparisons, we grouped the pro...

  20. How Many Protein-Protein Interactions Types Exist in Nature?

    OpenAIRE

    Leonardo Garma; Srayanta Mukherjee; Pralay Mitra; Yang Zhang

    2012-01-01

    "Protein quaternary structure universe" refers to the ensemble of all protein-protein complexes across all organisms in nature. The number of quaternary folds thus corresponds to the number of ways proteins physically interact with other proteins. This study focuses on answering two basic questions: Whether the number of protein-protein interactions is limited and, if yes, how many different quaternary folds exist in nature. By all-to-all sequence and structure comparisons, we grouped the pro...

  1. Explicit model predictive control applications in power systems: an AGC study for an isolated industrial system

    DEFF Research Database (Denmark)

    Jiang, Hao; Lin, Jin; Song, Yonghua;

    2016-01-01

    that an improved partition algorithm of EMPC is studied which enables the EMPC method to be extended to a system of large number of state variables and more constraints. A simple single generator single load case is used to illustrate the whole procedure of EMPC and then the EMPC is applied to an...

  2. The cementless AGC 2000 knee prosthesis: 20-year results in a consecutive series

    DEFF Research Database (Denmark)

    Eriksen, Jamila; Christensen, Jan; Solgaard, Søren;

    2009-01-01

    survivorship analyses. All patients could be accounted for. With prosthesis revision as a failure criterion, the cumulative survival rate of all prosthetic components at 20 years was 84.4%. The fall in success rate was primarily due to early tibial and late patellar component failure. The cumulative survival...

  3. Protein (Cyanobacteria): 286011 [

    Lifescience Database Archive (English)

    Full Text Available YP_007057271.1 1117:4890 1161:684 1185:224 373984:129 373994:129 histidine kinase,PAS ... domain-con ... taining protein,PAS ... domain-containing protein,histidine kinase,GAF dom ...

  4. Protein (Viridiplantae): 357488463 [

    Lifescience Database Archive (English)

    Full Text Available XP_003614519.1 33090:2423 35493:1202 131221:1202 3193:1202 58023:2056 78536:1595 58024:1595 3398 ... 938 3814:1938 163742:3028 3877:3028 3880:3028 Cyst nematode ... resistance protein-like protein Medicago truncatul ...

  5. Poxviral Ankyrin Proteins

    Directory of Open Access Journals (Sweden)

    Michael H. Herbert

    2015-02-01

    Full Text Available Multiple repeats of the ankyrin motif (ANK are ubiquitous throughout the kingdoms of life but are absent from most viruses. The main exception to this is the poxvirus family, and specifically the chordopoxviruses, with ANK repeat proteins present in all but three species from separate genera. The poxviral ANK repeat proteins belong to distinct orthologue groups spread over different species, and align well with the phylogeny of their genera. This distribution throughout the chordopoxviruses indicates these proteins were present in an ancestral vertebrate poxvirus, and have since undergone numerous duplication events. Most poxviral ANK repeat proteins contain an unusual topology of multiple ANK motifs starting at the N-terminus with a C-terminal poxviral homologue of the cellular F-box enabling interaction with the cellular SCF ubiquitin ligase complex. The subtle variations between ANK repeat proteins of individual poxviruses suggest an array of different substrates may be bound by these protein-protein interaction domains and, via the F-box, potentially directed to cellular ubiquitination pathways and possible degradation. Known interaction partners of several of these proteins indicate that the NF-κB coordinated anti-viral response is a key target, whilst some poxviral ANK repeat domains also have an F-box independent affect on viral host-range.

  6. Protein (Viridiplantae): 186478918 [

    Lifescience Database Archive (English)

    Full Text Available NP_001117362.1 33090:264 35493:490 131221:490 3193:490 58023:763 78536:5554 58024:5554 3398:5554 ... 88 3699:588 3700:588 980083:588 3701:588 3702:2514 StaR -like protein domain-containing protein Arabidopsis ...

  7. Protein (Viridiplantae): 145336153 [

    Lifescience Database Archive (English)

    Full Text Available NP_174031.2 33090:264 35493:490 131221:490 3193:490 58023:763 78536:5554 58024:5554 3398:5554 71 ... 88 3699:588 3700:588 980083:588 3701:588 3702:2514 StaR -like protein domain-containing protein Arabidopsis ...

  8. Protein (Viridiplantae): 186478920 [

    Lifescience Database Archive (English)

    Full Text Available NP_001117363.1 33090:264 35493:490 131221:490 3193:490 58023:763 78536:5554 58024:5554 3398:5554 ... 88 3699:588 3700:588 980083:588 3701:588 3702:2514 StaR -like protein domain-containing protein Arabidopsis ...

  9. Protein (Viridiplantae): 18396209 [

    Lifescience Database Archive (English)

    Full Text Available NP_564271.1 33090:264 35493:490 131221:490 3193:490 58023:763 78536:5554 58024:5554 3398:5554 71 ... 88 3699:588 3700:588 980083:588 3701:588 3702:2514 StaR -like protein domain-containing protein Arabidopsis ...

  10. Proteins in biomass streams

    NARCIS (Netherlands)

    Mulder, W.J.

    2010-01-01

    The focus of this study is to give an overview of traditional and new biomasses and biomass streams that contain proteins. When information was available, the differences in molecular structure and physical and chemical properties for the different proteins is given. For optimal biomass use, isolati

  11. Protein (Cyanobacteria): 187726 [

    Lifescience Database Archive (English)

    Full Text Available ZP_00515693.1 1117:3739 1118:294 263510:556 263511:556 165597:1102 Cobalamin synthesis ... protein/P ... 47K:Cobalamin synthesis ... protein/P47K Crocosphaera watsonii WH 8501 MHKIPVT ...

  12. Protein (Cyanobacteria): 187721 [

    Lifescience Database Archive (English)

    Full Text Available ZP_00515086.1 1117:3739 1118:294 263510:556 263511:556 165597:1102 Cobalamin synthesis ... protein/P ... 47K:Cobalamin synthesis ... protein/P47K Crocosphaera watsonii WH 8501 MSGINQQ ...

  13. Protein (Cyanobacteria): 187724 [

    Lifescience Database Archive (English)

    Full Text Available ZP_00514782.1 1117:3739 1118:294 263510:556 263511:556 165597:1102 Cobalamin synthesis ... protein/P ... 47K:Cobalamin synthesis ... protein/P47K Crocosphaera watsonii WH 8501 MQIVDKK ...

  14. Protein (Cyanobacteria): 187722 [

    Lifescience Database Archive (English)

    Full Text Available ZP_00515750.1 1117:3739 1118:294 263510:556 263511:556 165597:1102 Cobalamin synthesis ... protein/P ... 47K:Cobalamin synthesis ... protein/P47K Crocosphaera watsonii WH 8501 MTPLNFN ...

  15. Protein (Cyanobacteria): 187723 [

    Lifescience Database Archive (English)

    Full Text Available ZP_00515087.1 1117:3739 1118:294 263510:556 263511:556 165597:1102 Cobalamin synthesis ... protein/P ... 47K:Cobalamin synthesis ... protein/P47K Crocosphaera watsonii WH 8501 MTRLDFN ...

  16. Protein (Viridiplantae): 15240110 [

    Lifescience Database Archive (English)

    Full Text Available NP_201488.1 33090:325 35493:1944 131221:1944 3193:1944 58023:3713 78536:2650 58024:2650 3398:265 ... :1852 LOB domain-containing protein 36 (ASYMMETRIC LEAVES ... 2-like protein 1) Arabidopsis thaliana MASSSSPCAAC ...

  17. Protein (Viridiplantae): 357505877 [

    Lifescience Database Archive (English)

    Full Text Available XP_003623227.1 33090:2309 35493:2314 131221:2314 3193:2314 58023:1780 78536:1486 58024:1486 3398 ... 163742:9849 3877:9849 3880:9849 Cell cycle control crn ... (Crooked neck) protein-like protein Medicago trunc ...

  18. Protein (Viridiplantae): 357472389 [

    Lifescience Database Archive (English)

    Full Text Available XP_003606479.1 33090:29954 35493:20452 131221:20452 3193:20452 58023:15679 78536:15788 58024:157 ... 2228 163742:12813 3877:12813 3880:12813 Defects in morphology ... protein-like protein Medicago truncatula MAETSSSNN ...

  19. Protein (Viridiplantae): 357472385 [

    Lifescience Database Archive (English)

    Full Text Available XP_003606477.1 33090:29954 35493:20452 131221:20452 3193:20452 58023:15679 78536:15788 58024:157 ... 2228 163742:12813 3877:12813 3880:12813 Defects in morphology ... protein-like protein Medicago truncatula MAETSSSNN ...

  20. Protein (Viridiplantae): 357440307 [

    Lifescience Database Archive (English)

    Full Text Available XP_003590431.1 33090:29954 35493:20452 131221:20452 3193:20452 58023:15679 78536:15788 58024:157 ... 2228 163742:12813 3877:12813 3880:12813 Defects in morphology ... protein-like protein Medicago truncatula MAGTSSKIP ...

  1. Protein (Viridiplantae): 357444551 [

    Lifescience Database Archive (English)

    Full Text Available XP_003592553.1 33090:29954 35493:20452 131221:20452 3193:20452 58023:15679 78536:15788 58024:157 ... 2228 163742:12813 3877:12813 3880:12813 Defects in morphology ... protein-like protein Medicago truncatula MAGTSSKIP ...

  2. C-reactive protein

    Science.gov (United States)

    C-reactive protein (CRP) is produced by the liver. The level of CRP rises when there is inflammation throughout the body. It is one of a group of proteins called "acute phase reactants" that go up in response to inflammation. ...

  3. Protein (Viridiplantae): 18414878 [

    Lifescience Database Archive (English)

    Full Text Available NP_567527.1 33090:1722 35493:20777 131221:20777 3193:20777 58023:13588 78536:13546 58024:13546 3 ... 83:5979 3701:5979 3702:6150 Tryptophan RNA-binding attenuator ... protein-like protein Arabidopsis thaliana MAAPFFST ...

  4. Protein (Viridiplantae): 238480800 [

    Lifescience Database Archive (English)

    Full Text Available NP_001154247.1 33090:1722 35493:20777 131221:20777 3193:20777 58023:13588 78536:13546 58024:1354 ... 83:5979 3701:5979 3702:6150 Tryptophan RNA-binding attenuator ... protein-like protein Arabidopsis thaliana MAAPFFST ...

  5. Protein (Viridiplantae): 238480798 [

    Lifescience Database Archive (English)

    Full Text Available NP_001154246.1 33090:1722 35493:20777 131221:20777 3193:20777 58023:13588 78536:13546 58024:1354 ... 83:5979 3701:5979 3702:6150 Tryptophan RNA-binding attenuator ... protein-like protein Arabidopsis thaliana MAAPFFST ...

  6. Protein (Cyanobacteria): 305313 [

    Lifescience Database Archive (English)

    Full Text Available ZP_09781770.1 1117:5986 1150:1684 35823:2516 376219:684 Cytochrome b6-f complex iron -sulfur subu ... nit 1 (Rieske iron -sulfur protein 1) (Plastohydroquinone:plastocyanin ... oxidoreductase iron -sulfur protein 1) (ISP 1) (RISP 1) Arthrospira sp. ...

  7. Protein Attachment on Nanodiamonds.

    Science.gov (United States)

    Lin, Chung-Lun; Lin, Cheng-Huang; Chang, Huan-Cheng; Su, Meng-Chih

    2015-07-16

    A recent advance in nanotechnology is the scale-up production of small and nonaggregated diamond nanoparticles suitable for biological applications. Using detonation nanodiamonds (NDs) with an average diameter of ∼4 nm as the adsorbents, we have studied the static attachment of three proteins (myoglobin, bovine serum albumin, and insulin) onto the nanoparticles by optical spectroscopy, mass spectrometry, and dynamic light scattering, and electrophoretic zeta potential measurements. Results show that the protein surface coverage is predominantly determined by the competition between protein-protein and protein-ND interactions, giving each protein a unique and characteristic structural configuration in its own complex. Specifically, both myoglobin and bovine serum albumin show a Langmuir-type adsorption behavior, forming 1:1 complexes at saturation, whereas insulin folds into a tightly bound multimer before adsorption. The markedly different adsorption patterns appear to be independent of the protein concentration and are closely related to the affinity of the individual proteins for the NDs. The present study provides a fundamental understanding for the use of NDs as a platform for nanomedical drug delivery. PMID:25815400

  8. Protein sequence databases.

    Science.gov (United States)

    Apweiler, Rolf; Bairoch, Amos; Wu, Cathy H

    2004-02-01

    A variety of protein sequence databases exist, ranging from simple sequence repositories, which store data with little or no manual intervention in the creation of the records, to expertly curated universal databases that cover all species and in which the original sequence data are enhanced by the manual addition of further information in each sequence record. As the focus of researchers moves from the genome to the proteins encoded by it, these databases will play an even more important role as central comprehensive resources of protein information. Several the leading protein sequence databases are discussed here, with special emphasis on the databases now provided by the Universal Protein Knowledgebase (UniProt) consortium. PMID:15036160

  9. Manipulating and Visualizing Proteins

    Energy Technology Data Exchange (ETDEWEB)

    Simon, Horst D.

    2003-12-05

    ProteinShop Gives Researchers a Hands-On Tool for Manipulating, Visualizing Protein Structures. The Human Genome Project and other biological research efforts are creating an avalanche of new data about the chemical makeup and genetic codes of living organisms. But in order to make sense of this raw data, researchers need software tools which let them explore and model data in a more intuitive fashion. With this in mind, researchers at Lawrence Berkeley National Laboratory and the University of California, Davis, have developed ProteinShop, a visualization and modeling program which allows researchers to manipulate protein structures with pinpoint control, guided in large part by their own biological and experimental instincts. Biologists have spent the last half century trying to unravel the ''protein folding problem,'' which refers to the way chains of amino acids physically fold themselves into three-dimensional proteins. This final shape, which resembles a crumpled ribbon or piece of origami, is what determines how the protein functions and translates genetic information. Understanding and modeling this geometrically complex formation is no easy matter. ProteinShop takes a given sequence of amino acids and uses visualization guides to help generate predictions about the secondary structures, identifying alpha helices and flat beta strands, and the coil regions that bind them. Once secondary structures are in place, researchers can twist and turn these pre-configurations until they come up with a number of possible tertiary structure conformations. In turn, these are fed into a computationally intensive optimization procedure that tries to find the final, three-dimensional protein structure. Most importantly, ProteinShop allows users to add human knowledge and intuition to the protein structure prediction process, thus bypassing bad configurations that would otherwise be fruitless for optimization. This saves compute cycles and accelerates

  10. MicroProteins

    DEFF Research Database (Denmark)

    Eguen, Teinai Ebimienere; Straub, Daniel; Graeff, Moritz;

    2015-01-01

    MicroProteins (miPs) are short, usually single-domain proteins that, in analogy to miRNAs, heterodimerize with their targets and exert a dominant-negative effect. Recent bioinformatic attempts to identify miPs have resulted in a list of potential miPs, many of which lack the defining...... characteristics of a miP. In this opinion article, we clearly state the characteristics of a miP as evidenced by known proteins that fit the definition; we explain why modulatory proteins misrepresented as miPs do not qualify as true miPs. We also discuss the evolutionary history of miPs, and how the miP concept...... can extend beyond transcription factors (TFs) to encompass different non-TF proteins that require dimerization for full function....

  11. The centrality of cancer proteins in human protein-protein interaction network: a revisit.

    Science.gov (United States)

    Xiong, Wei; Xie, Luyu; Zhou, Shuigeng; Liu, Hui; Guan, Jihong

    2014-01-01

    Topological analysis of protein-protein interaction (PPI) networks has been widely applied to the investigation on cancer mechanisms. However, there is still a debate on whether cancer proteins exhibit more topological centrality compared to the other proteins in the human PPI network. To resolve this debate, we first identified four sets of human proteins, and then mapped these proteins into the yeast PPI network by homologous genes. Finally, we compared these proteins' properties in human and yeast PPI networks. Experiments over two real datasets demonstrated that cancer proteins tend to have higher degree and smaller clustering coefficient than non-cancer proteins. Experimental results also validated that cancer proteins have larger betweenness centrality compared to the other proteins on the STRING dataset. However, on the BioGRID dataset, the average betweenness centrality of cancer proteins is larger than that of disease and control proteins, but smaller than that of essential proteins. PMID:24878726

  12. Protein oxidation in aquatic foods

    DEFF Research Database (Denmark)

    Baron, Caroline P.

    2014-01-01

    The chapter discusses general considerations about protein oxidation and reviews the mechanisms involved in protein oxidation and consequences of protein oxidation on fish proteins. It presents two case studies, the first deals with protein and lipid oxidation in frozen rainbow trout......, and the second with oxidation in salted herring. The mechanisms responsible for initiation of protein oxidation are unclear, but it is generally accepted that free radical species initiating lipid oxidation can also initiate protein oxidation. The chapter focuses on interaction between protein and lipid...... oxidation. The protein carbonyl group measurement is the widely used method for estimating protein oxidation in foods and has been used in fish muscle. The chapter also talks about the impact of protein oxidation on protein functionality, fish muscle texture, and food nutritional value. Protein oxidation...

  13. An Algorithm for Finding Functional Modules and Protein Complexes in Protein-Protein Interaction Networks

    OpenAIRE

    Guangyu Cui; Yu Chen; De-Shuang Huang; Kyungsook Han

    2008-01-01

    Biological processes are often performed by a group of proteins rather than by individual proteins, and proteins in a same biological group form a densely connected subgraph in a protein-protein interaction network. Therefore, finding a densely connected subgraph provides useful information to predict the function or protein complex of uncharacterized proteins in the highly connected subgraph. We have developed an efficient algorithm and program for finding cliques and near-cliques in a prote...

  14. Quantification of the Influence of Protein-Protein Interactions on Adsorbed Protein Structure and Bioactivity

    OpenAIRE

    Wei, Yang; Thyparambil, Aby A.; Latour, Robert A.

    2013-01-01

    While protein-surface interactions have been widely studied, relatively little is understood at this time regarding how protein-surface interaction effects are influenced by protein-protein interactions and how these effects combine with the internal stability of a protein to influence its adsorbed-state structure and bioactivity. The objectives of this study were to develop a method to study these combined effects under widely varying protein-protein interaction conditions using hen egg-whit...

  15. New approach for predicting protein-protein interactions

    Institute of Scientific and Technical Information of China (English)

    2007-01-01

    @@ Protein-protein interactions (PPIs) are of vital importance for virtually all processes of a living cell. The study of these associations of protein molecules could improve people's understanding of diseases and provide basis for therapeutic approaches.

  16. Analysis of correlations between protein complex and protein-protein interaction and mRNA expression

    Institute of Scientific and Technical Information of China (English)

    CAI Lun; XUE Hong; LU Hongchao; ZHAO Yi; ZHU Xiaopeng; BU Dongbo; LING Lunjiang; CHEN Runsheng

    2003-01-01

    Protein-protein interaction is a physical interaction of two proteins in living cells. In budding yeast Saccharomyces cerevisiae, large-scale protein-protein interaction data have been obtained through high-throughput yeast two-hybrid systems (Y2H) and protein complex purification techniques based on mass-spectrometry. Here, we collect 11855 interactions between total 2617 proteins. Through seriate genome-wide mRNA expression data, similarity between two genes could be measured. Protein complex data can also be obtained publicly and can be translated to pair relationship that any two proteins can only exist in the same complex or not. Analysis of protein complex data, protein-protein interaction data and mRNA expression data can elucidate correlations between them. The results show that proteins that have interactions or similar expression patterns have a higher possibility to be in the same protein complex than randomized selected proteins, and proteins which have interactions and similar expression patterns are even more possible to exist in the same protein complex. The work indicates that comprehensive integration and analysis of public large-scale bioinformatical data, such as protein complex data, protein-protein interaction data and mRNA expression data, may help to uncover their relationships and common biological information underlying these data. The strategies described here may help to integrate and analyze other functional genomic and proteomic data, such as gene expression profiling, protein-localization mapping and large-scale phenotypic data, both in yeast and in other organisms.

  17. Piezoelectric allostery of protein.

    Science.gov (United States)

    Ohnuki, Jun; Sato, Takato; Takano, Mitsunori

    2016-07-01

    Allostery is indispensable for a protein to work, where a locally applied stimulus is transmitted to a distant part of the molecule. While the allostery due to chemical stimuli such as ligand binding has long been studied, the growing interest in mechanobiology prompts the study of the mechanically stimulated allostery, the physical mechanism of which has not been established. By molecular dynamics simulation of a motor protein myosin, we found that a locally applied mechanical stimulus induces electrostatic potential change at distant regions, just like the piezoelectricity. This novel allosteric mechanism, "piezoelectric allostery", should be of particularly high value for mechanosensor/transducer proteins. PMID:27575163

  18. Alpha Shapes and Proteins

    DEFF Research Database (Denmark)

    Winter, Pawel; Sterner, Henrik; Sterner, Peter

    We provide a unified description of (weighted) alpha shapes, beta shapes and the corresponding simplicialcomplexes. We discuss their applicability to various protein-related problems. We also discuss filtrations of alpha shapes and touch upon related persistence issues.We claim that the full...... potential of alpha-shapes and related geometrical constructs in protein-related problems yet remains to be realized and verified. We suggest parallel algorithms for (weighted) alpha shapes, and we argue that future use of filtrations and kinetic variants for larger proteins will need such implementation....

  19. Protein crystallography prescreen kit

    Science.gov (United States)

    Segelke, Brent W.; Krupka, Heike I.; Rupp, Bernhard

    2005-07-12

    A kit for prescreening protein concentration for crystallization includes a multiplicity of vials, a multiplicity of pre-selected reagents, and a multiplicity of sample plates. The reagents and a corresponding multiplicity of samples of the protein in solutions of varying concentrations are placed on sample plates. The sample plates containing the reagents and samples are incubated. After incubation the sample plates are examined to determine which of the sample concentrations are too low and which the sample concentrations are too high. The sample concentrations that are optimal for protein crystallization are selected and used.

  20. Human Protein Z.

    OpenAIRE

    Broze, G J; Miletich, J P

    1984-01-01

    Protein Z was purified from human plasma by a four-step procedure which included barium citrate adsorption, ammonium sulfate fractionation, DEAE-Sepharose chromatography, and blue agarose chromatography with a yield of 20%. It is a 62,000 mol wt protein with an extinction coefficient of 12.0. The concentration of Protein Z in pooled, citrated plasma is 2.2 micrograms/ml and its half-life in patients starting warfarin anticoagulation therapy is estimated to be less than 2.5 d. The NH2-terminal...

  1. Evolution of proteins.

    Science.gov (United States)

    Dayhoff, M. O.

    1971-01-01

    The amino acid sequences of proteins from living organisms are dealt with. The structure of proteins is first discussed; the variation in this structure from one biological group to another is illustrated by the first halves of the sequences of cytochrome c, and a phylogenetic tree is derived from the cytochrome c data. The relative geological times associated with the events of this tree are discussed. Errors which occur in the duplication of cells during the evolutionary process are examined. Particular attention is given to evolution of mutant proteins, globins, ferredoxin, and transfer ribonucleic acids (tRNA's). Finally, a general outline of biological evolution is presented.

  2. The characterisation and prediction of protein-protein interfaces.

    OpenAIRE

    Kabir, T.

    2004-01-01

    Understanding how proteins interact with each other is of fundamental importance and is one of the most important goals of molecular biology. In order to study the characteristics of protein-protein interaction sites datasets of non-homologous protein-complexes have been compiled. These datasets include 142 obligate homocomplexes, 20 obligate hetero-complexes, 20 enzyme-inhibitor complexes, 15 antibody-antigen complexes, and 10 signaling complexes. Overall, the protein-protein interfaces of o...

  3. Whey Protein- The Role of Protein Supplementation in Resistance Training

    OpenAIRE

    Zimmer, Raymond

    2005-01-01

    Adequate protein intake is an important concern for many athletes who are undergoing strength-training programs. Many athletes choose to take a protein supplement, such as whey protein, in order to help them build lean muscle mass more efficiently. But the benefit of very high levels of dietary protein in resistance training remains questionable. This paper examines the effectiveness of whey protein, and other forms of protein supplements, in helping athletes augment their muscle mass. A comp...

  4. Protein-protein interaction databases: keeping up with growing interactomes

    OpenAIRE

    Lehne Benjamin; Schlitt Thomas

    2009-01-01

    Abstract Over the past few years, the number of known protein-protein interactions has increased substantially. To make this information more readily available, a number of publicly available databases have set out to collect and store protein-protein interaction data. Protein-protein interactions have been retrieved from six major databases, integrated and the results compared. The six databases (the Biological General Repository for Interaction Datasets [BioGRID], the Molecular INTeraction ...

  5. The effect of protein-protein and protein-membrane interactions on membrane fouling in ultrafiltration

    NARCIS (Netherlands)

    Huisman, I.H.; Prádanos, P.; Hernández, A.

    2000-01-01

    It was studied how protein-protein and protein-membrane interactions influence the filtration performance during the ultrafiltration of protein solutions over polymeric membranes. This was done by measuring flux, streaming potential, and protein transmission during filtration of bovine serum albumin

  6. Polymers for Protein Conjugation

    Directory of Open Access Journals (Sweden)

    Gianfranco Pasut

    2014-01-01

    Full Text Available Polyethylene glycol (PEG at the moment is considered the leading polymer for protein conjugation in view of its unique properties, as well as to its low toxicity in humans, qualities which have been confirmed by its extensive use in clinical practice. Other polymers that are safe, biodegradable and custom-designed have, nevertheless, also been investigated as potential candidates for protein conjugation. This review will focus on natural polymers and synthetic linear polymers that have been used for protein delivery and the results associated with their use. Genetic fusion approaches for the preparation of protein-polypeptide conjugates will be also reviewed and compared with the best known chemical conjugation ones.

  7. Protein (Cyanobacteria): 292092 [

    Lifescience Database Archive (English)

    Full Text Available ZP_11392515.1 1117:5087 1150:2441 44887:135 864702:135 PAS ... domain type 3-containing protein,PAS ... STISDITSQKRTEAALQRSTARYENLASNIPGMIYQVVLETNGHFRFAYASPAS REIFGLEPEQLMKSAALGMTVIHPDDVVSFRQSIAQSAKTLQTQLGKLPK ...

  8. Protein turnover in sheep

    International Nuclear Information System (INIS)

    Considerable advances have been made in the knowledge of the mechanisms and control of synthesis and degradation of proteins in animal tissues during the last decade. Most of the work on the measurement of synthetic and degradative rates of the mixed protein fraction from tissues has been conducted in the rat. There have, unfortunately, been few publications describing results of protein turnover studies with ruminants. Consideration is given here to the techniques used to measure protein turnover, and some of the results obtained, particularly with sheep, are summarized. No attempt has been made to discuss directly the situation in parasitized animals; rather the aim is to provide background information which complements other work dealing with the effects of parasites on the nitrogen metabolism of ruminants. (author)

  9. Engineered Proteins for Bioelectrochemistry

    Science.gov (United States)

    Akram, Muhammad Safwan; Rehman, Jawad Ur; Hall, Elizabeth A. H.

    2014-06-01

    It is only in the past two decades that excellent protein engineering tools have begun to meet parallel advances in materials chemistry, nanofabrication, and electronics. This is revealing scenarios from which synthetic enzymes can emerge, which were previously impossible, as well as interfaces with novel electrode materials. That means the control of the protein structure, electron transport pathway, and electrode surface can usher us into a new era of bioelectrochemistry. This article reviews the principle of electron transfer (ET) and considers how its application at the electrode, within the protein, and at a redox group is directing key advances in the understanding of protein structure to create systems that exhibit better efficiency and unique bioelectrochemistry.

  10. Protein (Viridiplantae): 308813231 [

    Lifescience Database Archive (English)

    Full Text Available XP_003083922.1 33090:9527 3041:5078 1035538:3664 13792:3664 70447:4128 70448:5494 Protein requir ... ed for actin cytoskeleton organization ... and cell cycle progression (ISS) Ostreococcus taur ...

  11. Protein (Viridiplantae): 308808566 [

    Lifescience Database Archive (English)

    Full Text Available XP_003081593.1 33090:6182 3041:4098 1035538:2508 13792:2508 70447:3211 70448:4097 Mitochondrial ... inheritance and actin cytoskeleton organization ... protein (ISS) Ostreococcus tauri MPPKKPPPPPPDAKSYP ...

  12. The Pentapeptide Repeat Proteins

    Energy Technology Data Exchange (ETDEWEB)

    Vetting,M.; Hegde, S.; Fajardo, J.; Fiser, A.; Roderick, S.; Takiff, H.; Blanchard, J.

    2006-01-01

    The Pentapeptide Repeat Protein (PRP) family has over 500 members in the prokaryotic and eukaryotic kingdoms. These proteins are composed of, or contain domains composed of, tandemly repeated amino acid sequences with a consensus sequence of [S, T,A, V][D, N][L, F]-[S, T,R][G]. The biochemical function of the vast majority of PRP family members is unknown. The three-dimensional structure of the first member of the PRP family was determined for the fluoroquinolone resistance protein (MfpA) from Mycobacterium tuberculosis. The structure revealed that the pentapeptide repeats encode the folding of a novel right-handed quadrilateral {beta}-helix. MfpA binds to DNA gyrase and inhibits its activity. The rod-shaped, dimeric protein exhibits remarkable size, shape and electrostatic similarity to DNA.

  13. Protein (Viridiplantae): 255084748 [

    Lifescience Database Archive (English)

    Full Text Available XP_002504805.1 33090:7862 3041:6362 1035538:5159 13792:5159 38832:5340 296587:5427 DUF1244/molyb ... denum cofactor synthesis ... fusion protein Micromonas sp. RCC299 MASTRTEIEAYAF ...

  14. Protein (Viridiplantae): 303283029 [

    Lifescience Database Archive (English)

    Full Text Available XP_003060806.1 33090:7862 3041:6362 1035538:5159 13792:5159 38832:5340 38833:5093 564608:5093 mo ... lybdenum cofactor synthesis ... protein Micromonas pusilla CCMP1545 MVDAQTTEKIEAYA ...

  15. Protein (Viridiplantae): 308812183 [

    Lifescience Database Archive (English)

    Full Text Available XP_003083399.1 33090:12970 3041:5897 1035538:4613 13792:4613 70447:1628 70448:5196 Glycosylphosp ... hatidylinositol anchor synthesis ... protein (ISS) Ostreococcus tauri MSARRASFQSRFNDSSQ ...

  16. Protein (Viridiplantae): 308810647 [

    Lifescience Database Archive (English)

    Full Text Available XP_003082632.1 33090:15674 3041:5296 1035538:3911 13792:3911 70447:3635 70448:4717 senescence-in ... ducible chloroplast stay-green ... protein (ISS) Ostreococcus tauri MDRATTSSRASTARTFH ...

  17. Protein (Viridiplantae): 308811905 [

    Lifescience Database Archive (English)

    Full Text Available XP_003083260.1 33090:255 3041:4962 1035538:3528 13792:3528 70447:3840 70448:5111 T08009 probable ... ribosomal protein L5-green ... alga (ISS) Ostreococcus tauri MGKRRQKRKSQSVAKTTAYQ ...

  18. Protein (Cyanobacteria): 28423 [

    Lifescience Database Archive (English)

    Full Text Available ZP_10226597.1 1117:517 1118:7626 1125:2051 1160279:627 Type 4 prepilin-like proteins leader ... pept ... ide-processing enzyme (Includes: Leader ... peptidase ; N-methyltransferase) Microcystis sp. T ...

  19. Protein (Cyanobacteria): 360784 [

    Lifescience Database Archive (English)

    Full Text Available YP_007097029.1 1117:17211 1118:17546 217161:1718 1173032:1718 1173020:1718 putative stress ... prote ... in (general stress ... protein 26) Chamaesiphon minutus PCC 6605 MANATENQ ...

  20. Protein (Cyanobacteria): 392180 [

    Lifescience Database Archive (English)

    Full Text Available ZP_07113914.1 1117:24513 1150:7038 1158:3915 272129:3709 Bifunctional protein birA (Includes: Biotin ... otin operon repressor; Biotin --(acetyl-CoA-carboxylase) synthetase (Biotin --prot ...

  1. Interactive protein manipulation

    Energy Technology Data Exchange (ETDEWEB)

    SNCrivelli@lbl.gov

    2003-07-01

    We describe an interactive visualization and modeling program for the creation of protein structures ''from scratch''. The input to our program is an amino acid sequence -decoded from a gene- and a sequence of predicted secondary structure types for each amino acid-provided by external structure prediction programs. Our program can be used in the set-up phase of a protein structure prediction process; the structures created with it serve as input for a subsequent global internal energy minimization, or another method of protein structure prediction. Our program supports basic visualization methods for protein structures, interactive manipulation based on inverse kinematics, and visualization guides to aid a user in creating ''good'' initial structures.

  2. Protein (Viridiplantae): 308811366 [

    Lifescience Database Archive (English)

    Full Text Available XP_003082991.1 33090:1951 3041:1340 1035538:592 13792:592 70447:610 70448:205 Transporter, ABC s ... uperfamily (Breast cancer ... resistance protein) (ISS), partial Ostreococcus ta ...

  3. Protein (Viridiplantae): 308810513 [

    Lifescience Database Archive (English)

    Full Text Available XP_003082565.1 33090:8864 3041:8803 1035538:7822 13792:7822 70447:3615 70448:4680 Predicted memb ... rane protein (associated with esophageal cancer ... in humans) (ISS) Ostreococcus tauri MTSSRKLCAFVRDA ...

  4. Protein (Viridiplantae): 308804289 [

    Lifescience Database Archive (English)

    Full Text Available XP_003079457.1 33090:1951 3041:1340 1035538:592 13792:592 70447:610 70448:205 Transporter, ABC s ... uperfamily (Breast cancer ... resistance protein) (ISS) Ostreococcus tauri MASRV ...

  5. Untying knots in proteins.

    Science.gov (United States)

    Sułkowska, Joanna I; Sułkowski, Piotr; Szymczak, Piotr; Cieplak, Marek

    2010-10-13

    A shoelace can be readily untied by pulling its ends rather than its loops. Attempting to untie a native knot in a protein can also succeed or fail depending on where one pulls. However, thermal fluctuations induced by the surrounding water affect conformations stochastically and may add to the uncertainty of the outcome. When the protein is pulled by the termini, the knot can only get tightened, and any attempt at untying results in failure. We show that, by pulling specific amino acids, one may easily retract a terminal segment of the backbone from the knotting loop and untangle the knot. At still other amino acids, the outcome of pulling can go either way. We study the dependence of the untying probability on the way the protein is grasped, the pulling speed, and the temperature. Elucidation of the mechanisms underlying this dependence is critical for a successful experimental realization of protein knot untying. PMID:20857930

  6. Protein (Viridiplantae): 308806666 [

    Lifescience Database Archive (English)

    Full Text Available XP_003080644.1 33090:21099 3041:5360 1035538:3986 13792:3986 70447:3049 70448:3532 COG3310: Unch ... aracterized protein conserved in bacteria ... (ISS) Ostreococcus tauri MRRTCASRNLARSPVAARERCRQMV ...

  7. Protein (Viridiplantae): 308803575 [

    Lifescience Database Archive (English)

    Full Text Available XP_003079100.1 33090:20519 3041:4460 1035538:2940 13792:2940 70447:2035 70448:2555 COG4399: Unch ... aracterized protein conserved in bacteria ... (ISS) Ostreococcus tauri MKALQRLVLRGSTDGVRPACERAMA ...

  8. Protein (Viridiplantae): 308804123 [

    Lifescience Database Archive (English)

    Full Text Available XP_003079374.1 33090:20519 3041:4460 1035538:2940 13792:2940 70447:2035 70448:2555 COG4399: Unch ... aracterized protein conserved in bacteria ... (ISS) Ostreococcus tauri MDSLATSRRRRLARAGAAIATALAL ...

  9. Protein (Viridiplantae): 255077633 [

    Lifescience Database Archive (English)

    Full Text Available XP_002502450.1 33090:20956 3041:5145 1035538:3740 13792:3740 38832:3722 296587:3525 isocitrate d ... ehydrogenase (NADP+), bacteria -like protein Micromonas sp. RCC299 MAAASAGGKIQAAPM ...

  10. Protein (Cyanobacteria): 228257 [

    Lifescience Database Archive (English)

    Full Text Available ZP_09784859.1 1117:4333 1150:1533 35823:3512 376219:3411 Protein ushA precursor (Includes: UDP-sugar ... ugar hydrolase (UDP-sugar ... pyrophosphatase) (UDP-sugar ... diphosphatase); 5'-nuc ...

  11. Protein folding and cosmology

    CERN Document Server

    González-Diáz, P F

    1997-01-01

    Protein denaturing induced by supercooling is interpreted as a process where some or all internal symmetries of the native protein are spontaneously broken. Hence, the free-energy potential corresponding to a folding-funnel landscape becomes temperature-dependent and describes a phase transition. The idea that deformed vortices could be produced in the transition induced by temperature quenching, from native proteins to unfolded conformations is discussed in terms of the Zurek mechanism that implements the analogy between vortices, created in the laboratory at low energy, and the cosmic strings which are thought to have been left after symmetry breaking phase transitions in the early universe. An experiment is proposed to test the above idea which generalizes the cosmological analogy to also encompass biological systems and push a step ahead the view that protein folding is a biological equivalent of the big bang.

  12. Protein (Viridiplantae): 308804764 [

    Lifescience Database Archive (English)

    Full Text Available XP_003079694.1 33090:24290 3041:9393 1035538:8433 13792:8433 70447:5209 70448:2928 probable memb ... rane protein YCR013c-yeast ... (ISS) Ostreococcus tauri MQLREVKERLRAYFSSSAATPGRTR ...

  13. Protein (Cyanobacteria): 338848 [

    Lifescience Database Archive (English)

    Full Text Available YP_007172477.1 1117:11758 1118:7408 13034:1671 292566:1671 13035:1671 cell envelope-related func ... tion transcriptional attenuator ... common domain protein Dactylococcopsis salina PCC ...

  14. Electron transfer in proteins

    DEFF Research Database (Denmark)

    Farver, O; Pecht, I

    1991-01-01

    Electron migration between and within proteins is one of the most prevalent forms of biological energy conversion processes. Electron transfer reactions take place between active centers such as transition metal ions or organic cofactors over considerable distances at fast rates and with remarkable...... specificity. The electron transfer is attained through weak electronic interaction between the active sites, so that considerable research efforts are centered on resolving the factors that control the rates of long-distance electron transfer reactions in proteins. These factors include (in addition to the......-containing proteins. These proteins serve almost exclusively in electron transfer reactions, and as it turns out, their metal coordination sites are endowed with properties uniquely optimized for their function....

  15. Protein Colloidal Aggregation Project

    Science.gov (United States)

    Oliva-Buisson, Yvette J. (Compiler)

    2014-01-01

    To investigate the pathways and kinetics of protein aggregation to allow accurate predictive modeling of the process and evaluation of potential inhibitors to prevalent diseases including cataract formation, chronic traumatic encephalopathy, Alzheimer's Disease, Parkinson's Disease and others.

  16. Interactive protein manipulation

    International Nuclear Information System (INIS)

    We describe an interactive visualization and modeling program for the creation of protein structures ''from scratch''. The input to our program is an amino acid sequence -decoded from a gene- and a sequence of predicted secondary structure types for each amino acid-provided by external structure prediction programs. Our program can be used in the set-up phase of a protein structure prediction process; the structures created with it serve as input for a subsequent global internal energy minimization, or another method of protein structure prediction. Our program supports basic visualization methods for protein structures, interactive manipulation based on inverse kinematics, and visualization guides to aid a user in creating ''good'' initial structures

  17. Egg protein hydrolysates

    NARCIS (Netherlands)

    Amerongen, van A.; Beelen, M.J.C.; Wolbers, L.A.M.; Gilst, van W.H.; Buikema, J.H.; Nelissen, J.W.P.M.

    2009-01-01

    The present invention provides egg-protein hydrolysates with DPP-IV inhibitory activity which are particularly suited for the treatment of diabetes. Particularly advantageous is to use hydrolysate of lysozyme for the treatment of diabetes.

  18. Bence-Jones protein - quantitative

    Science.gov (United States)

    Immunoglobulin light chains - urine; Urine Bence-Jones protein ... Bence-Jones proteins are a part of regular antibodies called light chains. These proteins are not normally in urine. Sometimes, when ...

  19. The Malignant Protein Puzzle.

    Science.gov (United States)

    Walker, Lary C; Jucker, Mathias

    2016-01-01

    When most people hear the words malignant and brain, cancer immediately comes to mind. But our authors argue that proteins can be malignant too, and can spread harmfully through the brain in neurodegenerative diseases that include Alzheimer's, Parkinson's, CTE, and ALS. Studying how proteins such as PrP, amyloid beta, tau, and others aggregate and spread, and kill brain cells, represents a crucial new frontier in neuroscience. PMID:27408676

  20. Fish protein hydrolysates

    Energy Technology Data Exchange (ETDEWEB)

    Mackie, I.M.

    1982-01-01

    Proteolytic enzymes now available in commercial quantities can be used to liquefy the fish and fish waste presently considered suitable for conversion to fish meal. The products obtained are readily dispersed or dissolved in water and have a high nutritional value. They have been satisfactorily used as substitutes for milk proteins in milk replacers for young animals. Further research is necessary on means of controlling the degree of hydrolysis to give protein preparations with acceptable functional properties as human food supplements. (Refs. 21).

  1. Recombinant Collagenlike Proteins

    Science.gov (United States)

    Fertala, Andzej

    2007-01-01

    A group of collagenlike recombinant proteins containing high densities of biologically active sites has been invented. The method used to express these proteins is similar to a method of expressing recombinant procollagens and collagens described in U. S. Patent 5,593,859, "Synthesis of human procollagens and collagens in recombinant DNA systems." Customized collagenous proteins are needed for biomedical applications. In particular, fibrillar collagens are attractive for production of matrices needed for tissue engineering and drug delivery. Prior to this invention, there was no way of producing customized collagenous proteins for these and other applications. Heretofore, collagenous proteins have been produced by use of such biological systems as yeasts, bacteria, and transgenic animals and plants. These products are normal collagens that can also be extracted from such sources as tendons, bones, and hides. These products cannot be made to consist only of biologically active, specific amino acid sequences that may be needed for specific applications. Prior to this invention, it had been established that fibrillar collagens consist of domains that are responsible for such processes as interaction with cells, binding of growth factors, and interaction with a number of structural proteins present in the extracellular matrix. A normal collagen consists of a sequence of domains that can be represented by a corresponding sequence of labels, e.g., D1D2D3D4. A collagenlike protein of the present invention contains regions of collagen II that contain multiples of a single domain (e.g., D1D1D1D1 or D4D4D4D4) chosen for its specific biological activity. By virtue of the multiplicity of the chosen domain, the density of sites having that specific biological activity is greater than it is in a normal collagen. A collagenlike protein according to this invention can thus be made to have properties that are necessary for tissue engineering.

  2. Untying Knots in Proteins

    OpenAIRE

    Sułkowska, Joanna I.; Sułkowski, Piotr; Szymczak, Piotr; Cieplak, Marek

    2010-01-01

    A shoelace can be readily untied by pulling its ends rather than its loops. Attempting to untie a native knot in a protein can also succeed or fail depending on where one pulls. However, thermal fluctuations induced by the surrounding water affect conformations stochastically and may add to the uncertainty of the outcome. When the protein is pulled by the termini, the knot can only get tightened, and any attempt at untying results in failure. We show that, by pulling specific amino acids, ...

  3. Digestibility of sorghum proteins.

    OpenAIRE

    Axtell, J D; Kirleis, A. W.; Hassen, M M; D'Croz Mason, N; Mertz, E T; Munck, L.

    1981-01-01

    Published information indicates that rice, maize, and wheat proteins are much more digestible in children than sorghum proteins are (66-81% compared with 46%). However, this digestibility difference cannot be demonstrated with the weanling rat, which gave digestibility values of 80% for cooked and 85% for uncooked sorghum gruels. Therefore, a search was made for a laboratory system sensitive to the digestibility differences between sorghum and other cereals. We found that porcine pepsin in vi...

  4. Identifying Unknown Proteins

    OpenAIRE

    Barker, Winona C.; Dayhoff, Margaret O.

    1983-01-01

    In this paper we discuss ways to identify a protein, both when its amino acid sequence is known and, particularly, prior to the determination of the complete sequence. If a similar sequence is in the Protein Sequence Database, an unknown may be identified on the basis of partial or ambiguous sequence data, or on the basis of amino acid composition. Identification in the early stages of structural determination can save time and scarce resources by preventing duplicate effort or by suggesting ...

  5. Proteins and their crystals

    Czech Academy of Sciences Publication Activity Database

    Kutá-Smatanová, Ivana; Hogg, T.; Hilgenfeld, R.; Grandori, R.; Carey, J.; Vácha, František; Štys, Dalibor

    2003-01-01

    Roč. 10, č. 1 (2003), s. 31-32. ISSN 1211-5894 R&D Projects: GA MŠk LN00A141; GA ČR GA206/00/D007 Institutional research plan: CEZ:AV0Z5051902; CEZ:MSM 123100001 Keywords : pokeweed antiviral protein * flavodoxin-like protein * PSII Subject RIV: EB - Genetics ; Molecular Biology

  6. Occupational protein contact dermatitis.

    Science.gov (United States)

    Barbaud, Annick; Poreaux, Claire; Penven, Emmanuelle; Waton, Julie

    2015-12-01

    Occupational contact dermatitis is generally caused by haptens but can also be induced by proteins causing mainly immunological contact urticaria (ICU); chronic hand eczema in the context of protein contact dermatitis (PCD). In a monocentric retrospective study, from our database, only 31 (0.41%) of patients with contact dermatitis had positive skin tests with proteins: 22 had occupational PCD, 3 had non-occupational PCD, 5 occupational ICU and 1 cook had a neutrophilic fixed food eruption (NFFE) due to fish. From these results and analysis of literature, the characteristics of PCD can be summarized as follows. It is a chronic eczematous dermatitis, possibly exacerbated by work, suggestive if associated with inflammatory perionyxix and immediate erythema with pruritis, to be investigated when the patient resumes work after a period of interruption. Prick tests with the suspected protein-containing material are essential, as patch tests have negative results. In case of multisensitisation revealed by prick tests, it is advisable to analyse IgE against recombinant allergens. A history of atopy, found in 56 to 68% of the patients, has to be checked for. Most of the cases are observed among food-handlers but PCD can also be due to non-edible plants, latex, hydrolysed proteins or animal proteins. Occupational exposure to proteins can thus lead to the development of ICU. Reflecting hypersensitivity to very low concentrations of allergens, investigating ICU therefore requires caution and prick tests should be performed with a diluted form of the causative protein-containing product. Causes are food, especially fruit peel, non-edible plants, cosmetic products, latex, animals. PMID:26242922

  7. Protein hydrolysates in sports nutrition

    Directory of Open Access Journals (Sweden)

    Manninen Anssi H

    2009-09-01

    Full Text Available Abstract It has been suggested that protein hydrolysates providing mainly di- and tripeptides are superior to intact (whole proteins and free amino acids in terms of skeletal muscle protein anabolism. This review provides a critical examination of protein hydrolysate studies conducted in healthy humans with special reference to sports nutrition. The effects of protein hydrolysate ingestion on blood amino acid levels, muscle protein anabolism, body composition, exercise performance and muscle glycogen resynthesis are discussed.

  8. Protein Functionality in Food Systems

    Institute of Scientific and Technical Information of China (English)

    WANG Panpan

    2010-01-01

    The structure,shape,color,smell and taste of food were decided by protein functionality.The utilization of protein will improve by changing the protein functionality.Protein functionality is also advantage to maintain and utilize the nutrition of food.This paper summarized the nature,classification,factors and prospect of protein functionality.It ccn provide a theoretical basis for application of protein in food industry.

  9. Protein Databases on the Internet

    OpenAIRE

    Xu, Dong

    2004-01-01

    Protein databases have become a crucial part of modern biology. Huge amounts of data for protein structures, functions, and particularly sequences are being generated. Searching databases is often the first step in the study of a new protein. Comparison between proteins or between protein families provides information about the relationship between proteins within a genome or across different species, and hence offers much more information than can be obtained by studying only an isolated pro...

  10. More protein in cereals?

    International Nuclear Information System (INIS)

    Ways in which the protein content of plant crops may be raised by the use of nuclear radiation are to be discussed at a symposium in Vienna in June next year, organized by the joint Food and Agriculture Organization/Agency Division of Atomic Energy in Food and Agriculture. Plant crops - especially cereal grains - are the basic food and protein source of most of the world's population, particularly in less-developed countries. But their natural protein content is low; increasing the quantity and nutritional quality of plant protein is potentially the most feasible way to combat widespread protein malnutrition. This improvement in seed stock can be achieved by plant breeding methods in which nuclear irradiation techniques are used to induce mutations in grain, and other isotopic techniques can be used to select only those mutants which have the desired properties. The scientists who attend the symposium will have an opportunity to review what mutation plant breeders have achieved, the application of nuclear techniques to screening for protein and amino-acid content and nutritional value, and isotopic methods which contribute to research in plant nutrition and physiology. (author)

  11. Stretching to Understand Proteins

    Science.gov (United States)

    Cieplak, Marek

    2007-03-01

    Mechanical stretching of single proteins has been studied experimentally for about 50 proteins yielding a variety of force patterns and values of the peak forces. We have performed a theoretical survey of 7749 proteins of known native structure and map out the landscape of possible dynamical behaviors unders stretching at constant speed. The model used is constructed based on the native geometry. It is solved by methods of molecular dynamics and validated by comparing the theoretical predictions to experimental results. We characterize the distribution of peak forces and on correlations with the system size and with the structure classification as characterized by the CATH scheme. We identify proteins with the biggest forces and show that they belong to few topology classes. We determine which protein segments act as mechanical clamps and show that, in most cases, they correspond to long stretches of parallel beta-strands, but other mechanisms are also possible. We then consider stretching by fluid flows. We show that unfolding induced by a uniform flow shows a richer behavior than that in the force clamp. The dynamics of unfolding is found to depend strongly on the selection of the amino acid, usually one of the termini, which is anchored. These features offer potentially wider diagnostic tools to investigate structure of proteins compared to experiments based on the atomic force microscopy.

  12. Inferring protein function by domain context similarities in protein-protein interaction networks

    OpenAIRE

    Sun Zhirong; Liu Ke; Chen Hu; Zhang Song

    2009-01-01

    Abstract Background Genome sequencing projects generate massive amounts of sequence data but there are still many proteins whose functions remain unknown. The availability of large scale protein-protein interaction data sets makes it possible to develop new function prediction methods based on protein-protein interaction (PPI) networks. Although several existing methods combine multiple information resources, there is no study that integrates protein domain information and PPI networks to pre...

  13. ADSORPTION OF PROTEIN ON NANOPARTICLES

    Institute of Scientific and Technical Information of China (English)

    WU Qi

    1994-01-01

    The adsorption of protein on nanoparticles was studied by using dynamic light scattering to measure the hydrodynamic size of both pure protein and nanoparticles adsorbed with different amounts of protein. The thickness of the adsorbed protein layer increases as protein concentration, but decreases as the initial size of nanoparticles. After properly scaling the thickness with the initial diameter, we are able to fit all experimental data with a single master curve. Our experimental results suggest that the adsorbed proteins form a monolayeron the nanoparticle surface and the adsorbed protein molecules are attached to the particle surface at many points through a possible hydrogen-bonding. Our results also indicate that as protein concentration increases, the overall shape of the adsorbed protein molecule continuously changes from a flat layer on the particle surface to a stretched coil extended into water. During the change, the hydrodynamic volume of the adsorbed protein increases linearly with protein concentration.

  14. Measuring protein breakdown rate in individual proteins in vivo

    DEFF Research Database (Denmark)

    Holm, Lars; Kjaer, Michael

    2010-01-01

    To outline different approaches of how protein breakdown can be quantified and to present a new approach to determine the fractional breakdown rate of individual slow turnover proteins in vivo.......To outline different approaches of how protein breakdown can be quantified and to present a new approach to determine the fractional breakdown rate of individual slow turnover proteins in vivo....

  15. Histophilus somni Surface Proteins.

    Science.gov (United States)

    Corbeil, Lynette B

    2016-01-01

    The pathogen surface is usually the first site of interaction with the host. Histophilus somni was earlier thought to only have an outer membrane on its surface. Now it is known that the surface is composed of many virulence factors, including outer membrane proteins, lipooligosaccharide or endotoxin, a fibrillar network, and an exopolysaccharide. Outer membrane blebs, endotoxin, the fibrillar network, and the exopolysaccharide are also shed from the surface. This review will focus on the surface proteins of this pathogen that may colonize the mucosal surface of ruminants as a commensal or may cause pneumonia, septicemia, myocarditis, thrombotic meningoencephalitis, arthritis, and/or abortion. The major outer membrane protein has been well studied. Since its size and epitopes vary from strain to strain, it may be useful for typing strains. Iron-regulated OMPs have also received much attention because of their role in iron uptake for in vivo growth of H. somni. Other OMPs may be protective, based on passive immunization with monospecific antibodies and active immunization experiments. The surface and shed fibrillar network has been shown to be an immunoglobulin-binding protein in that it binds bovine IgG2 by the Fc portion. Two repeat domains (DR1 and DR2) have cytotoxic Fic motifs. Vaccine studies with recombinant DR2 are promising. Studies of the bacterial genome as well as comparison of surface proteins of different strains from the various H. somni syndromes and carrier states will be discussed and have provided much insight into pathogenesis and protection. PMID:26728061

  16. Ontology integration to identify protein complex in protein interaction networks

    OpenAIRE

    Yang Zhihao; Lin Hongfei; Xu Bo

    2011-01-01

    Abstract Background Protein complexes can be identified from the protein interaction networks derived from experimental data sets. However, these analyses are challenging because of the presence of unreliable interactions and the complex connectivity of the network. The integration of protein-protein interactions with the data from other sources can be leveraged for improving the effectiveness of protein complexes detection algorithms. Methods We have developed novel semantic similarity metho...

  17. Identifying Protein-Protein Interaction Sites Using Covering Algorithm

    OpenAIRE

    Jie Song; Jiaxing Cheng; Xiuquan Du

    2009-01-01

    Identification of protein-protein interface residues is crucial for structural biology. This paper proposes a covering algorithm for predicting protein-protein interface residues with features including protein sequence profile and residue accessible area. This method adequately utilizes the characters of a covering algorithm which have simple, lower complexity and high accuracy for high dimension data. The covering algorithm can achieve a comparable performance (69.62%, Complete dataset; 60....

  18. Protein-Protein Interaction Detection: Methods and Analysis

    OpenAIRE

    V. Srinivasa Rao; Srinivas, K.; Sujini, G. N.; G. N. Sunand Kumar

    2014-01-01

    Protein-protein interaction plays key role in predicting the protein function of target protein and drug ability of molecules. The majority of genes and proteins realize resulting phenotype functions as a set of interactions. The in vitro and in vivo methods like affinity purification, Y2H (yeast 2 hybrid), TAP (tandem affinity purification), and so forth have their own limitations like cost, time, and so forth, and the resultant data sets are noisy and have more false positives to annotate t...

  19. Protein Microarray On-Demand: A Novel Protein Microarray System

    OpenAIRE

    Chatterjee, Deb K.; Sitaraman, Kalavathy; Baptista, Cassio; Hartley, James; Hill, Thomas M.; David J. Munroe

    2008-01-01

    We describe a novel, simple and low-cost protein microarray strategy wherein the microarrays are generated by printing expression ready plasmid DNAs onto slides that can be converted into protein arrays on-demand. The printed expression plasmids serve dual purposes as they not only direct the synthesis of the protein of interest; they also serve to capture the newly synthesized proteins through a high affinity DNA-protein interaction. To accomplish this we have exploited the high-affinity bin...

  20. Polarizable protein packing

    KAUST Repository

    Ng, Albert H.

    2011-01-24

    To incorporate protein polarization effects within a protein combinatorial optimization framework, we decompose the polarizable force field AMOEBA into low order terms. Including terms up to the third-order provides a fair approximation to the full energy while maintaining tractability. We represent the polarizable packing problem for protein G as a hypergraph and solve for optimal rotamers with the FASTER combinatorial optimization algorithm. These approximate energy models can be improved to high accuracy [root mean square deviation (rmsd) < 1 kJ mol -1] via ridge regression. The resulting trained approximations are used to efficiently identify new, low-energy solutions. The approach is general and should allow combinatorial optimization of other many-body problems. © 2011 Wiley Periodicals, Inc. J Comput Chem, 2011 Copyright © 2011 Wiley Periodicals, Inc.

  1. Polarizable protein packing.

    Science.gov (United States)

    Ng, Albert H; Snow, Christopher D

    2011-05-01

    To incorporate protein polarization effects within a protein combinatorial optimization framework, we decompose the polarizable force field AMOEBA into low order terms. Including terms up to the third-order provides a fair approximation to the full energy while maintaining tractability. We represent the polarizable packing problem for protein G as a hypergraph and solve for optimal rotamers with the FASTER combinatorial optimization algorithm. These approximate energy models can be improved to high accuracy [root mean square deviation (rmsd) < 1 kJ mol(-1)] via ridge regression. The resulting trained approximations are used to efficiently identify new, low-energy solutions. The approach is general and should allow combinatorial optimization of other many-body problems. PMID:21264879

  2. Electron transfer in proteins.

    Science.gov (United States)

    Gray, H B; Winkler, J R

    1996-01-01

    Electron-transfer (ET) reactions are key steps in a diverse array of biological transformations ranging from photosynthesis to aerobic respiration. A powerful theoretical formalism has been developed that describes ET rates in terms of two parameters: the nuclear reorganization energy (lambda) and the electronic-coupling strength (HAB). Studies of ET reactions in ruthenium-modified proteins have probed lambda and HAB in several metalloproteins (cytochrome c, myoglobin, azurin). This work has shown that protein reorganization energies are sensitive to the medium surrounding the redox sites and that an aqueous environment, in particular, leads to large reorganization energies. Analyses of electronic-coupling strengths suggest that the efficiency of long-range ET depends on the protein secondary structure: beta sheets appear to mediate coupling more efficiently than alpha-helical structures, and hydrogen bonds play a critical role in both. PMID:8811189

  3. Accessory Proteins at ERES

    DEFF Research Database (Denmark)

    Klinkenberg, Rafael David

    proteins. Together these components co‐operate in cargo‐selection as well as forming, loading and releasing budding vesicles from specific regions on the membrane surface of the ER. Coat components furthermore convey vesicle targeting towards the Golgi. However, not much is known about the mechanisms that...... regulate the COPII assembly at the vesicle bud site. This thesis provides the first regulatory mechanism of COPII assembly in relation to ER‐membrane lipid‐signal recognition by the accessory protein p125A (Sec23IP). The aim of the project was to characterize p125A function by dissecting two main domains...... in the protein; a putative lipid‐associating domain termed the DDHD domain that is defined by the four amino acid motif that gives the domain its name; and a ubiquitously found domain termed Sterile α‐motif (SAM), which is mostly associated with oligomerization and polymerization. We first show, that...

  4. Sound of proteins

    DEFF Research Database (Denmark)

    2007-01-01

    In my group we work with Molecular Dynamics to model several different proteins and protein systems. We submit our modelled molecules to changes in temperature, changes in solvent composition and even external pulling forces. To analyze our simulation results we have so far used visual inspection...... and statistical analysis of the resulting molecular trajectories (as everybody else!). However, recently I started assigning a particular sound frequency to each amino acid in the protein, and by setting the amplitude of each frequency according to the movement amplitude we can "hear" whenever two aminoacids....... These are early days, and it still remains to be proven that this method has any advantage over other methods, but at least it is fun to do and the harmonies produced invoke an eerie sounding futuristic landscape...

  5. Ubiquitin domain proteins in disease

    DEFF Research Database (Denmark)

    Klausen, Louise Kjær; Schulze, Andrea; Seeger, Michael;

    2007-01-01

    The human genome encodes several ubiquitin-like (UBL) domain proteins (UDPs). Members of this protein family are involved in a variety of cellular functions and many are connected to the ubiquitin proteasome system, an essential pathway for protein degradation in eukaryotic cells. Despite their...... and cancer. Publication history: Republished from Current BioData's Targeted Proteins database (TPdb; http://www.targetedproteinsdb.com)....

  6. SOY PROTEIN NANOPARTICLES AND NANOCOMPOSITES

    Science.gov (United States)

    Soy protein isolate (SPI) is obtained from soybean by removing soybean oil and soy carbohydrates. SPI contains more than 90% protein. Structurally, SPI is a globular protein and its aggregates in water consist of sphere-like protein particles. The number average aggregate size of SPI at pH=5.2 is...

  7. The Formation of Protein Structure

    DEFF Research Database (Denmark)

    Bohr, Jakob; Bohr, Henrik; Brunak, Søren

    1996-01-01

    Dynamically induced curvature owing to long-range excitations along the backbones of protein molecules with non-linear elastic properties may control the folding of proteins.......Dynamically induced curvature owing to long-range excitations along the backbones of protein molecules with non-linear elastic properties may control the folding of proteins....

  8. Vibrational spectroscopy of proteins

    International Nuclear Information System (INIS)

    Two important steps for the development of a biosensor are the immobilization of the biological component (e.g. protein) on a surface and the enhancement of the signal to improve the sensitivity of detection. To address these subjects, the present work describes Fourier transform infrared (FTIR) investigations of several proteins bound to the surface of an attenuated total reflection (ATR) crystal. Furthermore, new nanostructured surfaces for signal enhancement were developed for use in FTIR microscopy. The mitochondrial redox-protein cytochrome c oxidase (CcO) was incorporated into a protein-tethered bilayer lipid membrane (ptBLM) on an ATR crystal featuring a roughened two-layer gold surface for signal enhancement. Electrochemical excitation by periodic potential pulses at different modulation frequencies was followed by time-resolved FTIR spectroscopy. Phase sensitive detection was used for deconvolution of the IR spectra into vibrational components. A model based on protonation-dependent chemical reaction kinetics could be fitted to the time evolution of IR bands attributed to several different redox centers of the CcO. Further investigations involved the odorant binding protein 14 (OBP14) of the honey bee (Apis mellifera), which was studied using ATR-FTIR spectroscopy and circular dichroism. OBP14 was found to be thermally stable up to 45 °C, thus permitting the potential application of this protein for the fabrication of biosensors. Thermal denaturation measurements showed that odorant binding increases the thermal stability of the OBP-odorant complex. In another project, plasmonic nanostructures were fabricated that enhance the absorbance in FTIR microscopy measurements. The nanostructures are composed of an array of round-shaped insulator and gold discs on top of a continuous gold layer. Enhancement factors of up to ⁓125 could be observed with self-assembled monolayers of dodecanethiol molecules immobilized on the gold surface (author)

  9. Modeling Mercury in Proteins.

    Science.gov (United States)

    Parks, J M; Smith, J C

    2016-01-01

    Mercury (Hg) is a naturally occurring element that is released into the biosphere both by natural processes and anthropogenic activities. Although its reduced, elemental form Hg(0) is relatively nontoxic, other forms such as Hg(2+) and, in particular, its methylated form, methylmercury, are toxic, with deleterious effects on both ecosystems and humans. Microorganisms play important roles in the transformation of mercury in the environment. Inorganic Hg(2+) can be methylated by certain bacteria and archaea to form methylmercury. Conversely, bacteria also demethylate methylmercury and reduce Hg(2+) to relatively inert Hg(0). Transformations and toxicity occur as a result of mercury interacting with various proteins. Clearly, then, understanding the toxic effects of mercury and its cycling in the environment requires characterization of these interactions. Computational approaches are ideally suited to studies of mercury in proteins because they can provide a detailed molecular picture and circumvent issues associated with toxicity. Here, we describe computational methods for investigating and characterizing how mercury binds to proteins, how inter- and intraprotein transfer of mercury is orchestrated in biological systems, and how chemical reactions in proteins transform the metal. We describe quantum chemical analyses of aqueous Hg(II), which reveal critical factors that determine ligand-binding propensities. We then provide a perspective on how we used chemical reasoning to discover how microorganisms methylate mercury. We also highlight our combined computational and experimental studies of the proteins and enzymes of the mer operon, a suite of genes that confer mercury resistance in many bacteria. Lastly, we place work on mercury in proteins in the context of what is needed for a comprehensive multiscale model of environmental mercury cycling. PMID:27497164

  10. Mining protein structure data

    OpenAIRE

    Santos, José Carlos Almeida

    2006-01-01

    The principal topic of this work is the application of data mining techniques, in particular of machine learning, to the discovery of knowledge in a protein database. In the first chapter a general background is presented. Namely, in section 1.1 we overview the methodology of a Data Mining project and its main algorithms. In section 1.2 an introduction to the proteins and its supporting file formats is outlined. This chapter is concluded with section 1.3 which defines that main problem we...

  11. Protein-based ferrogels.

    Science.gov (United States)

    Mody, Puja; Hart, Cassidy; Romano, Siena; El-Magbri, Mariam; Esson, Moira M; Ibeh, Trisha; Knowlton, Elizabeth D; Zhang, Ming; Wagner, Michael J; Hartings, Matthew R

    2016-06-01

    We present a novel synthesis in which hemoglobin and Fe(2+) react, in the presence of KNO3 and KOH, to produce protein microgels that contain magnetic iron oxide nanoparticles. The synthesis results in microgels with polymer properties (denaturing and glass transition temperatures) that are consistent with the dried protein. The iron oxide nanoparticles that exhibit an average diameter of 22nm, are ferrimagnetic, and display properties consistent with Fe3O4. The multiple functional capabilities displayed by these materials: biocompatibility, magnetism, dye uptake and controlled release, and other properties archetypal of hydrogels, will make the magnetic hydrogels attractive for a number of biomedical applications. PMID:26901627

  12. Lipid-transfer proteins.

    Science.gov (United States)

    Ng, Tzi Bun; Cheung, Randy Chi Fai; Wong, Jack Ho; Ye, Xiujuan

    2012-01-01

    Lipid-transfer proteins (LTPs) are basic proteins found in abundance in higher plants. LTPs play lots of roles in plants such as participation in cutin formation, embryogenesis, defense reactions against phytopathogens, symbiosis, and the adaptation of plants to various environmental conditions. In addition, LTPs from field mustard and Chinese daffodil exhibit antiproliferative activity against human cancer cells. LTPs from chili pepper and coffee manifest inhibitory activity against fungi pathogenic to humans such as Candida species. The intent of this article is to review LTPs in the plant kingdom. PMID:23193591

  13. Chirality and Protein Folding

    OpenAIRE

    Kwiecinska, Joanna I.; Cieplak, Marek

    2004-01-01

    There are several simple criteria of folding to a native state in model proteins. One of them involves crossing of a threshold value of the RMSD distance away from the native state. Another checks whether all native contacts are established, i.e. whether the interacting amino acids come closer than some characteristic distance. We use Go-like models of proteins and show that such simple criteria may prompt one to declare folding even though fragments of the resulting conformations have a wron...

  14. Conformation Distributions in Adsorbed Proteins.

    Science.gov (United States)

    Meuse, Curtis W.; Hubbard, Joseph B.; Vrettos, John S.; Smith, Jackson R.; Cicerone, Marcus T.

    2007-03-01

    While the structural basis of protein function is well understood in the biopharmaceutical and biotechnology industries, few methods for the characterization and comparison of protein conformation distributions are available. New methods capable of measuring the stability of protein conformations and the integrity of protein-protein, protein-ligand and protein-surface interactions both in solution and on surfaces are needed to help the development of protein-based products. We are developing infrared spectroscopy methods for the characterization and comparison of molecular conformation distributions in monolayers and in solutions. We have extracted an order parameter describing the orientational and conformational variations of protein functional groups around the average molecular values from a single polarized spectrum. We will discuss the development of these methods and compare them to amide hydrogen/deuterium exchange methods for albumin in solution and on different polymer surfaces to show that our order parameter is related to protein stability.

  15. G Protein-coupled receptors

    OpenAIRE

    Ross, Elliott M.

    2014-01-01

    G protein-coupled receptors and heterotrimeric G proteins can diffuse laterally in the plasma membrane such that one receptor can catalyze the activation (GDP/GTP exchange) of multiple G proteins. In some cases, these processes are fast enough to support molecular signal amplification, where a single receptor maintains the activation of multiple G proteins at steady-state. Amplification in cells is probably highly regulated. It depends upon the identities of the G receptor and G protein - som...

  16. Protein stability, flexibility and function

    DEFF Research Database (Denmark)

    Teilum, Kaare; Olsen, Johan G; Kragelund, Birthe B

    2011-01-01

    Proteins rely on flexibility to respond to environmental changes, ligand binding and chemical modifications. Potentially, a perturbation that changes the flexibility of a protein may interfere with its function. Millions of mutations have been performed on thousands of proteins in quests for a...... data presented is it clear that there are specific sites (flexibility hotspots) in proteins that are important for both binding and stability. This article is part of a Special Issue entitled: Protein Dynamics: Experimental and Computational Approaches....

  17. Protein oxidation in aquatic foods

    DEFF Research Database (Denmark)

    Baron, Caroline P.

    oxidation. The protein carbonyl group measurement is the widely used method for estimating protein oxidation in foods and has been used in fish muscle. The chapter also talks about the impact of protein oxidation on protein functionality, fish muscle texture, and food nutritional value. Protein oxidation...... may not only induce quality losses but may be desirable in some type of foods, such as salted herring....

  18. Measuring protein breakdown in individual proteins in vivo

    DEFF Research Database (Denmark)

    Holm, Lars; Kjær, Michael

    2010-01-01

    PURPOSE OF REVIEW: To outline different approaches of how protein breakdown can be quantified and to present a new approach to determine the fractional breakdown rate of individual slow turnover proteins in vivo. RECENT FINDINGS: None of the available methods for determining protein breakdown can...... be used to determine the breakdown rate of specific proteins and, therefore, do not keep up to the preceding methodological demands in physiological research. A newly developed approach to determine the fractional breakdown rate of single proteins seems promising. Its conceptual advantage is that the...... proteins of interest are the site of measurement. Hence, the application initially demands the proteins to be labeled with stable isotopically labeled amino acids. Subsequently, the loss of label from the proteins will be dependent on the protein breakdown rate when no labeled amino acids are...

  19. Integral UBL domain proteins: a family of proteasome interacting proteins

    DEFF Research Database (Denmark)

    Hartmann-Petersen, Rasmus; Gordon, Colin

    2004-01-01

    The family of ubiquitin-like (UBL) domain proteins (UDPs) comprises a conserved group of proteins involved in a multitude of different cellular activities. However, recent studies on UBL-domain proteins indicate that these proteins appear to share a common property in their ability to interact with......-domain proteins catalyse the formation of ubiquitin-protein conjugates, whereas others appear to target ubiquitinated proteins for degradation and interact with chaperones. Hence, by binding to the 26S proteasome the UBL-domain proteins seem to tailor and direct the basic proteolytic functions of the particle to...... 26S proteasomes. The 26S proteasome is a multisubunit protease which is responsible for the majority of intracellular proteolysis in eukaryotic cells. Before degradation commences most proteins are first marked for destruction by being coupled to a chain of ubiquitin molecules. Some UBL...

  20. Interaction between plate make and protein in protein crystallisation screening.

    Directory of Open Access Journals (Sweden)

    Gordon J King

    Full Text Available BACKGROUND: Protein crystallisation screening involves the parallel testing of large numbers of candidate conditions with the aim of identifying conditions suitable as a starting point for the production of diffraction quality crystals. Generally, condition screening is performed in 96-well plates. While previous studies have examined the effects of protein construct, protein purity, or crystallisation condition ingredients on protein crystallisation, few have examined the effect of the crystallisation plate. METHODOLOGY/PRINCIPAL FINDINGS: We performed a statistically rigorous examination of protein crystallisation, and evaluated interactions between crystallisation success and plate row/column, different plates of same make, different plate makes and different proteins. From our analysis of protein crystallisation, we found a significant interaction between plate make and the specific protein being crystallised. CONCLUSIONS/SIGNIFICANCE: Protein crystal structure determination is the principal method for determining protein structure but is limited by the need to produce crystals of the protein under study. Many important proteins are difficult to crystallize, so that identification of factors that assist crystallisation could open up the structure determination of these more challenging targets. Our findings suggest that protein crystallisation success may be improved by matching a protein with its optimal plate make.

  1. HIV protein sequence hotspots for crosstalk with host hub proteins.

    Directory of Open Access Journals (Sweden)

    Mahdi Sarmady

    Full Text Available HIV proteins target host hub proteins for transient binding interactions. The presence of viral proteins in the infected cell results in out-competition of host proteins in their interaction with hub proteins, drastically affecting cell physiology. Functional genomics and interactome datasets can be used to quantify the sequence hotspots on the HIV proteome mediating interactions with host hub proteins. In this study, we used the HIV and human interactome databases to identify HIV targeted host hub proteins and their host binding partners (H2. We developed a high throughput computational procedure utilizing motif discovery algorithms on sets of protein sequences, including sequences of HIV and H2 proteins. We identified as HIV sequence hotspots those linear motifs that are highly conserved on HIV sequences and at the same time have a statistically enriched presence on the sequences of H2 proteins. The HIV protein motifs discovered in this study are expressed by subsets of H2 host proteins potentially outcompeted by HIV proteins. A large subset of these motifs is involved in cleavage, nuclear localization, phosphorylation, and transcription factor binding events. Many such motifs are clustered on an HIV sequence in the form of hotspots. The sequential positions of these hotspots are consistent with the curated literature on phenotype altering residue mutations, as well as with existing binding site data. The hotspot map produced in this study is the first global portrayal of HIV motifs involved in altering the host protein network at highly connected hub nodes.

  2. Characterization of Protein Complexes and Subcomplexes in Protein-Protein Interaction Databases

    OpenAIRE

    Nazar Zaki; Elfadil A. Mohamed; Antonio Mora

    2015-01-01

    The identification and characterization of protein complexes implicated in protein-protein interaction data are crucial to the understanding of the molecular events under normal and abnormal physiological conditions. This paper provides a novel characterization of subcomplexes in protein interaction databases, stressing definition and representation issues, quantification, biological validation, network metrics, motifs, modularity, and gene ontology (GO) terms. The paper introduces the concep...

  3. Protein Molecular Structures, Protein SubFractions, and Protein Availability Affected by Heat Processing: A Review

    Directory of Open Access Journals (Sweden)

    Peiqiang Yu

    2007-01-01

    Full Text Available The utilization and availability of protein depended on the types of protein and their specific susceptibility to enzymatic hydrolysis (inhibitory activities in the gastrointestine and was highly associated with protein molecular structures. Studying internal protein structure and protein subfraction profiles leaded to an understanding of the components that make up a whole protein. An understanding of the molecular structure of the whole protein was often vital to understanding its digestive behavior and nutritive value in animals. In this review, recently obtained information on protein molecular structural effects of heat processing was reviewed, in relation to protein characteristics affecting digestive behavior and nutrient utilization and availability. The emphasis of this review was on (1 using the newly advanced synchrotron technology (S-FTIR as a novel approach to reveal protein molecular chemistry affected by heat processing within intact plant tissues; (2 revealing the effects of heat processing on the profile changes of protein subfractions associated with digestive behaviors and kinetics manipulated by heat processing; (3 prediction of the changes of protein availability and supply after heat processing, using the advanced DVE/OEB and NRC-2001 models, and (4 obtaining information on optimal processing conditions of protein as intestinal protein source to achieve target values for potential high net absorbable protein in the small intestine. The information described in this article may give better insight in the mechanisms involved and the intrinsic protein molecular structural changes occurring upon processing.

  4. Transient protein-protein interactions visualized by solution NMR.

    Science.gov (United States)

    Liu, Zhu; Gong, Zhou; Dong, Xu; Tang, Chun

    2016-01-01

    Proteins interact with each other to establish their identities in cell. The affinities for the interactions span more than ten orders of magnitude, and KD values in μM-mM regimen are considered transient and are important in cell signaling. Solution NMR including diamagnetic and paramagnetic techniques has enabled atomic-resolution depictions of transient protein-protein interactions. Diamagnetic NMR allows characterization of protein complexes with KD values up to several mM, whereas ultraweak and fleeting complexes can be modeled with the use of paramagnetic NMR especially paramagnetic relaxation enhancement (PRE). When tackling ever-larger protein complexes, PRE can be particularly useful in providing long-range intermolecular distance restraints. As NMR measurements are averaged over the ensemble of complex structures, structural information for dynamic protein-protein interactions besides the stereospecific one can often be extracted. Herein the protein interaction dynamics are exemplified by encounter complexes, alternative binding modes, and coupled binding/folding of intrinsically disordered proteins. Further integration of NMR with other biophysical techniques should allow better visualization of transient protein-protein interactions. In particular, single-molecule data may facilitate the interpretation of ensemble-averaged NMR data. Though same structures of proteins and protein complexes were found in cell as in diluted solution, we anticipate that the dynamics of transient protein protein-protein interactions be different, which awaits awaits exploration by NMR. This article is part of a Special Issue entitled: Physiological Enzymology and Protein Functions. This article is part of a Special Issue entitled: Physiological Enzymology and Protein Functions. PMID:25896389

  5. Protein (Viridiplantae): 308810769 [

    Lifescience Database Archive (English)

    Full Text Available XP_003082693.1 33090:1723 3041:2182 1035538:123 13792:123 70447:3706 70448:4753 K+-channel ERG a ... nd related proteins, contain PAS /PAC sensor domain (ISS) Ostreococcus tauri MHFNADL ...

  6. Protein (Viridiplantae): 308809165 [

    Lifescience Database Archive (English)

    Full Text Available XP_003081892.1 33090:2400 3041:801 1035538:331 13792:331 70447:681 70448:136 K+-channel ERG and ... related proteins, contain PAS /PAC sensor domain (ISS) Ostreococcus tauri MPSTAGM ...

  7. Protein (Viridiplantae): 357507515 [

    Lifescience Database Archive (English)

    Full Text Available XP_003624046.1 33090:6310 35493:7221 131221:7221 3193:7221 58023:3109 78536:1898 58024:1898 3398 ... 803:6139 3814:6139 163742:7708 3877:7708 3880:7708 Nematode ... resistance-like protein Medicago truncatula MTLPLA ...

  8. Protein (Viridiplantae): 225448363 [

    Lifescience Database Archive (English)

    Full Text Available XP_002268520.1 33090:30695 35493:21281 131221:21281 3193:21281 58023:14619 78536:14658 58024:146 ... 667:4453 3602:4453 3603:4453 29760:4453 PREDICTED: nematode ... resistance protein-like HSPRO2 isoform 1 Vitis vin ...

  9. Protein (Viridiplantae): 226529483 [

    Lifescience Database Archive (English)

    Full Text Available NP_001151109.1 33090:30695 35493:21281 131221:21281 3193:21281 58023:14619 78536:14658 58024:146 ... 0:6136 147369:6136 147429:6136 4575:6020 4577:6020 nematode -resistance protein Zea mays MATPDLSPVSPVRRDDKQCAPS ...

  10. Protein (Viridiplantae): 357125930 [

    Lifescience Database Archive (English)

    Full Text Available XP_003564642.1 33090:30695 35493:21281 131221:21281 3193:21281 58023:14619 78536:14658 58024:146 ... :4262 147385:4262 15367:4262 15368:4262 PREDICTED: nematode ... resistance protein-like HSPRO1-like Brachypodium d ...

  11. Protein (Viridiplantae): 356553794 [

    Lifescience Database Archive (English)

    Full Text Available XP_003545237.1 33090:30695 35493:21281 131221:21281 3193:21281 58023:14619 78536:14658 58024:146 ... 14:9870 163735:3769 3846:3769 3847:3769 PREDICTED: nematode ... resistance protein-like HSPRO2-like Glycine max MV ...

  12. Protein (Viridiplantae): 357492609 [

    Lifescience Database Archive (English)

    Full Text Available XP_003616593.1 33090:30695 35493:21281 131221:21281 3193:21281 58023:14619 78536:14658 58024:146 ... :9870 3814:9870 163742:15503 3877:15503 3880:15503 Nematode ... resistance HS1pro1 protein Medicago truncatula MVD ...

  13. Protein (Viridiplantae): 351726303 [

    Lifescience Database Archive (English)

    Full Text Available NP_001236610.1 33090:30695 35493:21281 131221:21281 3193:21281 58023:14619 78536:14658 58024:146 ... 803:9870 3814:9870 163735:3769 3846:3769 3847:3769 nematode ... resistance HS1pro1 protein Glycine max MVDLDWQTKMV ...

  14. Protein (Viridiplantae): 350537949 [

    Lifescience Database Archive (English)

    Full Text Available NP_001234063.1 33090:6270 35493:2337 131221:2337 3193:2337 58023:2583 78536:1868 58024:1868 3398 ... 4 424574:154 4107:154 49274:154 4081:154 root-knot nematode ... resistance protein Solanum lycopersicum MEKRKDIEEA ...

  15. Protein (Viridiplantae): 356568543 [

    Lifescience Database Archive (English)

    Full Text Available XP_003552470.1 33090:30695 35493:21281 131221:21281 3193:21281 58023:14619 78536:14658 58024:146 ... 14:9870 163735:3769 3846:3769 3847:3769 PREDICTED: nematode ... resistance protein-like HSPRO2-like Glycine max MV ...

  16. Protein (Viridiplantae): 356560204 [

    Lifescience Database Archive (English)

    Full Text Available XP_003548384.1 33090:30695 35493:21281 131221:21281 3193:21281 58023:14619 78536:14658 58024:146 ... 14:9870 163735:3769 3846:3769 3847:3769 PREDICTED: nematode ... resistance protein-like HSPRO2-like, partial Glyci ...

  17. Combinable protein crop production

    OpenAIRE

    Wright, Isobel

    2008-01-01

    This research topic review aims to summarise research knowledge and observational experience of combinable protein crop production in organic farming systems for the UK. European research on peas, faba beans and lupins is included; considering their role in the rotation, nitrogen fixation, varieties, establishment, weed control, yields, problems experienced and intercropping with cereals.

  18. Protein (Viridiplantae): 226531780 [

    Lifescience Database Archive (English)

    Full Text Available NP_001147196.1 33090:20715 35493:21884 131221:21884 3193:21884 58023:14330 78536:14347 58024:143 ... 470 4575:5441 4577:5441 deleted in split hand/splt foot ... protein 1 Zea mays MAAAPADAKAEAAKMDLLEDDDEFEEFEIDQ ...

  19. Protein (Viridiplantae): 159468784 [

    Lifescience Database Archive (English)

    Full Text Available XP_001692554.1 33090:22049 3041:6770 3166:4229 3042:4229 3051:3540 3052:3540 3055:3540 coenzyme ... ing protein, partial Chlamydomonas reinhardtii WTPEQ LYAVVSRVEDYHLFVPWCQ KSRPAAREAGDYMEAELEVGFQ LLVERYTSQ I ... YLTPGRAVRSAVPDSSLFDHLDSTWTMEPGPAPATCWLSFHVDFAFRSQ LHGYLADLFFSEVVKQ MSNAFEGRCARLYGPSS ...

  20. Protein (Viridiplantae): 18395564 [

    Lifescience Database Archive (English)

    Full Text Available NP_027545.1 33090:256 35493:21220 131221:21220 3193:21220 58023:13487 78536:13436 58024:13436 33 ... 0:5421 980083:5421 3701:5421 3702:5521 SPFH/Band 7/PHB ... domain-containing membrane-associated protein Arab ...

  1. Protein (Viridiplantae): 15239547 [

    Lifescience Database Archive (English)

    Full Text Available NP_200221.1 33090:255 35493:10960 131221:10960 3193:10960 58023:6871 78536:476 58024:476 3398:47 ... 0:2583 980083:2583 3701:2583 3702:1873 SPFH/Band 7/PHB ... domain-containing membrane-associated protein Arab ...

  2. Protein (Viridiplantae): 18417021 [

    Lifescience Database Archive (English)

    Full Text Available NP_567778.1 33090:255 35493:10960 131221:10960 3193:10960 58023:6871 78536:476 58024:476 3398:47 ... 0:2583 980083:2583 3701:2583 3702:1873 SPFH/Band 7/PHB ... domain-containing membrane-associated protein Arab ...

  3. Protein (Viridiplantae): 42571103 [

    Lifescience Database Archive (English)

    Full Text Available NP_973625.1 33090:14975 35493:14487 131221:14487 3193:14487 58023:10069 78536:8383 58024:8383 33 ... 980083:5566 3701:5566 3702:5685 protein sodium-and lithium -tolerant 1 Arabidopsis thaliana MENMYMWVFKERPENALG ...

  4. Protein (Viridiplantae): 18404463 [

    Lifescience Database Archive (English)

    Full Text Available NP_565864.1 33090:14975 35493:14487 131221:14487 3193:14487 58023:10069 78536:8383 58024:8383 33 ... 980083:5566 3701:5566 3702:5685 protein sodium-and lithium -tolerant 1 Arabidopsis thaliana MENHHPSTLLSMDSSASS ...

  5. Protein (Viridiplantae): 255590528 [

    Lifescience Database Archive (English)

    Full Text Available XP_002535292.1 33090:897 35493:1400 131221:1400 3193:1400 58023:1784 78536:1198 58024:1198 3398: ... 5629:537 235880:537 3987:537 3988:537 Protein BABY BOOM , putative Ricinus communis MKHMTRQEFVASIRRKSSGFSRG ...

  6. Protein (Viridiplantae): 226500350 [

    Lifescience Database Archive (English)

    Full Text Available NP_001147535.1 33090:897 35493:1400 131221:1400 3193:1400 58023:1784 78536:1198 58024:1198 3398: ... 7369:454 147429:454 4575:168 4577:168 protein BABY BOOM ... 1 Zea mays MASANNWLGFSLSGQDNPQPNQDSSPAAGIDISGASDFY ...

  7. Protein (Viridiplantae): 255585676 [

    Lifescience Database Archive (English)

    Full Text Available XP_002533523.1 33090:897 35493:1400 131221:1400 3193:1400 58023:1784 78536:1198 58024:1198 3398: ... 5629:537 235880:537 3987:537 3988:537 Protein BABY BOOM , putative Ricinus communis MAPATTNWLSFSLSPMEMLRSST ...

  8. Protein (Viridiplantae): 308807062 [

    Lifescience Database Archive (English)

    Full Text Available XP_003080842.1 33090:2448 3041:440 1035538:347 13792:347 70447:323 70448:86 FTSH1_SYNY3 Cell ... div ... ision protein ftsH homolog 1 dbj|BAA10230.1| cell ... division prot (ISS) Ostreococcus tauri MRAHFRASVRA ...

  9. Protein Thin Film Machines

    OpenAIRE

    Federici, Stefania; Oliviero, Giulio; Hamad-Schifferli, Kimberly; Bergese, Paolo

    2010-01-01

    We report the first example of microcantilever beams that are reversibly driven by protein thin film machines fuelled by cycling the salt concentration of the surrounding solution. We also show that upon the same salinity stimulus the drive can be completely reversed in its direction by introducing a surface coating ligand. Experimental results are throughout discussed within a general yet simple thermodynamic model.

  10. Protein (Viridiplantae): 255541926 [

    Lifescience Database Archive (English)

    Full Text Available XP_002512027.1 33090:26381 35493:16326 131221:16326 3193:16326 58023:13222 78536:13135 58024:131 ... 7:4031 235629:4031 235880:4031 3987:4031 3988:4031 Ethanol ... tolerance protein GEKO1, putative Ricinus communis ...

  11. Protein (Viridiplantae): 30693285 [

    Lifescience Database Archive (English)

    Full Text Available NP_198682.3 33090:122 35493:14455 131221:14455 3193:14455 58023:10070 78536:8442 58024:8442 3398 ... 83:3647 3701:3647 3702:3409 protein acclimation of photosynthesis ... to environment Arabidopsis thaliana MGSITVAPGTTVLF ...

  12. Protein (Viridiplantae): 334188069 [

    Lifescience Database Archive (English)

    Full Text Available NP_001190435.1 33090:122 35493:14455 131221:14455 3193:14455 58023:10070 78536:8442 58024:8442 3 ... 83:3647 3701:3647 3702:3409 protein acclimation of photosynthesis ... to environment Arabidopsis thaliana MGSITVAPGTTVLF ...

  13. Protein (Viridiplantae): 15233302 [

    Lifescience Database Archive (English)

    Full Text Available NP_191115.1 33090:10299 35493:193 131221:193 3193:193 58023:114 78536:2677 58024:2677 3398:2677 ... 083:3094 3701:3094 3702:2636 AT-hook protein of GA feedback ... 2 Arabidopsis thaliana MANPWWVGNVAIGGVESPVTSSAPSLH ...

  14. Protein (Viridiplantae): 30690333 [

    Lifescience Database Archive (English)

    Full Text Available NP_195265.2 33090:10299 35493:193 131221:193 3193:193 58023:114 78536:2677 58024:2677 3398:2677 ... 083:3094 3701:3094 3702:2636 AT-hook protein of GA feedback ... 1 Arabidopsis thaliana MSSYMHPLLGQELHLQRPEDSRTPPDQ ...

  15. Protein (Viridiplantae): 357439925 [

    Lifescience Database Archive (English)

    Full Text Available XP_003590240.1 33090:207 35493:345 131221:345 3193:345 58023:188 78536:6156 58024:6156 3398:6156 ... 249 3803:249 3814:249 163742:554 3877:554 3880:554 CRM ... domain-containing protein, putative Medicago trunc ...

  16. Protein (Viridiplantae): 15232195 [

    Lifescience Database Archive (English)

    Full Text Available NP_189392.1 33090:207 35493:345 131221:345 3193:345 58023:188 78536:6156 58024:6156 3398:6156 71 ... :2768 3701:2768 3702:2151 RNA-binding CRS1 / YhbY (CRM ) domain protein Arabidopsis thaliana MNQVFKGWSRGMS ...

  17. Protein (Viridiplantae): 357439975 [

    Lifescience Database Archive (English)

    Full Text Available XP_003590265.1 33090:207 35493:345 131221:345 3193:345 58023:188 78536:6156 58024:6156 3398:6156 ... 249 3803:249 3814:249 163742:554 3877:554 3880:554 CRM ... domain-containing protein, putative Medicago trunc ...

  18. Protein (Viridiplantae): 15226402 [

    Lifescience Database Archive (English)

    Full Text Available NP_180415.1 33090:207 35493:345 131221:345 3193:345 58023:188 78536:6156 58024:6156 3398:6156 71 ... :2768 3701:2768 3702:2151 RNA-binding CRS1 / YhbY (CRM ) domain protein Arabidopsis thaliana MAIAFARGLRKAS ...

  19. Protein (Viridiplantae): 225448146 [

    Lifescience Database Archive (English)

    Full Text Available XP_002263852.1 33090:207 35493:345 131221:345 3193:345 58023:188 78536:6156 58024:6156 3398:6156 ... :525 3603:525 29760:525 PREDICTED: uncharacterized CRM ... domain-containing protein At3g25440, chloroplastic ...

  20. Protein (Viridiplantae): 79417439 [

    Lifescience Database Archive (English)

    Full Text Available NP_189171.2 33090:207 35493:345 131221:345 3193:345 58023:188 78536:6156 58024:6156 3398:6156 71 ... 68 980083:2768 3701:2768 3702:2151 uncharacterized CRM ... domain-containing protein Arabidopsis thaliana MGF ...

  1. Protein (Viridiplantae): 145332683 [

    Lifescience Database Archive (English)

    Full Text Available NP_001078207.1 33090:207 35493:345 131221:345 3193:345 58023:188 78536:6156 58024:6156 3398:6156 ... 68 980083:2768 3701:2768 3702:2151 uncharacterized CRM ... domain-containing protein Arabidopsis thaliana MWN ...

  2. Protein (Viridiplantae): 240254502 [

    Lifescience Database Archive (English)

    Full Text Available NP_179731.4 33090:11082 35493:11019 131221:11019 3193:11019 58023:8723 78536:6595 58024:6595 339 ... :4699 3701:4699 3702:4683 RNA-binding CRS1 / YhbY (CRM ) domain protein Arabidopsis thaliana MATAKSSTLTNLI ...

  3. Protein (Viridiplantae): 42566743 [

    Lifescience Database Archive (English)

    Full Text Available NP_193043.2 33090:207 35493:345 131221:345 3193:345 58023:188 78536:6156 58024:6156 3398:6156 71 ... :2768 3701:2768 3702:2151 RNA-binding CRS1 / YhbY (CRM ) domain protein Arabidopsis thaliana MLALGYAKEIAQR ...

  4. Protein (Viridiplantae): 15229636 [

    Lifescience Database Archive (English)

    Full Text Available NP_188468.1 33090:207 35493:345 131221:345 3193:345 58023:188 78536:6156 58024:6156 3398:6156 71 ... :2768 980083:2768 3701:2768 3702:2151 CRS1 / YhbY (CRM ) domain-containing protein Arabidopsis thaliana MA ...

  5. Protein (Viridiplantae): 225444203 [

    Lifescience Database Archive (English)

    Full Text Available XP_002270373.1 33090:207 35493:345 131221:345 3193:345 58023:188 78536:6156 58024:6156 3398:6156 ... :525 3603:525 29760:525 PREDICTED: uncharacterized CRM ... domain-containing protein At3g25440, chloroplastic ...

  6. Protein (Viridiplantae): 357478871 [

    Lifescience Database Archive (English)

    Full Text Available XP_003609721.1 33090:207 35493:345 131221:345 3193:345 58023:188 78536:6156 58024:6156 3398:6156 ... 249 3803:249 3814:249 163742:554 3877:554 3880:554 CRM ... domain-containing protein, putative Medicago trunc ...

  7. Protein (Viridiplantae): 334187011 [

    Lifescience Database Archive (English)

    Full Text Available NP_194704.2 33090:207 35493:345 131221:345 3193:345 58023:188 78536:6156 58024:6156 3398:6156 71 ... :2768 980083:2768 3701:2768 3702:2151 CRS1 / YhbY (CRM ) domain-containing protein Arabidopsis thaliana MA ...

  8. Protein (Viridiplantae): 357167884 [

    Lifescience Database Archive (English)

    Full Text Available XP_003581379.1 33090:207 35493:345 131221:345 3193:345 58023:188 78536:6156 58024:6156 3398:6156 ... 6 15367:4086 15368:4086 PREDICTED: uncharacterized CRM ... domain-containing protein At3g25440, chloroplastic ...

  9. Protein (Viridiplantae): 357521229 [

    Lifescience Database Archive (English)

    Full Text Available XP_003630903.1 33090:207 35493:345 131221:345 3193:345 58023:188 78536:6156 58024:6156 3398:6156 ... 249 3803:249 3814:249 163742:554 3877:554 3880:554 CRM ... domain-containing protein, putative Medicago trunc ...

  10. Protein (Viridiplantae): 357124470 [

    Lifescience Database Archive (English)

    Full Text Available XP_003563923.1 33090:207 35493:345 131221:345 3193:345 58023:188 78536:6156 58024:6156 3398:6156 ... 6 15367:4086 15368:4086 PREDICTED: uncharacterized CRM ... domain-containing protein At3g25440, chloroplastic ...

  11. Protein (Viridiplantae): 357467665 [

    Lifescience Database Archive (English)

    Full Text Available XP_003604117.1 33090:7684 35493:9413 131221:9413 3193:9413 58023:4125 78536:6265 58024:6265 3398 ... :7265 3814:7265 163742:15887 3877:15887 3880:15887 StAR -related lipid transfer protein Medicago truncatula ...

  12. Protein (Viridiplantae): 15236909 [

    Lifescience Database Archive (English)

    Full Text Available NP_194422.1 33090:7490 35493:1858 131221:1858 3193:1858 58023:4234 78536:3190 58024:3190 3398:31 ... 22 3699:122 3700:122 980083:122 3701:122 3702:1780 StAR -related lipid-transfer protein Arabidopsis thalian ...

  13. Protein (Viridiplantae): 357464181 [

    Lifescience Database Archive (English)

    Full Text Available XP_003602372.1 33090:7684 35493:9413 131221:9413 3193:9413 58023:4125 78536:6265 58024:6265 3398 ... :7265 3814:7265 163742:15887 3877:15887 3880:15887 StAR -related lipid transfer protein Medicago truncatula ...

  14. Protein (Viridiplantae): 357464183 [

    Lifescience Database Archive (English)

    Full Text Available XP_003602373.1 33090:7684 35493:9413 131221:9413 3193:9413 58023:4125 78536:6265 58024:6265 3398 ... :7265 3814:7265 163742:15887 3877:15887 3880:15887 StAR -related lipid transfer protein Medicago truncatula ...

  15. Protein (Viridiplantae): 357467663 [

    Lifescience Database Archive (English)

    Full Text Available XP_003604116.1 33090:7684 35493:9413 131221:9413 3193:9413 58023:4125 78536:6265 58024:6265 3398 ... :7265 3814:7265 163742:15887 3877:15887 3880:15887 StAR -related lipid transfer protein Medicago truncatula ...

  16. Protein (Viridiplantae): 255568289 [

    Lifescience Database Archive (English)

    Full Text Available XP_002525119.1 33090:1951 35493:1293 131221:1293 3193:1293 58023:2877 78536:1422 58024:1422 3398 ... 977:13 235629:13 235880:13 3987:13 3988:13 Adaptin ear -binding coat-associated protein, putative Ricinus ...

  17. Protein (Viridiplantae): 18410992 [

    Lifescience Database Archive (English)

    Full Text Available NP_567071.1 33090:1951 35493:1293 131221:1293 3193:1293 58023:2877 78536:1422 58024:1422 3398:14 ... 239 3700:239 980083:239 3701:239 3702:5411 Adaptin ear -binding coat-associated protein 1 NECAP-1 Arabidop ...

  18. Protein (Viridiplantae): 255577954 [

    Lifescience Database Archive (English)

    Full Text Available XP_002529849.1 33090:1951 35493:1293 131221:1293 3193:1293 58023:2877 78536:1422 58024:1422 3398 ... 977:13 235629:13 235880:13 3987:13 3988:13 Adaptin ear -binding coat-associated protein, putative Ricinus ...

  19. Protein (Viridiplantae): 226509020 [

    Lifescience Database Archive (English)

    Full Text Available NP_001152713.1 33090:451 35493:523 131221:523 3193:523 58023:837 78536:8759 58024:8759 3398:8759 ... 147369:5146 147429:5146 4575:1047 4577:1047 MFT2 - Corn ... MFT-like protein Zea mays MARFVDPLVVGRVIGEVVDLFVPS ...

  20. Protein (Viridiplantae): 226532395 [

    Lifescience Database Archive (English)

    Full Text Available NP_001147266.1 33090:451 35493:523 131221:523 3193:523 58023:837 78536:8759 58024:8759 3398:8759 ... 147369:5146 147429:5146 4575:1047 4577:1047 MFT2 - Corn ... MFT-like protein Zea mays MARFVDPLVVGRVIGEVVDLFVPS ...

  1. Protein (Cyanobacteria): 28418 [

    Lifescience Database Archive (English)

    Full Text Available ZP_18827726.1 1117:517 1118:7626 1125:2051 1126:2469 1160281:2759 Type 4 prepilin-like proteins ... leader ... peptide-processing enzyme (Includes: Leader ... peptidase ; N-methyltransferase) Microcystis aerug ...

  2. Protein (Cyanobacteria): 28422 [

    Lifescience Database Archive (English)

    Full Text Available ZP_18817031.1 1117:517 1118:7626 1125:2051 1126:2469 1160280:2213 Type 4 prepilin-like proteins ... leader ... peptide-processing enzyme (Includes: Leader ... peptidase ; N-methyltransferase) Microcystis aerug ...

  3. Protein (Cyanobacteria): 28419 [

    Lifescience Database Archive (English)

    Full Text Available ZP_18835633.1 1117:517 1118:7626 1125:2051 1126:2469 1160283:2051 Type 4 prepilin-like proteins ... leader ... peptide-processing enzyme (Includes: Leader ... peptidase ; N-methyltransferase) Microcystis aerug ...

  4. Protein (Cyanobacteria): 28417 [

    Lifescience Database Archive (English)

    Full Text Available ZP_18822668.1 1117:517 1118:7626 1125:2051 1126:2469 1160286:2656 Type 4 prepilin-like proteins ... leader ... peptide-processing enzyme (Includes: Leader ... peptidase ; N-methyltransferase) Microcystis aerug ...

  5. Protein (Cyanobacteria): 28421 [

    Lifescience Database Archive (English)

    Full Text Available ZP_18849476.1 1117:517 1118:7626 1125:2051 1126:2469 721123:1760 Type 4 prepilin-like proteins leader ... eader peptide-processing enzyme (Includes: Leader ... peptidase ; N-methyltransferase) Microcystis aerug ...

  6. Protein (Cyanobacteria): 28415 [

    Lifescience Database Archive (English)

    Full Text Available ZP_18831825.1 1117:517 1118:7626 1125:2051 1126:2469 213618:2396 Type 4 prepilin-like proteins leader ... eader peptide-processing enzyme (Includes: Leader ... peptidase ; N-methyltransferase) Microcystis aerug ...

  7. Protein (Cyanobacteria): 28416 [

    Lifescience Database Archive (English)

    Full Text Available ZP_18841888.1 1117:517 1118:7626 1125:2051 1126:2469 1160284:2857 Type 4 prepilin-like proteins ... leader ... peptide-processing enzyme (Includes: Leader ... peptidase ; N-methyltransferase) Microcystis aerug ...

  8. Protein (Cyanobacteria): 28420 [

    Lifescience Database Archive (English)

    Full Text Available ZP_18844408.1 1117:517 1118:7626 1125:2051 1126:2469 1160285:1581 Type 4 prepilin-like proteins ... leader ... peptide-processing enzyme (Includes: Leader ... peptidase ; N-methyltransferase) Microcystis aerug ...

  9. Protein (Cyanobacteria): 28414 [

    Lifescience Database Archive (English)

    Full Text Available ZP_16388674.1 1117:517 1118:7626 1125:2051 1126:2469 1160282:309 Type 4 prepilin-like proteins leader ... eader peptide-processing enzyme (Includes: Leader ... peptidase ; N-methyltransferase) Microcystis aerug ...

  10. Protein (Viridiplantae): 359494868 [

    Lifescience Database Archive (English)

    Full Text Available XP_003634859.1 33090:7785 35493:2083 131221:2083 3193:2083 58023:1440 78536:1643 58024:1643 3398 ... 403667:299 3602:299 3603:299 29760:299 PREDICTED: influenza ... virus NS1A-binding protein homolog Vitis vinifera ...

  11. Protein (Viridiplantae): 359496826 [

    Lifescience Database Archive (English)

    Full Text Available XP_003635348.1 33090:7785 35493:2083 131221:2083 3193:2083 58023:1440 78536:1643 58024:1643 3398 ... 403667:299 3602:299 3603:299 29760:299 PREDICTED: influenza ... virus NS1A-binding protein homolog Vitis vinifera ...

  12. Protein (Viridiplantae): 255547720 [

    Lifescience Database Archive (English)

    Full Text Available XP_002514917.1 33090:975 35493:959 131221:959 3193:959 58023:1582 78536:423 58024:423 3398:423 7 ... 235629:4243 235880:4243 3987:4243 3988:4243 Small rubber ... particle protein, putative Ricinus communis METEKK ...

  13. Protein (Viridiplantae): 30697500 [

    Lifescience Database Archive (English)

    Full Text Available NP_849856.1 33090:975 35493:959 131221:959 3193:959 58023:1582 78536:423 58024:423 3398:423 7124 ... 699:3534 3700:3534 980083:3534 3701:3534 3702:3251 Rubber ... elongation factor protein (REF) Arabidopsis thalia ...

  14. Protein (Viridiplantae): 15230002 [

    Lifescience Database Archive (English)

    Full Text Available NP_187201.1 33090:975 35493:959 131221:959 3193:959 58023:1582 78536:423 58024:423 3398:423 7124 ... 699:3534 3700:3534 980083:3534 3701:3534 3702:3251 Rubber ... elongation factor protein Arabidopsis thaliana MAT ...

  15. Protein (Viridiplantae): 15220426 [

    Lifescience Database Archive (English)

    Full Text Available NP_176904.1 33090:975 35493:959 131221:959 3193:959 58023:1582 78536:423 58024:423 3398:423 7124 ... 699:3534 3700:3534 980083:3534 3701:3534 3702:3251 Rubber ... elongation factor protein (REF) Arabidopsis thalia ...

  16. Protein (Viridiplantae): 255542728 [

    Lifescience Database Archive (English)

    Full Text Available XP_002512427.1 33090:975 35493:959 131221:959 3193:959 58023:1582 78536:423 58024:423 3398:423 7 ... 7:4243 235629:4243 235880:4243 3987:4243 3988:4243 Rubber ... elongation factor protein, putative Ricinus commun ...

  17. Protein (Viridiplantae): 297841421 [

    Lifescience Database Archive (English)

    Full Text Available XP_002888592.1 33090:975 35493:959 131221:959 3193:959 58023:1582 78536:423 58024:423 3398:423 7 ... 0:3534 980083:3534 3701:3534 59689:7990 81972:7990 rubber ... elongation factor family protein Arabidopsis lyrat ...

  18. Protein (Viridiplantae): 255582180 [

    Lifescience Database Archive (English)

    Full Text Available XP_002531884.1 33090:975 35493:959 131221:959 3193:959 58023:1582 78536:423 58024:423 3398:423 7 ... 235629:4243 235880:4243 3987:4243 3988:4243 Small rubber ... particle protein, putative Ricinus communis MAESEV ...

  19. Protein (Viridiplantae): 297829074 [

    Lifescience Database Archive (English)

    Full Text Available XP_002882419.1 33090:975 35493:959 131221:959 3193:959 58023:1582 78536:423 58024:423 3398:423 7 ... 0:3534 980083:3534 3701:3534 59689:7990 81972:7990 rubber ... elongation factor family protein Arabidopsis lyrat ...

  20. Protein (Viridiplantae): 15227131 [

    Lifescience Database Archive (English)

    Full Text Available NP_182299.1 33090:975 35493:959 131221:959 3193:959 58023:1582 78536:423 58024:423 3398:423 7124 ... 699:3534 3700:3534 980083:3534 3701:3534 3702:3251 Rubber ... elongation factor protein (REF) Arabidopsis thalia ...

  1. Protein (Viridiplantae): 15219200 [

    Lifescience Database Archive (English)

    Full Text Available NP_178006.1 33090:6322 35493:2262 131221:2262 3193:2262 58023:2407 78536:1099 58024:1099 3398:10 ... 514 3702:695 D-mannose binding lectin protein with Apple -like carbohydrate-binding domain Arabidopsis thali ...

  2. Protein (Viridiplantae): 15230565 [

    Lifescience Database Archive (English)

    Full Text Available NP_190739.1 33090:6322 35493:2262 131221:2262 3193:2262 58023:2407 78536:1099 58024:1099 3398:10 ... 514 3702:895 D-mannose binding lectin protein with Apple -like carbohydrate-binding domain Arabidopsis thali ...

  3. Protein (Viridiplantae): 15219197 [

    Lifescience Database Archive (English)

    Full Text Available NP_178003.1 33090:6322 35493:2262 131221:2262 3193:2262 58023:2407 78536:1099 58024:1099 3398:10 ... 514 3702:695 D-mannose binding lectin protein with Apple -like carbohydrate-binding domain Arabidopsis thali ...

  4. Protein Requirements during Aging.

    Science.gov (United States)

    Courtney-Martin, Glenda; Ball, Ronald O; Pencharz, Paul B; Elango, Rajavel

    2016-01-01

    Protein recommendations for elderly, both men and women, are based on nitrogen balance studies. They are set at 0.66 and 0.8 g/kg/day as the estimated average requirement (EAR) and recommended dietary allowance (RDA), respectively, similar to young adults. This recommendation is based on single linear regression of available nitrogen balance data obtained at test protein intakes close to or below zero balance. Using the indicator amino acid oxidation (IAAO) method, we estimated the protein requirement in young adults and in both elderly men and women to be 0.9 and 1.2 g/kg/day as the EAR and RDA, respectively. This suggests that there is no difference in requirement on a gender basis or on a per kg body weight basis between younger and older adults. The requirement estimates however are ~40% higher than the current protein recommendations on a body weight basis. They are also 40% higher than our estimates in young men when calculated on the basis of fat free mass. Thus, current recommendations may need to be re-assessed. Potential rationale for this difference includes a decreased sensitivity to dietary amino acids and increased insulin resistance in the elderly compared with younger individuals. PMID:27529275

  5. Protein Requirements during Aging

    Directory of Open Access Journals (Sweden)

    Glenda Courtney-Martin

    2016-08-01

    Full Text Available Protein recommendations for elderly, both men and women, are based on nitrogen balance studies. They are set at 0.66 and 0.8 g/kg/day as the estimated average requirement (EAR and recommended dietary allowance (RDA, respectively, similar to young adults. This recommendation is based on single linear regression of available nitrogen balance data obtained at test protein intakes close to or below zero balance. Using the indicator amino acid oxidation (IAAO method, we estimated the protein requirement in young adults and in both elderly men and women to be 0.9 and 1.2 g/kg/day as the EAR and RDA, respectively. This suggests that there is no difference in requirement on a gender basis or on a per kg body weight basis between younger and older adults. The requirement estimates however are ~40% higher than the current protein recommendations on a body weight basis. They are also 40% higher than our estimates in young men when calculated on the basis of fat free mass. Thus, current recommendations may need to be re-assessed. Potential rationale for this difference includes a decreased sensitivity to dietary amino acids and increased insulin resistance in the elderly compared with younger individuals.

  6. Protein (Viridiplantae): 357437225 [

    Lifescience Database Archive (English)

    Full Text Available XP_003588888.1 33090:11850 35493:11195 131221:11195 3193:11195 58023:7061 78536:6038 58024:6038 ... 5 91835:7640 72025:8712 3803:8712 3814:8712 163742:12345 ... 3877:12345 ... 3880:12345 ... hypothetical protein MTR_1g0 ...

  7. Protein (Viridiplantae): 168024037 [

    Lifescience Database Archive (English)

    Full Text Available XP_001764543.1 33090:26221 35493:16132 131221:16132 3193:16132 3208:12345 ... 404260:12345 ... 3214:12345 ... 5 114656:12345 ... 3215:12345 ... 3216:12345 ... 3217:12345 ... 3218:12345 ... 145481 ... :12345 ... predicted protein Physcomitrella patens subsp. pat ...

  8. Protein (Viridiplantae): 255588560 [

    Lifescience Database Archive (English)

    Full Text Available XP_002534643.1 33090:54663 35493:45756 131221:45756 3193:45756 58023:34361 78536:34515 58024:345 ... 62 235629:11062 235880:11062 3987:11062 3988:11062 Biopolymer ... transport exbD1 protein, putative Ricinus communis ...

  9. Protein (Viridiplantae): 255588558 [

    Lifescience Database Archive (English)

    Full Text Available XP_002534642.1 33090:54662 35493:45755 131221:45755 3193:45755 58023:34360 78536:34514 58024:345 ... 61 235629:11061 235880:11061 3987:11061 3988:11061 Biopolymer ... transport exbB protein, putative Ricinus communis ...

  10. Protein (Viridiplantae): 255593120 [

    Lifescience Database Archive (English)

    Full Text Available XP_002535793.1 33090:54662 35493:45755 131221:45755 3193:45755 58023:34360 78536:34514 58024:345 ... 61 235629:11061 235880:11061 3987:11061 3988:11061 Biopolymer ... transport exbB protein, putative Ricinus communis ...

  11. Protein (Viridiplantae): 357453997 [

    Lifescience Database Archive (English)

    Full Text Available XP_003597279.1 33090:16324 35493:17354 131221:17354 3193:17354 58023:13519 78536:13471 58024:134 ... 2531 3814:12531 163742:14737 3877:14737 3880:14737 Cat ... eye syndrome critical region protein Medicago trun ...

  12. Protein (Viridiplantae): 226501984 [

    Lifescience Database Archive (English)

    Full Text Available NP_001152161.1 33090:16324 35493:17354 131221:17354 3193:17354 58023:13519 78536:13471 58024:134 ... 0:3521 147369:3521 147429:3521 4575:4966 4577:4966 cat ... eye syndrome critical region protein 5 Zea mays MR ...

  13. Protein (Viridiplantae): 15234540 [

    Lifescience Database Archive (English)

    Full Text Available NP_193892.1 33090:988 35493:13743 131221:13743 3193:13743 58023:94 78536:8446 58024:8446 3398:84 ... 699:2376 3700:2376 980083:2376 3701:2376 3702:1438 lsd ... one like 2 protein Arabidopsis thaliana MEEIQQQTQK ...

  14. Protein (Viridiplantae): 18398482 [

    Lifescience Database Archive (English)

    Full Text Available NP_564405.1 33090:988 35493:13743 131221:13743 3193:13743 58023:94 78536:8446 58024:8446 3398:84 ... 699:2376 3700:2376 980083:2376 3701:2376 3702:1438 lsd ... one like 1 protein Arabidopsis thaliana MPVPLAPYPT ...

  15. Protein (Viridiplantae): 42570227 [

    Lifescience Database Archive (English)

    Full Text Available NP_849742.2 33090:988 35493:13743 131221:13743 3193:13743 58023:94 78536:8446 58024:8446 3398:84 ... 699:2376 3700:2376 980083:2376 3701:2376 3702:1438 lsd ... one like 1 protein Arabidopsis thaliana MHTWKNQIFS ...

  16. Protein (Viridiplantae): 186479127 [

    Lifescience Database Archive (English)

    Full Text Available NP_001117399.1 33090:988 35493:13743 131221:13743 3193:13743 58023:94 78536:8446 58024:8446 3398 ... 699:2376 3700:2376 980083:2376 3701:2376 3702:1438 lsd ... one like 1 protein Arabidopsis thaliana MPVPLAPYPT ...

  17. Thermal unfolding of proteins

    OpenAIRE

    Cieplak, Marek; Sulkowska, Joanna I.

    2006-01-01

    Thermal unfolding of proteins is compared to folding and mechanical stretching in a simple topology-based dynamical model. We define the unfolding time and demonstrate its low-temperature divergence. Below a characteristic temperature, contacts break at separate time scales and unfolding proceeds approximately in a way reverse to folding. Features in these scenarios agree with experiments and atomic simulations on titin.

  18. Thermal unfolding of proteins

    Science.gov (United States)

    Cieplak, Marek; Sułkowska, Joanna I.

    2005-11-01

    Thermal unfolding of proteins is compared to folding and mechanical stretching in a simple topology-based dynamical model. We define the unfolding time and demonstrate its low-temperature divergence. Below a characteristic temperature, contacts break at separate time scales and unfolding proceeds approximately in a way reverse to folding. Features in these scenarios agree with experiments and atomic simulations on titin.

  19. Protein (Viridiplantae): 30698814 [

    Lifescience Database Archive (English)

    Full Text Available NP_177324.2 33090:6429 35493:2153 131221:2153 3193:2153 58023:2922 78536:756 58024:756 3398:756 ... 01:7638 3702:7984 capping protein (actin filament) muscle ... Z-line, beta Arabidopsis thaliana MEAALGLLRRMPPKQS ...

  20. Protein (Viridiplantae): 240254201 [

    Lifescience Database Archive (English)

    Full Text Available NP_174750.4 33090:1851 35493:568 131221:568 3193:568 58023:377 78536:7947 58024:7947 3398:7947 7 ... 0083:7173 3701:7173 3702:7453 TRAM, LAG1 and CLN8 (TLC ) lipid-sensing domain containing protein Arabidops ...

  1. Protein (Viridiplantae): 18413327 [

    Lifescience Database Archive (English)

    Full Text Available NP_567355.1 33090:1851 35493:568 131221:568 3193:568 58023:377 78536:7947 58024:7947 3398:7947 7 ... 0083:5499 3701:5499 3702:5612 TRAM, LAG1 and CLN8 (TLC ) lipid-sensing domain containing protein Arabidops ...

  2. Protein (Viridiplantae): 18397885 [

    Lifescience Database Archive (English)

    Full Text Available NP_564377.1 33090:1851 35493:568 131221:568 3193:568 58023:377 78536:7947 58024:7947 3398:7947 7 ... 0083:5499 3701:5499 3702:5612 TRAM, LAG1 and CLN8 (TLC ) lipid-sensing domain containing protein Arabidops ...

  3. Protein (Viridiplantae): 22330031 [

    Lifescience Database Archive (English)

    Full Text Available NP_175121.2 33090:1851 35493:568 131221:568 3193:568 58023:377 78536:7947 58024:7947 3398:7947 7 ... 0083:7173 3701:7173 3702:7453 TRAM, LAG1 and CLN8 (TLC ) lipid-sensing domain containing protein Arabidops ...

  4. Protein (Viridiplantae): 30693154 [

    Lifescience Database Archive (English)

    Full Text Available NP_174751.2 33090:1851 35493:568 131221:568 3193:568 58023:377 78536:7947 58024:7947 3398:7947 7 ... 0083:7173 3701:7173 3702:7453 TRAM, LAG1 and CLN8 (TLC ) lipid-sensing domain containing protein Arabidops ...

  5. Protein (Viridiplantae): 15230950 [

    Lifescience Database Archive (English)

    Full Text Available NP_189224.1 33090:1851 35493:568 131221:568 3193:568 58023:378 78536:1039 58024:1039 3398:1039 7 ... 980083:388 3701:388 3702:2630 TRAM, LAG1 and CLN8 (TLC ) lipid-sensing domain containing protein Arabidops ...

  6. Protein (Viridiplantae): 18395035 [

    Lifescience Database Archive (English)

    Full Text Available NP_564152.1 33090:10991 35493:11467 131221:11467 3193:11467 58023:7243 78536:6148 58024:6148 339 ... 4 980083:14 3701:14 3702:5507 TRAM, LAG1 and CLN8 (TLC ) lipid-sensing domain containing protein Arabidops ...

  7. Protein (Viridiplantae): 357463503 [

    Lifescience Database Archive (English)

    Full Text Available XP_003602033.1 33090:10991 35493:11467 131221:11467 3193:11467 58023:7243 78536:6148 58024:6148 ... 1543 3814:11543 163742:15806 3877:15806 3880:15806 TLC ... domain-containing protein Medicago truncatula MAKK ...

  8. Protein (Viridiplantae): 22328807 [

    Lifescience Database Archive (English)

    Full Text Available NP_680724.1 33090:1851 35493:568 131221:568 3193:568 58023:377 78536:7947 58024:7947 3398:7947 7 ... 0083:5499 3701:5499 3702:5612 TRAM, LAG1 and CLN8 (TLC ) lipid-sensing domain containing protein Arabidops ...

  9. Protein (Viridiplantae): 238478639 [

    Lifescience Database Archive (English)

    Full Text Available NP_001154368.1 33090:9039 35493:11752 131221:11752 3193:11752 58023:7721 78536:6590 58024:6590 3 ... 0083:3773 3701:3773 3702:4297 TRAM, LAG1 and CLN8 (TLC ) lipid-sensing domain containing protein Arabidops ...

  10. Protein (Viridiplantae): 356518541 [

    Lifescience Database Archive (English)

    Full Text Available XP_003527937.1 33090:10991 35493:11467 131221:11467 3193:11467 58023:7243 78536:6148 58024:6148 ... 4:11543 163735:6135 3846:6135 3847:6135 PREDICTED: TLC ... domain-containing protein 2-like Glycine max MGGGK ...

  11. Protein (Viridiplantae): 79319015 [

    Lifescience Database Archive (English)

    Full Text Available NP_001031121.1 33090:1851 35493:568 131221:568 3193:568 58023:377 78536:7947 58024:7947 3398:794 ... 0083:5499 3701:5499 3702:5612 TRAM, LAG1 and CLN8 (TLC ) lipid-sensing domain containing protein Arabidops ...

  12. Protein (Viridiplantae): 79325051 [

    Lifescience Database Archive (English)

    Full Text Available NP_001031610.1 33090:1851 35493:568 131221:568 3193:568 58023:377 78536:7947 58024:7947 3398:794 ... 0083:5499 3701:5499 3702:5612 TRAM, LAG1 and CLN8 (TLC ) lipid-sensing domain containing protein Arabidops ...

  13. Protein (Viridiplantae): 15232128 [

    Lifescience Database Archive (English)

    Full Text Available NP_189363.1 33090:1851 35493:568 131221:568 3193:568 58023:378 78536:1039 58024:1039 3398:1039 7 ... 980083:388 3701:388 3702:2630 TRAM, LAG1 and CLN8 (TLC ) lipid-sensing domain containing protein Arabidops ...

  14. Protein (Viridiplantae): 30684833 [

    Lifescience Database Archive (English)

    Full Text Available NP_849545.1 33090:1851 35493:568 131221:568 3193:568 58023:377 78536:7947 58024:7947 3398:7947 7 ... 0083:5499 3701:5499 3702:5612 TRAM, LAG1 and CLN8 (TLC ) lipid-sensing domain containing protein Arabidops ...

  15. Protein oxidation and ageing

    DEFF Research Database (Denmark)

    Linton, S; Davies, Michael Jonathan; Dean, R T

    2001-01-01

    of redox-active metal ions that could catalyse oxidant formation. As a result of this decrease in antioxidant defences, and increased rate of ROS formation, it is possible that the impact of ROS increases with age. ROS are known to oxidise biological macromolecules, with proteins an important target...

  16. Mobility of photosynthetic proteins

    Czech Academy of Sciences Publication Activity Database

    Kaňa, Radek

    2013-01-01

    Roč. 116, 2-3 (2013), s. 465-479. ISSN 0166-8595 R&D Projects: GA ČR GAP501/12/0304; GA MŠk(CZ) ED2.1.00/03.0110 Institutional support: RVO:61388971 Keywords : Photosynthesis * Protein mobility * FRAP Subject RIV: EE - Microbiology, Virology Impact factor: 3.185, year: 2013

  17. Protein (Viridiplantae): 297844542 [

    Lifescience Database Archive (English)

    Full Text Available XP_002890152.1 33090:1045 35493:1883 131221:1883 3193:1883 58023:1713 78536:1480 58024:1480 3398 ... 7 3700:517 980083:517 3701:517 59689:609 81972:609 TMS ... membrane family protein Arabidopsis lyrata subsp. ...

  18. Protein (Viridiplantae): 297826769 [

    Lifescience Database Archive (English)

    Full Text Available XP_002881267.1 33090:1045 35493:1883 131221:1883 3193:1883 58023:1713 78536:1480 58024:1480 3398 ... 7 3700:517 980083:517 3701:517 59689:609 81972:609 TMS ... membrane family protein Arabidopsis lyrata subsp. ...

  19. Protein (Viridiplantae): 297829140 [

    Lifescience Database Archive (English)

    Full Text Available XP_002882452.1 33090:1045 35493:1883 131221:1883 3193:1883 58023:1713 78536:1480 58024:1480 3398 ... 7 3700:517 980083:517 3701:517 59689:609 81972:609 TMS ... membrane family protein Arabidopsis lyrata subsp. ...

  20. Protein (Viridiplantae): 297835532 [

    Lifescience Database Archive (English)

    Full Text Available XP_002885648.1 33090:1045 35493:1883 131221:1883 3193:1883 58023:1713 78536:1480 58024:1480 3398 ... 7 3700:517 980083:517 3701:517 59689:609 81972:609 TMS ... membrane family protein Arabidopsis lyrata subsp. ...

  1. Protein (Viridiplantae): 22327636 [

    Lifescience Database Archive (English)

    Full Text Available NP_199553.2 33090:1722 35493:20777 131221:20777 3193:20777 58023:13588 78536:13546 58024:13546 3 ... 83:5979 3701:5979 3702:6150 tryptophan RNA-binding attenuator -like protein Arabidopsis thaliana MAAPFFSTPFQPYVYQ ...

  2. Protein (Viridiplantae): 357116578 [

    Lifescience Database Archive (English)

    Full Text Available XP_003560057.1 33090:13671 35493:12750 131221:12750 3193:12750 58023:9989 78536:6448 58024:6448 ... 15367:3000 15368:3000 PREDICTED: protein TIME FOR COFFEE -like Brachypodium distachyon MIGVPVPRKARSASTKRSSHE ...

  3. Protein (Viridiplantae): 356536773 [

    Lifescience Database Archive (English)

    Full Text Available XP_003536909.1 33090:13671 35493:12750 131221:12750 3193:12750 58023:9989 78536:6448 58024:6448 ... 96 3846:5196 3847:5196 PREDICTED: protein TIME FOR COFFEE -like Glycine max MDRTRESRRSSMTTSTNGFPKRRHRTIALRDSS ...

  4. Protein (Viridiplantae): 186510319 [

    Lifescience Database Archive (English)

    Full Text Available NP_001118676.1 33090:13671 35493:12750 131221:12750 3193:12750 58023:9989 78536:6448 58024:6448 ... 8 980083:2818 3701:2818 3702:2235 protein TIME FOR COFFEE ... Arabidopsis thaliana MDRNREARRVPMAAAGNGLSRRRHRAGSF ...

  5. Protein (Viridiplantae): 356575829 [

    Lifescience Database Archive (English)

    Full Text Available XP_003556039.1 33090:13671 35493:12750 131221:12750 3193:12750 58023:9989 78536:6448 58024:6448 ... 96 3846:5196 3847:5196 PREDICTED: protein TIME FOR COFFEE -like Glycine max MDRIREARRSTMAANGLTRRRHRTNNSLRDSPE ...

  6. Protein (Viridiplantae): 357444275 [

    Lifescience Database Archive (English)

    Full Text Available XP_003592415.1 33090:13671 35493:12750 131221:12750 3193:12750 58023:9989 78536:6448 58024:6448 ... 63742:12887 3877:12887 3880:12887 Protein TIME FOR COFFEE ... Medicago truncatula MDRIREARRSTMAANGLTRRRHRTNSLRDS ...

  7. Protein (Viridiplantae): 359477506 [

    Lifescience Database Archive (English)

    Full Text Available XP_002277982.2 33090:13671 35493:12750 131221:12750 3193:12750 58023:9989 78536:6448 58024:6448 ... 1 3603:5721 29760:5721 PREDICTED: protein TIME FOR COFFEE -like Vitis vinifera MDRNREARRASMGTSNGLSRRRHRSSSLRD ...

  8. Protein (Viridiplantae): 359479681 [

    Lifescience Database Archive (English)

    Full Text Available XP_002272732.2 33090:13671 35493:12750 131221:12750 3193:12750 58023:9989 78536:6448 58024:6448 ... 1 3603:5721 29760:5721 PREDICTED: protein TIME FOR COFFEE -like Vitis vinifera MAATNGLSRRRQRSSSLRDTPEEDGQVDLP ...

  9. Protein (Viridiplantae): 357440721 [

    Lifescience Database Archive (English)

    Full Text Available XP_003590638.1 33090:13671 35493:12750 131221:12750 3193:12750 58023:9989 78536:6448 58024:6448 ... 63742:12887 3877:12887 3880:12887 Protein TIME FOR COFFEE ... Medicago truncatula MDRIRESRKSNGFPRHRHRNLEYEAVELRE ...

  10. Protein (Viridiplantae): 18403361 [

    Lifescience Database Archive (English)

    Full Text Available NP_566705.1 33090:13671 35493:12750 131221:12750 3193:12750 58023:9989 78536:6448 58024:6448 339 ... 8 980083:2818 3701:2818 3702:2235 protein TIME FOR COFFEE ... Arabidopsis thaliana MDRNREARRVPMAAAGNGLSRRRHRAGSF ...

  11. Protein (Viridiplantae): 356564268 [

    Lifescience Database Archive (English)

    Full Text Available XP_003550377.1 33090:672 35493:1481 131221:1481 3193:1481 58023:3852 78536:2780 58024:2780 3398: ... 814:981 163735:1038 3846:1038 3847:1038 PREDICTED: random ... slug protein 5-like Glycine max MFHRWSNSHQQDQGSSEL ...

  12. Protein (Viridiplantae): 18401727 [

    Lifescience Database Archive (English)

    Full Text Available NP_029426.1 33090:21008 35493:15650 131221:15650 3193:15650 58023:14656 78536:14697 58024:14697 ... 699:5639 3700:5639 980083:5639 3701:5639 3702:5762 SAND ... family protein Arabidopsis thaliana MATSDSRSSPSSSD ...

  13. Protein (Viridiplantae): 297822433 [

    Lifescience Database Archive (English)

    Full Text Available XP_002879099.1 33090:21008 35493:15650 131221:15650 3193:15650 58023:14656 78536:14697 58024:146 ... 0:5639 980083:5639 3701:5639 59689:7788 81972:7788 sand ... family protein Arabidopsis lyrata subsp. lyrata MA ...

  14. Protein–protein interactions

    NARCIS (Netherlands)

    Janin, J.; Bonvin, A.M.J.J.

    2013-01-01

    We are proud to present the first edition of the Protein–protein interactions Section of Current Opinion in Structural Biology. The Section is new, but the topic has been present in the journal from the very start. Volume 1, Issue 1, dated February 1991, had a review by Janin entitled Protein–protei

  15. Proteins and their crystals

    Czech Academy of Sciences Publication Activity Database

    Kutá-Smatanová, Ivana; Hogg, T.; Hilgenfeld, R.; Grandori, R.; Carey, J.; Vácha, František; Štys, D.

    2003-01-01

    Roč. 10, - (2003), s. 30-31. ISSN 1211-5894 R&D Projects: GA MŠk LN00A141; GA ČR GA206/00/D007 Institutional research plan: CEZ:MSM 123100001 Keywords : antiviral proteins Subject RIV: CD - Macromolecular Chemistry

  16. Thermodynamics of meat proteins

    NARCIS (Netherlands)

    Sman, van der R.G.M.

    2012-01-01

    We describe the water activity of meat, being a mixture of proteins, salts and water, by the Free-Volume-Flory–Huggins (FVFH) theory augmented with the equation. Earlier, the FVFH theory is successfully applied to describe the thermodynamics to glucose homopolymers like starch, dextrans and maltodex

  17. Protein (Cyanobacteria): 274905 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available ASVISLTPLPVVDLLATAAVNAQMVVEIGKIYGCELNMERGRELALSLGKTLASLGIVKGAIQILSTTLRLNLATYVVGKAIQGVTAAYLIRIAGKSFIEYFRNDQDWGDGGMSEVVQKQFQLNQRDEFIKAFVSEAIAKVVQPLTGKSEAQSPIDERDEIKDKGRKS ... ...LYTEQDSERVLARLRQRVRGFIPASDVVAIAANPQPVTLENGQLCQPEPEILPLIRRLAAVLRAEGEELIADNILLQSQRLGQEARHILDKQRRREAEKVVERFQWIG...YTMGLFGKSRKRPGKGRLEPKAPEVKTEAAEETLKAVRQQVKQIQDEVSRQAMLRRSEEIEAILSRGELLVVVFGTGSAGKTSLVNALIGRMVGQVGAPMGTTEVGETYKLKLKGLERPILITDTPGIL...inding protein domain protein Moorea producens 3L MPLPRLLTLIIGLIIILGLMLWLINGLYQLYIQISFTAPLLANLLLLLVITLLGLLIWALI

  18. High quality protein microarray using in situ protein purification

    Directory of Open Access Journals (Sweden)

    Fleischmann Robert D

    2009-08-01

    Full Text Available Abstract Background In the postgenomic era, high throughput protein expression and protein microarray technologies have progressed markedly permitting screening of therapeutic reagents and discovery of novel protein functions. Hexa-histidine is one of the most commonly used fusion tags for protein expression due to its small size and convenient purification via immobilized metal ion affinity chromatography (IMAC. This purification process has been adapted to the protein microarray format, but the quality of in situ His-tagged protein purification on slides has not been systematically evaluated. We established methods to determine the level of purification of such proteins on metal chelate-modified slide surfaces. Optimized in situ purification of His-tagged recombinant proteins has the potential to become the new gold standard for cost-effective generation of high-quality and high-density protein microarrays. Results Two slide surfaces were examined, chelated Cu2+ slides suspended on a polyethylene glycol (PEG coating and chelated Ni2+ slides immobilized on a support without PEG coating. Using PEG-coated chelated Cu2+ slides, consistently higher purities of recombinant proteins were measured. An optimized wash buffer (PBST composed of 10 mM phosphate buffer, 2.7 mM KCl, 140 mM NaCl and 0.05% Tween 20, pH 7.4, further improved protein purity levels. Using Escherichia coli cell lysates expressing 90 recombinant Streptococcus pneumoniae proteins, 73 proteins were successfully immobilized, and 66 proteins were in situ purified with greater than 90% purity. We identified several antigens among the in situ-purified proteins via assays with anti-S. pneumoniae rabbit antibodies and a human patient antiserum, as a demonstration project of large scale microarray-based immunoproteomics profiling. The methodology is compatible with higher throughput formats of in vivo protein expression, eliminates the need for resin-based purification and circumvents

  19. Predicting multiplex subcellular localization of proteins using protein-protein interaction network: a comparative study

    OpenAIRE

    Jiang Jonathan Q; Wu Maoying

    2012-01-01

    Abstract Background Proteins that interact in vivo tend to reside within the same or "adjacent" subcellular compartments. This observation provides opportunities to reveal protein subcellular localization in the context of the protein-protein interaction (PPI) network. However, so far, only a few efforts based on heuristic rules have been made in this regard. Results We systematically and quantitatively validate the hypothesis that proteins physically interacting with each other probably shar...

  20. Photolytic Crosslinking to Probe Protein-Protein and Protein-Matrix Interactions In Lyophilized Powders

    OpenAIRE

    Iyer, Lavanya K.; Moorthy, Balakrishnan S.; Topp, Elizabeth M.

    2015-01-01

    Protein structure and local environment in lyophilized formulations were probed using high-resolution solid-state photolytic crosslinking with mass spectrometric analysis (ssPC-MS). In order to characterize structure and microenvironment, protein-protein, protein-excipient and protein-water interactions in lyophilized powders were identified. Myoglobin (Mb) was derivatized in solution with the heterobifunctional probe succinimidyl 4,4’-azipentanoate (SDA) and the structural integrity of the l...

  1. Dairy Proteins and Energy Balance

    DEFF Research Database (Denmark)

    Bendtsen, Line Quist

    High protein diets affect energy balance beneficially through decreased hunger, enhanced satiety and increased energy expenditure. Dairy products are a major source of protein. Dairy proteins are comprised of two classes, casein (80%) and whey proteins (20%), which are both of high quality, but...... casein is absorbed slowly and whey is absorbed rapidly. The present PhD study investigated the effects of total dairy proteins, whey, and casein, on energy balance and the mechanisms behind any differences in the effects of the specific proteins. The results do not support the hypothesis that dairy...... proteins, whey or casein are more beneficial than other protein sources in the regulation of energy balance, and suggest that dairy proteins, whey or casein seem to play only a minor role, if any, in the prevention and treatment of obesity....

  2. Coevolution study of mitochondria respiratory chain proteins:Toward the understanding of protein-protein interaction

    Institute of Scientific and Technical Information of China (English)

    Ming Yang; Yan Ge; Jiayan Wu; Jingfa Xiao; Jun Yu

    2011-01-01

    Coevolution can be seen as the interdependency between evolutionary histories. In the context of protein evolution, functional correlation proteins are ever-present coordinated evolutionary characters without disruption of organismal integrity. As to complex system, there are two forms of protein-protein interactions in vivo, which refer to inter-complex interaction and intra-complex interaction. In this paper, we studied the difference of coevolution characters between inter-complex interaction and intra-complex interaction using "Mirror tree" method on the respiratory chain (RC) proteins. We divided the correlation coefficients of every pairwise RC proteins into two groups corresponding to the binary protein-protein interaction in intra-complex and the binary protein-protein interaction in inter-complex, respectively. A dramatical discrepancy is detected between the coevolution characters of the two sets of protein interactions (Wilcoxon test, p-value = 4.4 x 10-6). Our finding reveals some critical information on coevolutionary study and assists the mechanical investigation of protein-protein interaction.Furthermore, the results also provide some unique clue for supramolecular organization of protein complexes in the mitochondrial inner membrane. More detailed binding sites map and genome information of nuclear encoded RC proteins will be extraordinary valuable for the further mitochondria dynamics study.

  3. Protein-protein interaction databases: keeping up with growing interactomes

    Directory of Open Access Journals (Sweden)

    Lehne Benjamin

    2009-04-01

    Full Text Available Abstract Over the past few years, the number of known protein-protein interactions has increased substantially. To make this information more readily available, a number of publicly available databases have set out to collect and store protein-protein interaction data. Protein-protein interactions have been retrieved from six major databases, integrated and the results compared. The six databases (the Biological General Repository for Interaction Datasets [BioGRID], the Molecular INTeraction database [MINT], the Biomolecular Interaction Network Database [BIND], the Database of Interacting Proteins [DIP], the IntAct molecular interaction database [IntAct] and the Human Protein Reference Database [HPRD] differ in scope and content; integration of all datasets is non-trivial owing to differences in data annotation. With respect to human protein-protein interaction data, HPRD seems to be the most comprehensive. To obtain a complete dataset, however, interactions from all six databases have to be combined. To overcome this limitation, meta-databases such as the Agile Protein Interaction Database (APID offer access to integrated protein-protein interaction datasets, although these also currently have certain restrictions.

  4. Direct Probing of Protein-Protein Interactions

    International Nuclear Information System (INIS)

    This project aimed to establish feasibility of using experimental techniques based on direct measurements of interaction forces on the single molecule scale to characterize equilibrium interaction potentials between individual biological molecules. Such capability will impact several research areas, ranging from rapid interaction screening capabilities to providing verifiable inputs for computational models. It should be one of the enabling technologies for modern proteomics research. This study used a combination of Monte-Carlo simulations, theoretical considerations, and direct experimental measurements to investigate two model systems that represented typical experimental situations: force-induced melting of DNA rigidly attached to the tip, and force-induced unbinding of a protein-antibody pair connected to flexible tethers. Our results establish that for both systems researchers can use force spectroscopy measurements to extract reliable information about equilibrium interaction potentials. However, the approaches necessary to extract these potentials in each case--Jarzynski reconstruction and Dynamic Force Spectroscopy--are very different. We also show how the thermodynamics and kinetics of unbinding process dictates the choice between in each case

  5. Direct Probing of Protein-Protein Interactions

    Energy Technology Data Exchange (ETDEWEB)

    Noy, A; Sulchek, T A; Friddle, R W

    2005-03-10

    This project aimed to establish feasibility of using experimental techniques based on direct measurements of interaction forces on the single molecule scale to characterize equilibrium interaction potentials between individual biological molecules. Such capability will impact several research areas, ranging from rapid interaction screening capabilities to providing verifiable inputs for computational models. It should be one of the enabling technologies for modern proteomics research. This study used a combination of Monte-Carlo simulations, theoretical considerations, and direct experimental measurements to investigate two model systems that represented typical experimental situations: force-induced melting of DNA rigidly attached to the tip, and force-induced unbinding of a protein-antibody pair connected to flexible tethers. Our results establish that for both systems researchers can use force spectroscopy measurements to extract reliable information about equilibrium interaction potentials. However, the approaches necessary to extract these potentials in each case--Jarzynski reconstruction and Dynamic Force Spectroscopy--are very different. We also show how the thermodynamics and kinetics of unbinding process dictates the choice between in each case.

  6. Hydrogels Constructed from Engineered Proteins.

    Science.gov (United States)

    Li, Hongbin; Kong, Na; Laver, Bryce; Liu, Junqiu

    2016-02-24

    Due to their various potential biomedical applications, hydrogels based on engineered proteins have attracted considerable interest. Benefitting from significant progress in recombinant DNA technology and protein engineering/design techniques, the field of protein hydrogels has made amazing progress. The latest progress of hydrogels constructed from engineered recombinant proteins are presented, mainly focused on biorecognition-driven physical hydrogels as well as chemically crosslinked hydrogels. The various bio-recognition based physical crosslinking strategies are discussed, as well as chemical crosslinking chemistries used to engineer protein hydrogels, and protein hydrogels' various biomedical applications. The future perspectives of this fast evolving field of biomaterials are also discussed. PMID:26707834

  7. Mapping the human protein interactome

    Institute of Scientific and Technical Information of China (English)

    Daniel Figeys

    2008-01-01

    Interactions are the essence of all biomolecules because they cannot fulfill their roles without interacting with other molecules. Hence, mapping the interactions of biomolecules can be useful for understanding their roles and functions. Furthermore, the development of molecular based systems biology requires an understanding of the biomolecular interactions. In recent years, the mapping of protein-protein interactions in different species has been reported, but few reports have focused on the large-scale mapping of protein-protein interactions in human. Here, we review the developments in protein interaction mapping and we discuss issues and strategies for the mapping of the human protein interactome.

  8. Affinity purification of proteins binding to GST fusion proteins.

    Science.gov (United States)

    Swaffield, J C; Johnston, S A

    2001-05-01

    This unit describes the use of proteins fused to glutathione-S-transferase (GST fusion proteins) to affinity purify other proteins, a technique also known as GST pulldown purification. The describes a strategy in which a GST fusion protein is bound to agarose affinity beads and the complex is then used to assay the binding of a specific test protein that has been labeled with [35S]methionine by in vitro translation. However, this method can be adapted for use with other types of fusion proteins; for example, His6, biotin tags, or maltose-binding protein fusions (MBP), and these may offer particular advantages. A describes preparation of an E. coli extract that is added to the reaction mixture with purified test protein to reduce nonspecific binding. PMID:18265191

  9. Functionalizing Microporous Membranes for Protein Purification and Protein Digestion

    Science.gov (United States)

    Dong, Jinlan; Bruening, Merlin L.

    2015-07-01

    This review examines advances in the functionalization of microporous membranes for protein purification and the development of protease-containing membranes for controlled protein digestion prior to mass spectrometry analysis. Recent studies confirm that membranes are superior to bead-based columns for rapid protein capture, presumably because convective mass transport in membrane pores rapidly brings proteins to binding sites. Modification of porous membranes with functional polymeric films or TiO2 nanoparticles yields materials that selectively capture species ranging from phosphopeptides to His-tagged proteins, and protein-binding capacities often exceed those of commercial beads. Thin membranes also provide a convenient framework for creating enzyme-containing reactors that afford control over residence times. With millisecond residence times, reactors with immobilized proteases limit protein digestion to increase sequence coverage in mass spectrometry analysis and facilitate elucidation of protein structures. This review emphasizes the advantages of membrane-based techniques and concludes with some challenges for their practical application.

  10. Protein-protein interactions in DNA mismatch repair.

    Science.gov (United States)

    Friedhoff, Peter; Li, Pingping; Gotthardt, Julia

    2016-02-01

    The principal DNA mismatch repair proteins MutS and MutL are versatile enzymes that couple DNA mismatch or damage recognition to other cellular processes. Besides interaction with their DNA substrates this involves transient interactions with other proteins which is triggered by the DNA mismatch or damage and controlled by conformational changes. Both MutS and MutL proteins have ATPase activity, which adds another level to control their activity and interactions with DNA substrates and other proteins. Here we focus on the protein-protein interactions, protein interaction sites and the different levels of structural knowledge about the protein complexes formed with MutS and MutL during the mismatch repair reaction. PMID:26725162

  11. How do oncoprotein mutations rewire protein-protein interaction networks?

    Science.gov (United States)

    Bowler, Emily H; Wang, Zhenghe; Ewing, Rob M

    2015-01-01

    The acquisition of mutations that activate oncogenes or inactivate tumor suppressors is a primary feature of most cancers. Mutations that directly alter protein sequence and structure drive the development of tumors through aberrant expression and modification of proteins, in many cases directly impacting components of signal transduction pathways and cellular architecture. Cancer-associated mutations may have direct or indirect effects on proteins and their interactions and while the effects of mutations on signaling pathways have been widely studied, how mutations alter underlying protein-protein interaction networks is much less well understood. Systematic mapping of oncoprotein protein interactions using proteomics techniques as well as computational network analyses is revealing how oncoprotein mutations perturb protein-protein interaction networks and drive the cancer phenotype. PMID:26325016

  12. Geometric De-noising of Protein-Protein Interaction Networks

    OpenAIRE

    Kuchaiev, Oleksii; Rasajski, Marija; Higham, Desmond J.; Przul, Natasa; Przytycka, Teresa Maria

    2009-01-01

    Understanding complex networks of protein-protein interactions (PPIs) is one of the foremost challenges of the post-genomic era. Due to the recent advances in experimental bio-technology, including yeast-2-hybrid (Y2H), tandem affinity purification (TAP) and other high-throughput methods for protein-protein interaction (PPI) detection, huge amounts of PPI network data are becoming available. Of major concern, however, are the levels of noise and incompleteness. For example, for Y2H screens, i...

  13. Cooperative long range protein-protein dynamics in Purple Membrane

    OpenAIRE

    Rheinstadter, Maikel; Schmalzl, Karin; Wood, Kathleen; Strauch, Dieter

    2008-01-01

    We present experimental evidence for a long-range protein-protein interaction in purple membrane (PM). The interprotein dynamics were quantified by measuring the spectrum of the acoustic phonons in the 2D bacteriorhodopsin (BR) protein lattice using inelastic neutron scattering. Phonon energies of about 1 meV were determined. The data are compared to an analytical model, and the effective spring constant for the interaction between neighboring protein trimers are determined to be k=53 N/m. Ad...

  14. Biophysics of protein evolution and evolutionary protein biophysics

    OpenAIRE

    Sikosek, Tobias; Chan, Hue Sun

    2014-01-01

    The study of molecular evolution at the level of protein-coding genes often entails comparing large datasets of sequences to infer their evolutionary relationships. Despite the importance of a protein's structure and conformational dynamics to its function and thus its fitness, common phylogenetic methods embody minimal biophysical knowledge of proteins. To underscore the biophysical constraints on natural selection, we survey effects of protein mutations, highlighting the physical basis for ...

  15. Statistical thermodynamics of membrane bending mediated protein-protein attraction

    OpenAIRE

    Chou, Tom; Kim, Ken S.; Oster, George

    1999-01-01

    Integral membrane proteins deform the surrounding bilayer creating long-ranged forces that influence distant proteins. These forces can be attractive or repulsive, depending on the proteins' shape, height, contact angle with the bilayer, as well as the local membrane curvature. Although interaction energies are not pairwise additive, for sufficiently low protein density, thermodynamic properties depend only upon pair interactions. Here, we compute pair interaction potentials and entropic cont...

  16. Conformational Analysis of Therapeutic Proteins by Hydroxyl Radical Protein Footprinting

    OpenAIRE

    Watson, Caroline; Sharp, Joshua S.

    2012-01-01

    Unlike small molecule drugs, therapeutic protein pharmaceuticals must not only have the correct amino acid sequence and modifications, but also the correct conformation to ensure safety and efficacy. Here, we describe a method for comparison of therapeutic protein conformations by hydroxyl radical protein footprinting using liquid chromatography-mass spectrometry (LC-MS) as an analytical platform. Hydroxyl radical protein footprinting allows for rapid analysis of the conformation of therapeut...

  17. Hub Promiscuity in Protein-Protein Interaction Networks

    OpenAIRE

    Haruki Nakamura; Kengo Kinoshita; Ashwini Patil

    2010-01-01

    Hubs are proteins with a large number of interactions in a protein-protein interaction network. They are the principal agents in the interaction network and affect its function and stability. Their specific recognition of many different protein partners is of great interest from the structural viewpoint. Over the last few years, the structural properties of hubs have been extensively studied. We review the currently known features that are particular to hubs, possibly affecting their binding ...

  18. Metabolism of minor isoforms of prion proteins Cytosolic prion protein and transmembrane prion protein*

    Institute of Scientific and Technical Information of China (English)

    Zhiqi Song; Deming Zhao; Lifeng Yang

    2013-01-01

    Transmissible spongiform encephalopathy or prion disease is triggered by the conversion from cellular prion protein to pathogenic prion protein. Growing evidence has concentrated on prion protein configuration changes and their correlation with prion disease transmissibility and pathoge-nicity. In vivo and in vitro studies have shown that several cytosolic forms of prion protein with spe-cific topological structure can destroy intracellular stability and contribute to prion protein pathoge-nicity. In this study, the latest molecular chaperone system associated with endoplasmic reticu-lum-associated protein degradation, the endoplasmic reticulum resident protein quality-control system and the ubiquitination proteasome system, is outlined. The molecular chaperone system directly correlates with the prion protein degradation pathway. Understanding the molecular me-chanisms wil help provide a fascinating avenue for further investigations on prion disease treatment and prion protein-induced neurodegenerative diseases.

  19. Protein Functionalized Nanodiamond Arrays

    Directory of Open Access Journals (Sweden)

    Liu YL

    2010-01-01

    Full Text Available Abstract Various nanoscale elements are currently being explored for bio-applications, such as in bio-images, bio-detection, and bio-sensors. Among them, nanodiamonds possess remarkable features such as low bio-cytotoxicity, good optical property in fluorescent and Raman spectra, and good photostability for bio-applications. In this work, we devise techniques to position functionalized nanodiamonds on self-assembled monolayer (SAMs arrays adsorbed on silicon and ITO substrates surface using electron beam lithography techniques. The nanodiamond arrays were functionalized with lysozyme to target a certain biomolecule or protein specifically. The optical properties of the nanodiamond-protein complex arrays were characterized by a high throughput confocal microscope. The synthesized nanodiamond-lysozyme complex arrays were found to still retain their functionality in interacting with E. coli.

  20. A magnetic protein biocompass

    Science.gov (United States)

    Qin, Siying; Yin, Hang; Yang, Celi; Dou, Yunfeng; Liu, Zhongmin; Zhang, Peng; Yu, He; Huang, Yulong; Feng, Jing; Hao, Junfeng; Hao, Jia; Deng, Lizong; Yan, Xiyun; Dong, Xiaoli; Zhao, Zhongxian; Jiang, Taijiao; Wang, Hong-Wei; Luo, Shu-Jin; Xie, Can

    2016-02-01

    The notion that animals can detect the Earth’s magnetic field was once ridiculed, but is now well established. Yet the biological nature of such magnetosensing phenomenon remains unknown. Here, we report a putative magnetic receptor (Drosophila CG8198, here named MagR) and a multimeric magnetosensing rod-like protein complex, identified by theoretical postulation and genome-wide screening, and validated with cellular, biochemical, structural and biophysical methods. The magnetosensing complex consists of the identified putative magnetoreceptor and known magnetoreception-related photoreceptor cryptochromes (Cry), has the attributes of both Cry- and iron-based systems, and exhibits spontaneous alignment in magnetic fields, including that of the Earth. Such a protein complex may form the basis of magnetoreception in animals, and may lead to applications across multiple fields.

  1. Markers of protein oxidation

    DEFF Research Database (Denmark)

    Headlam, Henrietta A; Davies, Michael Jonathan

    2004-01-01

    Exposure of proteins to radicals in the presence of O2 gives both side-chain oxidation and backbone fragmentation. These processes can be interrelated, with initial side-chain oxidation giving rise to backbone damage via transfer reactions. We have shown previously that alkoxyl radicals formed...... on the C-3 carbons of Ala, Val, Leu, and Asp residues undergo beta-scission to give backbone alpha-carbon radicals, with the release of the side- chain as a carbonyl compound. We now show that this is a general mechanism that occurs with a wide range of oxidants. The quantitative significance...... of this process depends on the extent of oxidation at C-3 compared with other sites. HO*, generated by gamma radiolysis, gave the highest total carbonyl yield, with protein-bound carbonyls predominating over released. In contrast, metal ion/H2O2 systems, gave more released than bound carbonyls, with this ratio...

  2. Yeast Interacting Proteins Database: YJL199C, YJL199C [Yeast Interacting Proteins Database

    Lifescience Database Archive (English)

    Full Text Available d in closely related Saccharomyces species; protein detected in large-scale protein-protein interaction studies...cies; protein detected in large-scale protein-protein interaction studies Rows with this prey as prey (4) Ro...n; not conserved in closely related Saccharomyces species; protein detected in large-scale protein-protein interaction studies... species; protein detected in large-scale protein-protein interaction studies Rows with this prey as prey Ro

  3. High throughput recombinant protein production of fungal secreted proteins

    DEFF Research Database (Denmark)

    Vala, Andrea Lages Lino; Roth, Doris; Grell, Morten Nedergaard;

    2011-01-01

    high-throughput protein production system with a special focus on fungal secreted proteins. We use a ligation independent cloning to clone target genes into expression vectors for E. coli and P. pastoris and a small scale test expression to identify constructs producing soluble protein. Expressed...

  4. Protein Crystal Isocitrate Lyase

    Science.gov (United States)

    1998-01-01

    The comparison of protein crystal, Isocitrate Lyase earth-grown (left) and space-grown (right). This is a target enzyme for fungicides. A better understanding of this enzyme should lead to the discovery of more potent fungicides to treat serious crop diseases such as rice blast; it regulates the flow of metabolic intermediates required for cell growth. Principal Investigator is Larry DeLucas.

  5. HRTEM in protein crystallography

    International Nuclear Information System (INIS)

    Electron microscopy/diffraction (ED/D) using spot-scan and low-dose imaging has been successfully applied to investigate microcrystals of an alpha-helical coiled-coil protein extracted from ootheca of the praying mantis. Fourier transforms of the images show resolution out to 4 Angstroems and can be used to phase the corresponding ED data which shows reflections out to 2 Aangstroems. 5 refs., 3 figs

  6. Proteins, electrochemical detection of

    Czech Academy of Sciences Publication Activity Database

    Bartošík, Martin; Doneux, T.; Pechan, Zdeněk; Ostatná, Veronika; Paleček, Emil

    Chichester : John Wiley & Sons Ltd, 2009 - (Meyers, R.), s. 1-37 ISBN 978-0-470-97333-2 R&D Projects: GA AV ČR(CZ) KAN400310651; GA MŠk(CZ) LC06035 Grant ostatní: GA ČR(CZ) GA301/07/0490 Institutional research plan: CEZ:AV0Z50040507; CEZ:AV0Z50040702 Keywords : protein electrochemistry * electrodes - carbon * gold Subject RIV: BO - Biophysics

  7. Tuber Storage Proteins

    OpenAIRE

    Shewry, Peter R.

    2003-01-01

    A wide range of plants are grown for their edible tubers, but five species together account for almost 90 % of the total world production. These are potato (Solanum tuberosum), cassava (Manihot esculenta), sweet potato (Ipomoea batatus), yams (Dioscorea spp.) and taro (Colocasia, Cyrtosperma and Xanthosoma spp.). All of these, except cassava, contain groups of storage proteins, but these differ in the biological properties and evolutionary relationships. Thus, patatin from potato exhibits act...

  8. Protein aggregation and bioprocessing

    OpenAIRE

    Cromwell, Mary E. M.; Hilario, Eric; Jacobson, Fred

    2006-01-01

    Protein aggregation is a common issue encountered during manufacture of biotherapeutics. It is possible to influence the amount of aggregate produced during the cell culture and purification process by carefully controlling the environment (eg, media components) and implementing appro-priate strategies to minimize the extent of aggregation. Steps to remove aggregates have been successfully used at a manufacturing scale. Care should be taken when developing a process to monitor the compatibili...

  9. PEGylation of therapeutic proteins

    OpenAIRE

    Jevsevar, Simona; Kunstelj, Menci; Gaberc Porekar, Vladka

    2010-01-01

    Abstract PEGylation has been widely used as a post-production modification methodology for improving biomedical efficacy and physicochemical properties of therapeutic proteins since the first PEGylated product was approved by Food and Drug Administration in 1990. Applicability and safety of this technology have been proven by use of various PEGylated pharmaceuticals for many years. It is expected that PEGylation as the most established technology for extension of drug residence in ...

  10. DELIVERY OF THERAPEUTIC PROTEINS

    OpenAIRE

    Pisal, Dipak S.; Kosloski, Matthew P.; Balu-Iyer, Sathy V.

    2010-01-01

    The safety and efficacy of protein therapeutics are limited by three interrelated pharmaceutical issues, in vitro and in vivo instability, immunogenicity and shorter half-lives. Novel drug modifications for overcoming these issues are under investigation and include covalent attachment of poly(ethylene glycol) (PEG), polysialic acid, or glycolic acid, as well as developing new formulations containing nanoparticulate or colloidal systems (e.g. liposomes, polymeric microspheres, polymeric nanop...

  11. Protein threading by learning

    Science.gov (United States)

    Chang, Iksoo; Cieplak, Marek; Dima, Ruxandra I.; Maritan, Amos; Banavar, Jayanth R.

    2001-01-01

    By using techniques borrowed from statistical physics and neural networks, we determine the parameters, associated with a scoring function, that are chosen optimally to ensure complete success in threading tests in a training set of proteins. These parameters provide a quantitative measure of the propensities of amino acids to be buried or exposed and to be in a given secondary structure and are a good starting point for solving both the threading and design problems. PMID:11717394

  12. Redox meets protein trafficking.

    Science.gov (United States)

    Bölter, Bettina; Soll, Jürgen; Schwenkert, Serena

    2015-09-01

    After the engulfment of two prokaryotic organisms, the thus emerged eukaryotic cell needed to establish means of communication and signaling to properly integrate the acquired organelles into its metabolism. Regulatory mechanisms had to evolve to ensure that chloroplasts and mitochondria smoothly function in accordance with all other cellular processes. One essential process is the post-translational import of nuclear encoded organellar proteins, which needs to be adapted according to the requirements of the plant. The demand for protein import is constantly changing depending on varying environmental conditions, as well as external and internal stimuli or different developmental stages. Apart from long-term regulatory mechanisms such as transcriptional/translation control, possibilities for short-term acclimation are mandatory. To this end, protein import is integrated into the cellular redox network, utilizing the recognition of signals from within the organelles and modifying the efficiency of the translocon complexes. Thereby, cellular requirements can be communicated throughout the whole organism. This article is part of a Special Issue entitled: Chloroplast Biogenesis. PMID:25626173

  13. Neutron protein crystallography

    Energy Technology Data Exchange (ETDEWEB)

    Niimura, Nobuo [Japan Atomic Energy Research Inst., Tokai, Ibaraki (Japan). Tokai Research Establishment

    1998-10-01

    X-ray diffraction of single crystal has enriched the knowledge of various biological molecules such as proteins, DNA, t-RNA, viruses, etc. It is difficult to make structural analysis of hydrogen atoms in a protein using X-ray crystallography, whereas neutron diffraction seems usable to directly determine the location of those hydrogen atoms. Here, neutron diffraction method was applied to structural analysis of hen egg-white lysozyme. Since the crystal size of a protein to analyze is generally small (5 mm{sup 3} at most), the neutron beam at the sample position in monochromator system was set to less than 5 x 5 mm{sup 2} and beam divergence to 0.4 degree or less. Neutron imaging plate with {sup 6}Li or Gd mixed with photostimulated luminescence material was used and about 2500 Bragg reflections were recorded in one crystal setting. A total of 38278 reflections for 2.0 A resolution were collected in less than 10 days. Thus, stereo views of Trp-111 omit map around the indol ring of Trp-111 was presented and the three-dimensional arrangement of 696H and 264D atoms in the lysozyme molecules was determined using the omit map. (M.N.)

  14. Protein Misfolding and Human Disease

    DEFF Research Database (Denmark)

    Gregersen, Niels; Bross, Peter Gerd; Vang, Søren; Christensen, Jane Hvarregaard

    2006-01-01

    Protein misfolding is a common event in living cells. In young and healthy cells, the misfolded protein load is disposed of by protein quality control (PQC) systems. In aging cells and in cells from certain individuals with genetic diseases, the load may overwhelm the PQC capacity, resulting in...... accumulation of misfolded proteins. Dependent on the properties of the protein and the efficiency of the PQC systems, the accumulated protein may be degraded or assembled into toxic oligomers and aggregates. To illustrate this concept, we discuss a number of very different protein misfolding diseases including...... phenylketonuria, Parkinson's disease, α-1-antitrypsin deficiency, familial neurohypophyseal diabetes insipidus, and short-chain acyl-CoA dehydrogenase deficiency. Despite the differences, an emerging paradigm suggests that the cellular effects of protein misfolding provide a common framework that may contribute...

  15. Protein: FBA4 [TP Atlas

    Lifescience Database Archive (English)

    Full Text Available FBA4 general transcription factor TFIIH ERCC3 XPB, XPBC ERCC3 TFIIH basal transcription factor c ... bunit Basic transcription factor 2 89 kDa subunit, DNA ... excision repair protein ERCC-3, DNA ... repair protein ...

  16. Protein: FBA4 [TP Atlas

    Lifescience Database Archive (English)

    Full Text Available FBA4 general transcription factor TFIIH ERCC2 XPD, XPDC ERCC2_gene TFIIH basal transcription fac ... Basic transcription factor 2 80 kDa subunit, CXPD, DNA ... excision repair protein ERCC-2, DNA ... repair protein ...

  17. Dipolar response of hydrated proteins

    CERN Document Server

    Matyushov, Dmitry V

    2011-01-01

    The paper presents an analytical theory and numerical simulations of the dipolar response of hydrated proteins. The effective dielectric constant of the solvated protein, representing the average dipole moment induced at the protein by a uniform external field, shows a remarkable variation among the proteins studied by numerical simulations. It changes from 0.5 for ubiquitin to 640 for cytochrome c. The former value implies a negative dipolar susceptibility of ubiquitin, that is a dia-electric dipolar response and negative dielectrophoresis. It means that a protein carrying an average dipole of ~240 D is expected to repel from the region of a stronger electric field. This outcome is the result of a negative cross-correlation between the protein and water dipoles, compensating for the positive variance of the protein dipole in the overall dipolar susceptibility. This phenomenon can be characterized as overscreening of protein's dipole by the hydration shell. In contrast to the neutral ubiquitin, charged protei...

  18. Leptospira Protein Expression During Infection

    Science.gov (United States)

    We are characterizing protein expression in vivo during experimental leptospirosis using immunofluorescence microscopy. Coding regions for several proteins were identified through analysis of Leptospira interrogans serovar Copenhageni and L. borgpetersenii serovar Hardjo genomes. In addition, codi...

  19. Stabilized polyacrylic saccharide protein conjugates

    Science.gov (United States)

    Callstrom, M.R.; Bednarski, M.D.; Gruber, P.R.

    1996-02-20

    This invention is directed to water soluble protein polymer conjugates which are stable in hostile environments. The conjugate comprises a protein which is linked to an acrylic polymer at multiple points through saccharide linker groups. 16 figs.

  20. Protein: FEA6 [TP Atlas

    Lifescience Database Archive (English)

    Full Text Available FEA6 Histone Deacetylases BRD2 KIAA9001, RING3 BRD2 Bromodomain-containing protein 2 O27.1.1, Re ... ally interesting new ... gene 3 protein 9606 Homo sapiens P25440 6046 3ONI, ...

  1. Protein: MPB2 [TP Atlas

    Lifescience Database Archive (English)

    Full Text Available MPB2 Transcription regulators NCOA3 AIB1, BHLHE42, RAC3, TRAM1 NCOA3 Nuclear receptor coactivato ... r 3 ACTR, Amplified in breast cancer ... 1 protein, CBP-interacting protein, Class E basic ...

  2. Lattice tube model of proteins

    OpenAIRE

    Banavar, Jayanth R.; Cieplak, Marek; Maritan, Amos

    2004-01-01

    We present a new lattice model for proteins that incorporates a tube-like anisotropy by introducing a preference for mutually parallel alignments in the conformations. The model is demonstrated to capture many aspects of real proteins.

  3. Lattice Tube Model of Proteins

    Science.gov (United States)

    Banavar, Jayanth R.; Cieplak, Marek; Maritan, Amos

    2004-11-01

    We present a new lattice model for proteins that incorporates a tubelike anisotropy by introducing a preference for mutually parallel alignments in the conformations. The model is demonstrated to capture many aspects of real proteins.

  4. Geometry and physics of proteins

    Science.gov (United States)

    Banavar, Jayanth R.; Cieplak, Marek; Hoang, Trinh X.; Maritan, Amos

    2005-03-01

    We recall some of the key lessons of protein research over the last several decades and show that they strongly suggest a new framework for understanding proteins. The unified framework is useful for understanding protein folding, amyloid formation and protein interactions and has important implications for natural selection. The experimental data and our new approach, supported by computer simulations, reveal an astonishing simplicity underlying the protein problem. REFERENCES: Banavar, J. R. and Maritan, A. (2003). Colloquium: Geometrical approach to protein folding: A tube picture. Rev. Mod. Phys. 75, 23. Banavar, J. R., Hoang, T. X., Maritan, A., Seno, F. and Trovato, A., (2004). A unified perspective on proteins -- a physics approach. Phys. Rev. E 70, 041905. Banavar, J. R., Cieplak, M. and Maritan, A., (2004). Lattice tube model of proteins, Phys. Rev. Lett. (in press).

  5. Protein: FBA5 [TP Atlas

    Lifescience Database Archive (English)

    Full Text Available FBA5 VSOP(voltage sensor -only protein1) HVCN1 VSOP, VSX1 Voltage-gated hydrogen channel 1 Hydrog ... en voltage-gated channel 1, Voltage sensor ... domain-only protein 7719 Ciona intestinalis 778897 ...

  6. Protein Linked to Atopic Dermatitis

    Science.gov (United States)

    ... Research Matters NIH Research Matters January 14, 2013 Protein Linked to Atopic Dermatitis Normal skin from a ... in mice suggests that lack of a certain protein may trigger atopic dermatitis, the most common type ...

  7. Protein: MPA1 [TP Atlas

    Lifescience Database Archive (English)

    Full Text Available MPA1 TLR signaling molecules Mavs Ips1, Visa Mitochondrial antiviral-signaling protein CARD adap ... ta, Interferon beta promoter stimulator protein 1, Virus -induced-signaling adapter 10090 Mus musculus 22860 ...

  8. Yeast Interacting Proteins Database: YNL086W, YKL061W [Yeast Interacting Proteins Database

    Lifescience Database Archive (English)

    Full Text Available YNL086W - Putative protein of unknown function; green ... fluorescent protein (GFP)-fusion protein l ... 2) YKL061W - Putative protein of unknown function; green ... fluorescent protein (GFP)-fusion protein localizes ... description Putative protein of unknown function; green ... fluorescent protein (GFP)-fusion protein localizes ...

  9. Yeast Interacting Proteins Database: YLR108C, YLR108C [Yeast Interacting Proteins Database

    Lifescience Database Archive (English)

    Full Text Available YLR108C - Protein of unknown function; green ... fluorescent protein (GFP)-fusion protein localizes ... as prey (1) YLR108C - Protein of unknown function; green ... fluorescent protein (GFP)-fusion protein localizes ... me - Bait description Protein of unknown function; green ... fluorescent protein (GFP)-fusion protein localizes ...

  10. Yeast Interacting Proteins Database: YJR056C, YJR056C [Yeast Interacting Proteins Database

    Lifescience Database Archive (English)

    Full Text Available YJR056C - Putative protein of unknown function; green ... fluorescent protein (GFP)-fusion protein l ... 2) YJR056C - Putative protein of unknown function; green ... fluorescent protein (GFP)-fusion protein localizes ... description Putative protein of unknown function; green ... fluorescent protein (GFP)-fusion protein localizes ...

  11. Protein kinase substrate identification on functional protein arrays

    Directory of Open Access Journals (Sweden)

    Zhou Fang

    2008-02-01

    Full Text Available Abstract Background Over the last decade, kinases have emerged as attractive therapeutic targets for a number of different diseases, and numerous high throughput screening efforts in the pharmaceutical community are directed towards discovery of compounds that regulate kinase function. The emerging utility of systems biology approaches has necessitated the development of multiplex tools suitable for proteomic-scale experiments to replace lower throughput technologies such as mass spectroscopy for the study of protein phosphorylation. Recently, a new approach for identifying substrates of protein kinases has applied the miniaturized format of functional protein arrays to characterize phosphorylation for thousands of candidate protein substrates in a single experiment. This method involves the addition of protein kinases in solution to arrays of immobilized proteins to identify substrates using highly sensitive radioactive detection and hit identification algorithms. Results To date, the factors required for optimal performance of protein array-based kinase substrate identification have not been described. In the current study, we have carried out a detailed characterization of the protein array-based method for kinase substrate identification, including an examination of the effects of time, buffer compositions, and protein concentration on the results. The protein array approach was compared to standard solution-based assays for assessing substrate phosphorylation, and a correlation of greater than 80% was observed. The results presented here demonstrate how novel substrates for protein kinases can be quickly identified from arrays containing thousands of human proteins to provide new clues to protein kinase function. In addition, a pooling-deconvolution strategy was developed and applied that enhances characterization of specific kinase-substrate relationships and decreases reagent consumption. Conclusion Functional protein microarrays are an

  12. From protein engineering to immobilization

    DEFF Research Database (Denmark)

    Singh, Raushan Kumar; Tiwari, Manish Kumar; Singh, Ranjitha; Lee, Jung-Kul

    2013-01-01

    in protein engineering have revolutionized the development of commercially available enzymes into better industrial catalysts. Protein engineering aims at modifying the sequence of a protein, and hence its structure, to create enzymes with improved functional properties such as stability, specific...... in improved enzyme stability. Protein engineering and immobilization techniques are sequential and compatible approaches for the improvement of enzyme properties. The present review highlights and summarizes various studies that have aimed to improve the biochemical properties of industrially...

  13. Spectral affinity in protein networks

    OpenAIRE

    Teng Shang-Hua; Voevodski Konstantin; Xia Yu

    2009-01-01

    Abstract Background Protein-protein interaction (PPI) networks enable us to better understand the functional organization of the proteome. We can learn a lot about a particular protein by querying its neighborhood in a PPI network to find proteins with similar function. A spectral approach that considers random walks between nodes of interest is particularly useful in evaluating closeness in PPI networks. Spectral measures of closeness are more robust to noise in the data and are more precise...

  14. Protein structure by mechanical triangulation

    OpenAIRE

    Dietz, Hendrik; Rief, Matthias

    2006-01-01

    Knowledge of protein structure is essential to understand protein function. High-resolution protein structure has so far been the domain of ensemble methods. Here, we develop a simple single-molecule technique to measure spatial position of selected residues within a folded and functional protein structure in solution. Construction and mechanical unfolding of cysteine-engineered polyproteins with controlled linkage topology allows measuring intramolecular distance with angstrom precision. We ...

  15. Similarity measures for protein ensembles

    DEFF Research Database (Denmark)

    Lindorff-Larsen, Kresten; Ferkinghoff-Borg, Jesper

    2009-01-01

    Analyses of similarities and changes in protein conformation can provide important information regarding protein function and evolution. Many scores, including the commonly used root mean square deviation, have therefore been developed to quantify the similarities of different protein conformations...... synthetic example from molecular dynamics simulations. We then apply the algorithms to revisit the problem of ensemble averaging during structure determination of proteins, and find that an ensemble refinement method is able to recover the correct distribution of conformations better than standard single...

  16. Green fluorescent protein: A perspective

    OpenAIRE

    Remington, S James

    2011-01-01

    A brief personal perspective is provided for green fluorescent protein (GFP), covering the period 1994–2011. The topics discussed are primarily those in which my research group has made a contribution and include structure and function of the GFP polypeptide, the mechanism of fluorescence emission, excited state protein transfer, the design of ratiometric fluorescent protein biosensors and an overview of the fluorescent proteins derived from coral reef animals. Structure-function relationship...

  17. Recent advances of protein microarrays

    OpenAIRE

    Hultschig, Claus; Kreutzberger, Jürgen; Seitz, Harald; Konthur, Zoltán; Büssow, Konrad; Lehrach, Hans

    2006-01-01

    Technological innovations and novel applications have greatly advanced the field of protein microarrays. Over the past two years, different types of protein microarrays have been used for serum profiling, protein abundance determinations, and identification of proteins that bind DNA or small compounds. However, considerable development is still required to ensure common quality standards and to establish large content repertoires. Here, we summarize applications available to date and discuss ...

  18. Putting Proteins back into Water

    OpenAIRE

    Rios, Paolo De Los; Caldarelli, Guido

    2000-01-01

    We introduce a simplified protein model where the solvent (water) degrees of freedom appear explicitly (although in an extremely simplified fashion). Using this model we are able to recover the thermodynamic phenomenology of proteins over a wide range of temperatures. In particular we describe both the warm and the {\\it cold} protein denaturation within a single framework, while addressing important issues about the structure of model proteins.

  19. Charge configurations in viral proteins.

    OpenAIRE

    Karlin, S; Brendel, V

    1988-01-01

    The spatial distribution of the charged residues of a protein is of interest with respect to potential electrostatic interactions. We have examined the proteins of a large number of representative eukaryotic and prokaryotic viruses for the occurrence of significant clusters, runs, and periodic patterns of charge. Clusters and runs of positive charge are prominent in many capsid and core proteins, whereas surface (glyco)proteins frequently contain a negative charge cluster. Significant charge ...

  20. Protein: FBB5 [TP Atlas

    Lifescience Database Archive (English)

    Full Text Available FBB5 RNA silencing RAN ARA24 Ran_(biology) GTP-binding nuclear ... protein Ran Androgen receptor-ass ... 24, GTPase Ran, Ras-like protein TC4, Ras-related nuclear ... protein 9606 Homo sapiens P62826 5901 1I2M, 3GJ4, ...