WorldWideScience

Sample records for agamous lineage genes

  1. Regulatory elements of the floral homeotic gene AGAMOUS identified by phylogenetic footprinting and shadowing.

    Energy Technology Data Exchange (ETDEWEB)

    Hong, R. L., Hamaguchi, L., Busch, M. A., and Weigel, D.

    2003-06-01

    OAK-B135 In Arabidopsis thaliana, cis-regulatory sequences of the floral homeotic gene AGAMOUS (AG) are located in the second intron. This 3 kb intron contains binding sites for two direct activators of AG, LEAFY (LFY) and WUSCHEL (WUS), along with other putative regulatory elements. We have used phylogenetic footprinting and the related technique of phylogenetic shadowing to identify putative cis-regulatory elements in this intron. Among 29 Brassicaceae, several other motifs, but not the LFY and WUS binding sites previously identified, are largely invariant. Using reporter gene analyses, we tested six of these motifs and found that they are all functionally important for activity of AG regulatory sequences in A. thaliana. Although there is little obvious sequence similarity outside the Brassicaceae, the intron from cucumber AG has at least partial activity in A. thaliana. Our studies underscore the value of the comparative approach as a tool that complements gene-by-gene promoter dissection, but also highlight that sequence-based studies alone are insufficient for a complete identification of cis-regulatory sites.

  2. Role for the banana AGAMOUS-like gene MaMADS7 in regulation of fruit ripening and quality.

    Science.gov (United States)

    Liu, Juhua; Liu, Lin; Li, Yujia; Jia, Caihong; Zhang, Jianbin; Miao, Hongxia; Hu, Wei; Wang, Zhuo; Xu, Biyu; Jin, Zhiqiang

    2015-11-01

    MADS-box transcription factors play important roles in organ development. In plants, most studies on MADS-box genes have mainly focused on flower development and only a few concerned fruit development and ripening. A new MADS-box gene named MaMADS7 was isolated from banana fruit by rapid amplification of cDNA ends (RACE) based on a MADS-box fragment obtained from a banana suppression subtractive hybridization (SSH) cDNA library. MaMADS7 is an AGAMOUS-like MADS-box gene that is preferentially expressed in the ovaries and fruits and in tobacco its protein product localizes to the nucleus. This study found that MaMADS7 expression can be induced by exogenous ethylene. Ectopic expression of MaMADS7 in tomato resulted in broad ripening phenotypes. The expression levels of seven ripening and quality-related genes, ACO1, ACS2, E4, E8, PG, CNR and PSY1 in MaMADS7 transgenic tomato fruits were greatly increased while the expression of the AG-like MADS-box gene TAGL1 was suppressed. Compared with the control, the contents of β-carotene, lycopene, ascorbic acid and organic acid in transformed tomato fruits were increased, while the contents of glucose and fructose were slightly decreased. MaMADS7 interacted with banana 1-aminocyclopropane-1-carboxylic acid (ACC) oxidase gene 1 (MaACO1) and tomato phytoene synthase gene (LePSY1) promoters. Our results indicated that MaMADS7 plays an important role in initiating endogenous ethylene biosynthesis and fruit ripening.

  3. Identification and Characterization of Mouse Otic Sensory Lineage Genes

    Directory of Open Access Journals (Sweden)

    Byron H. Hartman

    2015-03-01

    Full Text Available Vertebrate embryogenesis gives rise to all cell types of an organism through the development of many unique lineages derived from the three primordial germ layers. The otic sensory lineage arises from the otic vesicle, a structure formed through invagination of placodal non-neural ectoderm. This developmental lineage possesses unique differentiation potential, giving rise to otic sensory cell populations including hair cells, supporting cells, and ganglion neurons of the auditory and vestibular organs. Here we present a systematic approach to identify transcriptional features that distinguish the otic sensory lineage (from early otic progenitors to otic sensory populations from other major lineages of vertebrate development. We used a microarray approach to analyze otic sensory lineage populations including microdissected otic vesicles (embryonic day 10.5 as well as isolated neonatal cochlear hair cells and supporting cells at postnatal day 3. Non-otic tissue samples including periotic tissues and whole embryos with otic regions removed were used as reference populations to evaluate otic specificity. Otic populations shared transcriptome-wide correlations in expression profiles that distinguish members of this lineage from non-otic populations. We further analyzed the microarray data using comparative and dimension reduction methods to identify individual genes that are specifically expressed in the otic sensory lineage. This analysis identified and ranked top otic sensory lineage-specific transcripts including Fbxo2, Col9a2, and Oc90, and additional novel otic lineage markers. To validate these results we performed expression analysis on select genes using immunohistochemistry and in situ hybridization. Fbxo2 showed the most striking pattern of specificity to the otic sensory lineage, including robust expression in the early otic vesicle and sustained expression in prosensory progenitors and auditory and vestibular hair cells and supporting

  4. Identification of genes to differentiate closely related Salmonella lineages.

    Directory of Open Access Journals (Sweden)

    Qing-Hua Zou

    Full Text Available BACKGROUND: Salmonella are important human and animal pathogens. Though highly related, the Salmonella lineages may be strictly adapted to different hosts or cause different diseases, from mild local illness like gastroenteritis to fatal systemic infections like typhoid. Therefore, rapid and accurate identification of Salmonella is essential for timely and correct diagnosis of Salmonella infections. The current identification methods such as 16S rRNA sequencing and multilocus sequence typing are expensive and time consuming. Additionally, these methods often do not have sufficient distinguishing resolution among the Salmonella lineages. METHODOLOGIES/PRINCIPAL FINDINGS: We compared 27 completely sequenced Salmonella genomes to identify possible genomic features that could be used for differentiation of individual lineages. We concatenated 2372 core genes in each of the 27 genomes and constructed a neighbor-joining tree. On the tree, strains of each serotype were clustered tightly together and different serotypes were unambiguously separated with clear genetic distances, demonstrating systematic genomic divergence among the Salmonella lineages. We made detailed comparisons among the 27 genomes and identified distinct sets of genomic differences, including nucleotide variations and genomic islands (GIs, among the Salmonella lineages. Two core genes STM4261 and entF together could unambiguously distinguish all Salmonella lineages compared in this study. Additionally, strains of a lineage have a common set of GIs and closely related lineages have similar sets of GIs. CONCLUSIONS: Salmonella lineages have accumulated distinct sets of mutations and laterally acquired DNA (e.g., GIs in evolution. Two genes entF and STM4261 have diverged sufficiently among the Salmonella lineages to be used for their differentiation. Further investigation of the distinct sets of mutations and GIs will lead to novel insights into genomic evolution of Salmonella and

  5. Inferring gene family histories in yeast identifies lineage specific expansions.

    Directory of Open Access Journals (Sweden)

    Ryan M Ames

    Full Text Available The complement of genes found in the genome is a balance between gene gain and gene loss. Knowledge of the specific genes that are gained and lost over evolutionary time allows an understanding of the evolution of biological functions. Here we use new evolutionary models to infer gene family histories across complete yeast genomes; these models allow us to estimate the relative genome-wide rates of gene birth, death, innovation and extinction (loss of an entire family for the first time. We show that the rates of gene family evolution vary both between gene families and between species. We are also able to identify those families that have experienced rapid lineage specific expansion/contraction and show that these families are enriched for specific functions. Moreover, we find that families with specific functions are repeatedly expanded in multiple species, suggesting the presence of common adaptations and that these family expansions/contractions are not random. Additionally, we identify potential specialisations, unique to specific species, in the functions of lineage specific expanded families. These results suggest that an important mechanism in the evolution of genome content is the presence of lineage-specific gene family changes.

  6. Transcriptional Activity of the MADS Box ARLEQUIN/TOMATO AGAMOUS-LIKE1 Gene Is Required for Cuticle Development of Tomato Fruit.

    Science.gov (United States)

    Giménez, Estela; Dominguez, Eva; Pineda, Benito; Heredia, Antonio; Moreno, Vicente; Lozano, Rafael; Angosto, Trinidad

    2015-07-01

    Fruit development and ripening entail key biological and agronomic events, which ensure the appropriate formation and dispersal of seeds and determine productivity and yield quality traits. The MADS box gene Arlequin/tomato Agamous-like1 (hereafter referred to as TAGL1) was reported as a key regulator of tomato (Solanum lycopersicum) reproductive development, mainly involved in flower development, early fruit development, and ripening. It is shown here that silencing of the TAGL1 gene (RNA interference lines) promotes significant changes affecting cuticle development, mainly a reduction of thickness and stiffness, as well as a significant decrease in the content of cuticle components (cutin, waxes, polysaccharides, and phenolic compounds). Accordingly, overexpression of TAGL1 significantly increased the amount of cuticle and most of its components while rendering a mechanically weak cuticle. Expression of the genes involved in cuticle biosynthesis agreed with the biochemical and biomechanical features of cuticles isolated from transgenic fruits; it also indicated that TAGL1 participates in the transcriptional control of cuticle development mediating the biosynthesis of cuticle components. Furthermore, cell morphology and the arrangement of epidermal cell layers, on whose activity cuticle formation depends, were altered when TAGL1 was either silenced or constitutively expressed, indicating that this transcription factor regulates cuticle development, probably through the biosynthetic activity of epidermal cells. Our results also support cuticle development as an integrated event in the fruit expansion and ripening processes that characterize fleshy-fruited species such as tomato.

  7. Evolution of the MAGUK protein gene family in premetazoan lineages

    Directory of Open Access Journals (Sweden)

    Ruiz-Trillo Iñaki

    2010-04-01

    Full Text Available Abstract Background Cell-to-cell communication is a key process in multicellular organisms. In multicellular animals, scaffolding proteins belonging to the family of membrane-associated guanylate kinases (MAGUK are involved in the regulation and formation of cell junctions. These MAGUK proteins were believed to be exclusive to Metazoa. However, a MAGUK gene was recently identified in an EST survey of Capsaspora owczarzaki, an unicellular organism that branches off near the metazoan clade. To further investigate the evolutionary history of MAGUK, we have undertook a broader search for this gene family using available genomic sequences of different opisthokont taxa. Results Our survey and phylogenetic analyses show that MAGUK proteins are present not only in Metazoa, but also in the choanoflagellate Monosiga brevicollis and in the protist Capsaspora owczarzaki. However, MAGUKs are absent from fungi, amoebozoans or any other eukaryote. The repertoire of MAGUKs in Placozoa and eumetazoan taxa (Cnidaria + Bilateria is quite similar, except for one class that is missing in Trichoplax, while Porifera have a simpler MAGUK repertoire. However, Vertebrata have undergone several independent duplications and exhibit two exclusive MAGUK classes. Three different MAGUK types are found in both M. brevicollis and C. owczarzaki: DLG, MPP and MAGI. Furthermore, M. brevicollis has suffered a lineage-specific diversification. Conclusions The diversification of the MAGUK protein gene family occurred, most probably, prior to the divergence between Metazoa+choanoflagellates and the Capsaspora+Ministeria clade. A MAGI-like, a DLG-like, and a MPP-like ancestral genes were already present in the unicellular ancestor of Metazoa, and new gene members have been incorporated through metazoan evolution within two major periods, one before the sponge-eumetazoan split and another within the vertebrate lineage. Moreover, choanoflagellates have suffered an independent MAGUK

  8. Neuroblast lineage identification and lineage-specific Hox gene action during postembryonic development of the subesophageal ganglion in the Drosophila central brain.

    Science.gov (United States)

    Kuert, Philipp A; Hartenstein, Volker; Bello, Bruno C; Lovick, Jennifer K; Reichert, Heinrich

    2014-06-15

    The central brain of Drosophila consists of the supraesophageal ganglion (SPG) and the subesophageal ganglion (SEG), both of which are generated by neural stem cell-like neuroblasts during embryonic and postembryonic development. Considerable information has been obtained on postembryonic development of the neuroblasts and their lineages in the SPG. In contrast, very little is known about neuroblasts, neural lineages, or any other aspect of the postembryonic development in the SEG. Here we characterize the neuroanatomy of the larval SEG in terms of tracts, commissures, and other landmark features as compared to a thoracic ganglion. We then use clonal MARCM labeling to identify all adult-specific neuroblast lineages in the late larval SEG and find a surprisingly small number of neuroblast lineages, 13 paired and one unpaired. The Hox genes Dfd, Scr, and Antp are expressed in a lineage-specific manner in these lineages during postembryonic development. Hox gene loss-of-function causes lineage-specific defects in axonal targeting and reduction in neural cell numbers. Moreover, it results in the formation of novel ectopic neuroblast lineages. Apoptosis block also results in ectopic lineages suggesting that Hox genes are required for lineage-specific termination of proliferation through programmed cell death. Taken together, our findings show that postembryonic development in the SEG is mediated by a surprisingly small set of identified lineages and requires lineage-specific Hox gene action to ensure the correct formation of adult-specific neurons in the Drosophila brain. PMID:24713419

  9. Consistent and contrasting properties of lineage-specific genes in the apicomplexan parasites Plasmodium and Theileria

    Directory of Open Access Journals (Sweden)

    Kissinger Jessica C

    2008-04-01

    Full Text Available Abstract Background Lineage-specific genes, the genes that are restricted to a limited subset of related organisms, may be important in adaptation. In parasitic organisms, lineage-specific gene products are possible targets for vaccine development or therapeutics when these genes are absent from the host genome. Results In this study, we utilized comparative approaches based on a phylogenetic framework to characterize lineage-specific genes in the parasitic protozoan phylum Apicomplexa. Genes from species in two major apicomplexan genera, Plasmodium and Theileria, were categorized into six levels of lineage specificity based on a nine-species phylogeny. In both genera, lineage-specific genes tend to have a higher level of sequence divergence among sister species. In addition, species-specific genes possess a strong codon usage bias compared to other genes in the genome. We found that a large number of genus- or species-specific genes are putative surface antigens that may be involved in host-parasite interactions. Interestingly, the two parasite lineages exhibit several notable differences. In Plasmodium, the (G + C content at the third codon position increases with lineage specificity while Theileria shows the opposite trend. Surface antigens in Plasmodium are species-specific and mainly located in sub-telomeric regions. In contrast, surface antigens in Theileria are conserved at the genus level and distributed across the entire lengths of chromosomes. Conclusion Our results provide further support for the model that gene duplication followed by rapid divergence is a major mechanism for generating lineage-specific genes. The result that many lineage-specific genes are putative surface antigens supports the hypothesis that lineage-specific genes could be important in parasite adaptation. The contrasting properties between the lineage-specific genes in two major apicomplexan genera indicate that the mechanisms of generating lineage-specific genes

  10. Sequencing of Sylvilagus VDJ genes reveals a new VHa allelic lineage and shows that ancient VH lineages were retained differently in leporids.

    Science.gov (United States)

    Pinheiro, Ana; Melo-Ferreira, José; Abrantes, Joana; Martinelli, Nicola; Lavazza, Antonio; Alves, Paulo C; Gortázar, Christian; Esteves, Pedro J

    2014-12-01

    Antigen recognition by immunoglobulins depends upon initial rearrangements of heavy chain V, D, and J genes. In leporids, a unique system exists for the VH genes usage that exhibit highly divergent lineages: the VHa allotypes, the Lepus sL lineage and the VHn genes. For the European rabbit (Oryctolagus cuniculus), four VHa lineages have been described, the a1, a2, a3 and a4. For hares (Lepus sp.), one VHa lineage was described, the a2L, as well as a more ancient sL lineage. Both genera use the VHn genes in a low frequency of their VDJ rearrangements. To address the hypothesis that the VH specificities could be associated with different environments, we sequenced VDJ genes from a third leporid genus, Sylvilagus. We found a fifth and equally divergent VHa lineage, the a5, and an ancient lineage, the sS, related to the hares' sL, but failed to obtain VHn genes. These results show that the studied leporids employ different VH lineages in the generation of the antibody repertoire, suggesting that the leporid VH genes are subject to strong selective pressure likely imposed by specific pathogens.

  11. Isolation and characterization of the AGAMOUS homologous gene NTAG in Chinese narcissus (Narcissus tazetta var. Chinensis Roem)

    Institute of Scientific and Technical Information of China (English)

    Wang Zheng-ke; Gao Jian; Li Lu-bin; Peng Zhen-hua

    2006-01-01

    Amaryllidaceae, a monocot plant family, consists of many important ornamental bulb flower species. Chinese narcissus (Narcissus tazetta var. chinensis Roem), its flowers developed at high temperatures and bloomed at lower temperatures during the Chinese Spring Festival, is a traditional Chinese flower with high economic and ornamental value. To study its flower development,a full length cDNA containing MADS box domain from narcissus was isolated by a reverse transcription polymerase chain reaction (RT-PCR) with degenerate oligo-nucleotide primers derived from a conserved MADS- and K-box domain sequence. The 5' and the 3'regions of the gene were amplified using the PCR protocol for the rapid amplification of cDNA ends (RACE). The 690 bp open reading frame encodes 230 amino acid residues. A comparison of the deduced amino acid sequence of NTAG with the sequence of other MADS box proteins showed 91.3% amino acid identities with HAG (Hyacinthus orientalis). Sequence analysis and alignment showed significant similarity with other AG homologues. RNA blot analysis indicated that the narcissus NTAG gene was expressed only in reproductive organs, especially in stamens and carpels. These results indicated that the NTAG gene was an AG homologue and that the AG genes appeared to be structurally and functionally conserved between dicots and monocots.

  12. Exon: CBRC-AGAM-01-0035 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-AGAM-01-0035 ctccacagtcttctggaatcgattccggatagtaggtccggaatcagtttccggaatcgattccggaatcggctccggaatcggaatcg...actccggaattggttccggaatcgaaacagaatcggaactggctcccgaattgattccagaatcggctccggaattgaaatctgttccggaatcgtctccggaatcg...gatctataattgattccggaatcggctccggaatcgactccagaatcgactccggaatcggctccggaatcggaatcgattccagcgtcggaatcggctccggaattgattccgaacacggaatcggaatcgg ...

  13. Exon: CBRC-AGAM-07-0046 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-AGAM-07-0046 tcaacaccggaatcggctccggagccaactccggaatcggctccgaaatcggctccggaatcggttccggaatcggctccggaatcg...gctccggaatcgactccggaatcggctccggaatcgactccggaatcggctccggaatcggctccggaatcggaatcgattccagcatcggaatcggctccggAATTGATTCCCAACACGGAATCGGAATCGG ...

  14. LCGbase: A Comprehensive Database for Lineage-Based Co-regulated Genes.

    Science.gov (United States)

    Wang, Dapeng; Zhang, Yubin; Fan, Zhonghua; Liu, Guiming; Yu, Jun

    2012-01-01

    Animal genes of different lineages, such as vertebrates and arthropods, are well-organized and blended into dynamic chromosomal structures that represent a primary regulatory mechanism for body development and cellular differentiation. The majority of genes in a genome are actually clustered, which are evolutionarily stable to different extents and biologically meaningful when evaluated among genomes within and across lineages. Until now, many questions concerning gene organization, such as what is the minimal number of genes in a cluster and what is the driving force leading to gene co-regulation, remain to be addressed. Here, we provide a user-friendly database-LCGbase (a comprehensive database for lineage-based co-regulated genes)-hosting information on evolutionary dynamics of gene clustering and ordering within animal kingdoms in two different lineages: vertebrates and arthropods. The database is constructed on a web-based Linux-Apache-MySQL-PHP framework and effective interactive user-inquiry service. Compared to other gene annotation databases with similar purposes, our database has three comprehensible advantages. First, our database is inclusive, including all high-quality genome assemblies of vertebrates and representative arthropod species. Second, it is human-centric since we map all gene clusters from other genomes in an order of lineage-ranks (such as primates, mammals, warm-blooded, and reptiles) onto human genome and start the database from well-defined gene pairs (a minimal cluster where the two adjacent genes are oriented as co-directional, convergent, and divergent pairs) to large gene clusters. Furthermore, users can search for any adjacent genes and their detailed annotations. Third, the database provides flexible parameter definitions, such as the distance of transcription start sites between two adjacent genes, which is extendable to genes that flanking the cluster across species. We also provide useful tools for sequence alignment, gene

  15. Identification, characterization and expression analysis of lineage-specific genes within sweet orange (Citrus sinensis)

    OpenAIRE

    Xu, Yuantao; Wu, Guizhi; Hao, Baohai; Chen, Lingling; Deng, Xiuxin; Xu, Qiang

    2015-01-01

    Background With the availability of rapidly increasing number of genome and transcriptome sequences, lineage-specific genes (LSGs) can be identified and characterized. Like other conserved functional genes, LSGs play important roles in biological evolution and functions. Results Two set of citrus LSGs, 296 citrus-specific genes (CSGs) and 1039 orphan genes specific to sweet orange, were identified by comparative analysis between the sweet orange genome sequences and 41 genomes and 273 transcr...

  16. Evolution of the APETALA2 Gene Lineage in Seed Plants.

    Science.gov (United States)

    Zumajo-Cardona, Cecilia; Pabón-Mora, Natalia

    2016-07-01

    Gene duplication is a fundamental source of functional evolutionary change and has been associated with organismal diversification and the acquisition of novel features. The APETALA2/ETHYLENE RESPONSIVE ELEMENT-BINDING FACTOR (AP2/ERF) genes are exclusive to vascular plants and have been classified into the AP2-like and ERF-like clades. The AP2-like clade includes the AINTEGUMENTA (ANT) and the euAPETALA2 (euAP2) genes, both regulated by miR172 Arabidopsis has two paralogs in the euAP2 clade, namely APETALA2 (AP2) and TARGET OF EAT3 (TOE3) that control flowering time, meristem determinacy, sepal and petal identity and fruit development. euAP2 genes are likely functionally divergent outside Brassicaceae, as they control fruit development in tomato, and regulate inflorescence meristematic activity in maize. We studied the evolution and expression patterns of euAP2/TOE3 genes to assess large scale and local duplications and evaluate protein motifs likely related with functional changes across seed plants. We sampled euAP2/TOE3 genes from vascular plants and have found three major duplications and a few taxon-specific duplications. Here, we report conserved and new motifs across euAP2/TOE3 proteins and conclude that proteins predating the Brassicaceae duplication are more similar to AP2 than TOE3. Expression data show a shift from restricted expression in leaves, carpels, and fruits in non-core eudicots and asterids to a broader expression of euAP2 genes in leaves, all floral organs and fruits in rosids. Altogether, our data show a functional trend where the canonical A-function (sepal and petal identity) is exclusive to Brassicaceae and it is likely not maintained outside of rosids. PMID:27030733

  17. Evolutionary history of the reprimo tumor suppressor gene family in vertebrates with a description of a new reprimo gene lineage.

    Science.gov (United States)

    Wichmann, Ignacio A; Zavala, Kattina; Hoffmann, Federico G; Vandewege, Michael W; Corvalán, Alejandro H; Amigo, Julio D; Owen, Gareth I; Opazo, Juan C

    2016-10-10

    Genes related to human diseases should be natural targets for evolutionary studies, since they could provide clues regarding the genetic bases of pathologies and potential treatments. Here we studied the evolution of the reprimo gene family, a group of tumor-suppressor genes that are implicated in p53-mediated cell cycle arrest. These genes, especially the reprimo duplicate located on human chromosome 2, have been associated with epigenetic modifications correlated with transcriptional silencing and cancer progression. We demonstrate the presence of a third reprimo lineage that, together with the reprimo and reprimo-like genes, appears to have been differentially retained during the evolutionary history of vertebrates. We present evidence that these reprimo lineages originated early in vertebrate evolution and expanded as a result of the two rounds of whole genome duplications that occurred in the last common ancestor of vertebrates. The reprimo gene has been lost in birds, and the third reprimo gene lineage has been retained in only a few distantly related species, such as coelacanth and gar. Expression analyses revealed that the reprimo paralogs are mainly expressed in the nervous system. Different vertebrate lineages have retained different reprimo paralogs, and even in species that have retained multiple copies, only one of them is heavily expressed. PMID:27432065

  18. Lineage divergence and historical gene flow in the Chinese horseshoe bat (Rhinolophus sinicus.

    Directory of Open Access Journals (Sweden)

    Xiuguang Mao

    Full Text Available Closely related taxa living in sympatry provide good opportunities to investigate the origin of barriers to gene flow as well as the extent of reproductive isolation. The only two recognized subspecies of the Chinese rufous horseshoe bat Rhinolophus sinicus are characterized by unusual relative distributions in which R. s. septentrionalis is restricted to a small area within the much wider range of its sister taxon R. s. sinicus. To determine the history of lineage divergence and gene flow between these taxa, we applied phylogenetic, demographic and coalescent analyses to multi-locus datasets. MtDNA gene genealogies and microsatellite-based clustering together revealed three divergent lineages of sinicus, corresponding to Central China, East China and the offshore Hainan Island. However, the central lineage of sinicus showed a closer relationship with septentrionalis than with other lineages of R. s. sinicus, in contrary to morphological data. Paraphyly of sinicus could result from either past asymmetric mtDNA introgression between these two taxa, or could suggest septentrionalis evolved in situ from its more widespread sister subspecies. To test between these hypotheses, we applied coalescent-based phylogenetic reconstruction and Approximate Bayesian Computation (ABC. We found that septentrionalis is likely to be the ancestral taxon and therefore a recent origin of this subspecies can be ruled out. On the other hand, we found a clear signature of asymmetric mtDNA gene flow from septentrionalis into central populations of sinicus yet no nuclear gene flow, thus strongly pointing to historical mtDNA introgression. We suggest that the observed deeply divergent lineages within R. sinicus probably evolved in isolation in separate Pleistocene refugia, although their close phylogeographic correspondence with distinct eco-environmental zones suggests that divergent selection might also have promoted broad patterns of population genetic structure.

  19. Aberrant chromatin at genes encoding stem cell regulators in human mixed-lineage leukemia

    OpenAIRE

    Guenther, Matthew G.; Lawton, Lee N.; Rozovskaia, Tatiana; Frampton, Garrett M.; Levine, Stuart S.; Thomas L Volkert; Croce, Carlo M.; Nakamura, Tatsuya; Canaani, Eli; Young, Richard A.

    2008-01-01

    Mixed-lineage leukemia (MLL) fusion proteins are potent inducers of leukemia, but how these proteins generate aberrant gene expression programs is poorly understood. Here we show that the MLL-AF4 fusion protein occupies developmental regulatory genes important for hematopoietic stem cell identity and self-renewal in human leukemia cells. These MLL-AF4-bound regions have grossly altered chromatin structure, with histone modifications catalyzed by trithorax group proteins and DOT1 extending acr...

  20. Lineage Divergence and Historical Gene Flow in the Chinese Horseshoe Bat (Rhinolophus sinicus)

    OpenAIRE

    Xiuguang Mao; Guimei He; Junpeng Zhang; Rossiter, Stephen J.; Shuyi Zhang

    2013-01-01

    Closely related taxa living in sympatry provide good opportunities to investigate the origin of barriers to gene flow as well as the extent of reproductive isolation. The only two recognized subspecies of the Chinese rufous horseshoe bat Rhinolophus sinicus are characterized by unusual relative distributions in which R. s. septentrionalis is restricted to a small area within the much wider range of its sister taxon R. s. sinicus. To determine the history of lineage divergence and gene flow be...

  1. Genome-wide identification of lineage-specific genes within Caenorhabditis elegans.

    Science.gov (United States)

    Zhou, Kun; Huang, Beibei; Zou, Ming; Lu, Dandan; He, Shunping; Wang, Guoxiu

    2015-10-01

    With the rapid growth of sequencing technology, a number of genomes and transcriptomes of various species have been sequenced, contributing to the study of lineage-specific genes (LSGs). We identified two sets of LSGs using BLAST: one included Caenorhabditis elegans species-specific genes (1423, SSGs), and the other consisted of Caenorhabditis genus-specific genes (4539, GSGs). The subsequent characterization and analysis of the SSGs and GSGs showed that they have significant differences in evolution and that most LSGs were generated by gene duplication and integration of transposable elements (TEs). We then performed temporal expression profiling and protein function prediction and observed that many SSGs and GSGs are expressed and that genes involved with sex determination, specific stress, immune response, and morphogenesis are over-represented, suggesting that these specific genes may be related to the Caenorhabditis nematodes' special ability to survive in severe and extreme environments.

  2. De Novo Genes Arise at a Slow but Steady Rate along the Primate Lineage and Have Been Subject to Incomplete Lineage Sorting.

    Science.gov (United States)

    Guerzoni, Daniele; McLysaght, Aoife

    2016-01-01

    De novo protein-coding gene origination is increasingly recognized as an important evolutionary mechanism. However, there remains a large amount of uncertainty regarding the frequency of these events and the mechanisms and speed of gene establishment. Here, we describe a rigorous search for cases of de novo gene origination in the great apes. We analyzed annotated proteomes as well as full genomic DNA and transcriptional and translational evidence. It is notable that results vary between database updates due to the fluctuating annotation of these genes. Nonetheless we identified 35 de novo genes: 16 human-specific; 5 human and chimpanzee specific; and 14 that originated prior to the divergence of human, chimpanzee, and gorilla and are found in all three genomes. The taxonomically restricted distribution of these genes cannot be explained by loss in other lineages. Each gene is supported by an open reading frame-creating mutation that occurred within the primate lineage, and which is not polymorphic in any species. Similarly to previous studies we find that the de novo genes identified are short and frequently located near pre-existing genes. Also, they may be associated with Alu elements and prior transcription and RNA-splicing at the locus. Additionally, we report the first case of apparent independent lineage sorting of a de novo gene. The gene is present in human and gorilla, whereas chimpanzee has the ancestral noncoding sequence. This indicates a long period of polymorphism prior to fixation and thus supports a model where de novo genes may, at least initially, have a neutral effect on fitness. PMID:27056411

  3. In silico analysis of stomach lineage specific gene set expression pattern in gastric cancer

    Energy Technology Data Exchange (ETDEWEB)

    Pandi, Narayanan Sathiya, E-mail: sathiyapandi@gmail.com; Suganya, Sivagurunathan; Rajendran, Suriliyandi

    2013-10-04

    Highlights: •Identified stomach lineage specific gene set (SLSGS) was found to be under expressed in gastric tumors. •Elevated expression of SLSGS in gastric tumor is a molecular predictor of metabolic type gastric cancer. •In silico pathway scanning identified estrogen-α signaling is a putative regulator of SLSGS in gastric cancer. •Elevated expression of SLSGS in GC is associated with an overall increase in the survival of GC patients. -- Abstract: Stomach lineage specific gene products act as a protective barrier in the normal stomach and their expression maintains the normal physiological processes, cellular integrity and morphology of the gastric wall. However, the regulation of stomach lineage specific genes in gastric cancer (GC) is far less clear. In the present study, we sought to investigate the role and regulation of stomach lineage specific gene set (SLSGS) in GC. SLSGS was identified by comparing the mRNA expression profiles of normal stomach tissue with other organ tissue. The obtained SLSGS was found to be under expressed in gastric tumors. Functional annotation analysis revealed that the SLSGS was enriched for digestive function and gastric epithelial maintenance. Employing a single sample prediction method across GC mRNA expression profiles identified the under expression of SLSGS in proliferative type and invasive type gastric tumors compared to the metabolic type gastric tumors. Integrative pathway activation prediction analysis revealed a close association between estrogen-α signaling and SLSGS expression pattern in GC. Elevated expression of SLSGS in GC is associated with an overall increase in the survival of GC patients. In conclusion, our results highlight that estrogen mediated regulation of SLSGS in gastric tumor is a molecular predictor of metabolic type GC and prognostic factor in GC.

  4. Molecular phylogenetic lineage of Plagiopogon and Askenasia (Protozoa, Ciliophora) revealed by their gene sequences

    Science.gov (United States)

    Liu, An; Yi, Zhenzhen; Lin, Xiaofeng; Hu, Xiaozhong; Al-Farraj, Saleh A.; Al-Rasheid, Khaled A. S.

    2015-08-01

    Prostomates and haptorians are two basal groups of ciliates with limited morphological characteristics available for taxonomy. Morphologically, the structures used to identify prostomates and haptorians are similar or even identical, which generate heavy taxonomic and phylogenetic confusion. In present work, phylogenetic positions lineage of two rare genera, Plagiopogon and Askenasia, were investigated. Three genes including small subunit ribosomal RNA gene (hereafter SSU rDNA), internal transcribed spacer region (ITS region), and large subunit ribosomal RNA gene (LSU rDNA) were analyzed, 10 new sequences five species each. Our findings included 1) class Prostomatea and order Haptorida are multiphyletic; 2) it may not be appropriate to place order Cyclotrichiida in subclass Haptoria, and the systematic lineage of order Cyclotrichiida needs to be verified further; 3) genus Plagiopogon branches consistently within a clade covering most prostomes and is basal of clade Colepidae, implying its close lineage to Prostomatea; and 4) Askenasia is phylogenetically distant from the subclass Haptoria but close to classes Prostomatea, Plagiopylea and Oligohymenophorea. We supposed that the toxicyst of Askenasia may be close to taxa of prostomes instead of haptorians, and the dorsal brush is a more typical morphological characteristics of haptorians than toxicysts.

  5. Data in support of genome-wide identification of lineage-specific genes within Caenorhabditis elegans

    Directory of Open Access Journals (Sweden)

    Kun Zhou

    2015-09-01

    Full Text Available Two sets of LSGs were identified using BLAST: Caenorhabditis elegans species-specific genes (SSGs, 1423, and Caenorhabditis genus-specific genes (GSGs, 4539. The data contained in this article show SSGs and GSGs have significant differences in evolution and that most of them were formed by gene duplication and integration of transposable elements (TEs. Subsequent observation of temporal expression and protein function presents that many SSGs and GSGs are expressed and that genes involved with sex determination, specific stress, immune response, and morphogenesis are most represented. The data are related to research article “Genome-wide identification of lineage-specific genes within Caenorhabditis elegans” in Journal of Genomics [1].

  6. Widespread Discordance of Gene Trees with Species Tree inDrosophila: Evidence for Incomplete Lineage Sorting

    Energy Technology Data Exchange (ETDEWEB)

    Pollard, Daniel A.; Iyer, Venky N.; Moses, Alan M.; Eisen,Michael B.

    2006-08-28

    The phylogenetic relationship of the now fully sequencedspecies Drosophila erecta and D. yakuba with respect to the D.melanogaster species complex has been a subject of controversy. All threepossible groupings of the species have been reported in the past, thoughrecent multi-gene studies suggest that D. erecta and D. yakuba are sisterspecies. Using the whole genomes of each of these species as well as thefour other fully sequenced species in the subgenus Sophophora, we set outto investigate the placement of D. erecta and D. yakuba in the D.melanogaster species group and to understand the cause of the pastincongruence. Though we find that the phylogeny grouping D. erecta and D.yakuba together is the best supported, we also find widespreadincongruence in nucleotide and amino acid substitutions, insertions anddeletions, and gene trees. The time inferred to span the two keyspeciation events is short enough that under the coalescent model, theincongruence could be the result of incomplete lineage sorting.Consistent with the lineage-sorting hypothesis, substitutions supportingthe same tree were spatially clustered. Support for the different treeswas found to be linked to recombination such that adjacent genes supportthe same tree most often in regions of low recombination andsubstitutions supporting the same tree are most enriched roughly on thesame scale as linkage disequilibrium, also consistent with lineagesorting. The incongruence was found to be statistically significant androbust to model and species choice. No systematic biases were found. Weconclude that phylogenetic incongruence in the D. melanogaster speciescomplex is the result, at least in part, of incomplete lineage sorting.Incomplete lineage sorting will likely cause phylogenetic incongruence inmany comparative genomics datasets. Methods to infer the correct speciestree, the history of every base in the genome, and comparative methodsthat control for and/or utilize this information will be

  7. The probability of monophyly of a sample of gene lineages on a species tree.

    Science.gov (United States)

    Mehta, Rohan S; Bryant, David; Rosenberg, Noah A

    2016-07-19

    Monophyletic groups-groups that consist of all of the descendants of a most recent common ancestor-arise naturally as a consequence of descent processes that result in meaningful distinctions between organisms. Aspects of monophyly are therefore central to fields that examine and use genealogical descent. In particular, studies in conservation genetics, phylogeography, population genetics, species delimitation, and systematics can all make use of mathematical predictions under evolutionary models about features of monophyly. One important calculation, the probability that a set of gene lineages is monophyletic under a two-species neutral coalescent model, has been used in many studies. Here, we extend this calculation for a species tree model that contains arbitrarily many species. We study the effects of species tree topology and branch lengths on the monophyly probability. These analyses reveal new behavior, including the maintenance of nontrivial monophyly probabilities for gene lineage samples that span multiple species and even for lineages that do not derive from a monophyletic species group. We illustrate the mathematical results using an example application to data from maize and teosinte. PMID:27432988

  8. E2F4 modulates differentiation and gene expression in hematopoietic progenitor cells during commitment to the lymphoid lineage.

    Science.gov (United States)

    Enos, Megan E; Bancos, Simona A; Bushnell, Timothy; Crispe, Ian N

    2008-03-15

    The E2F4 protein is involved in gene repression and cell cycle exit, and also has poorly understood effects in differentiation. We analyzed the impact of E2F4 deficiency on early steps in mouse hematopoietic development, and found defects in early hematopoietic progenitor cells that were propagated through common lymphoid precursors to the B and T lineages. In contrast, the defects in erythromyeloid precursor cells were self-correcting over time. This suggests that E2F4 is important in early stages of commitment to the lymphoid lineage. The E2F4-deficient progenitor cells showed reduced expression of several key lymphoid-lineage genes, and overexpression of two erythromyeloid lineage genes. However, we did not detect effects on cell proliferation. These findings emphasize the significance of E2F4 in controlling gene expression and cell fate.

  9. Negative regulation of miRNA-9 on oligodendrocyte lineage gene 1 during hypoxic-ischemic brain damage

    Institute of Scientific and Technical Information of China (English)

    Lijun Yang; Hong Cui; Ting Cao

    2014-01-01

    Oligodendrocyte lineage gene 1 plays a key role in hypoxic-ischemic brain damage and myelin repair. miRNA-9 is involved in the occurrence of many related neurological disorders. Bioin-formatics analysis demonstrated that miRNA-9 complementarily, but incompletely, bound oligodendrocyte lineage gene 1, but whether miRNA-9 regulates oligodendrocyte lineage gene 1 remains poorly understood. Whole brain slices of 3-day-old Sprague-Dawley rats were cultured and divided into four groups:control group;oxygen-glucose deprivation group (treatment with 8% O2+ 92%N2 and sugar-free medium for 60 minutes);transfection control group (after oxygen and glucose deprivation for 60 minutes, transfected with control plasmid) and miRNA-9 transfection group (after oxygen and glucose deprivation for 60 minutes, transfected with miRNA-9 plasmid). From the third day of transfection, and with increasing culture days, oligodendrocyte lineage gene 1 expression increased in each group, peaked at 14 days, and then decreased at 21 days. Real-time quantitative PCR results, however, demonstrated that oligoden-drocyte lineage gene 1 expression was lower in the miRNA-9 transfection group than that in the transfection control group at 1, 3, 7, 14, 21 and 28 days after transfection. Results suggested that miRNA-9 possibly negatively regulated oligodendrocyte lineage gene 1 in brain tissues during hypoxic-ischemic brain damage.

  10. Reassortment compatibility between PB1, PB2, and HA genes of the two influenza B virus lineages in mammalian cells

    Science.gov (United States)

    Kim, Jin Il; Lee, Ilseob; Park, Sehee; Bae, Joon-Yong; Yoo, Kirim; Lemey, Philippe; Park, Mee Sook; Song, Jin-Won; Kee, Sun-Ho; Song, Ki-Joon; Park, Man-Seong

    2016-01-01

    In addition to influenza A subtypes, two distinct lineages of influenza B virus also cause seasonal epidemics to humans. Recently, Dudas et al. have done evolutionary analyses of reassortment patterns of the virus and suggested genetic lineage relationship between PB1, PB2, and HA genes. Using genetic plasmids and reassortant viruses, we here demonstrate that a homologous lineage PB1-PB2 pair exhibits better compatibility than a heterologous one and that the lineage relationship between PB1 and HA is more important for viral replication than that between PB2 and HA. However, co-adaptation of PB1-PB2-HA genes appears to be affected by complete gene constellation. PMID:27270757

  11. Neural crest and mesoderm lineage-dependent gene expression in orofacial development.

    Science.gov (United States)

    Bhattacherjee, Vasker; Mukhopadhyay, Partha; Singh, Saurabh; Johnson, Charles; Philipose, John T; Warner, Courtney P; Greene, Robert M; Pisano, M Michele

    2007-06-01

    The present study utilizes a combination of genetic labeling/selective isolation of pluripotent embryonic progenitor cells, and oligonucleotide-based microarray technology, to delineate and compare the "molecular fingerprint" of two mesenchymal cell populations from distinct lineages in the developing embryonic orofacial region. The first branchial arches-bi-lateral tissue primordia that flank the primitive oral cavity-are populated by pluripotent mesenchymal cells from two different lineages: neural crest (neuroectoderm)- and mesoderm-derived mesenchymal cells. These cells give rise to all of the connective tissue elements (bone, cartilage, smooth and skeletal muscle, dentin) of the orofacial region (maxillary and mandibular portion), as well as neurons and glia associated with the cranial ganglia, among other tissues. In the present study, neural crest- and mesoderm-derived mesenchymal cells were selectively isolated from the first branchial arch of gestational day 9.5 mouse embryos using laser capture microdissection (LCM). The two different embryonic cell lineages were distinguished through utilization of a novel two component transgenic mouse model (Wnt1Cre/ZEG) in which the neural crest cells and their derivatives are indelibly marked (i.e., expressing enhanced green fluorescent protein, EGFP) throughout the pre- and post-natal lifespan of the organism. EGFP-labeled neural crest-derived, and non-fluorescent mesoderm-derived mesenchymal cells from the first branchial arch were visualized in frozen tissue sections from gestational day 9.5 mouse embryos and independently isolated by LCM under epifluorescence optics. RNA was extracted from the two populations of LCM-procured cells, and amplified by double-stranded cDNA synthesis and in vitro transcription. Gene expression profiles of the two progenitor cell populations were generated via hybridization of the cell-type specific cRNA samples to oligo-based GeneChip microarrays. Comparison of gene expression

  12. A general scenario of Hox gene inventory variation among major sarcopterygian lineages

    Directory of Open Access Journals (Sweden)

    Wang Chaolin

    2011-01-01

    Full Text Available Abstract Background Hox genes are known to play a key role in shaping the body plan of metazoans. Evolutionary dynamics of these genes is therefore essential in explaining patterns of evolutionary diversity. Among extant sarcopterygians comprising both lobe-finned fishes and tetrapods, our knowledge of the Hox genes and clusters has largely been restricted in several model organisms such as frogs, birds and mammals. Some evolutionary gaps still exist, especially for those groups with derived body morphology or occupying key positions on the tree of life, hindering our understanding of how Hox gene inventory varied along the sarcopterygian lineage. Results We determined the Hox gene inventory for six sarcopterygian groups: lungfishes, caecilians, salamanders, snakes, turtles and crocodiles by comprehensive PCR survey and genome walking. Variable Hox genes in each of the six sarcopterygian group representatives, compared to the human Hox gene inventory, were further validated for their presence/absence by PCR survey in a number of related species representing a broad evolutionary coverage of the group. Turtles, crocodiles, birds and placental mammals possess the same 39 Hox genes. HoxD12 is absent in snakes, amphibians and probably lungfishes. HoxB13 is lost in frogs and caecilians. Lobe-finned fishes, amphibians and squamate reptiles possess HoxC3. HoxC1 is only present in caecilians and lobe-finned fishes. Similar to coelacanths, lungfishes also possess HoxA14, which is only found in lobe-finned fishes to date. Our Hox gene variation data favor the lungfish-tetrapod, turtle-archosaur and frog-salamander relationships and imply that the loss of HoxD12 is not directly related to digit reduction. Conclusions Our newly determined Hox inventory data provide a more complete scenario for evolutionary dynamics of Hox genes along the sarcopterygian lineage. Limbless, worm-like caecilians and snakes possess similar Hox gene inventories to animals with

  13. Lineage-specific evolution of the vertebrate Otopetrin gene family revealed by comparative genomic analyses

    Directory of Open Access Journals (Sweden)

    Ryan Joseph F

    2011-01-01

    Full Text Available Abstract Background Mutations in the Otopetrin 1 gene (Otop1 in mice and fish produce an unusual bilateral vestibular pathology that involves the absence of otoconia without hearing impairment. The encoded protein, Otop1, is the only functionally characterized member of the Otopetrin Domain Protein (ODP family; the extended sequence and structural preservation of ODP proteins in metazoans suggest a conserved functional role. Here, we use the tools of sequence- and cytogenetic-based comparative genomics to study the Otop1 and the Otop2-Otop3 genes and to establish their genomic context in 25 vertebrates. We extend our evolutionary study to include the gene mutated in Usher syndrome (USH subtype 1G (Ush1g, both because of the head-to-tail clustering of Ush1g with Otop2 and because Otop1 and Ush1g mutations result in inner ear phenotypes. Results We established that OTOP1 is the boundary gene of an inversion polymorphism on human chromosome 4p16 that originated in the common human-chimpanzee lineage more than 6 million years ago. Other lineage-specific evolutionary events included a three-fold expansion of the Otop genes in Xenopus tropicalis and of Ush1g in teleostei fish. The tight physical linkage between Otop2 and Ush1g is conserved in all vertebrates. To further understand the functional organization of the Ushg1-Otop2 locus, we deduced a putative map of binding sites for CCCTC-binding factor (CTCF, a mammalian insulator transcription factor, from genome-wide chromatin immunoprecipitation-sequencing (ChIP-seq data in mouse and human embryonic stem (ES cells combined with detection of CTCF-binding motifs. Conclusions The results presented here clarify the evolutionary history of the vertebrate Otop and Ush1g families, and establish a framework for studying the possible interaction(s of Ush1g and Otop in developmental pathways.

  14. The lineage-specific evolution of aquaporin gene clusters facilitated tetrapod terrestrial adaptation.

    Directory of Open Access Journals (Sweden)

    Roderick Nigel Finn

    Full Text Available A major physiological barrier for aquatic organisms adapting to terrestrial life is dessication in the aerial environment. This barrier was nevertheless overcome by the Devonian ancestors of extant Tetrapoda, but the origin of specific molecular mechanisms that solved this water problem remains largely unknown. Here we show that an ancient aquaporin gene cluster evolved specifically in the sarcopterygian lineage, and subsequently diverged into paralogous forms of AQP2, -5, or -6 to mediate water conservation in extant Tetrapoda. To determine the origin of these apomorphic genomic traits, we combined aquaporin sequencing from jawless and jawed vertebrates with broad taxon assembly of >2,000 transcripts amongst 131 deuterostome genomes and developed a model based upon Bayesian inference that traces their convergent roots to stem subfamilies in basal Metazoa and Prokaryota. This approach uncovered an unexpected diversity of aquaporins in every lineage investigated, and revealed that the vertebrate superfamily consists of 17 classes of aquaporins (Aqp0 - Aqp16. The oldest orthologs associated with water conservation in modern Tetrapoda are traced to a cluster of three aqp2-like genes in Actinistia that likely arose >500 Ma through duplication of an aqp0-like gene present in a jawless ancestor. In sea lamprey, we show that aqp0 first arose in a protocluster comprised of a novel aqp14 paralog and a fused aqp01 gene. To corroborate these findings, we conducted phylogenetic analyses of five syntenic nuclear receptor subfamilies, which, together with observations of extensive genome rearrangements, support the coincident loss of ancestral aqp2-like orthologs in Actinopterygii. We thus conclude that the divergence of sarcopterygian-specific aquaporin gene clusters was permissive for the evolution of water conservation mechanisms that facilitated tetrapod terrestrial adaptation.

  15. Metalaxyl Resistance in Phytophthora infestans: Assessing Role of RPA190 Gene and Diversity Within Clonal Lineages.

    Science.gov (United States)

    Matson, Michael E H; Small, Ian M; Fry, William E; Judelson, Howard S

    2015-12-01

    Prior work has shown that the inheritance of resistance to metalaxyl, an oomycete-specific fungicide, is complex and may involve multiple genes. Recent research indicated that a single nucleotide polymorphism (SNP) in the gene encoding RPA190, the largest subunit of RNA polymerase I, confers resistance to metalaxyl (or mefenoxam) in some isolates of the potato late blight pathogen Phytophthora infestans. Using both DNA sequencing and high resolution melt assays for distinguishing RPA190 alleles, we show here that the SNP is absent from certain resistant isolates of P. infestans from North America, Europe, and Mexico. The SNP is present in some members of the US-23 and US-24 clonal lineages, but these tend to be fairly sensitive to the fungicide based on artificial media and field test data. Diversity in the level of sensitivity, RPA190 genotype, and RPA190 copy number was observed in these lineages but were uncorrelated. Controlled laboratory crosses demonstrated that RPA190 did not cosegregate with metalaxyl resistance from a Mexican and British isolate. We conclude that while metalaxyl may be used to control many contemporary strains of P. infestans, an assay based on RPA190 will not be sufficient to diagnose the sensitivity levels of isolates.

  16. A Gene Regulatory Network Cooperatively Controlled by Pdx1 and Sox9 Governs Lineage Allocation of Foregut Progenitor Cells

    Directory of Open Access Journals (Sweden)

    Hung Ping Shih

    2015-10-01

    Full Text Available The generation of pancreas, liver, and intestine from a common pool of progenitors in the foregut endoderm requires the establishment of organ boundaries. How dorsal foregut progenitors activate pancreatic genes and evade the intestinal lineage choice remains unclear. Here, we identify Pdx1 and Sox9 as cooperative inducers of a gene regulatory network that distinguishes the pancreatic from the intestinal lineage. Genetic studies demonstrate dual and cooperative functions for Pdx1 and Sox9 in pancreatic lineage induction and repression of the intestinal lineage choice. Pdx1 and Sox9 bind to regulatory sequences near pancreatic and intestinal differentiation genes and jointly regulate their expression, revealing direct cooperative roles for Pdx1 and Sox9 in gene activation and repression. Our study identifies Pdx1 and Sox9 as important regulators of a transcription factor network that initiates pancreatic fate and sheds light on the gene regulatory circuitry that governs the development of distinct organs from multi-lineage-competent foregut progenitors.

  17. The polyphenol oxidase gene family in land plants: Lineage-specific duplication and expansion

    Directory of Open Access Journals (Sweden)

    Tran Lan T

    2012-08-01

    Full Text Available Abstract Background Plant polyphenol oxidases (PPOs are enzymes that typically use molecular oxygen to oxidize ortho-diphenols to ortho-quinones. These commonly cause browning reactions following tissue damage, and may be important in plant defense. Some PPOs function as hydroxylases or in cross-linking reactions, but in most plants their physiological roles are not known. To better understand the importance of PPOs in the plant kingdom, we surveyed PPO gene families in 25 sequenced genomes from chlorophytes, bryophytes, lycophytes, and flowering plants. The PPO genes were then analyzed in silico for gene structure, phylogenetic relationships, and targeting signals. Results Many previously uncharacterized PPO genes were uncovered. The moss, Physcomitrella patens, contained 13 PPO genes and Selaginella moellendorffii (spike moss and Glycine max (soybean each had 11 genes. Populus trichocarpa (poplar contained a highly diversified gene family with 11 PPO genes, but several flowering plants had only a single PPO gene. By contrast, no PPO-like sequences were identified in several chlorophyte (green algae genomes or Arabidopsis (A. lyrata and A. thaliana. We found that many PPOs contained one or two introns often near the 3’ terminus. Furthermore, N-terminal amino acid sequence analysis using ChloroP and TargetP 1.1 predicted that several putative PPOs are synthesized via the secretory pathway, a unique finding as most PPOs are predicted to be chloroplast proteins. Phylogenetic reconstruction of these sequences revealed that large PPO gene repertoires in some species are mostly a consequence of independent bursts of gene duplication, while the lineage leading to Arabidopsis must have lost all PPO genes. Conclusion Our survey identified PPOs in gene families of varying sizes in all land plants except in the genus Arabidopsis. While we found variation in intron numbers and positions, overall PPO gene structure is congruent with the phylogenetic

  18. Recombination in pe/ppe genes contributes to genetic variation in Mycobacterium tuberculosis lineages

    KAUST Repository

    Phelan, Jody E.

    2016-02-29

    Background Approximately 10 % of the Mycobacterium tuberculosis genome is made up of two families of genes that are poorly characterized due to their high GC content and highly repetitive nature. The PE and PPE families are typified by their highly conserved N-terminal domains that incorporate proline-glutamate (PE) and proline-proline-glutamate (PPE) signature motifs. They are hypothesised to be important virulence factors involved with host-pathogen interactions, but their high genetic variability and complexity of analysis means they are typically disregarded in genome studies. Results To elucidate the structure of these genes, 518 genomes from a diverse international collection of clinical isolates were de novo assembled. A further 21 reference M. tuberculosis complex genomes and long read sequence data were used to validate the approach. SNP analysis revealed that variation in the majority of the 168 pe/ppe genes studied was consistent with lineage. Several recombination hotspots were identified, notably pe_pgrs3 and pe_pgrs17. Evidence of positive selection was revealed in 65 pe/ppe genes, including epitopes potentially binding to major histocompatibility complex molecules. Conclusions This, the first comprehensive study of the pe and ppe genes, provides important insight into M. tuberculosis diversity and has significant implications for vaccine development.

  19. An experimental test for lineage-specific position effects on alcohol dehydrogenase (Adh) genes in Drosophila

    Science.gov (United States)

    Siegal, Mark L.; Hartl, Daniel L.

    1998-01-01

    Independent transgene insertions differ in expression based on their location in the genome; these position effects are of interest because they reflect the influence of genome organization on gene regulation. Position effects also represent potentially insurmountable obstacles to the rigorous functional comparison of homologous genes from different species because (i) quantitative variation in expression of each gene across genomic positions (generalized position effects, or GPEs) may overwhelm differences between the genes of interest, or (ii) divergent genes may be differentially sensitive to position effects, reflecting unique interactions between each gene and its genomic milieu (lineage-specific position effects, or LSPEs). We have investigated both types of position-effect variation by applying our method of transgene coplacement, which allows comparisons of transgenes in the same position in the genome of Drosophila melanogaster. Here we report an experimental test for LSPE in Drosophila. The alcohol dehydrogenase (Adh) genes of D. melanogaster and Drosophila affinidisjuncta differ in both tissue distribution and amounts of ADH activity. Despite this striking regulatory divergence, we found a very high correlation in overall ADH activity between the genes of the two species when placed in the same genomic position as assayed in otherwise Adh-null adults and larvae. These results argue against the influence of LSPE for these sequences, although the effects of GPE are significant. Our new findings validate the coplacement approach and show that it greatly magnifies the power to detect differences in expression between transgenes. Transgene coplacement thus dramatically extends the range of functional and evolutionary questions that can be addressed by transgenic technology. PMID:9861000

  20. Expression of major photosynthetic and salt-resistance genes in invasive reed lineages grown under elevated CO2 and temperature

    Science.gov (United States)

    Eller, Franziska; Lambertini, Carla; Nielsen, Mette W; Radutoiu, Simona; Brix, Hans

    2014-01-01

    It is important to investigate the molecular causes of the variation in ecologically important traits to fully understand phenotypic responses to climate change. In the Mississippi River Delta, two distinct, sympatric invasive lineages of common reed (Phragmites australis) are known to differ in several ecophysiological characteristics and are expected to become more salt resistant due to increasing atmospheric CO2 and temperature. We investigated whether different patterns of gene expression can explain their ecophysiological differences and increased vigor under future climatic conditions. We compared the transcript abundance of photosynthetic genes of the Calvin cycle (Rubisco small subunit, RbcS; Phosphoglycerate kinase, PGK; Phosphoribulokinase, PRK), genes related with salt transport (Na+/H+ antiporter, PhaNHA) and oxidative stress response genes (Manganese Superoxide dismutase, MnSOD; Glutathione peroxidase, GPX), and the total aboveground biomass production between two genotypes representing the two lineages. The two genotypes (Delta-type, Mediterranean lineage, and EU-type, Eurasian lineage) were grown under an ambient and a future climate scenario with simultaneously elevated CO2 and temperature, and under two different soil salinities (0‰ or 20‰). We found neither differences in the aboveground biomass production nor the transcript abundances of the two genotypes, but soil salinity significantly affected all the investigated parameters, often interacting with the climatic conditions. At 20‰ salinity, most genes were higher expressed in the future than in the ambient climatic conditions. Higher transcription of the genes suggests higher abundance of the protein they code for, and consequently increased photosynthate production, improved stress responses, and salt exclusion. Therefore, the higher expression of these genes most likely contributed to the significantly ameliorated salinity impact on the aboveground biomass production of both P

  1. Chicken globin gene transcription is cell lineage specific during the time of the switch

    International Nuclear Information System (INIS)

    Posttranscriptional silencing of embryonic globin gene expression occurs during hemoglobin switching in chickens. Here the authors use Percoll density gradients to fractionate the red blood cells of 5-9 day embryos in order to determine the cellular source and the timing of this posttranscriptional process. By means of nuclear run-on transcription in vitro they show that it is within mature primitive cells that production of embryonic globin mRNA is terminated posttranscriptionally. In contrast, young definitive cells produce little (or no) embryonic globin mRNA because of regulation at the transcriptional level. Thus the lineage specificity of embryonic and adult globin gene expression is determined transcriptionally, and the posttranscriptional process described by Landes et al. is a property of the senescing primitive cells, not a mechanism operative in the hemoglobin switch. This conclusion is supported by [3H]leucine incorporation experiments on Percoll-fractionated cells which reveal no posttranscriptional silencing of the embryonic genes during the early stages of the switch. In the course of these studies they have noticed a strong transcriptional pause near the second exon of the globin genes which is induced by 5,6-dichloro-1-β-D-ribofuranosylbenzimidazole (DRB) and which resembles a natural pause near that position

  2. Allelic lineages of the ficolin genes (FCNs are passed from ancestral to descendant primates.

    Directory of Open Access Journals (Sweden)

    Tina Hummelshøj

    Full Text Available The ficolins recognize carbohydrates and acetylated compounds on microorganisms and dying host cells and are able to activate the lectin pathway of the complement system. In humans, three ficolin genes have been identified: FCN1, FCN2 and FCN3, which encode ficolin-1, ficolin-2 and ficolin-3, respectively. Rodents have only two ficolins designated ficolin-A and ficolin-B that are closely related to human ficolin-1, while the rodent FCN3 orthologue is a pseudogene. Ficolin-2 and ficolin-3 have so far only been observed in humans. Thus, we performed a systematic investigation of the FCN genes in non-human primates. The exons and intron-exon boundaries of the FCN1-3 genes were sequenced in the following primate species: chimpanzee, gorilla, orangutan, rhesus macaque, cynomolgus macaque, baboon and common marmoset. We found that the exon organisation of the FCN genes was very similar between all the non-human primates and the human FCN genes. Several variations in the FCN genes were found in more than one primate specie suggesting that they were carried from one species to another including humans. The amino acid diversity of the ficolins among human and non-human primate species was estimated by calculating the Shannon entropy revealing that all three proteins are generally highly conserved. Ficolin-1 and ficolin-2 showed the highest diversity, whereas ficolin-3 was more conserved. Ficolin-2 and ficolin-3 were present in non-human primate sera with the same characteristic oligomeric structures as seen in human serum. Taken together all the FCN genes show the same characteristics in lower and higher primates. The existence of trans-species polymorphisms suggests that different FCN allelic lineages may be passed from ancestral to descendant species.

  3. Detecting lineage-specific adaptive evolution of brain-expressed genes in human using rhesus macaque as outgroup

    DEFF Research Database (Denmark)

    Yu, Xiao-Jing; Zheng, Hong-Kun; Wang, Jun;

    2006-01-01

    Comparative genetic analysis between human and chimpanzee may detect genetic divergences responsible for human-specific characteristics. Previous studies have identified a series of genes that potentially underwent Darwinian positive selection during human evolution. However, without a closely...... related species as outgroup, it is difficult to identify human-lineage-specific changes, which is critical in delineating the biological uniqueness of humans. In this study, we conducted phylogeny-based analyses of 2633 human brain-expressed genes using rhesus macaque as the outgroup. We identified 47...... candidate genes showing strong evidence of positive selection in the human lineage. Genes with maximal expression in the brain showed a higher evolutionary rate in human than in chimpanzee. We observed that many immune-defense-related genes were under strong positive selection, and this trend was more...

  4. Amoebozoa possess lineage-specific globin gene repertoires gained by individual horizontal gene transfers.

    Science.gov (United States)

    Dröge, Jasmin; Buczek, Dorota; Suzuki, Yutaka; Makałowski, Wojciech

    2014-01-01

    The Amoebozoa represent a clade of unicellular amoeboid organisms that display a wide variety of lifestyles, including free-living and parasitic species. For example, the social amoeba Dictyostelium discoideum has the ability to aggregate into a multicellular fruiting body upon starvation, while the pathogenic amoeba Entamoeba histolytica is a parasite of humans. Globins are small heme proteins that are present in almost all extant organisms. Although several genomes of amoebozoan species have been sequenced, little is known about the phyletic distribution of globin genes within this phylum. Only two flavohemoglobins (FHbs) of D. discoideum have been reported and characterized previously while the genomes of Entamoeba species are apparently devoid of globin genes. We investigated eleven amoebozoan species for the presence of globin genes by genomic and phylogenetic in silico analyses. Additional FHb genes were identified in the genomes of four social amoebas and the true slime mold Physarum polycephalum. Moreover, a single-domain globin (SDFgb) of Hartmannella vermiformis, as well as two truncated hemoglobins (trHbs) of Acanthamoeba castellanii were identified. Phylogenetic evidence suggests that these globin genes were independently acquired via horizontal gene transfer from some ancestral bacteria. Furthermore, the phylogenetic tree of amoebozoan FHbs indicates that they do not share a common ancestry and that a transfer of FHbs from bacteria to amoeba occurred multiple times. PMID:25013378

  5. Lineage relationship of prostate cancer cell types based on gene expression

    Directory of Open Access Journals (Sweden)

    Ware Carol B

    2011-05-01

    Full Text Available Abstract Background Prostate tumor heterogeneity is a major factor in disease management. Heterogeneity could be due to multiple cancer cell types with distinct gene expression. Of clinical importance is the so-called cancer stem cell type. Cell type-specific transcriptomes are used to examine lineage relationship among cancer cell types and their expression similarity to normal cell types including stem/progenitor cells. Methods Transcriptomes were determined by Affymetrix DNA array analysis for the following cell types. Putative prostate progenitor cell populations were characterized and isolated by expression of the membrane transporter ABCG2. Stem cells were represented by embryonic stem and embryonal carcinoma cells. The cancer cell types were Gleason pattern 3 (glandular histomorphology and pattern 4 (aglandular sorted from primary tumors, cultured prostate cancer cell lines originally established from metastatic lesions, xenografts LuCaP 35 (adenocarcinoma phenotype and LuCaP 49 (neuroendocrine/small cell carcinoma grown in mice. No detectable gene expression differences were detected among serial passages of the LuCaP xenografts. Results Based on transcriptomes, the different cancer cell types could be clustered into a luminal-like grouping and a non-luminal-like (also not basal-like grouping. The non-luminal-like types showed expression more similar to that of stem/progenitor cells than the luminal-like types. However, none showed expression of stem cell genes known to maintain stemness. Conclusions Non-luminal-like types are all representatives of aggressive disease, and this could be attributed to the similarity in overall gene expression to stem and progenitor cell types.

  6. Diversification and gene flow in nascent lineages of island and mainland North American tree squirrels (Tamiasciurus).

    Science.gov (United States)

    Chavez, Andreas S; Maher, Sean P; Arbogast, Brian S; Kenagy, G J

    2014-04-01

    Pleistocene climate cycles and glaciations had profound impacts on taxon diversification in the Boreal Forest Biome. Using population genetic analyses with multilocus data, we examined diversification, isolation, and hybridization in two sibling species of tree squirrels (Tamiasciurus douglasii and Tamiasciurus hudsonicus) with special attention to the geographically and genetically enigmatic population of T. hudsonicus on Vancouver Island, Canada. The two species differentiated only about 500,000 years ago, in the Late Pleistocene. The island population is phylogenetically nested within T. hudsonicus according to our nuclear analysis but within T. douglasii according to mitochondrial DNA. This conflict is more likely due to historical hybridization than to incomplete lineage sorting, and it appears that bidirectional gene flow occurred between the island population and both species on the mainland. This interpretation of our genetic analyses is consistent with our bioclimatic modeling, which demonstrates that both species were able to occupy this region throughout the Late Pleistocene. The divergence of the island population 40,000 years ago suggests that tree squirrels persisted in a refugium on Vancouver Island at the last glacial maximum, 20,000 years ago. Our observations demonstrate how Pleistocene climate change and habitat shifts have created incipient divergence in the presence of gene flow. Sequence data have been archived in GenBank—accession numbers: KF882736–KF885216.

  7. Clustering of two genes putatively involved in cyanate detoxification evolved recently and independently in multiple fungal lineages.

    Science.gov (United States)

    Elmore, M Holly; McGary, Kriston L; Wisecaver, Jennifer H; Slot, Jason C; Geiser, David M; Sink, Stacy; O'Donnell, Kerry; Rokas, Antonis

    2015-03-01

    Fungi that have the enzymes cyanase and carbonic anhydrase show a limited capacity to detoxify cyanate, a fungicide employed by both plants and humans. Here, we describe a novel two-gene cluster that comprises duplicated cyanase and carbonic anhydrase copies, which we name the CCA gene cluster, trace its evolution across Ascomycetes, and examine the evolutionary dynamics of its spread among lineages of the Fusarium oxysporum species complex (hereafter referred to as the FOSC), a cosmopolitan clade of purportedly clonal vascular wilt plant pathogens. Phylogenetic analysis of fungal cyanase and carbonic anhydrase genes reveals that the CCA gene cluster arose independently at least twice and is now present in three lineages, namely Cochliobolus lunatus, Oidiodendron maius, and the FOSC. Genome-wide surveys within the FOSC indicate that the CCA gene cluster varies in copy number across isolates, is always located on accessory chromosomes, and is absent in FOSC's closest relatives. Phylogenetic reconstruction of the CCA gene cluster in 163 FOSC strains from a wide variety of hosts suggests a recent history of rampant transfers between isolates. We hypothesize that the independent formation of the CCA gene cluster in different fungal lineages and its spread across FOSC strains may be associated with resistance to plant-produced cyanates or to use of cyanate fungicides in agriculture.

  8. Topologically associated domains enriched for lineage-specific genes reveal expression-dependent nuclear topologies during myogenesis.

    Science.gov (United States)

    Neems, Daniel S; Garza-Gongora, Arturo G; Smith, Erica D; Kosak, Steven T

    2016-03-22

    The linear distribution of genes across chromosomes and the spatial localization of genes within the nucleus are related to their transcriptional regulation. The mechanistic consequences of linear gene order, and how it may relate to the functional output of genome organization, remain to be fully resolved, however. Here we tested the relationship between linear and 3D organization of gene regulation during myogenesis. Our analysis has identified a subset of topologically associated domains (TADs) that are significantly enriched for muscle-specific genes. These lineage-enriched TADs demonstrate an expression-dependent pattern of nuclear organization that influences the positioning of adjacent nonenriched TADs. Therefore, lineage-enriched TADs inform cell-specific genome organization during myogenesis. The reduction of allelic spatial distance of one of these domains, which contains Myogenin, correlates with reduced transcriptional variability, identifying a potential role for lineage-specific nuclear topology. Using a fusion-based strategy to decouple mitosis and myotube formation, we demonstrate that the cell-specific topology of syncytial nuclei is dependent on cell division. We propose that the effects of linear and spatial organization of gene loci on gene regulation are linked through TAD architecture, and that mitosis is critical for establishing nuclear topologies during cellular differentiation. PMID:26957603

  9. Candidate adaptive genes associated with lineage divergence: identifying SNPs via next-generation targeted resequencing in mule deer (Odocoileus hemionus).

    Science.gov (United States)

    Powell, John H; Amish, Stephen J; Haynes, Gwilym D; Luikart, Gordon; Latch, Emily K

    2016-09-01

    Mule deer (Odocoileus hemionus) are an excellent nonmodel species for empirically testing hypotheses in landscape and population genomics due to their large population sizes (low genetic drift), relatively continuous distribution, diversity of occupied habitats and phenotypic variation. Because few genomic resources are currently available for this species, we used exon data from a cattle (Bos taurus) reference genome to direct targeted resequencing of 5935 genes in mule deer. We sequenced approximately 3.75 Mbp at minimum 20X coverage in each of the seven mule deer, identifying 23 204 single nucleotide polymorphisms (SNPs) within, or adjacent to, 6886 exons in 3559 genes. We found 91 SNP loci (from 69 genes) with putatively fixed allele frequency differences between the two major lineages of mule deer (mule deer and black-tailed deer), and our estimate of mean genetic divergence (genome-wide FST  = 0.123) between these lineages was consistent with previous findings using microsatellite loci. We detected an over-representation of gamete generation and amino acid transport genes among the genes with SNPs exhibiting potentially fixed allele frequency differences between lineages. This targeted resequencing approach using exon capture techniques has identified a suite of loci that can be used in future research to investigate the genomic basis of adaptation and differentiation between black-tailed deer and mule deer. This study also highlights techniques (and an exon capture array) that will facilitate population genomic research in other cervids and nonmodel organisms. PMID:27438092

  10. Brown and polar bear Y chromosomes reveal extensive male-biased gene flow within brother lineages.

    Science.gov (United States)

    Bidon, Tobias; Janke, Axel; Fain, Steven R; Eiken, Hans Geir; Hagen, Snorre B; Saarma, Urmas; Hallström, Björn M; Lecomte, Nicolas; Hailer, Frank

    2014-06-01

    Brown and polar bears have become prominent examples in phylogeography, but previous phylogeographic studies relied largely on maternally inherited mitochondrial DNA (mtDNA) or were geographically restricted. The male-specific Y chromosome, a natural counterpart to mtDNA, has remained underexplored. Although this paternally inherited chromosome is indispensable for comprehensive analyses of phylogeographic patterns, technical difficulties and low variability have hampered its application in most mammals. We developed 13 novel Y-chromosomal sequence and microsatellite markers from the polar bear genome and screened these in a broad geographic sample of 130 brown and polar bears. We also analyzed a 390-kb-long Y-chromosomal scaffold using sequencing data from published male ursine genomes. Y chromosome evidence support the emerging understanding that brown and polar bears started to diverge no later than the Middle Pleistocene. Contrary to mtDNA patterns, we found 1) brown and polar bears to be reciprocally monophyletic sister (or rather brother) lineages, without signals of introgression, 2) male-biased gene flow across continents and on phylogeographic time scales, and 3) male dispersal that links the Alaskan ABC islands population to mainland brown bears. Due to female philopatry, mtDNA provides a highly structured estimate of population differentiation, while male-biased gene flow is a homogenizing force for nuclear genetic variation. Our findings highlight the importance of analyzing both maternally and paternally inherited loci for a comprehensive view of phylogeographic history, and that mtDNA-based phylogeographic studies of many mammals should be reevaluated. Recent advances in sequencing technology render the analysis of Y-chromosomal variation feasible, even in nonmodel organisms. PMID:24667925

  11. Combined lineage mapping and gene expression profiling of embryonic brain patterning using ultrashort pulse microscopy and image registration

    Science.gov (United States)

    Gibbs, Holly C.; Dodson, Colin R.; Bai, Yuqiang; Lekven, Arne C.; Yeh, Alvin T.

    2014-12-01

    During embryogenesis, presumptive brain compartments are patterned by dynamic networks of gene expression. The spatiotemporal dynamics of these networks, however, have not been characterized with sufficient resolution for us to understand the regulatory logic resulting in morphogenetic cellular behaviors that give the brain its shape. We have developed a new, integrated approach using ultrashort pulse microscopy [a high-resolution, two-photon fluorescence (2PF)-optical coherence microscopy (OCM) platform using 10-fs pulses] and image registration to study brain patterning and morphogenesis in zebrafish embryos. As a demonstration, we used time-lapse 2PF to capture midbrain-hindbrain boundary morphogenesis and a wnt1 lineage map from embryos during brain segmentation. We then performed in situ hybridization to deposit NBT/BCIP, where wnt1 remained actively expressed, and reimaged the embryos with combined 2PF-OCM. When we merged these datasets using morphological landmark registration, we found that the mechanism of boundary formation differs along the dorsoventral axis. Dorsally, boundary sharpening is dominated by changes in gene expression, while ventrally, sharpening may be accomplished by lineage sorting. We conclude that the integrated visualization of lineage reporter and gene expression domains simultaneously with brain morphology will be useful for understanding how changes in gene expression give rise to proper brain compartmentalization and structure.

  12. Expression of hypoxia-inducible factor 1 alpha and oligodendrocyte lineage gene-1 in cultured brain slices after oxygen-glucose deprivation

    Institute of Scientific and Technical Information of China (English)

    Hong Cui; Weijuan Han; Lijun Yang; Yanzhong Chang

    2013-01-01

    Oligodendrocyte lineage gene-1 expressed in oligodendrocytes may trigger the repair of neuronal myelin impairment, and play a crucial role in myelin repair. Hypoxia-inducible factor 1α, a transcription factor, is of great significance in premature infants with hypoxic-ischemic brain damage. There is little evidence of direct regulatory effects of hypoxia-inducible factor 1α on oligodendrocyte lineage gene-1. In this study, brain slices of Sprague-Dawley rats were cultured and subjected to oxygen-glucose deprivation. Then, slices were transfected with hypoxia-inducible factor 1α or oligodendrocyte lineage gene-1. The expression levels of hypoxia-inducible factor 1α and oligodendrocyte lineage gene-1 were significantly up-regulated in rat brains prior to transfection, as detected by immunohistochemical staining. Eight hours after transfection of slices with hypoxia-inducible factor 1α, oligodendrocyte lineage gene-1 expression was upregulated, and reached a peak 24 hours after transfection. Oligodendrocyte lineage gene-1 transfection induced no significant differences in hypoxia-inducible factor 1α levels in rat brain tissues with oxygen-glucose deprivation. These experimental findings indicate that hypoxia-inducible factor 1α can regulate oligodendrocyte lineage gene-1 expression in hypoxic brain tissue, thus repairing the neural impairment.

  13. Genetic clustering of Trypanosoma cruzi I lineage evidenced by intergenic miniexon gene sequencing

    OpenAIRE

    O' Connor, Olivia; Bosseno, Marie-France; Barnabé, Christian; Douzery, E. J. P.; Brenière, Simone Frédérique

    2007-01-01

    American trypanosomiasis or Chagas disease is endemic in Latin America and caused by the flagellate Trypanosoma cruzi, which exhibits broad genetic variation. In various areas, the transmission of Chagas disease is ensured by sylvatic vectors, mainly carrying the evolutionary lineage I of T cruzi. Despite its epidemiological importance, this lineage is poorly studied. Here, we investigated the genetic variability and the phylogenetic relationships within T cruzi I using sequences of the non-t...

  14. Demographic history of Canary Islands male gene-pool: replacement of native lineages by European

    Directory of Open Access Journals (Sweden)

    Amorim António

    2009-08-01

    Full Text Available Abstract Background The origin and prevalence of the prehispanic settlers of the Canary Islands has attracted great multidisciplinary interest. However, direct ancient DNA genetic studies on indigenous and historical 17th–18th century remains, using mitochondrial DNA as a female marker, have only recently been possible. In the present work, the analysis of Y-chromosome polymorphisms in the same samples, has shed light on the way the European colonization affected male and female Canary Island indigenous genetic pools, from the conquest to present-day times. Results Autochthonous (E-M81 and prominent (E-M78 and J-M267 Berber Y-chromosome lineages were detected in the indigenous remains, confirming a North West African origin for their ancestors which confirms previous mitochondrial DNA results. However, in contrast with their female lineages, which have survived in the present-day population since the conquest with only a moderate decline, the male indigenous lineages have dropped constantly being substituted by European lineages. Male and female sub-Saharan African genetic inputs were also detected in the Canary population, but their frequencies were higher during the 17th–18th centuries than today. Conclusion The European colonization of the Canary Islands introduced a strong sex-biased change in the indigenous population in such a way that indigenous female lineages survived in the extant population in a significantly higher proportion than their male counterparts.

  15. Fuzzy boundaries: color and gene flow patterns among parapatric lineages of the western shovel-nosed snake and taxonomic implication.

    Directory of Open Access Journals (Sweden)

    Dustin A Wood

    Full Text Available Accurate delineation of lineage diversity is increasingly important, as species distributions are becoming more reduced and threatened. During the last century, the subspecies category was often used to denote phenotypic variation within a species range and to provide a framework for understanding lineage differentiation, often considered incipient speciation. While this category has largely fallen into disuse, previously recognized subspecies often serve as important units for conservation policy and management when other information is lacking. In this study, we evaluated phenotypic subspecies hypotheses within shovel-nosed snakes on the basis of genetic data and considered how evolutionary processes such as gene flow influenced possible incongruence between phenotypic and genetic patterns. We used both traditional phylogenetic and Bayesian clustering analyses to infer range-wide genetic structure and spatially explicit analyses to detect possible boundary locations of lineage contact. Multilocus analyses supported three historically isolated groups with low to moderate levels of contemporary gene exchange. Genetic data did not support phenotypic subspecies as exclusive groups, and we detected patterns of discordance in areas where three subspecies are presumed to be in contact. Based on genetic and phenotypic evidence, we suggested that species-level diversity is underestimated in this group and we proposed that two species be recognized, Chionactis occipitalis and C. annulata. In addition, we recommend retention of two subspecific designations within C. annulata (C. a. annulata and C. a. klauberi that reflect regional shifts in both genetic and phenotypic variation within the species. Our results highlight the difficultly in validating taxonomic boundaries within lineages that are evolving under a time-dependent, continuous process.

  16. Fuzzy boundaries: color and gene flow patterns among parapatric lineages of the western shovel-nosed snake and taxonomic implication

    Science.gov (United States)

    Wood, Dustin A.; Fisher, Robert N.; Vandergast, Amy G.

    2014-01-01

    Accurate delineation of lineage diversity is increasingly important, as species distributions are becoming more reduced and threatened. During the last century, the subspecies category was often used to denote phenotypic variation within a species range and to provide a framework for understanding lineage differentiation, often considered incipient speciation. While this category has largely fallen into disuse, previously recognized subspecies often serve as important units for conservation policy and management when other information is lacking. In this study, we evaluated phenotypic subspecies hypotheses within shovel-nosed snakes on the basis of genetic data and considered how evolutionary processes such as gene flow influenced possible incongruence between phenotypic and genetic patterns. We used both traditional phylogenetic and Bayesian clustering analyses to infer range-wide genetic structure and spatially explicit analyses to detect possible boundary locations of lineage contact. Multilocus analyses supported three historically isolated groups with low to moderate levels of contemporary gene exchange. Genetic data did not support phenotypic subspecies as exclusive groups, and we detected patterns of discordance in areas where three subspecies are presumed to be in contact. Based on genetic and phenotypic evidence, we suggested that species-level diversity is underestimated in this group and we proposed that two species be recognized, Chionactis occipitalis and C. annulata. In addition, we recommend retention of two subspecific designations within C. annulata (C. a. annulata and C. a. klauberi) that reflect regional shifts in both genetic and phenotypic variation within the species. Our results highlight the difficultly in validating taxonomic boundaries within lineages that are evolving under a time-dependent, continuous process.

  17. Mixed lineage kinase 3 gene mutations in mismatch repair deficient gastrointestinal tumours.

    NARCIS (Netherlands)

    Velho, S.; Oliveira, C.; Paredes, J.; Sousa, S.; Leite, M.; Matos, P.; Milanezi, F.; Ribeiro, A.S.; Mendes, N.; Licastro, D.; Karhu, A.; Oliveira, M.J.; Ligtenberg, M.J.L.; Hamelin, R.; Carneiro, F.; Lindblom, A.; Peltomaki, P.; Castedo, S.; Schwartz Jr, S.; Jordan, P.; Aaltonen, L.A.; Hofstra, R.M.; Suriano, G.; Stupka, E.; Fialho, A.M.; Seruca, R.

    2010-01-01

    Mixed lineage kinase 3 (MLK3) is a serine/threonine kinase, regulating MAPkinase signalling, in which cancer-associated mutations have never been reported. In this study, 174 primary gastrointestinal cancers (48 hereditary and 126 sporadic forms) and 7 colorectal cancer cell lines were screened for

  18. Mixed lineage kinase 3 gene mutations in mismatch repair deficient gastrointestinal tumours

    NARCIS (Netherlands)

    Velho, Sergia; Oliveira, Carla; Paredes, Joana; Sousa, Sonia; Leite, Marina; Matos, Paulo; Milanezi, Fernanda; Ribeiro, Ana Sofia; Mendes, Nuno; Licastro, Danilo; Karhu, Auli; Oliveira, Maria Jose; Ligtenberg, Marjolijn; Hamelin, Richard; Carneiro, Fatima; Lindblom, Annika; Peltomaki, Paivi; Castedo, Sergio; Schwartz, Simo; Jordan, Peter; Aaltonen, Lauri A.; Hofstra, Robert M. W.; Suriano, Gianpaolo; Stupka, Elia; Fialho, Arsenio M.; Seruca, Raquel

    2010-01-01

    Mixed lineage kinase 3 (MLK3) is a serine/threonine kinase, regulating MAPkinase signalling, in which cancer-associated mutations have never been reported. In this study, 174 primary gastrointestinal cancers (48 hereditary and 126 sporadic forms) and 7 colorectal cancer cell lines were screened for

  19. Restricted Gene Flow among Lineages of Thrips tabaci Supports Genetic Divergence Among Cryptic Species Groups

    Science.gov (United States)

    Jacobson, Alana L.; Nault, Brian A.; Vargo, Edward L.; Kennedy, George G.

    2016-01-01

    Knowledge of the relative influence of population- versus species-level genetic variation is important to understand patterns of phenotypic variation and ecological relationships that exist among and within morphologically indistinguishable cryptic species and subspecies. In the case of cryptic species groups that are pests, such knowledge is also essential for devising effective population management strategies. The globally important crop pest Thrips tabaci is a taxonomically difficult group of putatively cryptic species. This study examines population genetic structure of T. tabaci and reproductive isolation among lineages of this species complex using microsatellite markers and mitochondrial COI sequences. Overall, genetic structure supports T. tabaci as a cryptic species complex, although limited interbreeding occurs between different clonal groups from the same lineage as well as between individuals from different lineages. These results also provide evidence that thelytoky and arrhenotoky are not fixed phenotypes among members of different T. tabaci lineages that have been generally associated with either reproductive mode. Possible biological and ecological factors contributing to these observations are discussed. PMID:27690317

  20. Evolution of the globin gene family in deuterostomes: Lineage-specific patterns of diversification and attrition

    OpenAIRE

    Hoffmann, Federico G.; Opazho, Juan C; Hoogewijs, David; Hankeln, Thomas; Ebner, Bettina; Vinogradov, Serge N; Bailly, Xavier; Storz, Jay F.

    2012-01-01

    In the Metazoa, globin proteins display an underlying unity in tertiary structure that belies an extraordinary diversity in primary structures, biochemical properties, and physiological functions. Phylogenetic reconstructions can reveal which of these functions represent novel, lineage-specific innovations, and which represent ancestral functions that are shared with homologous globin proteins in other eukaryotes and even prokaryotes. To date, our understanding of globin diversity in deuteros...

  1. Gene Expression Ratios Lead to Accurate and Translatable Predictors of DR5 Agonism across Multiple Tumor Lineages.

    Directory of Open Access Journals (Sweden)

    Anupama Reddy

    Full Text Available Death Receptor 5 (DR5 agonists demonstrate anti-tumor activity in preclinical models but have yet to demonstrate robust clinical responses. A key limitation may be the lack of patient selection strategies to identify those most likely to respond to treatment. To overcome this limitation, we screened a DR5 agonist Nanobody across >600 cell lines representing 21 tumor lineages and assessed molecular features associated with response. High expression of DR5 and Casp8 were significantly associated with sensitivity, but their expression thresholds were difficult to translate due to low dynamic ranges. To address the translational challenge of establishing thresholds of gene expression, we developed a classifier based on ratios of genes that predicted response across lineages. The ratio classifier outperformed the DR5+Casp8 classifier, as well as standard approaches for feature selection and classification using genes, instead of ratios. This classifier was independently validated using 11 primary patient-derived pancreatic xenograft models showing perfect predictions as well as a striking linearity between prediction probability and anti-tumor response. A network analysis of the genes in the ratio classifier captured important biological relationships mediating drug response, specifically identifying key positive and negative regulators of DR5 mediated apoptosis, including DR5, CASP8, BID, cFLIP, XIAP and PEA15. Importantly, the ratio classifier shows translatability across gene expression platforms (from Affymetrix microarrays to RNA-seq and across model systems (in vitro to in vivo. Our approach of using gene expression ratios presents a robust and novel method for constructing translatable biomarkers of compound response, which can also probe the underlying biology of treatment response.

  2. Divergent evolutionary and expression patterns between lineage specific new duplicate genes and their parental paralogs in Arabidopsis thaliana.

    Directory of Open Access Journals (Sweden)

    Jun Wang

    Full Text Available Gene duplication is an important mechanism for the origination of functional novelties in organisms. We performed a comparative genome analysis to systematically estimate recent lineage specific gene duplication events in Arabidopsis thaliana and further investigate whether and how these new duplicate genes (NDGs play a functional role in the evolution and adaption of A. thaliana. We accomplished this using syntenic relationship among four closely related species, A. thaliana, A. lyrata, Capsella rubella and Brassica rapa. We identified 100 NDGs, showing clear origination patterns, whose parental genes are located in syntenic regions and/or have clear orthologs in at least one of three outgroup species. All 100 NDGs were transcribed and under functional constraints, while 24% of the NDGs have differential expression patterns compared to their parental genes. We explored the underlying evolutionary forces of these paralogous pairs through conducting neutrality tests with sequence divergence and polymorphism data. Evolution of about 15% of NDGs appeared to be driven by natural selection. Moreover, we found that 3 NDGs not only altered their expression patterns when compared with parental genes, but also evolved under positive selection. We investigated the underlying mechanisms driving the differential expression of NDGs and their parents, and found a number of NDGs had different cis-elements and methylation patterns from their parental genes. Overall, we demonstrated that NDGs acquired divergent cis-elements and methylation patterns and may experience sub-functionalization or neo-functionalization influencing the evolution and adaption of A. thaliana.

  3. An LTR Retrotransposon-Derived Gene Displays Lineage-Specific Structural and Putative Species-Specific Functional Variations in Eutherians.

    Science.gov (United States)

    Irie, Masahito; Koga, Akihiko; Kaneko-Ishino, Tomoko; Ishino, Fumitoshi

    2016-01-01

    Amongst the 11 eutherian-specific genes acquired from a sushi-ichi retrotransposon is the CCHC type zinc-finger protein-encoding gene SIRH11/ZCCHC16. Its contribution to eutherian brain evolution is implied because of its involvement in cognitive function in mice, possibly via the noradrenergic system. Although, the possibility that Sirh11/Zcchc16 functions as a non-coding RNA still remains, dN/dS ratios in pairwise comparisons between its orthologs have provided supportive evidence that it acts as a protein. It became a pseudogene in armadillos (Cingulata) and sloths (Pilosa), the only two extant orders of xenarthra, which prompted us to examine the lineage-specific variations of SIRH11/ZCCHC16 in eutherians. We examined the predicted SIRH11/ZCCHC16 open reading frame (ORF) in 95 eutherian species based on the genomic DNA information in GenBank. A large variation in the SIRH11/ZCCHC16 ORF was detected in several lineages. These include a lack of a CCHC RNA-binding domain in its C-terminus, observed in gibbons (Hylobatidae: Primates) and megabats (Megachiroptera: Chiroptera). A lack of the N-terminal half, on the other hand, was observed in New World monkeys (Platyrrhini: Primates) and species belonging to New World and African Hystricognaths (Caviomorpha and Bathyergidae: Rodents) along with Cetacea and Ruminantia (Cetartiodactyla). Among the hominoids, interestingly, three out of four genera of gibbons have lost normal SIRH11/ZCCHC16 function by deletion or the lack of the CCHC RNA-binding domain. Our extensive dN/dS analysis suggests that such truncated SIRH11/ZCCHC16 ORFs are functionally diversified even within lineages. Combined, our results show that SIRH11/ZCCHC16 may contribute to the diversification of eutherians by lineage-specific structural changes after its domestication in the common eutherian ancestor, followed by putative species-specific functional changes that enhanced fitness and occurred as a consequence of complex natural selection events

  4. Major histocompatibility lineages and immune gene function in teleost fishes: the road not taken

    NARCIS (Netherlands)

    Stet, R.J.M.; Kruiswijk, C.P.; Dixon, B.

    2003-01-01

    It has become increasingly clear over the course of the past decade that the immune system genes of teleosts and tetrapods are plainly derived from common ancestral genes. The last 5 years, however, have also made it abundantly clear that in the teleost genome some of these genes are organized in a

  5. Reprogramming of human peripheral blood monocytes to erythroid lineage by blocking of the PU-1 gene expression.

    Science.gov (United States)

    Nouri, Masoumeh; Deezagi, Abdolkhalegh; Ebrahimi, Marzieh

    2016-03-01

    In hematopoietic system development, PU.1 and GATA-1 as lineage-specific transcription factors (TF) are expressed in common myeloid progenitors. The cross antagonism between them ascertains gene expression programs of monocytic and erythroid cells, respectively. This concept in transdifferentiation approaches has not been well considered yet, especially in intralineage conversion systems. To demonstrate whether PU.1 suppression induces monocyte lineage conversion into red blood cells, a combination of three PU.1-specific siRNAs was implemented to knock down PU.1 gene expression and generate the balance in favor of GATA-1 expression to induce erythroid differentiation. For this purpose, monocytes were isolated from human peripheral blood and transfected by PU.1 siRNAs. In transfected monocytes, the rate of PU.1 expression in mRNA level was significantly decreased until 0.38 ± 0.118 when compared to untreated monocytes at 72 h (p value ≤0.05) which resulted in significant overexpression of GATA1 of 16.1 ± 0.343-fold compared to the untreated group (p value ≤0.01). Subsequently, overexpression of hemoglobin (α 13.26 ± 1.34-fold; p value≤0.0001) and β-globin (37.55 ± 16.56-fold; p value≤0.0001) was observed when compared to control groups. The results of western immunoblotting confirm those findings too. While, reduced expression of monocyte, CD14 gene, was observed in qRT-PCR and flow cytometry results. Our results suggest that manipulating the ratio of the two TFs in bifurcation differentiation pathways via applying siRNA technology can possibly change the cells' fate as a safe way for therapeutics application.

  6. HoxBlinc RNA Recruits Set1/MLL Complexes to Activate Hox Gene Expression Patterns and Mesoderm Lineage Development

    Directory of Open Access Journals (Sweden)

    Changwang Deng

    2016-01-01

    Full Text Available Trithorax proteins and long-intergenic noncoding RNAs are critical regulators of embryonic stem cell pluripotency; however, how they cooperatively regulate germ layer mesoderm specification remains elusive. We report here that HoxBlinc RNA first specifies Flk1+ mesoderm and then promotes hematopoietic differentiation through regulation of hoxb pathways. HoxBlinc binds to the hoxb genes, recruits Setd1a/MLL1 complexes, and mediates long-range chromatin interactions to activate transcription of the hoxb genes. Depletion of HoxBlinc by shRNA-mediated knockdown or CRISPR-Cas9-mediated genetic deletion inhibits expression of hoxb genes and other factors regulating cardiac/hematopoietic differentiation. Reduced hoxb expression is accompanied by decreased recruitment of Set1/MLL1 and H3K4me3 modification, as well as by reduced chromatin loop formation. Re-expression of hoxb2–b4 genes in HoxBlinc-depleted embryoid bodies rescues Flk1+ precursors that undergo hematopoietic differentiation. Thus, HoxBlinc plays an important role in controlling hoxb transcription networks that mediate specification of mesoderm-derived Flk1+ precursors and differentiation of Flk1+ cells into hematopoietic lineages.

  7. Identification and functional characterization of the miRNA-gene regulatory network in chronic myeloid leukemia lineage negative cells

    Science.gov (United States)

    Agatheeswaran, S.; Pattnayak, N. C.; Chakraborty, S.

    2016-09-01

    Chronic myeloid leukemia (CML) is maintained by leukemic stem cells (LSCs) which are resistant to the existing TKI therapy. Hence a better understanding of the CML LSCs is necessary to eradicate these cells and achieve complete cure. Using the miRNA-gene interaction networks from the CML lin(-) cells we identified a set of up/down-regulated miRNAs and corresponding target genes. Association studies (Pearson correlation) from the miRNA and gene expression data showed that miR-1469 and miR-1972 have significantly higher number of target genes, 75 and 50 respectively. We observed that miR-1972 induces G2-M cell cycle arrest and miR-1469 moderately arrested G1 cell cycle when overexpressed in KCL22 cells. We have earlier shown that a combination of imatinib and JAK inhibitor I can significantly bring down the proliferation of CML lineage negative cells. Here we observed that imatinib and JAK inhibitor I combination restored the expression pattern of the down-regulated miRNAs in primary CML lin(-) cells. Thus effective manipulation of the deregulated miRNAs can restore the miRNA-mRNA networks that can efficiently inhibit CML stem and progenitor cells and alleviate the disease.

  8. High diversity of genetic lineages and virulence genes in nasal Staphylococcus aureus isolates from donkeys destined to food consumption in Tunisia with predominance of the ruminant associated CC133 lineage

    Directory of Open Access Journals (Sweden)

    Gharsa Haythem

    2012-10-01

    Full Text Available Abstract Background The objective of this study was to determine the genetic lineages and the incidence of antibiotic resistance and virulence determinants of nasal Staphylococcus aureus isolates of healthy donkeys destined to food consumption in Tunisia. Results Nasal swabs of 100 donkeys obtained in a large slaughterhouse in 2010 were inoculated in specific media for S. aureus and methicillin-resistant S. aureus (MRSA recovery. S. aureus was obtained in 50% of the samples, being all of isolates methicillin-susceptible (MSSA. Genetic lineages, toxin gene profile, and antibiotic resistance mechanisms were determined in recovered isolates. Twenty-five different spa-types were detected among the 50 MSSA with 9 novel spa-types. S. aureus isolates were ascribed to agr type I (37 isolates, III (7, II (4, and IV (2. Sixteen different sequence-types (STs were revealed by MLST, with seven new ones. STs belonging to clonal clomplex CC133 were majority. The gene tst was detected in 6 isolates and the gene etb in one isolate. Different combinations of enterotoxin, leukocidin and haemolysin genes were identified among S. aureus isolates. The egc-cluster-like and an incomplete egc-cluster-like were detected. Isolates resistant to penicillin, erythromycin, fusidic acid, streptomycin, ciprofloxacin, clindamycin, tetracycline, or chloramphenicol were found and the genes blaZ, erm(A, erm(C, tet(M, fusC were identified. Conclusions The nares of donkeys frequently harbor MSSA. They could be reservoirs of the ruminant-associated CC133 lineage and of toxin genes encoding TSST-1 and other virulence traits with potential implications in public health. CC133 seems to have a broader host distribution than expected.

  9. The Evaluation of Nerve Growth Factor Over Expression on Neural Lineage Specific Genes in Human Mesenchymal Stem Cells

    Directory of Open Access Journals (Sweden)

    Mortazavi Yousef

    2016-07-01

    Full Text Available Objective Treatment and repair of neurodegenerative diseases such as brain tumors, spinal cord injuries, and functional disorders, including Alzheimer’s disease, are challenging problems. A common treatment approach for such disorders involves the use of mesenchymal stem cells (MSCs as an alternative cell source to replace injured cells. However, use of these cells in hosts may potentially cause adverse outcomes such as tumorigenesis and uncontrolled differentiation. In attempt to generate mesenchymal derived neural cells, we have infected MSCs with recombinant lentiviruses that expressed nerve growth factor (NGF and assessed their neural lineage genes. Materials and Methods In this experimental study, we cloned the NGF gene sequence into a helper dependent lentiviral vector that contained the green fluorescent protein (GFP gene. The recombinant vector was amplified in DH5 bacterial cells. Recombinant viruses were generated in the human embryonic kidney 293 (HEK-293 packaging cell line with the helper vectors and analyzed under fluorescent microscopy. Bone marrow mesenchymal cells were infected by recombinant viruses for three days followed by assessment of neural differentiation. We evaluated expression of NGF through measurement of the NGF protein in culture medium by ELISA; neural specific genes were quantified by real-time polymerase chain reaction (PCR. Results We observed neural morphological changes after three days. Quantitative PCR showed that expressions of NESTIN, glial derived neurotrophic factor (GDNF, glial fibrillary acidic protein (GFAP and Microtubule-associated protein 2 (MAP2 genes increased following induction of NGF overexpression, whereas expressions of endogenous NGF and brain derived neural growth factor (BDNF genes reduced. Conclusion Ectopic expression of NGF can induce neurogenesis in MSCs. Direct injection of MSCs may cause tumorigenesis and an undesirable outcome. Therefore an alternative choice to overcome this

  10. In Silico Reconstruction of the Viral Evolutionary Lineage Yields a Potent Gene Therapy Vector

    OpenAIRE

    Eric Zinn; Simon Pacouret; Vadim Khaychuk; Heikki T. Turunen; Livia S. Carvalho; Eva Andres-Mateos; Samiksha Shah; Rajani Shelke; Anna C. Maurer; Eva Plovie; Ru Xiao; Luk H. Vandenberghe

    2015-01-01

    Adeno-associated virus (AAV) vectors have emerged as a gene-delivery platform with demonstrated safety and efficacy in a handful of clinical trials for monogenic disorders. However, limitations of the current generation vectors often prevent broader application of AAV gene therapy. Efforts to engineer AAV vectors have been hampered by a limited understanding of the structure-function relationship of the complex multimeric icosahedral architecture of the particle. To develop additional reagent...

  11. Role of RNA splicing in mediating lineage-specific expression of the von Willebrand factor gene in the endothelium.

    Science.gov (United States)

    Yuan, Lei; Janes, Lauren; Beeler, David; Spokes, Katherine C; Smith, Joshua; Li, Dan; Jaminet, Shou-Ching; Oettgen, Peter; Aird, William C

    2013-05-23

    We previously demonstrated that the first intron of the human von Willebrand factor (vWF) is required for gene expression in the endothelium of transgenic mice. Based on this finding, we hypothesized that RNA splicing plays a role in mediating vWF expression in the vasculature. To address this question, we used transient transfection assays in human endothelial cells and megakaryocytes with intron-containing and intronless human vWF promoter-luciferase constructs. Next, we generated knockin mice in which LacZ was targeted to the endogenous mouse vWF locus in the absence or presence of the native first intron or heterologous introns from the human β-globin, mouse Down syndrome critical region 1, or hagfish coagulation factor X genes. In both the in vitro assays and the knockin mice, the loss of the first intron of vWF resulted in a significant reduction of reporter gene expression in endothelial cells but not megakaryocytes. This effect was rescued to varying degrees by the introduction of a heterologous intron. Intron-mediated enhancement of expression was mediated at a posttranscriptional level. Together, these findings implicate a role for intronic splicing in mediating lineage-specific expression of vWF in the endothelium.

  12. Dissemination of cephalosporin resistance genes between Escherichia coli strains from farm animals and humans by specific plasmid lineages.

    Directory of Open Access Journals (Sweden)

    Mark de Been

    2014-12-01

    Full Text Available Third-generation cephalosporins are a class of β-lactam antibiotics that are often used for the treatment of human infections caused by Gram-negative bacteria, especially Escherichia coli. Worryingly, the incidence of human infections caused by third-generation cephalosporin-resistant E. coli is increasing worldwide. Recent studies have suggested that these E. coli strains, and their antibiotic resistance genes, can spread from food-producing animals, via the food-chain, to humans. However, these studies used traditional typing methods, which may not have provided sufficient resolution to reliably assess the relatedness of these strains. We therefore used whole-genome sequencing (WGS to study the relatedness of cephalosporin-resistant E. coli from humans, chicken meat, poultry and pigs. One strain collection included pairs of human and poultry-associated strains that had previously been considered to be identical based on Multi-Locus Sequence Typing, plasmid typing and antibiotic resistance gene sequencing. The second collection included isolates from farmers and their pigs. WGS analysis revealed considerable heterogeneity between human and poultry-associated isolates. The most closely related pairs of strains from both sources carried 1263 Single-Nucleotide Polymorphisms (SNPs per Mbp core genome. In contrast, epidemiologically linked strains from humans and pigs differed by only 1.8 SNPs per Mbp core genome. WGS-based plasmid reconstructions revealed three distinct plasmid lineages (IncI1- and IncK-type that carried cephalosporin resistance genes of the Extended-Spectrum Beta-Lactamase (ESBL- and AmpC-types. The plasmid backbones within each lineage were virtually identical and were shared by genetically unrelated human and animal isolates. Plasmid reconstructions from short-read sequencing data were validated by long-read DNA sequencing for two strains. Our findings failed to demonstrate evidence for recent clonal transmission of

  13. In Silico Reconstruction of the Viral Evolutionary Lineage Yields a Potent Gene Therapy Vector.

    Science.gov (United States)

    Zinn, Eric; Pacouret, Simon; Khaychuk, Vadim; Turunen, Heikki T; Carvalho, Livia S; Andres-Mateos, Eva; Shah, Samiksha; Shelke, Rajani; Maurer, Anna C; Plovie, Eva; Xiao, Ru; Vandenberghe, Luk H

    2015-08-11

    Adeno-associated virus (AAV) vectors have emerged as a gene-delivery platform with demonstrated safety and efficacy in a handful of clinical trials for monogenic disorders. However, limitations of the current generation vectors often prevent broader application of AAV gene therapy. Efforts to engineer AAV vectors have been hampered by a limited understanding of the structure-function relationship of the complex multimeric icosahedral architecture of the particle. To develop additional reagents pertinent to further our insight into AAVs, we inferred evolutionary intermediates of the viral capsid using ancestral sequence reconstruction. In-silico-derived sequences were synthesized de novo and characterized for biological properties relevant to clinical applications. This effort led to the generation of nine functional putative ancestral AAVs and the identification of Anc80, the predicted ancestor of the widely studied AAV serotypes 1, 2, 8, and 9, as a highly potent in vivo gene therapy vector for targeting liver, muscle, and retina. PMID:26235624

  14. Housekeeping gene stability influences the quantification of osteogenic markers during stem cell differentiation to the osteogenic lineage.

    Science.gov (United States)

    Quiroz, Felipe Garcia; Posada, Olga M; Gallego-Perez, Daniel; Higuita-Castro, Natalia; Sarassa, Carlos; Hansford, Derek J; Agudelo-Florez, Piedad; López, Luis E

    2010-04-01

    Real-time reverse transcription PCR (RT-qPCR) relies on a housekeeping or normalizer gene whose expression remains constant throughout the experiment. RT-qPCR is commonly used for characterization of human bone marrow mesenchymal stem cells (hBMSCs). However, to the best of our knowledge, there are no studies validating the expression stability of the genes used as normalizers during hBMSCs differentiation. This work aimed to study the stability of the housekeeping genes beta-actin, glyceraldehyde-3-phosphate dehydrogenase (GAPDH) and ribosomal protein L13A (RPL13A) during the osteogenic differentiation of hBMSCs. Their stability was evaluated via RT-qPCR in 14 and 20 day differentiation assays to the osteogenic lineage. Different normalization strategies were evaluated to quantify the osteogenic markers collagen type I, bone sialoprotein and osteonectin. Cell differentiation was confirmed via alizarin red staining. The results demonstrated up-regulation of beta-actin with maximum fold changes (MFC) of 4.38. GAPDH and RPL13A were not regulated by osteogenic media after 14 days and presented average fold changes lower than 2 in 20 day cultures. RPL13A (MFC < 2) had a greater stability when normalizing as a function of culture time compared with GAPDH (MFC gene in osteogenic differentiation studies of hBMSCs. This work highlights the importance of validating the normalizer genes used for stem cells characterization via RT-qPCR.

  15. Rates of evolution in stress-related genes are associated with habitat preference in two Cardamine lineages

    Directory of Open Access Journals (Sweden)

    Ometto Lino

    2012-01-01

    and in the levels of selective pressure between the C. impatiens and C. resedifolia lineages. The within-species analyses also revealed evolutionary patterns associated with habitat preference of two Cardamine species. We conclude that the selective pressures associated with the habitats typical of C. resedifolia may have caused the rapid evolution of genes involved in cold response.

  16. Hydrogenase Gene Distribution and H2 Consumption Ability within the Thiomicrospira Lineage.

    Science.gov (United States)

    Hansen, Moritz; Perner, Mirjam

    2016-01-01

    Thiomicrospira were originally characterized as sulfur-oxidizing chemolithoautotrophs. Attempts to grow them on hydrogen failed for many years. Only recently we demonstrated hydrogen consumption among two of three tested Thiomicrospira and posited that hydrogen consumption may be more widespread among Thiomicrospira than previously assumed. Here, we investigate and compare the hydrogen consumption ability and the presence of group 1 [NiFe]-hydrogenase genes (enzyme catalyzes H2↔2H(+) + 2e(-)) for sixteen different Thiomicrospira species. Seven of these Thiomicrospira species encoded group 1 [NiFe]-hydrogenase genes and five of these species could also consume hydrogen. All Thiomicrospira species exhibiting hydrogen consumption were from hydrothermal vents along the Mid-Atlantic ridge or Eastern Pacific ridges. The tested Thiomicrospira from Mediterranean and Western Pacific vents could not consume hydrogen. The [NiFe]-hydrogenase genes were categorized into two clusters: those resembling the hydrogenase from Hydrogenovibrio are in cluster I and are related to those from Alpha- and other Gammaproteobacteria. In cluster II, hydrogenases found exclusively in Thiomicrospira crunogena strains are combined and form a monophyletic group with those from Epsilonproteobacteria suggesting they were acquired through horizontal gene transfer. Hydrogen consumption appears to be common among some Thiomicrospira, given that five of the tested sixteen strains carried this trait. The hydrogen consumption ability expands their competitiveness within an environment.

  17. Hydrogenase gene distribution and H2 consumption ability within the Thiomicrospira lineage

    Directory of Open Access Journals (Sweden)

    Moritz eHansen

    2016-02-01

    Full Text Available Thiomicrospira were originally characterized as sulfur-oxidizing chemolithoautotrophs. Attempts to grow them on hydrogen failed for many years. Only recently we demonstrated hydrogen consumption among two of three tested Thiomicrospira and posited that hydrogen consumption may be more widespread among Thiomicrospira than previously assumed. Here, we investigate and compare the hydrogen consumption ability and the presence of group 1 [NiFe]-hydrogenase genes (enzyme catalyzes H22H+ + 2e- for sixteen different Thiomicrospira species. Seven of these Thiomicrospira species encoded group 1 [NiFe]-hydrogenase genes and five of these species could also consume hydrogen. All Thiomicrospira species exhibiting hydrogen consumption were from hydrothermal vents along the Mid-Atlantic ridge or Eastern Pacific ridges. The tested Thiomicrospira from Mediterranean and Western Pacific vents could not consume hydrogen. The [NiFe]-hydrogenase genes were categorized into two clusters: those resembling the hydrogenase from Hydrogenovibrio are in cluster I and are related to those from Alpha- and other Gammaproteobacteria. In cluster II, hydrogenases found exclusively in T. crunogena strains are combined and form a monophyletic group with those from Epsilonproteobacteria suggesting they were acquired through horizontal gene transfer. Hydrogen consumption appears to be common among some Thiomicrospira, given that five of the tested sixteen strains carried this trait. The hydrogen consumption ability expands their competitiveness within an environment.

  18. Phylogenetic analysis of the tenascin gene family: evidence of origin early in the chordate lineage

    Directory of Open Access Journals (Sweden)

    Tucker RP

    2006-08-01

    Full Text Available Abstract Background Tenascins are a family of glycoproteins found primarily in the extracellular matrix of embryos where they help to regulate cell proliferation, adhesion and migration. In order to learn more about their origins and relationships to each other, as well as to clarify the nomenclature used to describe them, the tenascin genes of the urochordate Ciona intestinalis, the pufferfish Tetraodon nigroviridis and Takifugu rubripes and the frog Xenopus tropicalis were identified and their gene organization and predicted protein products compared with the previously characterized tenascins of amniotes. Results A single tenascin gene was identified in the genome of C. intestinalis that encodes a polypeptide with domain features common to all vertebrate tenascins. Both pufferfish genomes encode five tenascin genes: two tenascin-C paralogs, a tenascin-R with domain organization identical to mammalian and avian tenascin-R, a small tenascin-X with previously undescribed GK repeats, and a tenascin-W. Four tenascin genes corresponding to tenascin-C, tenascin-R, tenascin-X and tenascin-W were also identified in the X. tropicalis genome. Multiple sequence alignment reveals that differences in the size of tenascin-W from various vertebrate classes can be explained by duplications of specific fibronectin type III domains. The duplicated domains are encoded on single exons and contain putative integrin-binding motifs. A phylogenetic tree based on the predicted amino acid sequences of the fibrinogen-related domains demonstrates that tenascin-C and tenascin-R are the most closely related vertebrate tenascins, with the most conserved repeat and domain organization. Taking all lines of evidence together, the data show that the tenascins referred to as tenascin-Y and tenascin-N are actually members of the tenascin-X and tenascin-W gene families, respectively. Conclusion The presence of a tenascin gene in urochordates but not other invertebrate phyla

  19. The effect of risedronate on osteogenic lineage is mediated by cyclooxygenase-2 gene upregulation

    OpenAIRE

    Valenti, Maria Teresa; Giannini, Sandro; Donatelli, Luca; Zanatta, Mirko; Bertoldo, Francesco; Sella, Stefania; Vilei, Maria Teresa; Ossi, Elena; Realdi, Giuseppe; Lo Cascio, Vincenzo; Dalle Carbonare, Luca

    2010-01-01

    Introduction The purpose of this study was to evaluate the effects of risedronate (Ris) in the modulation of bone formation in rats with glucocorticoid (GC)-induced osteoporosis by histomorphometric, immunohistochemical and gene expression analyses. Methods We analyzed structure, turnover and microarchitecture, cyclooxygenase 2 (COX-2) levels and osteocyte apoptosis in 40 female rats divided as follows: 1) vehicle of methylprednisolone (vGC) + vehicle of risedronate (vRis); 2) Ris 5 μg/Kg + v...

  20. De Novo Genes Arise at a Slow but Steady Rate along the Primate Lineage and Have Been Subject to Incomplete Lineage Sorting

    OpenAIRE

    Guerzoni, Daniele; McLysaght, Aoife

    2016-01-01

    De novo protein-coding gene origination is increasingly recognized as an important evolutionary mechanism. However, there remains a large amount of uncertainty regarding the frequency of these events and the mechanisms and speed of gene establishment. Here, we describe a rigorous search for cases of de novo gene origination in the great apes. We analyzed annotated proteomes as well as full genomic DNA and transcriptional and translational evidence. It is notable that results vary between data...

  1. In Silico Reconstruction of the Viral Evolutionary Lineage Yields a Potent Gene Therapy Vector

    Directory of Open Access Journals (Sweden)

    Eric Zinn

    2015-08-01

    Full Text Available Adeno-associated virus (AAV vectors have emerged as a gene-delivery platform with demonstrated safety and efficacy in a handful of clinical trials for monogenic disorders. However, limitations of the current generation vectors often prevent broader application of AAV gene therapy. Efforts to engineer AAV vectors have been hampered by a limited understanding of the structure-function relationship of the complex multimeric icosahedral architecture of the particle. To develop additional reagents pertinent to further our insight into AAVs, we inferred evolutionary intermediates of the viral capsid using ancestral sequence reconstruction. In-silico-derived sequences were synthesized de novo and characterized for biological properties relevant to clinical applications. This effort led to the generation of nine functional putative ancestral AAVs and the identification of Anc80, the predicted ancestor of the widely studied AAV serotypes 1, 2, 8, and 9, as a highly potent in vivo gene therapy vector for targeting liver, muscle, and retina.

  2. Differentially expressed genes in Bordetella pertussis strains belonging to a lineage which recently spread globally.

    Science.gov (United States)

    de Gouw, Daan; Hermans, Peter W M; Bootsma, Hester J; Zomer, Aldert; Heuvelman, Kees; Diavatopoulos, Dimitri A; Mooi, Frits R

    2014-01-01

    Pertussis is a highly contagious, acute respiratory disease in humans caused by the Gram-negative pathogen Bordetella pertussis. Pertussis has resurged in the face of intensive vaccination and this has coincided with the emergence of strains carrying a particular allele for the pertussis toxin promoter, ptxP3, which is associated with higher levels of pertussis toxin (Ptx) production. Within 10 to 20 years, ptxP3 strains have nearly completely replaced the previously dominant ptxP1 strains resulting in a worldwide selective sweep. In order to identify B. pertussis genes associated with the selective sweep, we compared the expression of genes in ptxP1 and ptxP3 strains that are under control of the Bordetella master virulence regulatory locus (bvgASR). The BvgAS proteins comprise a two component sensory transduction system which is regulated by temperature, nicotinic acid and sulfate. By increasing the sulfate concentration, it is possible to change the phase of B. pertussis from virulent to avirulent. Until recently, the only distinctive phenotype of ptxP3 strains was a higher Ptx production. Here we identify additional phenotypic differences between ptxP1 and ptxP3 strains which may have contributed to its global spread by comparing global transcriptional responses under sulfate-modulating conditions. We show that ptxP3 strains are less sensitive to sulfate-mediated gene suppression, resulting in an increased production of the vaccine antigens pertactin (Prn) and Ptx and a number of other virulence genes, including a type III secretion toxin, Vag8, a protein involved in complement resistance, and lpxE involved in lipid A modification. Furthermore, enhanced expression of the vaccine antigens Ptx and Prn by ptxP3 strains was confirmed at the protein level. Identification of genes differentially expressed between ptxP1 and ptxP3 strains may elucidate how B. pertussis has adapted to vaccination and allow the improvement of pertussis vaccines by identifying novel

  3. Differentially expressed genes in Bordetella pertussis strains belonging to a lineage which recently spread globally.

    Directory of Open Access Journals (Sweden)

    Daan de Gouw

    Full Text Available Pertussis is a highly contagious, acute respiratory disease in humans caused by the Gram-negative pathogen Bordetella pertussis. Pertussis has resurged in the face of intensive vaccination and this has coincided with the emergence of strains carrying a particular allele for the pertussis toxin promoter, ptxP3, which is associated with higher levels of pertussis toxin (Ptx production. Within 10 to 20 years, ptxP3 strains have nearly completely replaced the previously dominant ptxP1 strains resulting in a worldwide selective sweep. In order to identify B. pertussis genes associated with the selective sweep, we compared the expression of genes in ptxP1 and ptxP3 strains that are under control of the Bordetella master virulence regulatory locus (bvgASR. The BvgAS proteins comprise a two component sensory transduction system which is regulated by temperature, nicotinic acid and sulfate. By increasing the sulfate concentration, it is possible to change the phase of B. pertussis from virulent to avirulent. Until recently, the only distinctive phenotype of ptxP3 strains was a higher Ptx production. Here we identify additional phenotypic differences between ptxP1 and ptxP3 strains which may have contributed to its global spread by comparing global transcriptional responses under sulfate-modulating conditions. We show that ptxP3 strains are less sensitive to sulfate-mediated gene suppression, resulting in an increased production of the vaccine antigens pertactin (Prn and Ptx and a number of other virulence genes, including a type III secretion toxin, Vag8, a protein involved in complement resistance, and lpxE involved in lipid A modification. Furthermore, enhanced expression of the vaccine antigens Ptx and Prn by ptxP3 strains was confirmed at the protein level. Identification of genes differentially expressed between ptxP1 and ptxP3 strains may elucidate how B. pertussis has adapted to vaccination and allow the improvement of pertussis vaccines by

  4. Evidence for gene flow via seed dispersal from crop to wild relatives in Beta vulgaris (Chenopodiaceae): consequences for the release of genetically modified crop species with weedy lineages.

    OpenAIRE

    Arnaud, J-F; Viard, F.; Delescluse, M; Cuguen, J.

    2003-01-01

    Gene flow and introgression from cultivated to wild plant populations have important evolutionary and ecological consequences and require detailed investigations for risk assessments of transgene escape into natural ecosystems. Sugar beets (Beta vulgaris ssp. vulgaris) are of particular concern because: (i) they are cross-compatible with their wild relatives (the sea beet, B. vulgaris ssp. maritima); (ii) crop-to-wild gene flow is likely to occur via weedy lineages resulting from hybridizatio...

  5. Gene invasion in distant eukaryotic lineages: discovery of mutually exclusive genetic elements reveals marine biodiversity.

    Science.gov (United States)

    Monier, Adam; Sudek, Sebastian; Fast, Naomi M; Worden, Alexandra Z

    2013-09-01

    Inteins are rare, translated genetic parasites mainly found in bacteria and archaea, while spliceosomal introns are distinctly eukaryotic features abundant in most nuclear genomes. Using targeted metagenomics, we discovered an intein in an Atlantic population of the photosynthetic eukaryote, Bathycoccus, harbored by the essential spliceosomal protein PRP8 (processing factor 8 protein). Although previously thought exclusive to fungi, we also identified PRP8 inteins in parasitic (Capsaspora) and predatory (Salpingoeca) protists. Most new PRP8 inteins were at novel insertion sites that, surprisingly, were not in the most conserved regions of the gene. Evolutionarily, Dikarya fungal inteins at PRP8 insertion site a appeared more related to the Bathycoccus intein at a unique insertion site, than to other fungal and opisthokont inteins. Strikingly, independent analyses of Pacific and Atlantic samples revealed an intron at the same codon as the Bathycoccus PRP8 intein. The two elements are mutually exclusive and neither was found in cultured Bathycoccus or other picoprasinophyte genomes. Thus, wild Bathycoccus contain one of few non-fungal eukaryotic inteins known and a rare polymorphic intron. Our data indicate at least two Bathycoccus ecotypes exist, associated respectively with oceanic or mesotrophic environments. We hypothesize that intein propagation is facilitated by marine viruses; and, while intron gain is still poorly understood, presence of a spliceosomal intron where a locus lacks an intein raises the possibility of new, intein-primed mechanisms for intron gain. The discovery of nucleus-encoded inteins and associated sequence polymorphisms in uncultivated marine eukaryotes highlights their diversity and reveals potential sexual boundaries between populations indistinguishable by common marker genes. PMID:23635865

  6. Lineage-specific STAT5 target gene activation in hematopoietic progenitor cells predicts the FLT3(+)-mediated leukemic phenotype.

    Science.gov (United States)

    Müller, T A; Grundler, R; Istvanffy, R; Rudelius, M; Hennighausen, L; Illert, A L; Duyster, J

    2016-08-01

    Mutations that activate FMS-like tyrosine kinase 3 (FLT3) are frequent occurrences in acute myeloid leukemia. Two distinct types of mutations have been described: internal duplication of the juxtamembranous domain (ITD) and point mutations of the tyrosine kinase domain (TKD). Although both mutations lead to constitutive FLT3 signaling, only FLT3-ITD strongly activates signal transducer and activator of transcription 5 (STAT5). In a murine transplantation model, FLT3-ITD induces a myeloproliferative neoplasm, whereas FLT3-TKD leads to a lymphoid malignancy with significantly longer latency. Here we report that the presence of STAT5 is critical for the development of a myeloproliferative disease by FLT3-ITD in mice. Deletion of Stat5 in FLT3-ITD-induced leukemogenesis leads not only to a significantly longer survival (82 vs 27 days) of the diseased mice, but also to an immunophenotype switch with expansion of the lymphoid cell compartment. Interestingly, we were able to show differential STAT5 activation in FLT3-ITD(+) myeloid and lymphoid murine progenitors. STAT5 target genes such as Oncostatin M were highly expressed in FLT3-ITD(+) myeloid but not in FLT3-ITD(+) lymphoid progenitor cells. Strikingly, FLT3-TKD expression in combination with Oncostatin M is sufficient to reverse the phenotype to a myeloproliferative disease in FLT3-TKD mice. Thus, lineage-specific STAT5 activation in hematopoietic progenitor cells predicts the FLT3(+)-mediated leukemic phenotype in mice. PMID:27046463

  7. ANALISIS POTENSI EKONOMI DAERAH DALAM PENGEMBANGAN KOMODITI UNGGULAN KABUPATEN AGAM

    OpenAIRE

    Yolamalinda

    2014-01-01

    Globalization requires areas within the national territory to compete in the free trade competitively with products from countries all over the world. Regional economic development is expected to produce superior quality products that can compete in competition, both domestically and abroad. Agam as areas that have the potential of tourism and culture has the potential to perform on the world market with superior commodity sub-sectors of the manufacturing industry. This article analyzes the e...

  8. Functional clustering and lineage markers: insights into cellular differentiation and gene function from large-scale microarray studies of purified primary cell populations.

    Science.gov (United States)

    Hume, David A; Summers, Kim M; Raza, Sobia; Baillie, J Kenneth; Freeman, Thomas C

    2010-06-01

    Very large microarray datasets showing gene expression across multiple tissues and cell populations provide a window on the transcriptional networks that underpin the differences in functional activity between biological systems. Clusters of co-expressed genes provide lineage markers, candidate regulators of cell function and, by applying the principle of guilt by association, candidate functions for genes of currently unknown function. We have analysed a dataset comprising pure cell populations from hemopoietic and non-hemopoietic cell types (http://biogps.gnf.org). Using a novel network visualisation and clustering approach, we demonstrate that it is possible to identify very tight expression signatures associated specifically with embryonic stem cells, mesenchymal cells and hematopoietic lineages. Selected examples validate the prediction that gene function can be inferred by co-expression. One expression cluster was enriched in phagocytes, which, alongside endosome-lysosome constituents, contains genes that may make up a 'pathway' for phagocyte differentiation. Promoters of these genes are enriched for binding sites for the ETS/PU.1 and MITF families. Another cluster was associated with the production of a specific extracellular matrix, with high levels of gene expression shared by cells of mesenchymal origin (fibroblasts, adipocytes, osteoblasts and myoblasts). We discuss the limitations placed upon such data by the presence of alternative promoters with distinct tissue specificity within many protein-coding genes.

  9. Allopolyploid speciation and ongoing backcrossing between diploid progenitor and tetraploid progeny lineages in the Achillea millefolium species complex: analyses of single-copy nuclear genes and genomic AFLP

    Directory of Open Access Journals (Sweden)

    Ehrendorfer Friedrich

    2010-04-01

    Full Text Available Abstract Background In the flowering plants, many polyploid species complexes display evolutionary radiation. This could be facilitated by gene flow between otherwise separate evolutionary lineages in contact zones. Achillea collina is a widespread tetraploid species within the Achillea millefolium polyploid complex (Asteraceae-Anthemideae. It is morphologically intermediate between the relic diploids, A. setacea-2x in xeric and A. asplenifolia-2x in humid habitats, and often grows in close contact with either of them. By analyzing DNA sequences of two single-copy nuclear genes and the genomic AFLP data, we assess the allopolyploid origin of A. collina-4x from ancestors corresponding to A. setacea-2x and A. asplenifolia-2x, and the ongoing backcross introgression between these diploid progenitor and tetraploid progeny lineages. Results In both the ncpGS and the PgiC gene tree, haplotype sequences of the diploid A. setacea-2x and A. asplenifolia-2x group into two clades corresponding to the two species, though lineage sorting seems incomplete for the PgiC gene. In contrast, A. collina-4x and its suspected backcross plants show homeologous gene copies: sequences from the same tetraploid individual plant are placed in both diploid clades. Semi-congruent splits of an AFLP Neighbor Net link not only A. collina-4x to both diploid species, but some 4x individuals in a polymorphic population with mixed ploidy levels to A. setacea-2x on one hand and to A. collina-4x on the other, indicating allopolyploid speciation as well as hybridization across ploidal levels. Conclusions The findings of this study clearly demonstrate the hybrid origin of Achillea collina-4x, the ongoing backcrossing between the diploid progenitor and their tetraploid progeny lineages. Such repeated hybridizations are likely the cause of the great genetic and phenotypic variation and ecological differentiation of the polyploid taxa in Achillea millefolium agg.

  10. A new mtDNA COI gene lineage closely related to Anopheles janconnae of the Albitarsis complex in the Caribbean region of Colombia

    Directory of Open Access Journals (Sweden)

    Lina A Gutiérrez

    2010-12-01

    Full Text Available An understanding of the taxonomic status and vector distribution of anophelines is crucial in controlling malaria. Previous phylogenetic analyses have supported the description of six species of the Neotropical malaria vector Anopheles (Nyssorhynchus albitarsis s.l. (Diptera: Culicidae: An. albitarsis, Anopheles deaneorum, Anopheles marajoara, Anopheles oryzalimnetes, Anopheles janconnae and An. albitarsis F. To evaluate the taxonomic status of An. albitarsis s.l. mosquitoes collected in various localities in the Colombian Caribbean region, specimens were analyzed using the complete mitochondrial DNA cytochrome oxidase I (COI gene, the ribosomal DNA (rDNA internal transcribed spacer 2 (ITS2 region and partial nuclear DNA white gene sequences. Phylogenetic analyses of the COI gene sequences detected a new lineage closely related to An. janconnae in the Caribbean region of Colombia and determined its position relative to the other members of the complex. However, the ITS2 and white gene sequences lacked sufficient resolution to support a new lineage closely related to An. janconnae or the An. janconnae clade. The possible involvement of this new lineage in malaria transmission in Colombia remains unknown, but its phylogenetic closeness to An. janconnae, which has been implicated in local malaria transmission in Brazil, is intriguing.

  11. Nucleotide mismatches between the VP7 gene and the primer are associated with genotyping failure of a specific lineage from G1 rotavirus strains

    Directory of Open Access Journals (Sweden)

    Espinola Emilio E

    2006-05-01

    Full Text Available Abstract In recent years it was reported that the accumulation of point mutations in VP4 and VP7 genes of rotavirus strains was the main cause of the failure of the G or P-typing. Failures in the correct genotyping of G1, G2, G8, G9 and G10 rotavirus strains were reported in the most commonly used reverse transcription (RT-PCR strategies. Collecting VP7 gene sequences of G1 rotavirus strains from databases we found that 74 (61.2 % out of 121 G1 strains from lineage I showed the four specific mismatches at the 5' end of the 9T1-1 primer, previously associated with the failure of G1-typing. Thus, a great percentage of the G1 strains from lineage I worldwide reported could not have been typed if the Das's RT-PCR strategy were used. This analysis shows that the failure on the detection of the G1 strains could be due to the diversification of rotavirus strains in phylogenetic lineages. Therefore, the use of different RT-PCR strategies with different primer binding locations on the VP7 gene or new typing methodologies -like microarrays procedures- could be a better option to avoid the failure of the G-typing of rotavirus strains detected during surveillance programs.

  12. Prevalent Exon-Intron Structural Changes in the APETALA1/FRUITFULL, SEPALLATA, AGAMOUS-LIKE6, and FLOWERING LOCUS C MADS-Box Gene Subfamilies Provide New Insights into Their Evolution.

    Science.gov (United States)

    Yu, Xianxian; Duan, Xiaoshan; Zhang, Rui; Fu, Xuehao; Ye, Lingling; Kong, Hongzhi; Xu, Guixia; Shan, Hongyan

    2016-01-01

    AP1/FUL, SEP, AGL6, and FLC subfamily genes play important roles in flower development. The phylogenetic relationships among them, however, have been controversial, which impedes our understanding of the origin and functional divergence of these genes. One possible reason for the controversy may be the problems caused by changes in the exon-intron structure of genes, which, according to recent studies, may generate non-homologous sites and hamper the homology-based sequence alignment. In this study, we first performed exon-by-exon alignments of these and three outgroup subfamilies (SOC1, AG, and STK). Phylogenetic trees reconstructed based on these matrices show improved resolution and better congruence with species phylogeny. In the context of these phylogenies, we traced evolutionary changes of exon-intron structures in each subfamily. We found that structural changes have occurred frequently following gene duplication and speciation events. Notably, exons 7 and 8 (if present) suffered more structural changes than others. With the knowledge of exon-intron structural changes, we generated more reasonable alignments containing all the focal subfamilies. The resulting trees showed that the SEP subfamily is sister to the monophyletic group formed by AP1/FUL and FLC subfamily genes and that the AGL6 subfamily forms a sister group to the three abovementioned subfamilies. Based on this topology, we inferred the evolutionary history of exon-intron structural changes among different subfamilies. Particularly, we found that the eighth exon originated before the divergence of AP1/FUL, FLC, SEP, and AGL6 subfamilies and degenerated in the ancestral FLC-like gene. These results provide new insights into the origin and evolution of the AP1/FUL, FLC, SEP, and AGL6 subfamilies.

  13. Misregulation of spermatogenesis genes in Drosophila hybrids is lineage-specific and driven by the combined effects of sterility and fast male regulatory divergence.

    Science.gov (United States)

    Gomes, S; Civetta, A

    2014-09-01

    Hybrid male sterility is a common outcome of crosses between different species. Gene expression studies have found that a number of spermatogenesis genes are differentially expressed in sterile hybrid males, compared with parental species. Late-stage sperm development genes are particularly likely to be misexpressed, with fewer early-stage genes affected. Thus, a link has been posited between misexpression and sterility. A more recent alternative explanation for hybrid gene misexpression has been that it is independent of sterility and driven by divergent evolution of male-specific regulatory elements between species (faster male hypothesis). The faster male hypothesis predicts that misregulation of spermatogenesis genes should be independent of sterility and approximately the same in both hybrids, whereas sterility should only affect gene expression in sterile hybrids. To test the faster male hypothesis vs. the effect of sterility on gene misexpression, we analyse spermatogenesis gene expression in different species pairs of the Drosophila phylogeny, where hybrid male sterility occurs in only one direction of the interspecies cross (i.e. unidirectional sterility). We find significant differences among genes in misexpression with effects that are lineage-specific and caused by sterility or fast male regulatory divergence.

  14. ANALISIS POTENSI EKONOMI DAERAH DALAM PENGEMBANGAN KOMODITI UNGGULAN KABUPATEN AGAM

    Directory of Open Access Journals (Sweden)

    Yolamalinda

    2014-10-01

    Full Text Available Globalization requires areas within the national territory to compete in the free trade competitively with products from countries all over the world. Regional economic development is expected to produce superior quality products that can compete in competition, both domestically and abroad. Agam as areas that have the potential of tourism and culture has the potential to perform on the world market with superior commodity sub-sectors of the manufacturing industry. This article analyzes the election of regional commodity Agam using LQ analysis, specialization index, Shift share and SWOT analysis. The analysis finds that subsekctor processing industry has a competitive advantage and thus likely to be developed to increase the region's economy. Commodity embroidery as a creative industry is a commodity that is mapped able to compete on the sub-sectors of the processing industry because the rich local cultural values and Islamic values. A variety of programs and government policies are needed to support these commodities to appear on the international market.

  15. Phylogenetic Studies of the Three RNA Silencing Suppressor Genes of South American CTV Isolates Reveal the Circulation of a Novel Genetic Lineage

    Directory of Open Access Journals (Sweden)

    María José Benítez-Galeano

    2015-07-01

    Full Text Available Citrus Tristeza Virus (CTV is the most economically important virus of citrus worldwide. Genetic diversity and population structure of CTV isolates from all citrus growing areas from Uruguay were analyzed by RT-PCR and cloning of the three RNA silencing suppressor genes (p25, p20 and p23. Bayesian phylogenetic analysis revealed the circulation of three known genotypes (VT, T3, T36 in the country, and the presence of a new genetic lineage composed by isolates from around the world, mainly from South America. Nucleotide and amino acid identity values for this new genetic lineage were both higher than 97% for the three analyzed regions. Due to incongruent phylogenetic relationships, recombination analysis was performed using Genetic Algorithms for Recombination Detection (GARD and SimPlot software. Recombination events between previously described CTV isolates were detected. High intra-sample variation was found, confirming the co-existence of different genotypes into the same plant. This is the first report describing: (1 the genetic diversity of Uruguayan CTV isolates circulating in the country and (2 the circulation of a novel CTV genetic lineage, highly present in the South American region. This information may provide assistance to develop an effective cross-protection program.

  16. Genetic diversity, seasonality and transmission network of human metapneumovirus: identification of a unique sub-lineage of the fusion and attachment genes.

    Science.gov (United States)

    Chow, Wei Zhen; Chan, Yoke Fun; Oong, Xiang Yong; Ng, Liang Jie; Nor'E, Siti Sarah; Ng, Kim Tien; Chan, Kok Gan; Hanafi, Nik Sherina; Pang, Yong Kek; Kamarulzaman, Adeeba; Tee, Kok Keng

    2016-01-01

    Human metapneumovirus (HMPV) is an important viral respiratory pathogen worldwide. Current knowledge regarding the genetic diversity, seasonality and transmission dynamics of HMPV among adults and children living in tropical climate remains limited. HMPV prevailed at 2.2% (n = 86/3,935) among individuals presented with acute respiratory tract infections in Kuala Lumpur, Malaysia between 2012 and 2014. Seasonal peaks were observed during the northeast monsoon season (November-April) and correlated with higher relative humidity and number of rainy days (P < 0.05). Phylogenetic analysis of the fusion and attachment genes identified the co-circulation of three known HMPV sub-lineages, A2b and B1 (30.2% each, 26/86) and B2 (20.9%, 18/86), with genotype shift from sub-lineage B1 to A2b observed in 2013. Interestingly, a previously unrecognized sub-lineage of A2 was identified in 18.6% (16/86) of the population. Using a custom script for network construction based on the TN93 pairwise genetic distance, we identified up to nine HMPV transmission clusters circulating as multiple sub-epidemics. Although no apparent major outbreak was observed, the increased frequency of transmission clusters (dyads) during seasonal peaks suggests the potential roles of transmission clusters in driving the spread of HMPV. Our findings provide essential information for therapeutic research, prevention strategies, and disease outbreak monitoring of HMPV. PMID:27279080

  17. Phylogenetic Studies of the Three RNA Silencing Suppressor Genes of South American CTV Isolates Reveal the Circulation of a Novel Genetic Lineage.

    Science.gov (United States)

    Benítez-Galeano, María José; Rubio, Leticia; Bertalmío, Ana; Maeso, Diego; Rivas, Fernando; Colina, Rodney

    2015-07-01

    Citrus Tristeza Virus (CTV) is the most economically important virus of citrus worldwide. Genetic diversity and population structure of CTV isolates from all citrus growing areas from Uruguay were analyzed by RT-PCR and cloning of the three RNA silencing suppressor genes (p25, p20 and p23). Bayesian phylogenetic analysis revealed the circulation of three known genotypes (VT, T3, T36) in the country, and the presence of a new genetic lineage composed by isolates from around the world, mainly from South America. Nucleotide and amino acid identity values for this new genetic lineage were both higher than 97% for the three analyzed regions. Due to incongruent phylogenetic relationships, recombination analysis was performed using Genetic Algorithms for Recombination Detection (GARD) and SimPlot software. Recombination events between previously described CTV isolates were detected. High intra-sample variation was found, confirming the co-existence of different genotypes into the same plant. This is the first report describing: (1) the genetic diversity of Uruguayan CTV isolates circulating in the country and (2) the circulation of a novel CTV genetic lineage, highly present in the South American region. This information may provide assistance to develop an effective cross-protection program. PMID:26205407

  18. Expansion of banana (Musa acuminata) gene families involved in ethylene biosynthesis and signalling after lineage-specific whole-genome duplications.

    Science.gov (United States)

    Jourda, Cyril; Cardi, Céline; Mbéguié-A-Mbéguié, Didier; Bocs, Stéphanie; Garsmeur, Olivier; D'Hont, Angélique; Yahiaoui, Nabila

    2014-05-01

    Whole-genome duplications (WGDs) are widespread in plants, and three lineage-specific WGDs occurred in the banana (Musa acuminata) genome. Here, we analysed the impact of WGDs on the evolution of banana gene families involved in ethylene biosynthesis and signalling, a key pathway for banana fruit ripening. Banana ethylene pathway genes were identified using comparative genomics approaches and their duplication modes and expression profiles were analysed. Seven out of 10 banana ethylene gene families evolved through WGD and four of them (1-aminocyclopropane-1-carboxylate synthase (ACS), ethylene-insensitive 3-like (EIL), ethylene-insensitive 3-binding F-box (EBF) and ethylene response factor (ERF)) were preferentially retained. Banana orthologues of AtEIN3 and AtEIL1, two major genes for ethylene signalling in Arabidopsis, were particularly expanded. This expansion was paralleled by that of EBF genes which are responsible for control of EIL protein levels. Gene expression profiles in banana fruits suggested functional redundancy for several MaEBF and MaEIL genes derived from WGD and subfunctionalization for some of them. We propose that EIL and EBF genes were co-retained after WGD in banana to maintain balanced control of EIL protein levels and thus avoid detrimental effects of constitutive ethylene signalling. In the course of evolution, subfunctionalization was favoured to promote finer control of ethylene signalling.

  19. Limited inter- and intra-patient sequence diversity of the genetic lineage a human metapneumovirus fusion gene

    DEFF Research Database (Denmark)

    Winther, T.N.; Madsen, C.D.; Pedersen, Anders Gorm;

    2005-01-01

    Human metapneumovirus (hMPV) is associated with respiratory tract illness especially in young children. Two hMPV genetic lineages, A and B, and four sublineages A1, A2 and B1, B2 have been defined. Infection with hMPV occurs through membrane fusion mediated by the hMPV fusion (F) protein. In this......Human metapneumovirus (hMPV) is associated with respiratory tract illness especially in young children. Two hMPV genetic lineages, A and B, and four sublineages A1, A2 and B1, B2 have been defined. Infection with hMPV occurs through membrane fusion mediated by the hMPV fusion (F) protein...

  20. Limited inter- and intra-patient sequence diversity of the genetic lineage A human metapneumovirus fusion gene

    DEFF Research Database (Denmark)

    Winther, Thilde Nordmann; Madsen, Chris D; Pedersen, Anders;

    2005-01-01

    Human metapneumovirus (hMPV) is associated with respiratory tract illness especially in young children. Two hMPV genetic lineages, A and B, and four sublineages A1, A2 and B1, B2 have been defined. Infection with hMPV occurs through membrane fusion mediated by the hMPV fusion (F) protein. In this......Human metapneumovirus (hMPV) is associated with respiratory tract illness especially in young children. Two hMPV genetic lineages, A and B, and four sublineages A1, A2 and B1, B2 have been defined. Infection with hMPV occurs through membrane fusion mediated by the hMPV fusion (F) protein...

  1. Current versus historical population sizes in vertebrate species with high gene flow: a comparison based on mitochondrial DNA lineages and inbreeding theory for neutral mutations.

    Science.gov (United States)

    Avise, J C; Ball, R M; Arnold, J

    1988-07-01

    Using inbreeding theory as applied to neutral alleles inherited maternally, we generate expected probability distributions of times to identity by descent for random pairs of mitochondrial genotypes within a population or within an entire species characterized by high gene flow. For comparisons with these expectations, empirical distributions of times to most recent common ancestry were calculated (by conventional mtDNA clock calibrations) from mtDNA haplotype distances observed within each of three vertebrate species--American eels, hardhead catfish, and redwinged blackbirds. These species were chosen for analysis because census population size in each is currently large and because both genetic and life-history data are consistent with the postulate that historical gene flow within these species has been high. The observed molecular distances among mtDNA lineages were two to three orders of magnitude lower than predicted from census sizes of breeding females, suggesting that rate of mtDNA evolution is decelerated in these species and/or that long-term effective population size is vastly smaller than present-day population size. Several considerations point to the latter possibility as most likely. The genetic structure of any species is greatly influenced by historical demography; even for species that are currently abundant, mtDNA gene lineages appear to have been channeled through fairly small numbers of ancestors.

  2. Evidence for gene flow via seed dispersal from crop to wild relatives in Beta vulgaris (Chenopodiaceae): consequences for the release of genetically modified crop species with weedy lineages.

    Science.gov (United States)

    Arnaud, J-F; Viard, F; Delescluse, M; Cuguen, J

    2003-08-01

    Gene flow and introgression from cultivated to wild plant populations have important evolutionary and ecological consequences and require detailed investigations for risk assessments of transgene escape into natural ecosystems. Sugar beets (Beta vulgaris ssp. vulgaris) are of particular concern because: (i) they are cross-compatible with their wild relatives (the sea beet, B. vulgaris ssp. maritima); (ii) crop-to-wild gene flow is likely to occur via weedy lineages resulting from hybridization events and locally infesting fields. Using a chloroplastic marker and a set of nuclear microsatellite loci, the occurrence of crop-to-wild gene flow was investigated in the French sugar beet production area within a 'contact-zone' in between coastal wild populations and sugar beet fields. The results did not reveal large pollen dispersal from weed to wild beets. However, several pieces of evidence clearly show an escape of weedy lineages from fields via seed flow. Since most studies involving the assessment of transgene escape from crops to wild outcrossing relatives generally focused only on pollen dispersal, this last result was unexpected: it points out the key role of a long-lived seed bank and highlights support for transgene escape via man-mediated long-distance dispersal events.

  3. Gene structure of the two-domain taurocyamine kinase from Paragonimus westermani: evidence for a distinct lineage of trematode phosphagen kinases.

    Science.gov (United States)

    Jarilla, Blanca R; Tokuhiro, Shinji; Nagataki, Mitsuru; Uda, Kouji; Suzuki, Tomohiko; Acosta, Luz P; Agatsuma, Takeshi

    2013-07-11

    Taurocyamine kinase (TK) is an enzyme that catalyzes the reversible transfer of a phosphate between ATP and taurocyamine. Annelid TKs were suggested to have evolved from a CK ancestor. However, TKs from the lung fluke Paragonimus westermani comprised another lineage. Construction of phylogenetic tree and comparison of exon/intron organization showed that P. westermani TK and other trematode TKs evolved from a molluscan arginine kinase (AK) gene. Exon shuffling probably caused the changes in amino acid sequence thereby changing the affinity from AK to TK. The present study provides new insights on the evolution of phosphagen kinases found in trematodes.

  4. Regulation of early T-lineage gene expression and developmental progression by the progenitor cell transcription factor PU.1.

    Science.gov (United States)

    Champhekar, Ameya; Damle, Sagar S; Freedman, George; Carotta, Sebastian; Nutt, Stephen L; Rothenberg, Ellen V

    2015-04-15

    The ETS family transcription factor PU.1 is essential for the development of several blood lineages, including T cells, but its function in intrathymic T-cell precursors has been poorly defined. In the thymus, high PU.1 expression persists through multiple cell divisions in early stages but then falls sharply during T-cell lineage commitment. PU.1 silencing is critical for T-cell commitment, but it has remained unknown how PU.1 activities could contribute positively to T-cell development. Here we employed conditional knockout and modified antagonist PU.1 constructs to perturb PU.1 function stage-specifically in early T cells. We show that PU.1 is needed for full proliferation, restricting access to some non-T fates, and controlling the timing of T-cell developmental progression such that removal or antagonism of endogenous PU.1 allows precocious access to T-cell differentiation. Dominant-negative effects reveal that this repression by PU.1 is mediated indirectly. Genome-wide transcriptome analysis identifies novel targets of PU.1 positive and negative regulation affecting progenitor cell signaling and cell biology and indicating distinct regulatory effects on different subsets of progenitor cell transcription factors. Thus, in addition to supporting early T-cell proliferation, PU.1 regulates the timing of activation of the core T-lineage developmental program.

  5. Functional Consequences of Genome Evolution in Listeria monocytogenes: the lmo0423 and lmo0422 Genes Encode σC and LstR, a Lineage II-Specific Heat Shock System†

    OpenAIRE

    Zhang, Chaomei; Nietfeldt, Joe; Zhang, Min; Benson, Andrew K.

    2005-01-01

    Listeria monocytogenes strains belonging to phylogenetic lineage II (serotypes 1/2a, 1/2c, and 3a) carry a lineage-specific genome segment encoding a putative sigma subunit of RNA polymerase (lmo0423, herein referred to as sigC), a gene of unknown function (lmo0422) similar to the padR family of regulators, and a gene that is similar to the rodA-ftsW family of cell wall morphology genes (lmo0421). To understand the function of this set of genes, their expression patterns and the effects of nu...

  6. Cloning and Expression Analysis of an AGAMOUS-Like Gene (CaspAG) from Catalpa speciosa%黄金树花器官特征决定的CaspAG基因克隆和表达分析

    Institute of Scientific and Technical Information of China (English)

    夏燕; 景丹龙; 王军辉

    2014-01-01

    以黄金树的花芽为材料,采用同源基因克隆技术,获得黄金树花器官特征决定的AG同源基因,将其命名为CaspAG,其开放阅读框(ORF)为738 bp,编码245个氨基酸。分子系统发生和蛋白序列比对分析表明:CaspAG是拟南芥的AG同源蛋白,被归为euAG进化分支,其MADS区有57个氨基酸, I区有32个氨基酸, K区有83个氨基酸, C区有55个氨基酸,其中C末端的转录激活区含有两个保守的基序:AGI和AGII基序。半定量RT-PCR分析表明,在花发育过程中, CaspAG基因仅在雄蕊和雌蕊中表达,而在茎、叶片、萼片和花瓣中几乎不表达。实时荧光定量PCR分析结果表明, CaspAG基因在雌雄蕊原基分化期至雌雄蕊成熟期均有表达,在雌雄蕊发育成熟期表达量达到最高;且在雄蕊的表达高峰的时间明显早于雌蕊,这与雌、雄蕊形态成熟的时间基本吻合。%A MADS-box gene CaspAG involved in lfower development was isolated from the lfower bud of Catalpa speciosa via homology cloning technique. The open reading frame (ORF) of CaspAG was 738 bp, which encoded 245 amino acid. Protein sequence alignment and molecular phylogeny analysis suggested that CaspAG was an AG homology in Arabidopsis, grouped with euAG clade. Conceptual translation revealed that the MADS domain contained 57 amino acid, the I domain contained 32 amino acid, the K domain contained 83 amino acid, the C domain contained 55 amino acid. Moreover, two highly conserved motifs speciifc to C pro-teins, AG motifs I and II, were found in the C-terminal regions of the CaspAG protein. Semi-quantitative RT-PCR analysis showed CaspAG transcriptional activity mainly concentrated on stamens and carpels while no-ex-pression in plant stem, leaves, sepals and petals during different stages of lfower development. The qRT-PCR analysis showed that the expression of CaspAG was detected at the primordium to mature stages of stamen and pistil during morphological differentiation

  7. Recruitment of Mediator Complex by Cell Type and Stage-Specific Factors Required for Tissue-Specific TAF Dependent Gene Activation in an Adult Stem Cell Lineage.

    Science.gov (United States)

    Lu, Chenggang; Fuller, Margaret T

    2015-12-01

    Onset of terminal differentiation in adult stem cell lineages is commonly marked by robust activation of new transcriptional programs required to make the appropriate differentiated cell type(s). In the Drosophila male germ line stem cell lineage, the switch from proliferating spermatogonia to spermatocyte is accompanied by one of the most dramatic transcriptional changes in the fly, as over 1000 new transcripts turn on in preparation for meiosis and spermatid differentiation. Here we show that function of the coactivator complex Mediator is required for activation of hundreds of new transcripts in the spermatocyte program. Mediator appears to act in a sequential hierarchy, with the testis activating Complex (tMAC), a cell type specific form of the Mip/dREAM general repressor, required to recruit Mediator subunits to the chromatin, and Mediator function required to recruit the testis TAFs (tTAFs), spermatocyte specific homologs of subunits of TFIID. Mediator, tMAC and the tTAFs co-regulate expression of a major set of spermatid differentiation genes. The Mediator subunit Med22 binds the tMAC component Topi when the two are coexpressed in S2 cells, suggesting direct recruitment. Loss of Med22 function in spermatocytes causes meiosis I maturation arrest male infertility, similar to loss of function of the tMAC subunits or the tTAFs. Our results illuminate how cell type specific versions of the Mip/dREAM complex and the general transcription machinery cooperate to drive selective gene activation during differentiation in stem cell lineages. PMID:26624996

  8. Lineage-specific expansion of vomeronasal type 2 receptor-like (OlfC) genes in cichlids may contribute to diversification of amino acid detection systems.

    Science.gov (United States)

    Nikaido, Masato; Suzuki, Hikoyu; Toyoda, Atsushi; Fujiyama, Asao; Hagino-Yamagishi, Kimiko; Kocher, Thomas D; Carleton, Karen; Okada, Norihiro

    2013-01-01

    Fish use olfaction to sense a variety of nonvolatile chemical signals in water. However, the evolutionary importance of olfaction in species-rich cichlids is controversial. Here, we determined an almost complete sequence of the vomeronasal type 2 receptor-like (OlfC: putative amino acids receptor in teleosts) gene cluster using the bacterial artificial chromosome library of the Lake Victoria cichlid, Haplochromis chilotes. In the cluster region, we found 61 intact OlfC genes, which is the largest number of OlfC genes identified among the seven teleost fish investigated to date. Data mining of the Oreochromis niloticus (Nile tilapia) draft genome sequence, and genomic Southern hybridization analysis revealed that the ancestor of all modern cichlids had already developed almost the same OlfC gene repertoire, which was accomplished by lineage-specific gene expansions. Furthermore, comparison of receptor sequences showed that recently duplicated paralogs are more variable than orthologs of different species at particular sites that were predicted to be involved in amino acid selectivity. Thus, the increase of paralogs through gene expansion may lead to functional diversification in detection of amino acids. This study implies that cichlids have developed a potent capacity to detect a variety of amino acids (and their derivatives) through OlfCs, which may have contributed to the extraordinary diversity of their feeding habitats. PMID:23501830

  9. Sequence of a complete chicken BG haplotype shows dynamic expansion and contraction of two gene lineages with particular expression patterns

    DEFF Research Database (Denmark)

    Salomonsen, Jan; Chattaway, John A.; Chan, Andrew C. Y.;

    2014-01-01

    Many genes important in immunity are found as multigene families. The butyrophilin genes are members of the B7 family, playing diverse roles in co-regulation and perhaps in antigen presentation. In humans, a fixed number of butyrophilin genes are found in and around the major histocompatibility c...

  10. Gene : CBRC-AGAM-05-0058 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available 07733 /ug=Aga.36101 /len=688 1e-25 52% MRQTLPRLLLLLLLLLPLLLLLLVLLLLLLLLLTLLLLTLLLLLLLLLLTLLLLTLLLTLLLLT...LLLLLLLLLLMLLLLSLLPELWWDIALTLLLLLLLLLLLLLPRALLLLSLLPELWWNIAFTLLLLLLLLLLRLTMPLGRAASYHRCPKLLLRLLQLLLLRLLLTLLLT

  11. Gene : CBRC-AGAM-04-0078 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available 439 /ug=Aga.1901 /len=2137 2e-40 28% MMTPTSPTIPTSPTSSSSPTIRTSPSVPTSPSTPQTSSSTTESTTASSTTSTSMTTSISPTIPSSPTSLSSPTTRTSPSAPTSPSTPQTTISTTES...TTAVTMNSDSSSSSTESTTPSSTTSTSMTTPTSPTIPTSPTSPSSPTIRTSPSATTSPSTPKTSSSTTESTTASSTTSISPTI...PSSPTSLSSPTTRTSPSAPTSPSTPETTISTTESTTAVTMTSDSTSSSTESTTVSSTTPETTSSITESTTAVTMTSDSSSSSTESTTASSTTPATTSSTTEST...TVSSTTSETTSSRTESTTAITMTSDSTSSSTESTTASSTTSTSMTTSISPTIPSSPTSLSSPTTRTSPSAPTSPSTPETISSTTEST...TASSTISTSMTTSISPTIPSSPTSPSSSTTRTTPSAPTSPSTPETTSSTTESTASSTTSTSMTTPTSPTIPSSPTSPSSPTTRTSPSAPTSPTTPETISSTTESTTA

  12. Gene : CBRC-AGAM-04-0011 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CPQVFDPRKLVLVEHRSCTKYNLCVLGLMLTVSCPNDLRFNNERCECDFKEKVHCEGEDPATTTVDYASSTDATTVYDSTTEDSTTEESTTELATSESTTEDSTTEESTTEVTVSES...TTEDSTTEESTTEGTVSESTTEDSTTEESTTEVATSESTTEESTTEESTTEVTVSESTTEDSTTKESTTEVTVSESTTEDSTTEESTTEVATSES...TTEDSTTEESTTEVTVSESTTEDSTTEESTTEAATSESTTEDSTTEEATTEVTVSESTTEDSTTEESTTEVVTSESTTEDSTTEESTTEVVTSES...TTEDSTTEESTTEVATSESTTEDSTTEESTTEVTVSESTTEDSTTEESTTEAATSESTTEDSTTEEATTEVTVSESTTEDSTTEESTTEVAVSESTTEDSTTEESTTEVATSES...TTEESTTEESTTEVTVSEPTTEDSTTEESTTEVTTSESTTEESTTEESTTEVTVSESTTEDSTTEESTTEVTTSES

  13. Gene : CBRC-AGAM-04-0082 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available cds=p(1,3606) /gb=AJ535205 /gi=27227575 /ug=Aga.35084 /len=3606 9e-51 24% MSSASTPEPSTTPGTTRTTPTRPTSTESTDTTMS...SASTSEPSTTPGTTRTTPTRPTSTESTDTTMSSASTPEPSTTPGTTRTTPTRPTSTESTDTTMSSASTPEPSTTSGTTRTTPTRPTPTDTTMS...SASTPEPSTTPGTTRTTPTRPTSTESTDTTMSSASTPEPSTTPGTTRTTPTRPTSTESTDTTMSSASTPEPSTTPGTTRTTPTRPTSTESTDTTMS...SASTPEPSTKPGTTRTTPTRPTTTESTDTTMSSASTTEPSTTPGTTRTTPTRPTSTESTDTTMSSASTPEPSTTPGTTRTTPTRPTSTESTDTTMSSASTPEPSTTPGTTRTTPTRPTSTESTDTTMS...SASTPEPSTTPGTTRTTPTRPTSTESTDTTMSSASTPEPSTTPGTTRTTPTRPTSTESTDTTMS

  14. Lineage-specific fragmentation and nuclear relocation of the mitochondrial cox2 gene in chlorophycean green algae (Chlorophyta).

    Science.gov (United States)

    Rodríguez-Salinas, Elizabeth; Riveros-Rosas, Héctor; Li, Zhongkui; Fucíková, Karolina; Brand, Jerry J; Lewis, Louise A; González-Halphen, Diego

    2012-07-01

    In most eukaryotes the subunit 2 of cytochrome c oxidase (COX2) is encoded in intact mitochondrial genes. Some green algae, however, exhibit split cox2 genes (cox2a and cox2b) encoding two polypeptides (COX2A and COX2B) that form a heterodimeric COX2 subunit. Here, we analyzed the distribution of intact and split cox2 gene sequences in 39 phylogenetically diverse green algae in phylum Chlorophyta obtained from databases (28 sequences from 22 taxa) and from new cox2 data generated in this work (23 sequences from 18 taxa). Our results support previous observations based on a smaller number of taxa, indicating that algae in classes Prasinophyceae, Ulvophyceae, and Trebouxiophyceae contain orthodox, intact mitochondrial cox2 genes. In contrast, all of the algae in Chlorophyceae that we examined exhibited split cox2 genes, and could be separated into two groups: one that has a mitochondrion-localized cox2a gene and a nucleus-localized cox2b gene ("Scenedesmus-like"), and another that has both cox2a and cox2b genes in the nucleus ("Chlamydomonas-like"). The location of the split cox2a and cox2b genes was inferred using five different criteria: differences in amino acid sequences, codon usage (mitochondrial vs. nuclear), codon preference (third position frequencies), presence of nucleotide sequences encoding mitochondrial targeting sequences and presence of spliceosomal introns. Distinct green algae could be grouped according to the form of cox2 gene they contain: intact or fragmented, mitochondrion- or nucleus-localized, and intron-containing or intron-less. We present a model describing the events that led to mitochondrial cox2 gene fragmentation and the independent and sequential migration of cox2a and cox2b genes to the nucleus in chlorophycean green algae. We also suggest that the distribution of the different forms of the cox2 gene provides important insights into the phylogenetic relationships among major groups of Chlorophyceae.

  15. Sequence of a complete chicken BG haplotype shows dynamic expansion and contraction of two gene lineages with particular expression patterns.

    Directory of Open Access Journals (Sweden)

    Jan Salomonsen

    2014-06-01

    Full Text Available Many genes important in immunity are found as multigene families. The butyrophilin genes are members of the B7 family, playing diverse roles in co-regulation and perhaps in antigen presentation. In humans, a fixed number of butyrophilin genes are found in and around the major histocompatibility complex (MHC, and show striking association with particular autoimmune diseases. In chickens, BG genes encode homologues with somewhat different domain organisation. Only a few BG genes have been characterised, one involved in actin-myosin interaction in the intestinal brush border, and another implicated in resistance to viral diseases. We characterise all BG genes in B12 chickens, finding a multigene family organised as tandem repeats in the BG region outside the MHC, a single gene in the MHC (the BF-BL region, and another single gene on a different chromosome. There is a precise cell and tissue expression for each gene, but overall there are two kinds, those expressed by haemopoietic cells and those expressed in tissues (presumably non-haemopoietic cells, correlating with two different kinds of promoters and 5' untranslated regions (5'UTR. However, the multigene family in the BG region contains many hybrid genes, suggesting recombination and/or deletion as major evolutionary forces. We identify BG genes in the chicken whole genome shotgun sequence, as well as by comparison to other haplotypes by fibre fluorescence in situ hybridisation, confirming dynamic expansion and contraction within the BG region. Thus, the BG genes in chickens are undergoing much more rapid evolution compared to their homologues in mammals, for reasons yet to be understood.

  16. Ancestral reconstruction of tick lineages.

    Science.gov (United States)

    Mans, Ben J; de Castro, Minique H; Pienaar, Ronel; de Klerk, Daniel; Gaven, Philasande; Genu, Siyamcela; Latif, Abdalla A

    2016-06-01

    Ancestral reconstruction in its fullest sense aims to describe the complete evolutionary history of a lineage. This depends on accurate phylogenies and an understanding of the key characters of each parental lineage. An attempt is made to delineate our current knowledge with regard to the ancestral reconstruction of the tick (Ixodida) lineage. Tick characters may be assigned to Core of Life, Lineages of Life or Edges of Life phenomena depending on how far back these characters may be assigned in the evolutionary Tree of Life. These include housekeeping genes, sub-cellular systems, heme processing (Core of Life), development, moulting, appendages, nervous and organ systems, homeostasis, respiration (Lineages of Life), specific adaptations to a blood-feeding lifestyle, including the complexities of salivary gland secretions and tick-host interactions (Edges of Life). The phylogenetic relationships of lineages, their origins and importance in ancestral reconstruction are discussed. Uncertainties with respect to systematic relationships, ancestral reconstruction and the challenges faced in comparative transcriptomics (next-generation sequencing approaches) are highlighted. While almost 150 years of information regarding tick biology have been assembled, progress in recent years indicates that we are in the infancy of understanding tick evolution. Even so, broad reconstructions can be made with relation to biological features associated with various lineages. Conservation of characters shared with sister and parent lineages are evident, but appreciable differences are present in the tick lineage indicating modification with descent, as expected for Darwinian evolutionary theory. Many of these differences can be related to the hematophagous lifestyle of ticks. PMID:26868413

  17. The complex translocation (9;14;14 involving IGH and CEBPE genes suggests a new subgroup in B-lineage acute lymphoblastic leukemia

    Directory of Open Access Journals (Sweden)

    Rachid Zerrouki

    2016-03-01

    Full Text Available Abstract Many subtypes of acute lymphoblastic leukemia (ALL are associated with specific chromosomal rearrangements. The complex translocation t(9;14;14, a variant of the translocation (14;14(q11;q32, is a rare but recurrent chromosomal abnormality involving the immunoglobulin heavy-chain (IGH and CCAAT enhancer-binding protein (CEBPE genes in B-lineage ALL (B-ALL and may represent a new B-ALL subgroup. We report here the case of a 5-year-old girl with B-ALL, positive for CD19, CD38 and HLA-DR. A direct technique and G-banding were used for chromosomal analysis and fluorescentin situ hybridization (FISH with BAC probes was used to investigate a possible rearrangement of the IGH andCEBPE genes. The karyotype exhibit the chromosomal aberration 46,XX,del(9(p21,t(14;14(q11;q32. FISH with dual-color break-apartIGH-specific and CEPBE-specific bacterial artificial chromosome (BAC probes showed a complex t(9;14;14 associated with a deletion of cyclin-dependent kinase inhibitor 2A (CDKN2A and paired box gene 5 (PAX5 at 9p21-13 and duplication of the fusion gene IGH-CEBPE.

  18. Gene expression regulation and lineage evolution: the North and South tale of the hybrid polyploid Squalius alburnoides complex

    Science.gov (United States)

    Pala, Irene; Schartl, Manfred; Brito, Miguel; Vacas, Joana Malta; Coelho, Maria Manuela

    2010-01-01

    The evolution of hybrid polyploid vertebrates, their viability and their perpetuation over evolutionary time have always been questions of great interest. However, little is known about the impact of hybridization and polyploidization on the regulatory networks that guarantee the appropriate quantitative and qualitative gene expression programme. The Squalius alburnoides complex of hybrid fish is an attractive system to address these questions, as it includes a wide variety of diploid and polyploid forms, and intricate systems of genetic exchange. Through the study of genome-specific allele expression of seven housekeeping and tissue-specific genes, we found that a gene copy silencing mechanism of dosage compensation exists throughout the distribution range of the complex. Here we show that the allele-specific patterns of silencing vary within the complex, according to the geographical origin and the type of genome involved in the hybridization process. In southern populations, triploids of S. alburnoides show an overall tendency for silencing the allele from the minority genome, while northern population polyploids exhibit preferential biallelic gene expression patterns, irrespective of genomic composition. The present findings further suggest that gene copy silencing and variable expression of specific allele combinations may be important processes in vertebrate polyploid evolution. PMID:20554543

  19. Prognostic and therapeutic role of targetable lesions in B-lineage acute lymphoblastic leukemia without recurrent fusion genes.

    Science.gov (United States)

    Messina, Monica; Chiaretti, Sabina; Wang, Jiguang; Fedullo, Anna Lucia; Peragine, Nadia; Gianfelici, Valentina; Piciocchi, Alfonso; Brugnoletti, Fulvia; Di Giacomo, Filomena; Pauselli, Simona; Holmes, Antony B; Puzzolo, Maria Cristina; Ceglie, Giulia; Apicella, Valerio; Mancini, Marco; Te Kronnie, Geertruy; Testi, Anna Maria; Vitale, Antonella; Vignetti, Marco; Guarini, Anna; Rabadan, Raul; Foà, Robin

    2016-03-22

    To shed light into the molecular bases of B-lineage acute lymphoblastic leukemia lacking known fusion transcripts, i.e. BCR-ABL1, ETV6-RUNX1, E2A-PBX1, and MLL rearrangements (B-NEG ALL) and the differences between children, adolescents/young adults (AYA) and adults, we analyzed 168 B-NEG ALLs by genome-wide technologies. This approach showed that B-NEG cases carry 10.5 mutations and 9.1 copy-number aberrations/sample. The most frequently mutated druggable pathways were those pertaining to RAS/RTK (26.8%) and JAK/STAT (12.5%) signaling. In particular, FLT3 and JAK/STAT mutations were detected mainly in AYA and adults, while KRAS and NRAS mutations were more frequent in children. RAS/RTK mutations negatively affected the outcome of AYA and adults, but not that of children. Furthermore, adult B-NEG ALL carrying JAK/STAT mutations had a shorter survival. In vitro experiments showed that FLT3 inhibitors reduced significantly the proliferation of FLT3-mutated primary B-NEG ALL cells. Likewise, PI3K/mTOR inhibitors reduced the proliferation of primary cells harboring RAS and IL7R mutations. These results refine the genetic landscape of B-NEG ALL and suggest that the different distribution of lesions and their prognostic impact might sustain the diverse outcome between children, adults and partly AYA - whose genomic scenario is similar to adults - and open the way to targeted therapeutic strategies. PMID:26883104

  20. The MADS domain protein DIANA acts together with AGAMOUS-LIKE80 to specify the central cell in Arabidopsis ovules.

    Science.gov (United States)

    Bemer, Marian; Wolters-Arts, Mieke; Grossniklaus, Ueli; Angenent, Gerco C

    2008-08-01

    MADS box genes in plants consist of MIKC-type and type I genes. While MIKC-type genes have been studied extensively, the functions of type I genes are still poorly understood. Evidence suggests that type I MADS box genes are involved in embryo sac and seed development. We investigated two independent T-DNA insertion alleles of the Arabidopsis thaliana type I MADS box gene AGAMOUS-LIKE61 (AGL61) and showed that in agl61 mutant ovules, the polar nuclei do not fuse and central cell morphology is aberrant. Furthermore, the central cell begins to degenerate before fertilization takes place. Although pollen tubes are attracted and perceived by the mutant ovules, neither endosperm development nor zygote formation occurs. AGL61 is expressed in the central cell during the final stages of embryo sac development. An AGL61:green fluorescent protein-beta-glucoronidase fusion protein localizes exclusively to the polar nuclei and the secondary nucleus of the central cell. Yeast two-hybrid analysis showed that AGL61 can form a heterodimer with AGL80 and that the nuclear localization of AGL61 is lost in the agl80 mutant. Thus, AGL61 and AGL80 appear to function together to differentiate the central cell in Arabidopsis. We renamed AGL61 DIANA, after the virginal Roman goddess of the hunt.

  1. Up-Regulation of Oligodendrocyte Lineage Markers in the Cerebellum of Autistic Patients: Evidence from Network Analysis of Gene Expression.

    Science.gov (United States)

    Zeidán-Chuliá, Fares; de Oliveira, Ben-Hur Neves; Casanova, Manuel F; Casanova, Emily L; Noda, Mami; Salmina, Alla B; Verkhratsky, Alexei

    2016-08-01

    Autism is a neurodevelopmental disorder manifested by impaired social interaction, deficits in communication skills, restricted interests, and repetitive behaviors. In neurodevelopmental, neurodegenerative, and psychiatric disorders, glial cells undergo morphological, biochemical, and functional rearrangements, which are critical for neuronal development, neurotransmission, and synaptic connectivity. Cerebellar function is not limited to motor coordination but also contributes to cognition and may be affected in autism. Oligodendrocytes and specifically oligodendroglial precursors are highly susceptible to oxidative stress and excitotoxic insult. In the present study, we searched for evidence for developmental oligodendropathy in the context of autism by performing a network analysis of gene expression of cerebellar tissue. We created an in silico network model (OLIGO) showing the landscape of interactions between oligodendrocyte markers and demonstrated that more than 50 % (16 out of 30) of the genes within this model displayed significant changes of expression (corrected p value disorders (ASD). PMID:26189831

  2. Conditional deletion of the relaxin receptor gene in cells of smooth muscle lineage affects lower reproductive tract in pregnant mice.

    Science.gov (United States)

    Kaftanovskaya, Elena M; Huang, Zaohua; Lopez, Carolina; Conrad, Kirk; Agoulnik, Alexander I

    2015-04-01

    Relaxin hormone secreted into the circulation during pregnancy was discovered through its effects on pubic symphysis relaxation and parturition. Genetic inactivation of the relaxin gene or its cognate relaxin family peptide receptor 1 (RXFP1) in mice caused failure of parturition and mammary nipple enlargement, as well as increased collagen fiber density in the cervix and vagina. However, the relaxin effect on discrete cells and tissues has yet to be determined. Using transgenic mice with a knockin LacZ reporter in the Rxfp1 allele, we showed strong expression of this gene in vaginal and cervical stromal cells, as well as pubic ligament cells. We produced a floxed Rxfp1 allele that was used in combination with the Tagln-cre transgene to generate mice with a smooth muscle-specific gene knockout. In pregnant females, the ROSA26 reporter activated by Tagln-cre was detected in smooth muscle cells of the cervix, vagina, uterine artery, and in cells of the pubic symphysis. In late pregnant females with conditional gene ablation, the length of pubic symphysis was significantly reduced compared with wild-type or heterozygous Rxfp1(+/-) females. Denser collagen content was revealed by Masson trichrome staining in reproductive tract organs, uterine artery, and pubic symphysis. The cervical and vaginal epithelium was less developed than in heterozygous or wild-type females, although nipple size was normal and the dams were able to nurse their pups. In summary, our data indicate that relaxin/RXFP1 signaling in smooth muscle cells is important for normal collagen turnover and relaxation of the pubic symphysis during pregnancy. PMID:25715795

  3. Breakdown of host resistance by independent evolutionary lineages of Beet necrotic yellow vein virus involves a parallel c/u mutation in its p25 gene.

    Science.gov (United States)

    Acosta-Leal, Rodolfo; Bryan, Becky K; Smith, Jessica T; Rush, Charles M

    2010-02-01

    ABSTRACT Breakdown of sugar beet Rz1-mediated resistance against Beet necrotic yellow vein virus (BNYVV) infection was previously found, by reverse genetics, to be caused by a single mutation in its p25 gene. The possibility of alternative breaking mutations, however, has not been discarded. To explore the natural diversity of BNYVV in the field and its effects on overcoming Rz1, wild-type (WT) and resistance-breaking (RB) p25 genes from diverse production regions of North America were characterized. The relative titer of WT p25 was inversely correlated with disease expression in Rz1 plants from Minnesota and California. In Minnesota, the predominant WT p25 encoded the A(67)C(68) amino acid signature whereas, in California, it encoded A(67)L(68). In both locations, these WT signatures were associated with asymptomatic BNYVV infections of Rz1 cultivars. Further analyses of symptomatic resistant plants revealed that, in Minnesota, WT A(67)C(68) was replaced by V(67)C(68) whereas, in California, WT A(67)L(68) was replaced by V(67)L(68). Therefore, V(67) was apparently critical in overcoming Rz1 in both pathosystems. The greater genetic distances between isolates from different geographic regions rather than between WT and RB from the same location indicate that the underlying C to U transition originated independently in both BNYVV lineages. PMID:20055646

  4. A family inheriting different subtypes of acute myelogenous leukemia identifies a gene common to the differentation of multiple hematopoetic lineages and acting early in leukemogenesis

    Energy Technology Data Exchange (ETDEWEB)

    Horwitz, M.S.; Radich, J. [Fred Hutchinson Cancer Research Center, Seattle, WA (United States); Sabath, D.E. [Univ. of Washington, Seattle (United States)

    1994-09-01

    The initial steps promoting carcinogenesis in the hematologic malignancies remain poorly understood. We report on a family with an incompletely penetrant, autosomal dominant syndrome of acute myelogenous leukemia, affecting at least eight adults from three generations. The affected individuals have developed leukemias differing in morphologic subtype, tumor cytogenetics, and abruptness of presentation. Within this family are found subtypes affecting the granulocytic, monocytic, and megakaryocytic lineages. At least one individual has a normal tumor karyotype while another has complex rearrangements including monsomy 7, trisomy 8 and translocation 1;7. Some have presented with acute onset and others with a protracted myelodysplasia syndrome. One person at fifty percent risk of inheriting this gene developed disseminated atypical mycobacterium infection in the absence of leukemia, but also without apparent causes for acquired deficiencies in cellular immunity. Features common to affected family members, including the individual with mycobacterium infection, are the early presence in bone marrow of red cell and platelet maturation defects. A search for mutations in diseased marrows fails to detect abnormalities of p53 exons 5, 6, 7 and 8 or N-ras codons 12, 13 and 61. We conclude that there is a gene in this family that probably acts early in hematopoetic differentiation and confers susceptibility to a wide range of leukemia subtypes spanning the maturation of the myeloid series.

  5. Myeloidcell—lineage and premylocytic—stage—specific—expression of the mouse myeloperoxidase gene is controlled at initiation as well as elongation levels of transcription

    Institute of Scientific and Technical Information of China (English)

    ZHUJINGDE

    1999-01-01

    The myeloperoxidase (MPO) is an important microbicidal protein present at high concentration in the primary granule of mature granulocyte and its expression is regulated in both myeloidcell-lineage and premyelocytic-stagespecific manners.A better understanding of the underlying control mechanisms should provide insights into the temporal and co-ordinate regulation of the gene expression during granulopoiesis.We have identified its promoter by mapping the start(s) of transcription using various molecular approaches together with demonstrating the promoter function of the relevant DNA segment in a transient transfection reporter assay.Besides the major start of transcription mapped at G residue,11 nucleotide upstream of the 3' end of exon 0,the usage of that is specific to the MPO expressing cell lines,we have shown that irrespective of the MPO-expression status of the hematopoietic cells,transcription occurs broadly within a two kb region upstream of the 5' proximity of the gene,and is largely terminated in intron 2.These data support a model of the premyelocytic-stage-specific MPO expression,the control of which is operated at initiation as well as elongation levels of transcription.

  6. Molecular Phylogenetic Analysis of the Main Lineages of Nymphalinae (Nymphalidae: Lepidoptera) Based on the Partial Mitochondrial COI Gene

    Institute of Scientific and Technical Information of China (English)

    ZHANG Min; CAO Tian-wen; ZHONG Yang; REN Zhu-mei; GUO Ya-ping; MA En-bo

    2008-01-01

    The phylogenetic relationships of the subfamily Nymphalinae (sensu Chou 1994) were analyzed based on 1488bp of mtDNA cytochrome oxidase subunit I (COI) gene sequence data obtained from 24 individuals, along with those of eight species obtained from GenBank. The base compositions of this COI fragment varied among the individuals as follows: T 39.9%, C 14.6%, A 32.2%, and G 13.4%, with a strong AT bias (72.1%), as usually found in insect mitochondrial genomes. The A+T contents of the third, second, and first codon positions of the COI fragments in this study was 92.4, 62.2, and 61.4%, respectively. The phylogenetic trees were reconstructed by neighbor-joining (NJ), maximum likelihood (ML), and Bayesian methods by using Byblia anvatara as outgroup. Phylogenetic analyses based on the COI gene sequence data created very similar topologies, which were producing trees with two main clades A and B, and five subclades. The data indicated that the tribes Nymphalini and Hypolimni (sensu Chou 1994) are not monophyletic groups, and the genus Junonia should be removed from Nymphalini to Hypolimni (=Junoniini). On the basis of the data, the Symbrenthia and Araschnia had a relative distant relationship with the rest of Nymphalini. The relationships of species in the Nymphalini were confirmed via the NJ, ML, and Bayesian methods, namely ((((Nymphalis+Kaniska)+Polygonia)+Aglais)+Vanessa)+(Symbrenthia+Araschnia). This investigation provides a little novel information for Chinese researches of butterflies.

  7. Lateral transfer of tetrahymanol-synthesizing genes has allowed multiple diverse eukaryote lineages to independently adapt to environments without oxygen

    Directory of Open Access Journals (Sweden)

    Takishita Kiyotaka

    2012-02-01

    Full Text Available Abstract Sterols are key components of eukaryotic cellular membranes that are synthesized by multi-enzyme pathways that require molecular oxygen. Because prokaryotes fundamentally lack sterols, it is unclear how the vast diversity of bacterivorous eukaryotes that inhabit hypoxic environments obtain, or synthesize, sterols. Here we show that tetrahymanol, a triterpenoid that does not require molecular oxygen for its biosynthesis, likely functions as a surrogate of sterol in eukaryotes inhabiting oxygen-poor environments. Genes encoding the tetrahymanol synthesizing enzyme squalene-tetrahymanol cyclase were found from several phylogenetically diverged eukaryotes that live in oxygen-poor environments and appear to have been laterally transferred among such eukaryotes. Reviewers This article was reviewed by Eric Bapteste and Eugene Koonin.

  8. Fixed differences in the paralytic gene define two lineages within the Lutzomyia longipalpis complex producing different types of courtship songs.

    Directory of Open Access Journals (Sweden)

    Rachel M M A Lins

    Full Text Available The sand fly Lutzomyia longipalpis (Diptera: Psychodidae: Phlebotominae, the most important vector of American visceral leishmaniasis, is widely distributed in Latin America. There is currently a consensus that it represents a species complex, however, the number and distribution of the different siblings is still uncertain. Previous analyses have indicated that Brazilian populations of this vector can be divided into two main groups according to the type of courtship song (Burst vs. Pulse males produce during copulation. Nevertheless, no diagnostic differences have been observed between these two groups with most molecular markers used to date. We analyzed the molecular divergence in a fragment of the paralytic (para gene, a locus involved in the control of courtship songs in Drosophila, among a number of Lu. longipalpis populations from Brazil producing Burst and Pulse-type songs. Our results revealed a very high level of divergence and fixed differences between populations producing the two types of songs. We also compared Lu. longipalpis with a very closely related species, Lutzomyia cruzi, which produces Burst-type songs. The results indicated a higher number of fixed differences between Lu. cruzi and the Pulse-type populations of Lu. longipalpis than with those producing Burst-type songs. The data confirmed our previous assumptions that the presence of different sibling species of the Lu. longipalpis complex in Brazil can be divided into two main groups, one representing a single species and a second more heterogeneous group that probably represents a number of incipient species. We hypothesize that para might be one of the genes directly involved in the control of the courtship song differences between these two groups or that it is linked to other loci associated with reproductive isolation of the Brazilian species.

  9. NCBI nr-aa BLAST: CBRC-AGAM-01-0038 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-AGAM-01-0038 ref|NP_938793.1| Putative cytochrome C biogenesis protein [Corynebacterium diphtheria...e NCTC 13129] emb|CAE48916.1| Putative cytochrome C biogenesis protein [Corynebacterium diphtheriae] NP_938793.1 1.6 24% ...

  10. NCBI nr-aa BLAST: CBRC-AGAM-07-0027 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-AGAM-07-0027 ref|ZP_00232264.1| conserved hypothetical protein [Listeria monoc...ytogenes str. 4b H7858] gb|EAL07894.1| conserved hypothetical protein [Listeria monocytogenes str. 4b H7858] ZP_00232264.1 1e-07 38% ...

  11. NCBI nr-aa BLAST: CBRC-AGAM-04-0117 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-AGAM-04-0117 ref|YP_761365.1| acyltransferase family protein [Hyphomonas neptun...ium ATCC 15444] gb|ABI76943.1| acyltransferase family protein [Hyphomonas neptunium ATCC 15444] YP_761365.1 1.4 24% ...

  12. NCBI nr-aa BLAST: CBRC-AGAM-07-0038 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-AGAM-07-0038 ref|ZP_01121627.1| hypothetical protein RB2501_11202 [Robiginital...ea biformata HTCC2501] gb|EAR14889.1| hypothetical protein RB2501_11202 [Robiginitalea biformata HTCC2501] ZP_01121627.1 1e-62 41% ...

  13. NCBI nr-aa BLAST: CBRC-AGAM-07-0041 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-AGAM-07-0041 ref|ZP_01120431.1| hypothetical protein RB2501_08655 [Robiginital...ea biformata HTCC2501] gb|EAR16959.1| hypothetical protein RB2501_08655 [Robiginitalea biformata HTCC2501] ZP_01120431.1 4e-31 32% ...

  14. NCBI nr-aa BLAST: CBRC-AGAM-02-0156 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-AGAM-02-0156 ref|XP_234385.3| PREDICTED: similar to pecanex homolog [Rattus no...rvegicus] ref|XP_001055794.1| PREDICTED: similar to pecanex homolog [Rattus norvegicus] XP_234385.3 1e-94 39% ...

  15. NCBI nr-aa BLAST: CBRC-AGAM-02-0087 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-AGAM-02-0087 ref|NP_731674.1| Calphotin CG4795-PB, isoform B [Drosophila melan...ogaster] sp|Q02910|CPN_DROME Calphotin gb|AAF54754.1| CG4795-PB, isoform B [Drosophila melanogaster] NP_731674.1 0.006 28% ...

  16. NCBI nr-aa BLAST: CBRC-AGAM-05-0030 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-AGAM-05-0030 ref|NP_731674.1| Calphotin CG4795-PB, isoform B [Drosophila melan...ogaster] sp|Q02910|CPN_DROME Calphotin gb|AAF54754.1| CG4795-PB, isoform B [Drosophila melanogaster] NP_731674.1 5e-08 31% ...

  17. NCBI nr-aa BLAST: CBRC-AGAM-01-0080 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-AGAM-01-0080 ref|ZP_01467057.1| conserved hypothetical protein [Stigmatella au...rantiaca DW4/3-1] gb|EAU62171.1| conserved hypothetical protein [Stigmatella aurantiaca DW4/3-1] ZP_01467057.1 4e-06 30% ...

  18. NCBI nr-aa BLAST: CBRC-AGAM-07-0038 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-AGAM-07-0038 ref|ZP_01688972.1| ABC transporter, permease protein, putative [Microscilla marina... ATCC 23134] gb|EAY29695.1| ABC transporter, permease protein, putative [Microscilla marina ATCC 23134] ZP_01688972.1 4e-61 37% ...

  19. NCBI nr-aa BLAST: CBRC-AGAM-07-0040 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-AGAM-07-0040 ref|ZP_01687956.1| mate efflux family protein [Microscilla marina... ATCC 23134] gb|EAY31163.1| mate efflux family protein [Microscilla marina ATCC 23134] ZP_01687956.1 2e-50 42% ...

  20. NCBI nr-aa BLAST: CBRC-AGAM-07-0034 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-AGAM-07-0034 ref|YP_752172.1| major facilitator superfamily MFS_1 [Shewanella frigidimarina... NCIMB 400] gb|ABI73333.1| major facilitator superfamily MFS_1 [Shewanella frigidimarina NCIMB 400] YP_752172.1 2e-55 45% ...

  1. NCBI nr-aa BLAST: CBRC-AGAM-05-0031 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-AGAM-05-0031 ref|YP_294122.1| hypothetical protein EhV364 [Emiliania huxleyi v...irus 86] emb|CAI65791.1| putative membrane protein [Emiliania huxleyi virus 86] YP_294122.1 8e-16 44% ...

  2. NCBI nr-aa BLAST: CBRC-AGAM-02-0138 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-AGAM-02-0138 ref|ZP_02029487.1| hypothetical protein BIFADO_01945 [Bifidobacterium adolescent...is L2-32] gb|EDN81820.1| hypothetical protein BIFADO_01945 [Bifidobacterium adolescentis L2-32] ZP_02029487.1 3e-07 24% ...

  3. NCBI nr-aa BLAST: CBRC-AGAM-07-0028 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-AGAM-07-0028 ref|YP_001193977.1| hypothetical protein Fjoh_1626 [Flavobacterium john...soniae UW101] gb|ABQ04658.1| hypothetical protein Fjoh_1626 [Flavobacterium johnsoniae UW101] YP_001193977.1 5e-72 44% ...

  4. NCBI nr-aa BLAST: CBRC-AGAM-07-0041 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-AGAM-07-0041 ref|YP_001193736.1| UbiA prenyltransferase [Flavobacterium johnso...niae UW101] gb|ABQ04417.1| UbiA prenyltransferase [Flavobacterium johnsoniae UW101] YP_001193736.1 4e-31 33% ...

  5. NCBI nr-aa BLAST: CBRC-AGAM-07-0045 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-AGAM-07-0045 ref|YP_001192547.1| heavy metal translocating P-type ATPase [Flavobacterium john...soniae UW101] gb|ABQ03228.1| heavy metal translocating P-type ATPase [Flavobacterium johnsoniae UW101] YP_001192547.1 1e-129 62% ...

  6. NCBI nr-aa BLAST: CBRC-AGAM-05-0050 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-AGAM-05-0050 ref|NP_965518.1| hypothetical protein LJ1711 [Lactobacillus johns...onii NCC 533] gb|AAS09484.1| hypothetical protein LJ_1711 [Lactobacillus johnsonii NCC 533] NP_965518.1 3e-35 42% ...

  7. NCBI nr-aa BLAST: CBRC-AGAM-07-0072 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-AGAM-07-0072 ref|YP_129371.1| putative transport ATP-binding protein CydD [Photobacterium profund...um SS9] emb|CAG19569.1| putative transport ATP-binding protein CydD [Photobacterium profundum SS9] YP_129371.1 1e-112 63% ...

  8. NCBI nr-aa BLAST: CBRC-AGAM-07-0016 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-AGAM-07-0016 ref|YP_128354.1| putative multidrug resistance protein [Photobacterium profund...um SS9] emb|CAG18552.1| putative multidrug resistance protein [Photobacterium profundum SS9] YP_128354.1 3e-54 55% ...

  9. NCBI nr-aa BLAST: CBRC-AGAM-07-0004 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-AGAM-07-0004 ref|YP_128755.1| chloride channel protein [Photobacterium profund...um SS9] emb|CAG18953.1| putative chloride channel protein EriC [Photobacterium profundum SS9] YP_128755.1 2e-88 60% ...

  10. NCBI nr-aa BLAST: CBRC-AGAM-07-0016 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-AGAM-07-0016 ref|ZP_01220770.1| putative multidrug resistance protein [Photobacterium profund...um 3TCK] gb|EAS42763.1| putative multidrug resistance protein [Photobacterium profundum 3TCK] ZP_01220770.1 2e-54 55% ...

  11. NCBI nr-aa BLAST: CBRC-AGAM-01-0097 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-AGAM-01-0097 ref|YP_001263414.1| major facilitator superfamily MFS_1 [Sphingomonas... wittichii RW1] gb|ABQ69276.1| major facilitator superfamily MFS_1 [Sphingomonas wittichii RW1] YP_001263414.1 4.6 27% ...

  12. NCBI nr-aa BLAST: CBRC-AGAM-07-0044 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-AGAM-07-0044 ref|ZP_01302230.1| putative manganese transport protein MntH [Sphingomonas... sp. SKA58] gb|EAT10059.1| putative manganese transport protein MntH [Sphingomonas sp. SKA58] ZP_01302230.1 1e-100 52% ...

  13. NCBI nr-aa BLAST: CBRC-AGAM-02-0168 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-AGAM-02-0168 ref|YP_001263414.1| major facilitator superfamily MFS_1 [Sphingomonas... wittichii RW1] gb|ABQ69276.1| major facilitator superfamily MFS_1 [Sphingomonas wittichii RW1] YP_001263414.1 0.77 31% ...

  14. NCBI nr-aa BLAST: CBRC-AGAM-01-0050 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-AGAM-01-0050 ref|XP_001657779.1| D7 protein, putative [Aedes aegypti] gb|EAT41...994.1| D7 protein, putative [Aedes aegypti] gb|ABM68616.1| AAEL006424-PA [Aedes aegypti] XP_001657779.1 7e-19 27% ...

  15. NCBI nr-aa BLAST: CBRC-AGAM-04-0002 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-AGAM-04-0002 ref|XP_001658302.1| sodium/solute symporter [Aedes aegypti] gb|EA...T47697.1| sodium/solute symporter [Aedes aegypti] gb|ABM68585.1| AAEL001198-PA [Aedes aegypti] XP_001658302.1 1e-143 68% ...

  16. NCBI nr-aa BLAST: CBRC-AGAM-01-0100 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-AGAM-01-0100 ref|XP_001653866.1| ultraviolet-sensitive opsin [Aedes aegypti] g...b|ABF18478.1| ultraviolet-sensitive opsin [Aedes aegypti] gb|EAT38511.1| ultraviolet-sensitive opsin [Aedes aegypti] XP_001653866.1 2e-60 37% ...

  17. NCBI nr-aa BLAST: CBRC-AGAM-01-0040 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-AGAM-01-0040 ref|XP_001653866.1| ultraviolet-sensitive opsin [Aedes aegypti] g...b|ABF18478.1| ultraviolet-sensitive opsin [Aedes aegypti] gb|EAT38511.1| ultraviolet-sensitive opsin [Aedes aegypti] XP_001653866.1 1e-178 80% ...

  18. NCBI nr-aa BLAST: CBRC-AGAM-07-0045 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-AGAM-07-0045 ref|ZP_01051647.1| Heavy metal translocating P-type ATPase [Tenac...ibaculum sp. MED152] gb|EAQ41075.1| Heavy metal translocating P-type ATPase [Polaribacter dokdonensis MED152] ZP_01051647.1 1e-132 63% ...

  19. NCBI nr-aa BLAST: CBRC-AGAM-07-0010 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-AGAM-07-0010 ref|ZP_01435324.1| amino acid permease-associated region [Shewanella baltica... OS195] gb|EAU26628.1| amino acid permease-associated region [Shewanella baltica OS195] ZP_01435324.1 1e-127 91% ...

  20. NCBI nr-aa BLAST: CBRC-AGAM-07-0010 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-AGAM-07-0010 ref|YP_001051439.1| amino acid permease-associated region [Shewanella baltica... OS155] gb|ABN62570.1| amino acid permease-associated region [Shewanella baltica OS155] YP_001051439.1 1e-127 91% ...

  1. NCBI nr-aa BLAST: CBRC-AGAM-07-0010 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-AGAM-07-0010 ref|ZP_01842482.1| amino acid permease-associated region [Shewanella baltica... OS223] gb|EDK49834.1| amino acid permease-associated region [Shewanella baltica OS223] ZP_01842482.1 1e-127 91% ...

  2. NCBI nr-aa BLAST: CBRC-AGAM-07-0010 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-AGAM-07-0010 ref|YP_001367293.1| amino acid permease-associated region [Shewanella baltica... OS185] gb|ABS09230.1| amino acid permease-associated region [Shewanella baltica OS185] YP_001367293.1 1e-126 91% ...

  3. NCBI nr-aa BLAST: CBRC-AGAM-07-0007 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-AGAM-07-0007 ref|YP_001099812.1| putative Urea transporter [Herminiimonas arsenico...xydans] emb|CAL61685.1| putative Urea transporter [Herminiimonas arsenicoxydans] YP_001099812.1 4e-36 33% ...

  4. NCBI nr-aa BLAST: CBRC-AGAM-02-0071 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-AGAM-02-0071 ref|NP_001035057.1| pteropsin [Apis mellifera] tpg|DAA05735.1| TP...A_exp: pteropsin [Apis mellifera] tpg|DAA05736.1| TPA_exp: pteropsin [Apis mellifera] NP_001035057.1 3e-73 46% ...

  5. NCBI nr-aa BLAST: CBRC-AGAM-07-0042 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-AGAM-07-0042 ref|ZP_00591264.1| Potassium efflux system protein [Prosthecochlo...ris aestuarii DSM 271] gb|EAN23634.1| Potassium efflux system protein [Prosthecochloris aestuarii DSM 271] ZP_00591264.1 1e-75 46% ...

  6. NCBI nr-aa BLAST: CBRC-AGAM-07-0040 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-AGAM-07-0040 ref|ZP_01882627.1| multidrug resistance protein [Pedobacter sp. B...AL39] gb|EDM38378.1| multidrug resistance protein [Pedobacter sp. BAL39] ZP_01882627.1 3e-50 42% ...

  7. NCBI nr-aa BLAST: CBRC-AGAM-07-0044 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-AGAM-07-0044 ref|ZP_01884120.1| Mn2+/Fe2+ transporter, NRAMP family protein [Pedo...bacter sp. BAL39] gb|EDM36559.1| Mn2+/Fe2+ transporter, NRAMP family protein [Pedobacter sp. BAL39] ZP_01884120.1 1e-119 55% ...

  8. NCBI nr-aa BLAST: CBRC-AGAM-07-0073 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-AGAM-07-0073 ref|ZP_01886744.1| hypothetical protein PBAL39_17149 [Pedobacter ...sp. BAL39] gb|EDM34019.1| hypothetical protein PBAL39_17149 [Pedobacter sp. BAL39] ZP_01886744.1 1e-114 75% ...

  9. NCBI nr-aa BLAST: CBRC-AGAM-01-0070 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-AGAM-01-0070 ref|NP_476722.1| shotgun CG3722-PA [Drosophila melanogaster] sp|Q...24298|CADE_DROME DE-cadherin precursor (Protein shotgun) gb|AAF46659.1| CG3722-PA [Drosophila melanogaster] NP_476722.1 0.0 42% ...

  10. NCBI nr-aa BLAST: CBRC-AGAM-02-0044 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-AGAM-02-0044 ref|ZP_01559561.1| conserved hypothetical protein [Burkholderia a...mbifaria MC40-6] gb|EAV47895.1| conserved hypothetical protein [Burkholderia ambifaria MC40-6] ZP_01559561.1 0.83 27% ...

  11. NCBI nr-aa BLAST: CBRC-AGAM-03-0021 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-AGAM-03-0021 ref|YP_331887.1| Planctomycete extracellular domain protein [Burkholder...ia pseudomallei 1710b] gb|ABA51048.1| Planctomycete extracellular domain protein [Burkholderia pseudomallei 1710b] YP_331887.1 0.005 31% ...

  12. NCBI nr-aa BLAST: CBRC-AGAM-02-0064 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-AGAM-02-0064 ref|YP_335617.1| haemagluttinin family protein [Burkholderia pseu...domallei 1710b] gb|ABA51851.1| haemagluttinin family protein [Burkholderia pseudomallei 1710b] YP_335617.1 0.0 31% ...

  13. NCBI nr-aa BLAST: CBRC-AGAM-04-0021 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-AGAM-04-0021 ref|ZP_01571862.1| 200 kDa antigen p200, putative [Burkholderia m...ultivorans ATCC 17616] gb|EAV64386.1| 200 kDa antigen p200, putative [Burkholderia multivorans ATCC 17616] ZP_01571862.1 0.82 25% ...

  14. NCBI nr-aa BLAST: CBRC-AGAM-01-0052 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-AGAM-01-0052 ref|YP_333983.1| hypothetical protein BURPS1710b_2591 [Burkholder...ia pseudomallei 1710b] gb|ABA48937.1| hypothetical protein BURPS1710b_2591 [Burkholderia pseudomallei 1710b] YP_333983.1 5e-11 27% ...

  15. NCBI nr-aa BLAST: CBRC-AGAM-07-0060 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-AGAM-07-0060 ref|YP_553299.1| Putative diguanylate cyclase (GGDEF domain) [Burkholder...ia xenovorans LB400] gb|ABE33949.1| Putative diguanylate cyclase (GGDEF domain) [Burkholderia xenovorans LB400] YP_553299.1 3e-20 29% ...

  16. NCBI nr-aa BLAST: CBRC-AGAM-01-0094 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-AGAM-01-0094 ref|XP_001650650.1| rab6 gtpase activating protein, gapcena (rabgap...1 protein) [Aedes aegypti] gb|EAT48196.1| rab6 gtpase activating protein, gapcena (rabgap1 protein) [Aedes aegypti] XP_001650650.1 1e-172 69% ...

  17. NCBI nr-aa BLAST: CBRC-AGAM-01-0094 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-AGAM-01-0094 ref|XP_001650651.1| rab6 gtpase activating protein, gapcena (rabgap...1 protein) [Aedes aegypti] gb|EAT48197.1| rab6 gtpase activating protein, gapcena (rabgap1 protein) [Aedes aegypti] XP_001650651.1 1e-172 69% ...

  18. NCBI nr-aa BLAST: CBRC-AGAM-02-0141 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-AGAM-02-0141 ref|ZP_01444683.1| tail fiber protein, putative [Roseovarius sp. ...HTCC2601] gb|EAU45064.1| tail fiber protein, putative [Roseovarius sp. HTCC2601] ZP_01444683.1 0.038 24% ...

  19. NCBI nr-aa BLAST: CBRC-AGAM-05-0028 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-AGAM-05-0028 ref|NP_309677.1| putative tail fiber protein [Escherichia coli O1...57:H7 str. Sakai] dbj|BAB35073.1| putative tail fiber protein [Escherichia coli O157:H7 str. Sakai] NP_309677.1 3e-18 34% ...

  20. NCBI nr-aa BLAST: CBRC-AGAM-01-0088 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-AGAM-01-0088 sp|P82149|NT53_DROME Lethal(2)neighbour of tid protein 2 (NOT53) ...emb|CAA64533.1| Not53 protein [Drosophila melanogaster] emb|CAA71168.1| lethal(2)neighbour of tid [Drosophila melanogaster] P82149 1e-123 61% ...

  1. NCBI nr-aa BLAST: CBRC-AGAM-02-0168 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-AGAM-02-0168 ref|YP_710943.1| Putative ABC transporter integral membrane protein [Frank...ia alni ACN14a] emb|CAJ59337.1| Putative ABC transporter integral membrane protein [Frankia alni ACN14a] YP_710943.1 0.20 26% ...

  2. NCBI nr-aa BLAST: CBRC-AGAM-07-0044 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-AGAM-07-0044 ref|YP_001193285.1| Mn2+/Fe2+ transporter, NRAMP family [Flavobac...terium johnsoniae UW101] gb|ABQ03966.1| Mn2+/Fe2+ transporter, NRAMP family [Flavobacterium johnsoniae UW101] YP_001193285.1 1e-123 62% ...

  3. NCBI nr-aa BLAST: CBRC-AGAM-07-0041 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-AGAM-07-0041 ref|YP_001295245.1| Prenyltransferase family protein [Flavobacter...ium psychrophilum JIP02/86] emb|CAL42427.1| Prenyltransferase family protein [Flavobacterium psychrophilum JIP02/86] YP_001295245.1 4e-31 34% ...

  4. NCBI nr-aa BLAST: CBRC-AGAM-07-0028 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-AGAM-07-0028 ref|YP_001295229.1| hypothetical protein FP0297 [Flavobacterium p...sychrophilum JIP02/86] emb|CAL42411.1| Protein of unknown function [Flavobacterium psychrophilum JIP02/86] YP_001295229.1 4e-70 43% ...

  5. NCBI nr-aa BLAST: CBRC-AGAM-07-0028 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-AGAM-07-0028 ref|ZP_01734073.1| hypothetical protein FBBAL38_06975 [Flavobacte...ria bacterium BAL38] gb|EAZ95423.1| hypothetical protein FBBAL38_06975 [Flavobacteria bacterium BAL38] ZP_01734073.1 5e-72 44% ...

  6. NCBI nr-aa BLAST: CBRC-AGAM-07-0038 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-AGAM-07-0038 ref|ZP_01732766.1| ABC transporter, permease protein, putative [Flavob...acteria bacterium BAL38] gb|EAZ95835.1| ABC transporter, permease protein, putative [Flavobacteria bacterium BAL38] ZP_01732766.1 9e-60 41% ...

  7. NCBI nr-aa BLAST: CBRC-AGAM-07-0035 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-AGAM-07-0035 ref|YP_001296724.1| Protein of unknown function YfkH [Flavobacter...ium psychrophilum JIP02/86] emb|CAL43921.1| Protein of unknown function YfkH [Flavobacterium psychrophilum JIP02/86] YP_001296724.1 3e-31 32% ...

  8. NCBI nr-aa BLAST: CBRC-AGAM-07-0028 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-AGAM-07-0028 ref|ZP_01105157.1| hypothetical protein FB2170_03125 [Flavobacter...iales bacterium HTCC2170] gb|EAR02242.1| hypothetical protein FB2170_03125 [Flavobacteriales bacterium HTCC2170] ZP_01105157.1 1e-68 43% ...

  9. NCBI nr-aa BLAST: CBRC-AGAM-07-0035 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-AGAM-07-0035 ref|ZP_01732843.1| hypothetical protein FBBAL38_00795 [Flavobacte...ria bacterium BAL38] gb|EAZ95912.1| hypothetical protein FBBAL38_00795 [Flavobacteria bacterium BAL38] ZP_01732843.1 7e-31 30% ...

  10. NCBI nr-aa BLAST: CBRC-AGAM-07-0034 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-AGAM-07-0034 ref|YP_001193612.1| major facilitator superfamily MFS_1 [Flavobac...terium johnsoniae UW101] gb|ABQ04293.1| major facilitator superfamily MFS_1 [Flavobacterium johnsoniae UW101] YP_001193612.1 3e-63 49% ...

  11. NCBI nr-aa BLAST: CBRC-AGAM-07-0007 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-AGAM-07-0007 ref|YP_001197147.1| Urea transporter [Flavobacterium johnsoniae U...W101] gb|ABQ07828.1| Urea transporter [Flavobacterium johnsoniae UW101] YP_001197147.1 4e-69 48% ...

  12. NCBI nr-aa BLAST: CBRC-AGAM-07-0045 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-AGAM-07-0045 ref|YP_001195410.1| heavy metal translocating P-type ATPase [Flavob...acterium johnsoniae UW101] gb|ABQ06091.1| heavy metal translocating P-type ATPase [Flavobacterium johnsoniae UW101] YP_001195410.1 1e-129 64% ...

  13. NCBI nr-aa BLAST: CBRC-AGAM-07-0043 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-AGAM-07-0043 ref|YP_001297326.1| hypothetical protein FP2472 [Flavobacterium p...sychrophilum JIP02/86] emb|CAL44525.1| Hypothetical protein [Flavobacterium psychrophilum JIP02/86] YP_001297326.1 2e-06 24% ...

  14. NCBI nr-aa BLAST: CBRC-AGAM-07-0073 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-AGAM-07-0073 ref|YP_001195652.1| protein of unknown function DUF81 [Flavobacte...rium johnsoniae UW101] gb|ABQ06333.1| protein of unknown function DUF81 [Flavobacterium johnsoniae UW101] YP_001195652.1 4e-97 65% ...

  15. NCBI nr-aa BLAST: CBRC-AGAM-07-0040 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-AGAM-07-0040 ref|YP_001197343.1| MATE efflux family protein [Flavobacterium jo...hnsoniae UW101] gb|ABQ08024.1| MATE efflux family protein [Flavobacterium johnsoniae UW101] YP_001197343.1 6e-52 43% ...

  16. NCBI nr-aa BLAST: CBRC-AGAM-07-0040 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-AGAM-07-0040 ref|ZP_01732967.1| multidrug resistance protein [Flavobacteria ba...cterium BAL38] gb|EAZ96036.1| multidrug resistance protein [Flavobacteria bacterium BAL38] ZP_01732967.1 9e-51 38% ...

  17. NCBI nr-aa BLAST: CBRC-AGAM-07-0040 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-AGAM-07-0040 ref|ZP_01203383.1| multidrug efflux pump, matE family [Flavobacte...ria bacterium BBFL7] gb|EAS18538.1| multidrug efflux pump, matE family [Flavobacteria bacterium BBFL7] ZP_01203383.1 3e-50 43% ...

  18. NCBI nr-aa BLAST: CBRC-AGAM-07-0041 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-AGAM-07-0041 ref|ZP_01107412.1| hypothetical protein FB2170_08224 [Flavobacter...iales bacterium HTCC2170] gb|EAR00476.1| hypothetical protein FB2170_08224 [Flavobacteriales bacterium HTCC2170] ZP_01107412.1 2e-32 36% ...

  19. NCBI nr-aa BLAST: CBRC-AGAM-04-0109 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-AGAM-04-0109 ref|YP_001430593.1| Adenylosuccinate synthase [Roseiflexus castenholz...ii DSM 13941] gb|ABU56575.1| Adenylosuccinate synthase [Roseiflexus castenholzii DSM 13941] YP_001430593.1 4.6 27% ...

  20. NCBI nr-aa BLAST: CBRC-AGAM-01-0097 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-AGAM-01-0097 ref|YP_001433581.1| protein of unknown function DUF296 [Roseiflexus castenholz...ii DSM 13941] gb|ABU59563.1| protein of unknown function DUF296 [Roseiflexus castenholzii DSM 13941] YP_001433581.1 0.11 35% ...

  1. NCBI nr-aa BLAST: CBRC-AGAM-05-0046 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-AGAM-05-0046 ref|YP_001348737.1| probable MFS transporter [Pseudomonas aerugino...sa PA7] gb|ABR81205.1| probable MFS transporter [Pseudomonas aeruginosa PA7] YP_001348737.1 1.6 29% ...

  2. NCBI nr-aa BLAST: CBRC-AGAM-07-0056 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-AGAM-07-0056 ref|YP_001345790.1| polyamine transport protein PotI [Pseudomonas aerugino...sa PA7] gb|ABR82934.1| polyamine transport protein PotI [Pseudomonas aeruginosa PA7] YP_001345790.1 1e-127 83% ...

  3. NCBI nr-aa BLAST: CBRC-AGAM-01-0071 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-AGAM-01-0071 ref|NP_476722.1| shotgun CG3722-PA [Drosophila melanogaster] sp|Q...24298|CADE_DROME DE-cadherin precursor (Protein shotgun) gb|AAF46659.1| CG3722-PA [Drosophila melanogaster] NP_476722.1 0.0 40% ...

  4. NCBI nr-aa BLAST: CBRC-AGAM-04-0107 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-AGAM-04-0107 ref|YP_001112131.1| protein of unknown function UPF0118 [Desulfotomaculum reduce...ns MI-1] gb|ABO49306.1| protein of unknown function UPF0118 [Desulfotomaculum reducens MI-1] YP_001112131.1 1.8 23% ...

  5. NCBI nr-aa BLAST: CBRC-AGAM-01-0085 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-AGAM-01-0085 ref|XP_626647.1| hypothetical protein with signal peptide [Cryptosporidium parvum... Iowa II] gb|EAK89294.1| hypothetical protein with signal peptide [Cryptosporidium parvum Iowa II] XP_626647.1 4e-05 38% ...

  6. NCBI nr-aa BLAST: CBRC-AGAM-02-0138 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-AGAM-02-0138 ref|XP_001645325.1| hypothetical protein Kpol_1058p4 [Vanderwalto...zyma polyspora DSM 70294] gb|EDO17467.1| hypothetical protein Kpol_1058p4 [Vanderwaltozyma polyspora DSM 70294] XP_001645325.1 9e-06 24% ...

  7. NCBI nr-aa BLAST: CBRC-AGAM-07-0008 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-AGAM-07-0008 ref|XP_001645325.1| hypothetical protein Kpol_1058p4 [Vanderwalto...zyma polyspora DSM 70294] gb|EDO17467.1| hypothetical protein Kpol_1058p4 [Vanderwaltozyma polyspora DSM 70294] XP_001645325.1 0.0 46% ...

  8. NCBI nr-aa BLAST: CBRC-AGAM-03-0043 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-AGAM-03-0043 ref|XP_001642520.1| hypothetical protein Kpol_325p1 [Vanderwaltoz...yma polyspora DSM 70294] gb|EDO14662.1| hypothetical protein Kpol_325p1 [Vanderwaltozyma polyspora DSM 70294] XP_001642520.1 1.3 25% ...

  9. NCBI nr-aa BLAST: CBRC-AGAM-03-0087 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-AGAM-03-0087 ref|XP_001643844.1| hypothetical protein Kpol_499p14 [Vanderwalto...zyma polyspora DSM 70294] gb|EDO15986.1| hypothetical protein Kpol_499p14 [Vanderwaltozyma polyspora DSM 70294] XP_001643844.1 4e-20 23% ...

  10. NCBI nr-aa BLAST: CBRC-AGAM-07-0045 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-AGAM-07-0045 ref|ZP_01061096.1| copper/silver efflux P-type ATPase [Flavobacte...rium sp. MED217] gb|EAQ49147.1| copper/silver efflux P-type ATPase [Leeuwenhoekiella blandensis MED217] ZP_01061096.1 1e-128 60% ...

  11. NCBI nr-aa BLAST: CBRC-AGAM-07-0041 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-AGAM-07-0041 ref|YP_863633.1| prenyltransferase family protein [Gramella forse...tii KT0803] emb|CAL68566.1| prenyltransferase family protein [Gramella forsetii KT0803] YP_863633.1 8e-30 31% ...

  12. NCBI nr-aa BLAST: CBRC-AGAM-07-0045 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-AGAM-07-0045 ref|YP_862949.1| copper-translocating P-type ATPase [Gramella for...setii KT0803] emb|CAL67882.1| copper-translocating P-type ATPase [Gramella forsetii KT0803] YP_862949.1 1e-135 66% ...

  13. NCBI nr-aa BLAST: CBRC-AGAM-07-0040 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-AGAM-07-0040 ref|YP_860564.1| NorM-like multidrug efflux protein [Gramella for...setii KT0803] emb|CAL65497.1| NorM-like multidrug efflux protein [Gramella forsetii KT0803] YP_860564.1 3e-53 43% ...

  14. NCBI nr-aa BLAST: CBRC-AGAM-07-0028 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-AGAM-07-0028 ref|YP_956869.1| conserved hypothetical protein, membrane [Gramel...la forsetii KT0803] emb|CAL65134.1| conserved hypothetical protein, membrane [Gramella forsetii KT0803] YP_956869.1 3e-65 41% ...

  15. NCBI nr-aa BLAST: CBRC-AGAM-07-0045 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-AGAM-07-0045 ref|YP_861225.1| copper-translocating P-type ATPase [Gramella for...setii KT0803] emb|CAL66158.1| copper-translocating P-type ATPase [Gramella forsetii KT0803] YP_861225.1 1e-132 64% ...

  16. NCBI nr-aa BLAST: CBRC-AGAM-07-0045 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-AGAM-07-0045 ref|YP_861383.1| copper-translocating P-type ATPase [Gramella for...setii KT0803] emb|CAL66316.1| copper-translocating P-type ATPase [Gramella forsetii KT0803] YP_861383.1 1e-129 62% ...

  17. NCBI nr-aa BLAST: CBRC-AGAM-03-0026 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-AGAM-03-0026 ref|XP_001659082.1| substance P receptor (long form), putative [A...edes aegypti] gb|EAT39962.1| substance P receptor (long form), putative [Aedes aegypti] XP_001659082.1 6e-92 51% ...

  18. NCBI nr-aa BLAST: CBRC-AGAM-03-0077 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-AGAM-03-0077 ref|XP_001659082.1| substance P receptor (long form), putative [A...edes aegypti] gb|EAT39962.1| substance P receptor (long form), putative [Aedes aegypti] XP_001659082.1 1e-141 74% ...

  19. NCBI nr-aa BLAST: CBRC-AGAM-07-0002 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-AGAM-07-0002 ref|YP_050752.1| hypothetical protein ECA2661 [Erwinia carotovora subsp. atroseptic...a SCRI1043] emb|CAG75561.1| putative membrane protein [Erwinia carotovora subsp. atroseptica SCRI1043] YP_050752.1 2e-66 53% ...

  20. NCBI nr-aa BLAST: CBRC-AGAM-07-0060 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-AGAM-07-0060 ref|YP_521030.1| hypothetical protein DSY4797 [Desulfitobacterium... hafniense Y51] dbj|BAE86586.1| hypothetical protein [Desulfitobacterium hafniense Y51] YP_521030.1 1e-19 24% ...

  1. NCBI nr-aa BLAST: CBRC-AGAM-02-0020 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-AGAM-02-0020 ref|NP_822673.1| integral membrane protein [Streptomyces avermitil...is MA-4680] dbj|BAC69208.1| putative integral membrane protein [Streptomyces avermitilis MA-4680] NP_822673.1 2e-04 24% ...

  2. NCBI nr-aa BLAST: CBRC-AGAM-07-0049 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-AGAM-07-0049 ref|ZP_01274777.1| Surface protein from Gram-positive cocci, anch...or region [Lactobacillus reuteri 100-23] gb|EAS88254.1| Surface protein from Gram-positive cocci, anchor region [Lactobacillus reuteri 100-23] ZP_01274777.1 2e-39 52% ...

  3. NCBI nr-aa BLAST: CBRC-AGAM-04-0123 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-AGAM-04-0123 ref|XP_973273.1| PREDICTED: similar to Putative gustatory receptor 21a [Tribolium... castaneum] emb|CAL23143.2| gustatory receptor candidate 10 [Tribolium castaneum] emb|CAL231...72.3| gustatory receptor candidate 39 [Tribolium castaneum] XP_973273.1 1e-135 60% ...

  4. NCBI nr-aa BLAST: CBRC-AGAM-02-0026 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-AGAM-02-0026 ref|NP_001076809.1| adipokinetic hormone receptor [Tribolium cast...aneum] gb|ABE02225.1| adipokinetic hormone receptor [Tribolium castaneum] gb|ABN79650.1| adipokinetic hormone receptor [Tribolium castaneum] NP_001076809.1 5e-71 44% ...

  5. NCBI nr-aa BLAST: CBRC-AGAM-03-0064 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-AGAM-03-0064 ref|XP_974025.1| PREDICTED: similar to CG13788-PB, isoform B [Tribolium... castaneum] emb|CAL23157.2| gustatory receptor candidate 24 [Tribolium castaneum] XP_974025.1 0.002 20% ...

  6. NCBI nr-aa BLAST: CBRC-AGAM-01-0059 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-AGAM-01-0059 ref|XP_968580.1| PREDICTED: hypothetical protein [Tribolium casta...neum] emb|CAL23149.2| gustatory receptor candidate 16 [Tribolium castaneum] XP_968580.1 0.11 22% ...

  7. NCBI nr-aa BLAST: CBRC-AGAM-02-0045 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-AGAM-02-0045 ref|NP_001076796.1| cardioactive peptide receptor 1 [Tribolium ca...staneum] gb|ABN79651.1| cardioactive peptide receptor 1 [Tribolium castaneum] NP_001076796.1 1e-111 66% ...

  8. NCBI nr-aa BLAST: CBRC-AGAM-02-0115 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-AGAM-02-0115 ref|XP_973273.1| PREDICTED: similar to Putative gustatory receptor 21a [Tribolium... castaneum] emb|CAL23143.2| gustatory receptor candidate 10 [Tribolium castaneum] emb|CAL231...72.3| gustatory receptor candidate 39 [Tribolium castaneum] XP_973273.1 9e-83 40% ...

  9. NCBI nr-aa BLAST: CBRC-AGAM-02-0045 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-AGAM-02-0045 ref|NP_001076795.1| cardioactive peptide receptor 2 [Tribolium ca...staneum] gb|ABN79652.1| cardioactive peptide receptor 2 [Tribolium castaneum] NP_001076795.1 1e-113 68% ...

  10. NCBI nr-aa BLAST: CBRC-AGAM-02-0098 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-AGAM-02-0098 ref|NP_001076793.1| ecdysis triggering hormone receptor isoform B [Tribolium... castaneum] gb|ABN79654.1| ecdysis triggering hormone receptor isoform B [Tribolium castaneum] NP_001076793.1 1e-114 62% ...

  11. NCBI nr-aa BLAST: CBRC-AGAM-02-0046 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-AGAM-02-0046 ref|NP_001076796.1| cardioactive peptide receptor 1 [Tribolium ca...staneum] gb|ABN79651.1| cardioactive peptide receptor 1 [Tribolium castaneum] NP_001076796.1 1e-121 68% ...

  12. NCBI nr-aa BLAST: CBRC-AGAM-02-0098 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-AGAM-02-0098 ref|NP_001076792.1| ecdysis triggering hormone receptor isoform A [Tribolium... castaneum] gb|ABN79653.1| ecdysis triggering hormone receptor isoform A [Tribolium castaneum] NP_001076792.1 1e-121 67% ...

  13. NCBI nr-aa BLAST: CBRC-AGAM-02-0128 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-AGAM-02-0128 ref|XP_972629.1| PREDICTED: similar to Probable gustatory receptor 64e [Tribolium... castaneum] emb|CAL23162.2| gustatory receptor candidate 29 [Tribolium castaneum] emb|CAL231...40.2| gustatory receptor candidate 7 [Tribolium castaneum] XP_972629.1 4e-42 29% ...

  14. NCBI nr-aa BLAST: CBRC-AGAM-02-0099 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-AGAM-02-0099 ref|NP_001076793.1| ecdysis triggering hormone receptor isoform B [Tribolium... castaneum] gb|ABN79654.1| ecdysis triggering hormone receptor isoform B [Tribolium castaneum] NP_001076793.1 4e-47 44% ...

  15. NCBI nr-aa BLAST: CBRC-AGAM-02-0065 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-AGAM-02-0065 ref|XP_975520.1| PREDICTED: similar to CG13788-PB, isoform B [Tribolium... castaneum] emb|CAL23188.2| gustatory receptor candidate 55 [Tribolium castaneum] XP_975520.1 9e-17 31% ...

  16. NCBI nr-aa BLAST: CBRC-AGAM-07-0052 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-AGAM-07-0052 ref|XP_972629.1| PREDICTED: similar to Probable gustatory receptor 64e [Tribolium... castaneum] emb|CAL23162.2| gustatory receptor candidate 29 [Tribolium castaneum] emb|CAL231...40.2| gustatory receptor candidate 7 [Tribolium castaneum] XP_972629.1 4e-42 29% ...

  17. NCBI nr-aa BLAST: CBRC-AGAM-04-0044 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-AGAM-04-0044 ref|XP_001549758.1| predicted protein [Botryotinia fuckeliana B05....10] gb|EDN32955.1| predicted protein [Botryotinia fuckeliana B05.10] XP_001549758.1 2e-71 88% ...

  18. NCBI nr-aa BLAST: CBRC-AGAM-04-0090 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-AGAM-04-0090 ref|XP_001549758.1| predicted protein [Botryotinia fuckeliana B05....10] gb|EDN32955.1| predicted protein [Botryotinia fuckeliana B05.10] XP_001549758.1 1e-71 90% ...

  19. NCBI nr-aa BLAST: CBRC-AGAM-05-0023 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-AGAM-05-0023 ref|XP_001551790.1| predicted protein [Botryotinia fuckeliana B05....10] gb|EDN30435.1| predicted protein [Botryotinia fuckeliana B05.10] XP_001551790.1 2e-62 91% ...

  20. NCBI nr-aa BLAST: CBRC-AGAM-01-0000 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-AGAM-01-0000 ref|XP_001549758.1| predicted protein [Botryotinia fuckeliana B05....10] gb|EDN32955.1| predicted protein [Botryotinia fuckeliana B05.10] XP_001549758.1 3e-65 86% ...

  1. NCBI nr-aa BLAST: CBRC-AGAM-01-0031 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-AGAM-01-0031 ref|XP_001549758.1| predicted protein [Botryotinia fuckeliana B05....10] gb|EDN32955.1| predicted protein [Botryotinia fuckeliana B05.10] XP_001549758.1 4e-55 88% ...

  2. NCBI nr-aa BLAST: CBRC-AGAM-04-0046 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-AGAM-04-0046 ref|XP_001551790.1| predicted protein [Botryotinia fuckeliana B05....10] gb|EDN30435.1| predicted protein [Botryotinia fuckeliana B05.10] XP_001551790.1 2e-69 95% ...

  3. NCBI nr-aa BLAST: CBRC-AGAM-05-0052 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-AGAM-05-0052 ref|XP_001551790.1| predicted protein [Botryotinia fuckeliana B05....10] gb|EDN30435.1| predicted protein [Botryotinia fuckeliana B05.10] XP_001551790.1 2e-53 84% ...

  4. NCBI nr-aa BLAST: CBRC-AGAM-03-0052 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-AGAM-03-0052 ref|XP_001551790.1| predicted protein [Botryotinia fuckeliana B05....10] gb|EDN30435.1| predicted protein [Botryotinia fuckeliana B05.10] XP_001551790.1 1e-46 81% ...

  5. NCBI nr-aa BLAST: CBRC-AGAM-05-0020 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-AGAM-05-0020 ref|XP_001551790.1| predicted protein [Botryotinia fuckeliana B05....10] gb|EDN30435.1| predicted protein [Botryotinia fuckeliana B05.10] XP_001551790.1 3e-52 73% ...

  6. NCBI nr-aa BLAST: CBRC-AGAM-04-0127 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-AGAM-04-0127 ref|XP_001549758.1| predicted protein [Botryotinia fuckeliana B05....10] gb|EDN32955.1| predicted protein [Botryotinia fuckeliana B05.10] XP_001549758.1 5e-66 80% ...

  7. NCBI nr-aa BLAST: CBRC-AGAM-03-0000 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-AGAM-03-0000 ref|XP_001549758.1| predicted protein [Botryotinia fuckeliana B05....10] gb|EDN32955.1| predicted protein [Botryotinia fuckeliana B05.10] XP_001549758.1 2e-66 88% ...

  8. NCBI nr-aa BLAST: CBRC-AGAM-04-0046 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-AGAM-04-0046 ref|XP_001549758.1| predicted protein [Botryotinia fuckeliana B05....10] gb|EDN32955.1| predicted protein [Botryotinia fuckeliana B05.10] XP_001549758.1 2e-74 96% ...

  9. NCBI nr-aa BLAST: CBRC-AGAM-05-0049 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-AGAM-05-0049 ref|XP_001551790.1| predicted protein [Botryotinia fuckeliana B05....10] gb|EDN30435.1| predicted protein [Botryotinia fuckeliana B05.10] XP_001551790.1 3e-64 95% ...

  10. NCBI nr-aa BLAST: CBRC-AGAM-04-0035 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-AGAM-04-0035 ref|NP_937902.1| NADH dehydrogenase subunit 5 [Strongyloides stercoral...is] emb|CAD90562.1| NADH dehydrogenase subunit 5 [Strongyloides stercoralis] NP_937902.1 0.009 23% ...

  11. NCBI nr-aa BLAST: CBRC-AGAM-01-0017 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-AGAM-01-0017 ref|XP_001649245.1| UDP-sugar transporter UST74c (fringe connection... protein), putative [Aedes aegypti] gb|EAT33098.1| UDP-sugar transporter UST74c (fringe connection protein), putative [Aedes aegypti] XP_001649245.1 1e-150 80% ...

  12. NCBI nr-aa BLAST: CBRC-AGAM-01-0017 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-AGAM-01-0017 ref|NP_524126.1| fringe connection CG3874-PA [Drosophila melanoga...ster] sp|Q95YI5|US74C_DROME UDP-sugar transporter UST74c (Protein fringe connection) gb|AAF49343.1| CG3874-P

  13. NCBI nr-aa BLAST: CBRC-AGAM-01-0017 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-AGAM-01-0017 ref|XP_001649246.1| UDP-sugar transporter UST74c (fringe connection... protein), putative [Aedes aegypti] gb|EAT33099.1| UDP-sugar transporter UST74c (fringe connection protein), putative [Aedes aegypti] XP_001649246.1 1e-150 80% ...

  14. NCBI nr-aa BLAST: CBRC-AGAM-02-0048 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-AGAM-02-0048 ref|XP_001352669.1| GA20395-PA [Drosophila pseudoobscura] gb|EAL3...0167.1| GA20395-PA [Drosophila pseudoobscura] gb|AAV40852.1| Rh-like protein [Drosophila pseudoobscura] XP_001352669.1 3e-96 67% ...

  15. NCBI nr-aa BLAST: CBRC-AGAM-02-0187 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-AGAM-02-0187 ref|XP_001648623.1| dopamine receptor, invertebrate [Aedes aegypt...i] gb|EAT33346.1| dopamine receptor, invertebrate [Aedes aegypti] XP_001648623.1 1e-112 63% ...

  16. NCBI nr-aa BLAST: CBRC-AGAM-07-0068 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-AGAM-07-0068 ref|YP_574435.1| flavin-containing monooxygenase FMO [Chromohalobacter sale...xigens DSM 3043] gb|ABE59736.1| flavin-containing monooxygenase FMO [Chromohalobacter salexigens DSM 3043] YP_574435.1 7.1 30% ...

  17. NCBI nr-aa BLAST: CBRC-AGAM-02-0155 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-AGAM-02-0155 ref|ZP_00373744.1| SD27140p [Wolbachia endosymbiont of Drosophila... ananassae] gb|EAL58741.1| SD27140p [Wolbachia endosymbiont of Drosophila ananassae] ZP_00373744.1 0.0 39% ...

  18. NCBI nr-aa BLAST: CBRC-AGAM-04-0091 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-AGAM-04-0091 ref|ZP_00373744.1| SD27140p [Wolbachia endosymbiont of Drosophila... ananassae] gb|EAL58741.1| SD27140p [Wolbachia endosymbiont of Drosophila ananassae] ZP_00373744.1 1e-163 38% ...

  19. NCBI nr-aa BLAST: CBRC-AGAM-02-0094 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-AGAM-02-0094 ref|ZP_00373744.1| SD27140p [Wolbachia endosymbiont of Drosophila... ananassae] gb|EAL58741.1| SD27140p [Wolbachia endosymbiont of Drosophila ananassae] ZP_00373744.1 0.0 39% ...

  20. NCBI nr-aa BLAST: CBRC-AGAM-03-0010 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-AGAM-03-0010 ref|ZP_00373744.1| SD27140p [Wolbachia endosymbiont of Drosophila... ananassae] gb|EAL58741.1| SD27140p [Wolbachia endosymbiont of Drosophila ananassae] ZP_00373744.1 0.0 39% ...

  1. NCBI nr-aa BLAST: CBRC-AGAM-04-0093 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-AGAM-04-0093 ref|ZP_00373744.1| SD27140p [Wolbachia endosymbiont of Drosophila... ananassae] gb|EAL58741.1| SD27140p [Wolbachia endosymbiont of Drosophila ananassae] ZP_00373744.1 0.0 40% ...

  2. NCBI nr-aa BLAST: CBRC-AGAM-05-0053 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-AGAM-05-0053 ref|ZP_00373744.1| SD27140p [Wolbachia endosymbiont of Drosophila... ananassae] gb|EAL58741.1| SD27140p [Wolbachia endosymbiont of Drosophila ananassae] ZP_00373744.1 0.0 39% ...

  3. NCBI nr-aa BLAST: CBRC-AGAM-03-0057 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-AGAM-03-0057 ref|ZP_00373744.1| SD27140p [Wolbachia endosymbiont of Drosophila... ananassae] gb|EAL58741.1| SD27140p [Wolbachia endosymbiont of Drosophila ananassae] ZP_00373744.1 0.0 37% ...

  4. NCBI nr-aa BLAST: CBRC-AGAM-03-0087 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-AGAM-03-0087 ref|XP_843162.1| proteophosphoglycan ppg4 [Leishmania major strain Fried...lin] gb|AAZ14280.1| proteophosphoglycan ppg4 [Leishmania major strain Friedlin] XP_843162.1 1e-23 19% ...

  5. NCBI nr-aa BLAST: CBRC-AGAM-04-0082 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-AGAM-04-0082 ref|XP_843163.1| proteophosphoglycan 5 [Leishmania major strain Fried...lin] gb|AAZ14281.1| proteophosphoglycan 5 [Leishmania major strain Friedlin] XP_843163.1 0.0 23% ...

  6. NCBI nr-aa BLAST: CBRC-AGAM-02-0064 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-AGAM-02-0064 ref|XP_843162.1| proteophosphoglycan ppg4 [Leishmania major strain Fried...lin] gb|AAZ14280.1| proteophosphoglycan ppg4 [Leishmania major strain Friedlin] XP_843162.1 0.0 31% ...

  7. NCBI nr-aa BLAST: CBRC-AGAM-03-0087 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-AGAM-03-0087 ref|XP_843163.1| proteophosphoglycan 5 [Leishmania major strain Fried...lin] gb|AAZ14281.1| proteophosphoglycan 5 [Leishmania major strain Friedlin] XP_843163.1 5e-23 19% ...

  8. NCBI nr-aa BLAST: CBRC-AGAM-03-0081 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-AGAM-03-0081 ref|XP_843162.1| proteophosphoglycan ppg4 [Leishmania major strain Fried...lin] gb|AAZ14280.1| proteophosphoglycan ppg4 [Leishmania major strain Friedlin] XP_843162.1 3e-14 27% ...

  9. NCBI nr-aa BLAST: CBRC-AGAM-03-0073 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-AGAM-03-0073 ref|XP_843162.1| proteophosphoglycan ppg4 [Leishmania major strain Fried...lin] gb|AAZ14280.1| proteophosphoglycan ppg4 [Leishmania major strain Friedlin] XP_843162.1 2e-13 29% ...

  10. NCBI nr-aa BLAST: CBRC-AGAM-02-0021 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-AGAM-02-0021 ref|XP_843163.1| proteophosphoglycan 5 [Leishmania major strain Fried...lin] gb|AAZ14281.1| proteophosphoglycan 5 [Leishmania major strain Friedlin] XP_843163.1 4e-26 26% ...

  11. NCBI nr-aa BLAST: CBRC-AGAM-01-0072 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-AGAM-01-0072 ref|YP_001034807.1| Platelet-binding glycoprotein [Streptococcus ...sanguinis SK36] gb|ABN44257.1| Platelet-binding glycoprotein [Streptococcus sanguinis SK36] YP_001034807.1 4e-59 30% ...

  12. NCBI nr-aa BLAST: CBRC-AGAM-07-0027 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-AGAM-07-0027 ref|YP_001034807.1| Platelet-binding glycoprotein [Streptococcus ...sanguinis SK36] gb|ABN44257.1| Platelet-binding glycoprotein [Streptococcus sanguinis SK36] YP_001034807.1 0.001 26% ...

  13. NCBI nr-aa BLAST: CBRC-AGAM-02-0102 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-AGAM-02-0102 ref|YP_001034807.1| Platelet-binding glycoprotein [Streptococcus ...sanguinis SK36] gb|ABN44257.1| Platelet-binding glycoprotein [Streptococcus sanguinis SK36] YP_001034807.1 1e-11 24% ...

  14. NCBI nr-aa BLAST: CBRC-AGAM-07-0063 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-AGAM-07-0063 ref|YP_001034807.1| Platelet-binding glycoprotein [Streptococcus ...sanguinis SK36] gb|ABN44257.1| Platelet-binding glycoprotein [Streptococcus sanguinis SK36] YP_001034807.1 2e-30 23% ...

  15. NCBI nr-aa BLAST: CBRC-AGAM-01-0035 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-AGAM-01-0035 ref|XP_001589660.1| predicted protein [Sclerotinia sclerotiorum 1...980] gb|EDN93515.1| predicted protein [Sclerotinia sclerotiorum 1980] XP_001589660.1 1e-42 90% ...

  16. NCBI nr-aa BLAST: CBRC-AGAM-03-0035 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-AGAM-03-0035 ref|ZP_02007270.1| protein of unknown function DUF6, transmembrane [Ralstonia pick...ettii 12D] gb|EDN41481.1| protein of unknown function DUF6, transmembrane [Ralstonia pickettii 12D] ZP_02007270.1 0.063 23% ...

  17. NCBI nr-aa BLAST: CBRC-AGAM-04-0130 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-AGAM-04-0130 ref|NP_001040188.1| KDEL endoplasmic reticulum protein retention ...receptor 2a [Bombyx mori] gb|ABD36213.1| KDEL endoplasmic reticulum protein retention receptor 2a [Bombyx mori] NP_001040188.1 3e-45 47% ...

  18. NCBI nr-aa BLAST: CBRC-AGAM-03-0074 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-AGAM-03-0074 ref|XP_567974.1| hypothetical protein [Cryptococcus neoformans va...r. neoformans JEC21] gb|AAW46457.1| conserved hypothetical protein [Cryptococcus neoformans var. neoformans JEC21] XP_567974.1 5e-09 58% ...

  19. NCBI nr-aa BLAST: CBRC-AGAM-01-0036 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-AGAM-01-0036 ref|NP_524202.1| crocodile CG5069-PA [Drosophila melanogaster] sp...|P32027|CROC_DROME Fork head domain-containing protein crocodile (FKH protein FD1) gb|AAB35643.1| crocodile

  20. NCBI nr-aa BLAST: CBRC-AGAM-05-0002 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-AGAM-05-0002 ref|YP_001477392.1| sugar transporter [Serratia proteamaculans 56...8] gb|ABV40264.1| sugar transporter [Serratia proteamaculans 568] YP_001477392.1 1e-08 25% ...

  1. NCBI nr-aa BLAST: CBRC-AGAM-02-0069 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-AGAM-02-0069 ref|XP_001652791.1| GDP-fucose transporter, putative [Aedes aegyp...ti] gb|EAT40804.1| GDP-fucose transporter, putative [Aedes aegypti] XP_001652791.1 1e-129 83% ...

  2. NCBI nr-aa BLAST: CBRC-AGAM-07-0062 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available ngiectasia and Rad3-related protein) [Rattus norvegicus] XP_001068985.1 0.0 33% ... ...CBRC-AGAM-07-0062 ref|XP_001068985.1| PREDICTED: similar to Serine/threonine-protein kinase ATR (Ataxia tela

  3. NCBI nr-aa BLAST: CBRC-AGAM-07-0022 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-AGAM-07-0022 ref|YP_858652.1| O-antigen polymerase [Aeromonas hydrophila subsp. hydrop...hila ATCC 7966] gb|ABK39666.1| O-antigen polymerase [Aeromonas hydrophila subsp. hydrophila ATCC 7966] YP_858652.1 1e-162 84% ...

  4. NCBI nr-aa BLAST: CBRC-AGAM-02-0131 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-AGAM-02-0131 ref|ZP_01909055.1| hypothetical protein PPSIR1_23714 [Plesiocystis pacific...a SIR-1] gb|EDM78078.1| hypothetical protein PPSIR1_23714 [Plesiocystis pacifica SIR-1] ZP_01909055.1 3e-06 34% ...

  5. NCBI nr-aa BLAST: CBRC-AGAM-01-0038 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-AGAM-01-0038 ref|ZP_01905410.1| hypothetical protein PPSIR1_21714 [Plesiocystis pacific...a SIR-1] gb|EDM81578.1| hypothetical protein PPSIR1_21714 [Plesiocystis pacifica SIR-1] ZP_01905410.1 1.2 40% ...

  6. NCBI nr-aa BLAST: CBRC-AGAM-03-0072 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-AGAM-03-0072 ref|ZP_01909055.1| hypothetical protein PPSIR1_23714 [Plesiocystis pacific...a SIR-1] gb|EDM78078.1| hypothetical protein PPSIR1_23714 [Plesiocystis pacifica SIR-1] ZP_01909055.1 5e-05 36% ...

  7. NCBI nr-aa BLAST: CBRC-AGAM-01-0054 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-AGAM-01-0054 ref|ZP_01909055.1| hypothetical protein PPSIR1_23714 [Plesiocystis pacific...a SIR-1] gb|EDM78078.1| hypothetical protein PPSIR1_23714 [Plesiocystis pacifica SIR-1] ZP_01909055.1 0.006 30% ...

  8. NCBI nr-aa BLAST: CBRC-AGAM-02-0119 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-AGAM-02-0119 ref|ZP_00982898.1| COG0477: Permeases of the major facilitator su...perfamily [Burkholderia dolosa AUO158] gb|EAY72007.1| Major facilitator superfamily (MFS_1) transporter [Burkholderia dolosa AUO158] ZP_00982898.1 0.36 24% ...

  9. NCBI nr-aa BLAST: CBRC-AGAM-04-0024 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-AGAM-04-0024 ref|NP_001089174.1| putative transient receptor potential channel... [Xenopus laevis] emb|CAE09056.1| putative transient receptor potential channel [Xenopus laevis] NP_001089174.1 1e-158 42% ...

  10. NCBI nr-aa BLAST: CBRC-AGAM-03-0028 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-AGAM-03-0028 ref|XP_001652261.1| transient receptor potential cation channel p...rotein painless [Aedes aegypti] gb|EAT41530.1| transient receptor potential cation channel protein painless [Aedes aegypti] XP_001652261.1 1e-102 38% ...

  11. NCBI nr-aa BLAST: CBRC-AGAM-03-0028 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-AGAM-03-0028 ref|XP_001652262.1| transient receptor potential cation channel p...rotein painless [Aedes aegypti] gb|EAT41531.1| transient receptor potential cation channel protein painless [Aedes aegypti] XP_001652262.1 1e-102 38% ...

  12. NCBI nr-aa BLAST: CBRC-AGAM-07-0029 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-AGAM-07-0029 ref|ZP_01423834.1| Lanthionine synthetase C-like [Herpetosiphon aura...ntiacus ATCC 23779] gb|EAU19386.1| Lanthionine synthetase C-like [Herpetosiphon aurantiacus ATCC 23779] ZP_01423834.1 2e-20 25% ...

  13. NCBI nr-aa BLAST: CBRC-AGAM-04-0112 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-AGAM-04-0112 ref|ZP_01465266.1| hypothetical protein STIAU_3860 [Stigmatella aura...ntiaca DW4/3-1] gb|EAU63984.1| hypothetical protein STIAU_3860 [Stigmatella aurantiaca DW4/3-1] ZP_01465266.1 8.6 33% ...

  14. NCBI nr-aa BLAST: CBRC-AGAM-07-0061 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-AGAM-07-0061 ref|YP_443145.1| fosmidomycin resistance protein [Burkholderia thailand...ensis E264] gb|ABC36646.1| fosmidomycin resistance protein [Burkholderia thailandensis E264] YP_443145.1 1e-117 64% ...

  15. NCBI nr-aa BLAST: CBRC-AGAM-03-0035 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-AGAM-03-0035 ref|YP_441277.1| hypothetical protein BTH_I0721 [Burkholderia thailand...ensis E264] gb|ABC36322.1| membrane protein, putative [Burkholderia thailandensis E264] YP_441277.1 0.063 24% ...

  16. NCBI nr-aa BLAST: CBRC-AGAM-02-0012 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-AGAM-02-0012 ref|YP_304864.1| hypothetical protein Mbar_A1321 [Methanosarcina barker...i str. Fusaro] gb|AAZ70284.1| hypothetical protein Mbar_A1321 [Methanosarcina barkeri str. Fusaro] YP_304864.1 0.39 34% ...

  17. NCBI nr-aa BLAST: CBRC-AGAM-04-0028 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-AGAM-04-0028 ref|YP_305972.1| hypothetical protein Mbar_A2479 [Methanosarcina barker...i str. Fusaro] gb|AAZ71392.1| hypothetical protein Mbar_A2479 [Methanosarcina barkeri str. Fusaro] YP_305972.1 9e-19 35% ...

  18. NCBI nr-aa BLAST: CBRC-AGAM-02-0057 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-AGAM-02-0057 ref|XP_001526785.1| conserved hypothetical protein [Lodderomyces ...elongisporus NRRL YB-4239] gb|EDK43435.1| conserved hypothetical protein [Lodderomyces elongisporus NRRL YB-4239] XP_001526785.1 5e-07 29% ...

  19. NCBI nr-aa BLAST: CBRC-AGAM-05-0006 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-AGAM-05-0006 ref|XP_001647749.1| neuropeptide y receptor (npy-r) (pr4 receptor...) [Aedes aegypti] gb|EAT32417.1| neuropeptide y receptor (npy-r) (pr4 receptor) [Aedes aegypti] XP_001647749.1 1e-87 55% ...

  20. NCBI nr-aa BLAST: CBRC-AGAM-05-0017 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-AGAM-05-0017 ref|XP_001653188.1| neuropeptide y receptor (npy-r) (pr4 receptor...) [Aedes aegypti] gb|EAT39936.1| neuropeptide y receptor (npy-r) (pr4 receptor) [Aedes aegypti] XP_001653188.1 2e-73 55% ...

  1. NCBI nr-aa BLAST: CBRC-AGAM-05-0017 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-AGAM-05-0017 ref|XP_001647749.1| neuropeptide y receptor (npy-r) (pr4 receptor...) [Aedes aegypti] gb|EAT32417.1| neuropeptide y receptor (npy-r) (pr4 receptor) [Aedes aegypti] XP_001647749.1 1e-64 59% ...

  2. NCBI nr-aa BLAST: CBRC-AGAM-05-0006 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-AGAM-05-0006 ref|XP_001653188.1| neuropeptide y receptor (npy-r) (pr4 receptor...) [Aedes aegypti] gb|EAT39936.1| neuropeptide y receptor (npy-r) (pr4 receptor) [Aedes aegypti] XP_001653188.1 7e-99 54% ...

  3. NCBI nr-aa BLAST: CBRC-AGAM-07-0020 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-AGAM-07-0020 ref|YP_001478696.1| major facilitator superfamily MFS_1 [Serratia proteam...aculans 568] gb|ABV41568.1| major facilitator superfamily MFS_1 [Serratia proteamaculans 568] YP_001478696.1 1e-164 82% ...

  4. NCBI nr-aa BLAST: CBRC-AGAM-07-0002 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-AGAM-07-0002 ref|YP_001477899.1| protein of unknown function DUF340 membrane [Serratia proteam...aculans 568] gb|ABV40771.1| protein of unknown function DUF340 membrane [Serratia proteamaculans 568] YP_001477899.1 4e-67 53% ...

  5. NCBI nr-aa BLAST: CBRC-AGAM-05-0028 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-AGAM-05-0028 ref|YP_719270.1| possible large adhesin [Haemophilus somnus 129PT...] gb|ABI25333.1| conserved hypothetical protein [Haemophilus somnus 129PT] YP_719270.1 1e-27 34% ...

  6. NCBI nr-aa BLAST: CBRC-AGAM-07-0022 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-AGAM-07-0022 ref|ZP_01789747.1| hypothetical protein CGSHiAA_08330 [Haemophilus... influenzae PittAA] gb|EDK08473.1| hypothetical protein CGSHiAA_08330 [Haemophilus influenzae PittAA] ZP_01789747.1 2e-14 23% ...

  7. NCBI nr-aa BLAST: CBRC-AGAM-02-0057 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-AGAM-02-0057 ref|YP_687145.1| hypothetical protein RRC34 [uncultured methanogenic... archaeon RC-I] emb|CAJ37819.1| hypothetical protein [uncultured methanogenic archaeon RC-I] YP_687145.1 2e-10 33% ...

  8. NCBI nr-aa BLAST: CBRC-AGAM-07-0037 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-AGAM-07-0037 ref|YP_687144.1| hypothetical protein RRC32 [uncultured methanogenic... archaeon RC-I] emb|CAJ37818.1| hypothetical protein [uncultured methanogenic archaeon RC-I] YP_687144.1 2e-10 30% ...

  9. NCBI nr-aa BLAST: CBRC-AGAM-07-0025 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-AGAM-07-0025 ref|YP_687144.1| hypothetical protein RRC32 [uncultured methanogenic... archaeon RC-I] emb|CAJ37818.1| hypothetical protein [uncultured methanogenic archaeon RC-I] YP_687144.1 2e-31 49% ...

  10. NCBI nr-aa BLAST: CBRC-AGAM-07-0037 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-AGAM-07-0037 ref|YP_687145.1| hypothetical protein RRC34 [uncultured methanogenic... archaeon RC-I] emb|CAJ37819.1| hypothetical protein [uncultured methanogenic archaeon RC-I] YP_687145.1 5e-11 28% ...

  11. NCBI nr-aa BLAST: CBRC-AGAM-02-0102 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-AGAM-02-0102 ref|YP_687144.1| hypothetical protein RRC32 [uncultured methanogenic... archaeon RC-I] emb|CAJ37818.1| hypothetical protein [uncultured methanogenic archaeon RC-I] YP_687144.1 7e-12 27% ...

  12. NCBI nr-aa BLAST: CBRC-AGAM-07-0025 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-AGAM-07-0025 ref|YP_687145.1| hypothetical protein RRC34 [uncultured methanogenic... archaeon RC-I] emb|CAJ37819.1| hypothetical protein [uncultured methanogenic archaeon RC-I] YP_687145.1 7e-31 50% ...

  13. NCBI nr-aa BLAST: CBRC-AGAM-02-0057 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-AGAM-02-0057 ref|YP_687144.1| hypothetical protein RRC32 [uncultured methanogenic... archaeon RC-I] emb|CAJ37818.1| hypothetical protein [uncultured methanogenic archaeon RC-I] YP_687144.1 9e-11 35% ...

  14. NCBI nr-aa BLAST: CBRC-AGAM-07-0034 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-AGAM-07-0034 ref|ZP_01539821.1| major facilitator superfamily MFS_1 [Shewanella woody...i ATCC 51908] gb|EAV37712.1| major facilitator superfamily MFS_1 [Shewanella woodyi ATCC 51908] ZP_01539821.1 3e-60 47% ...

  15. NCBI nr-aa BLAST: CBRC-AGAM-07-0032 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-AGAM-07-0032 ref|ZP_01541738.1| glucose/galactose transporter [Shewanella woody...i ATCC 51908] gb|EAV35787.1| glucose/galactose transporter [Shewanella woodyi ATCC 51908] ZP_01541738.1 5e-28 35% ...

  16. NCBI nr-aa BLAST: CBRC-AGAM-07-0048 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-AGAM-07-0048 ref|YP_001164099.1| potassium efflux system [Yersinia pestis Pest...oides F] gb|ABP41126.1| potassium efflux system [Yersinia pestis Pestoides F] YP_001164099.1 1e-106 53% ...

  17. NCBI nr-aa BLAST: CBRC-AGAM-03-0082 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-AGAM-03-0082 ref|XP_001568166.1| proteophosphoglycan ppg4 [Leishmania brazilie...nsis] emb|CAM43270.1| proteophosphoglycan ppg4 [Leishmania braziliensis] XP_001568166.1 6e-15 33% ...

  18. NCBI nr-aa BLAST: CBRC-AGAM-03-0032 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-AGAM-03-0032 ref|XP_001568167.1| proteophosphoglycan ppg4 [Leishmania brazilie...nsis] emb|CAM43271.1| proteophosphoglycan ppg4 [Leishmania braziliensis] XP_001568167.1 3e-40 29% ...

  19. NCBI nr-aa BLAST: CBRC-AGAM-02-0058 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-AGAM-02-0058 ref|NP_001076809.1| adipokinetic hormone receptor [Tribolium cast...aneum] gb|ABE02225.1| adipokinetic hormone receptor [Tribolium castaneum] gb|ABN79650.1| adipokinetic hormone receptor [Tribolium castaneum] NP_001076809.1 1e-112 60% ...

  20. Plant F-box protein evolution is determined by lineage-specific timing of major gene family expansion waves.

    Directory of Open Access Journals (Sweden)

    Aura Navarro-Quezada

    Full Text Available F-box proteins (FBPs represent one of the largest and fastest evolving gene/protein families in the plant kingdom. The FBP superfamily can be divided in several subfamilies characterized by different C-terminal protein-protein interaction domains that recruit targets for proteasomal degradation. Hence, a clear picture of their phylogeny and molecular evolution is of special interest for the general understanding of evolutionary histories of multi-domain and/or large protein families in plants. In an effort to further understand the molecular evolution of F-box family proteins, we asked whether the largest subfamily in Arabidopsis thaliana, which carries a C-terminal F-box associated domain (FBA proteins shares evolutionary patterns and signatures of selection with other FBPs. To address this question, we applied phylogenetic and molecular evolution analyses in combination with the evaluation of transcriptional profiles. Based on the 2219 FBA proteins we de novo identified in 34 completely sequenced plant genomes, we compared their evolutionary patterns to a previously analyzed large subfamily carrying C-terminal kelch repeats. We found that these two large FBP subfamilies generally tend to evolve by massive waves of duplication, followed by sequence conservation of the F-box domain and sequence diversification of the target recruiting domain. We conclude that the earlier in evolutionary time a major wave of expansion occurred, the more pronounced these selection signatures are. As a consequence, when performing cross species comparisons among FBP subfamilies, significant differences will be observed in the selective signatures of protein-protein interaction domains. Depending on the species, the investigated subfamilies comprise up to 45% of the complete superfamily, indicating that other subfamilies possibly follow similar modes of evolution.

  1. Restricted Infectivity of a Human-Lineage H3N2 Influenza A Virus in Pigs Is Hemagglutinin and Neuraminidase Gene Dependent

    Science.gov (United States)

    Landolt, Gabriele A.; Karasin, Alexander I.; Schutten, Melissa M.; Olsen, Christopher W.

    2006-01-01

    Influenza A viruses cause pandemics at sporadic intervals. Pandemic viruses can potentially be introduced into the human population through in toto transfer of an avian influenza virus or through reassortment between avian and human strains. Pigs are believed to play a central role in the creation of pandemic viruses through reassortment because of their susceptibility to infection with both avian and human influenza viruses. However, we recently found that a human-lineage H3N2 influenza virus was highly restricted in its ability to infect pigs after intranasal inoculation. We hypothesized that this restricted infectivity phenotype was controlled by the hemagglutinin (HA) and neuraminidase (NA). To test this, we infected pigs with reverse genetics-created HA plus NA reassortant viruses. Specifically, introduction of the HA and NA genes of a contemporary H3N2 swine virus into the genetic background of the wholly human virus resulted in a significant increase in virus shedding and pathogenicity. These data indicate that the HA/NA can play important roles in controlling human influenza virus infectivity in pigs. The results further support the premise that a barrier exists to human influenza virus infection in pigs, which may limit the role of pigs in pandemic virus creation through reassortment of human and avian influenza viruses. PMID:16455873

  2. The Revitalization of Women’s Entrepreneurship Spirit In Micro Enterprises With Islamic Microfinance Institution (IMI) (Study on The Contribution of BMTs Agam Madani in Agam sub-province, West Sumatra)

    OpenAIRE

    Hesi Eka Puteri

    2014-01-01

    Objective - The objective of this paper is to give an overview of the contribution of Islamic Microfinance Institutions (IMI) in the process of empowerment of women microenterprises, and recommended a related policy.Method – This study is a field research in 2012, which focused in BMTs Agam Madani at Agam district. The data is sourced from the observation, documentation and questionnaires from 60 women micro-entrepreneurs samples who receive working capital financing. This paper uses simple r...

  3. Phylogenomics of the Zygomycete lineages: Exploring phylogeny and genome evolution

    Science.gov (United States)

    The Zygomycete lineages mark the major transition from zoosporic life histories of the common ancestors of Fungi and the earliest diverging chytrid lineages (Chytridiomycota and Blastocladiomycota). Genome comparisons from these lineages may reveal gene content changes that reflect the transition to...

  4. The F-box-containing protein UFO and AGAMOUS participate in antagonistic pathways governing early petal development in Arabidopsis.

    Science.gov (United States)

    Durfee, Tim; Roe, Judith L; Sessions, R Allen; Inouye, Carla; Serikawa, Kyle; Feldmann, Kenneth A; Weigel, Detlef; Zambryski, Patricia C

    2003-07-01

    The UNUSUAL FLORAL ORGANS (UFO) gene is required for multiple processes in the developing Arabidopsis flower, including the proper patterning and identity of both petals and stamens. The gene encodes an F-box-containing protein, UFO, which interacts physically and genetically with the Skp1 homolog, ASK1. In this report, we describe four ufo alleles characterized by the absence of petals, which uncover another role for UFO in promoting second whorl development. This UFO-dependent pathway is required regardless of the second whorl organ to be formed, arguing that it affects a basic process acting in parallel with those establishing organ identity. However, the pathway is dispensable in the absence of AGAMOUS (AG), a known inhibitor of petal development. In situ hybridization results argue that AG is not transcribed in the petal region, suggesting that it acts non-cell-autonomously to inhibit second whorl development in ufo mutants. These results are combined into a genetic model explaining early second whorl initiation/proliferation, in which UFO functions to inhibit an AG-dependent activity. PMID:12826617

  5. The F-box-containing protein UFO and AGAMOUS participate in antagonistic pathways governing early petal development in Arabidopsis.

    Science.gov (United States)

    Durfee, Tim; Roe, Judith L; Sessions, R Allen; Inouye, Carla; Serikawa, Kyle; Feldmann, Kenneth A; Weigel, Detlef; Zambryski, Patricia C

    2003-07-01

    The UNUSUAL FLORAL ORGANS (UFO) gene is required for multiple processes in the developing Arabidopsis flower, including the proper patterning and identity of both petals and stamens. The gene encodes an F-box-containing protein, UFO, which interacts physically and genetically with the Skp1 homolog, ASK1. In this report, we describe four ufo alleles characterized by the absence of petals, which uncover another role for UFO in promoting second whorl development. This UFO-dependent pathway is required regardless of the second whorl organ to be formed, arguing that it affects a basic process acting in parallel with those establishing organ identity. However, the pathway is dispensable in the absence of AGAMOUS (AG), a known inhibitor of petal development. In situ hybridization results argue that AG is not transcribed in the petal region, suggesting that it acts non-cell-autonomously to inhibit second whorl development in ufo mutants. These results are combined into a genetic model explaining early second whorl initiation/proliferation, in which UFO functions to inhibit an AG-dependent activity.

  6. Sex determining region Y-Box 2 (SOX2 is a potential cell-lineage gene highly expressed in the pathogenesis of squamous cell carcinomas of the lung.

    Directory of Open Access Journals (Sweden)

    Ping Yuan

    Full Text Available BACKGROUND: Non-small cell lung cancer (NSCLC represents the majority (85% of lung cancers and is comprised mainly of adenocarcinomas and squamous cell carcinomas (SCCs. The sequential pathogenesis of lung adenocarcinomas and SCCs occurs through dissimilar phases as the former tumors typically arise in the lung periphery whereas the latter normally arise near the central airway. METHODOLOGY/PRINCIPAL FINDINGS: We assessed the expression of SOX2, an embryonic stem cell transcriptional factor that also plays important roles in the proliferation of basal tracheal cells and whose expression is restricted to the main and central airways and bronchioles of the developing and adult mouse lung, in NSCLC by various methodologies. Here, we found that SOX2 mRNA levels, from various published datasets, were significantly elevated in lung SCCs compared to adenocarcinomas (all p<0.001. Moreover, a previously characterized OCT4/SOX2/NANOG signature effectively separated lung SCCs from adenocarcinomas in two independent publicly available datasets which correlated with increased SOX2 mRNA in SCCs. Immunohistochemical analysis of various histological lung tissue specimens demonstrated marked nuclear SOX2 protein expression in all normal bronchial epithelia, alveolar bronchiolization structures and premalignant lesions in SCC development (hyperplasia, dysplasia and carcinoma in situ and absence of expression in all normal alveoli and atypical adenomatous hyperplasias. Moreover, SOX2 protein expression was greatly higher in lung SCCs compared to adenocarcinomas following analyses in two independent large TMA sets (TMA set I, n = 287; TMA set II, n = 511 both p<0.001. Furthermore, amplification of SOX2 DNA was detected in 20% of lung SCCs tested (n = 40 and in none of the adenocarcinomas (n = 17. CONCLUSIONS/SIGNIFICANCE: Our findings highlight a cell-lineage gene expression pattern for the stem cell transcriptional factor SOX2 in the pathogenesis of lung SCCs and

  7. Lineage diversification of fringe-toed lizards (Phrynosomatidae: Uma notata complex) in the Colorado Desert: Delimiting species in the presence of gene flow

    Science.gov (United States)

    Gottscho, Andrew D.; Wood, Dustin A.; Vandergast, Amy; Lemos Espinal, Julio A.; Gatesy, John; Reeder, Tod

    2017-01-01

    Multi-locus nuclear DNA data were used to delimit species of fringe-toed lizards of theUma notata complex, which are specialized for living in wind-blown sand habitats in the deserts of southwestern North America, and to infer whether Quaternary glacial cycles or Tertiary geological events were important in shaping the historical biogeography of this group. We analyzed ten nuclear loci collected using Sanger sequencing and genome-wide sequence and single-nucleotide polymorphism (SNP) data collected using restriction-associated DNA (RAD) sequencing. A combination of species discovery methods (concatenated phylogenies, parametric and non-parametric clustering algorithms) and species validation approaches (coalescent-based species tree/isolation-with-migration models) were used to delimit species, infer phylogenetic relationships, and to estimate effective population sizes, migration rates, and speciation times. Uma notata, U. inornata, U. cowlesi, and an undescribed species from Mohawk Dunes, Arizona (U. sp.) were supported as distinct in the concatenated analyses and by clustering algorithms, and all operational taxonomic units were decisively supported as distinct species by ranking hierarchical nested speciation models with Bayes factors based on coalescent-based species tree methods. However, significant unidirectional gene flow (2NM >1) from U. cowlesi and U. notata into U. rufopunctata was detected under the isolation-with-migration model. Therefore, we conservatively delimit four species-level lineages within this complex (U. inornata, U. notata, U. cowlesi, and U. sp.), treating U. rufopunctata as a hybrid population (U. notata x cowlesi). Both concatenated and coalescent-based estimates of speciation times support the hypotheses that speciation within the complex occurred during the late Pleistocene, and that the geological evolution of the Colorado River delta during this period was an important process shaping the observed phylogeographic patterns.

  8. NCBI nr-aa BLAST: CBRC-AGAM-02-0178 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-AGAM-02-0178 ref|XP_001651711.1| 5-hydroxytryptamine receptor 1 [Aedes aegypti...] ref|XP_001660238.1| 5-hydroxytryptamine receptor 1 [Aedes aegypti] gb|EAT32550.1| 5-hydroxytryptamine receptor 1 [Aedes aegypt...i] gb|EAT38553.1| 5-hydroxytryptamine receptor 1 [Aedes aegypti] XP_001651711.1 1e-176 74% ...

  9. NCBI nr-aa BLAST: CBRC-AGAM-04-0014 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-AGAM-04-0014 ref|NP_476702.1| rickets CG8930-PA, isoform A [Drosophila melanog...aster] ref|NP_599102.1| rickets CG8930-PB, isoform B [Drosophila melanogaster] ref|NP_599103.1| rickets CG89...30-PC, isoform C [Drosophila melanogaster] ref|NP_599104.1| rickets CG8930-PD, isoform D [Drosophila melanog

  10. NCBI nr-aa BLAST: CBRC-AGAM-02-0079 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-AGAM-02-0079 ref|XP_525054.2| PREDICTED: hedgehog acyltransferase isoform 6 [P...an troglodytes] ref|XP_001169314.1| PREDICTED: hedgehog acyltransferase isoform 3 [Pan troglodytes] ref|XP_0...01169359.1| PREDICTED: hedgehog acyltransferase isoform 4 [Pan troglodytes] ref|XP_001169380.1| PREDICTED: hedgehog acyltransferase isoform 5 [Pan troglodytes] XP_525054.2 4e-33 25% ...

  11. NCBI nr-aa BLAST: CBRC-AGAM-02-0116 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-AGAM-02-0116 ref|YP_081361.1| gluconate permease [Bacillus licheniformis ATCC ...14580] ref|YP_093794.1| GntP [Bacillus licheniformis ATCC 14580] gb|AAU25723.1| gluconate permease [Bacillus lichen...iformis ATCC 14580] gb|AAU43101.1| GntP [Bacillus licheniformis DSM 13] YP_081361.1 1.8 41% ...

  12. NCBI nr-aa BLAST: CBRC-AGAM-01-0038 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-AGAM-01-0038 ref|NP_824326.1| ABC transporter integral membrane protein BldKA [Streptomyces avermitil...is MA-4680] dbj|BAB69357.1| transport integral membrane protein BldKA [Streptomyces avermitil...is] dbj|BAC70861.1| putative peptide ABC transporter permease protein [Streptomyces avermitilis MA-4680] NP_824326.1 0.94 30% ...

  13. NCBI nr-aa BLAST: CBRC-AGAM-04-0130 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-AGAM-04-0130 ref|XP_307101.2| AGAP012756-PA [Anopheles gambiae str. PEST] ref|...XP_319412.2| AGAP010224-PA [Anopheles gambiae str. PEST] gb|EAA13938.2| AGAP010224-PA [Anopheles gambiae str. PEST...] gb|EAA02917.2| AGAP012756-PA [Anopheles gambiae str. PEST] XP_307101.2 3e-47 50% ...

  14. NCBI nr-aa BLAST: CBRC-AGAM-02-0019 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-AGAM-02-0019 ref|NP_725630.1| vegetable CG6657-PA, isoform A [Drosophila melan...ogaster] ref|NP_524685.2| vegetable CG6657-PB, isoform B [Drosophila melanogaster] sp|Q9V7W1|PIGV_DROME GPI ...mannosyltransferase 2 (GPI mannosyltransferase II) (GPI-MT-II) (Protein vegetable) gb|AAF57928.1| CG6657-PA,

  15. NCBI nr-aa BLAST: CBRC-AGAM-04-0111 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-AGAM-04-0111 ref|NP_001029470.1| non imprinted in Prader-Willi/Angelman syndro...me 2 [Bos taurus] sp|Q3SWX0|NIPA2_BOVIN Non-imprinted in Prader-Willi/Angelman syndrome region protein 2 hom...olog gb|AAI04628.1| Non imprinted in Prader-Willi/Angelman syndrome 2 [Bos taurus] NP_001029470.1 2e-72 51% ...

  16. The MADS Domain Protein DIANA Acts Together with AGAMOUS-LIKE80 to Specify the Central Cell in Arabidopsis Ovules[W

    Science.gov (United States)

    Bemer, Marian; Wolters-Arts, Mieke; Grossniklaus, Ueli; Angenent, Gerco C.

    2008-01-01

    MADS box genes in plants consist of MIKC-type and type I genes. While MIKC-type genes have been studied extensively, the functions of type I genes are still poorly understood. Evidence suggests that type I MADS box genes are involved in embryo sac and seed development. We investigated two independent T-DNA insertion alleles of the Arabidopsis thaliana type I MADS box gene AGAMOUS-LIKE61 (AGL61) and showed that in agl61 mutant ovules, the polar nuclei do not fuse and central cell morphology is aberrant. Furthermore, the central cell begins to degenerate before fertilization takes place. Although pollen tubes are attracted and perceived by the mutant ovules, neither endosperm development nor zygote formation occurs. AGL61 is expressed in the central cell during the final stages of embryo sac development. An AGL61:green fluorescent protein–β-glucoronidase fusion protein localizes exclusively to the polar nuclei and the secondary nucleus of the central cell. Yeast two-hybrid analysis showed that AGL61 can form a heterodimer with AGL80 and that the nuclear localization of AGL61 is lost in the agl80 mutant. Thus, AGL61 and AGL80 appear to function together to differentiate the central cell in Arabidopsis. We renamed AGL61 DIANA, after the virginal Roman goddess of the hunt. PMID:18713950

  17. Bazooka mediates secondary axon morphology in Drosophila brain lineages

    Directory of Open Access Journals (Sweden)

    Hartenstein Volker

    2011-04-01

    Full Text Available Abstract In the Drosophila brain, neural lineages project bundled axon tracts into a central neuropile. Each lineage exhibits a stereotypical branching pattern and trajectory, which distinguish it from other lineages. In this study, we used a multilineage approach to explore the neural function of the Par-complex member Par3/Bazooka in vivo. Drosophila bazooka is expressed in post-mitotic neurons of the larval brain and localizes within neurons in a lineage-dependent manner. The fact that multiple GAL4 drivers have been mapped to several lineages of the Drosophila brain enables investigation of the role of Bazooka from larval to adult stages Bazooka loss-of-function (LOF clones had abnormal morphologies, including aberrant pathway choice of ventral projection neurons in the BAla1 lineage, ectopic branching in the DALv2 and BAmv1 lineages, and excess BLD5 lineage axon projections in the optic medulla. Exogenous expression of Bazooka protein in BAla1 neurons rescued defective guidance, supporting an intrinsic requirement for Bazooka in the post-mitotic neuron. Elimination of the Par-complex member Par6 recapitulated Bazooka phenotypes in some but not all lineages, suggesting that the Par complex functions in a lineage-dependent manner, and that Bazooka may act independently in some lineages. Importantly, this study highlights the potential of using a multilineage approach when studying gene function during neural development in Drosophila.

  18. Bazooka mediates secondary axon morphology in Drosophila brain lineages.

    Science.gov (United States)

    Spindler, Shana R; Hartenstein, Volker

    2011-01-01

    In the Drosophila brain, neural lineages project bundled axon tracts into a central neuropile. Each lineage exhibits a stereotypical branching pattern and trajectory, which distinguish it from other lineages. In this study, we used a multilineage approach to explore the neural function of the Par-complex member Par3/Bazooka in vivo. Drosophila bazooka is expressed in post-mitotic neurons of the larval brain and localizes within neurons in a lineage-dependent manner. The fact that multiple GAL4 drivers have been mapped to several lineages of the Drosophila brain enables investigation of the role of Bazooka from larval to adult stages Bazooka loss-of-function (LOF) clones had abnormal morphologies, including aberrant pathway choice of ventral projection neurons in the BAla1 lineage, ectopic branching in the DALv2 and BAmv1 lineages, and excess BLD5 lineage axon projections in the optic medulla. Exogenous expression of Bazooka protein in BAla1 neurons rescued defective guidance, supporting an intrinsic requirement for Bazooka in the post-mitotic neuron. Elimination of the Par-complex member Par6 recapitulated Bazooka phenotypes in some but not all lineages, suggesting that the Par complex functions in a lineage-dependent manner, and that Bazooka may act independently in some lineages. Importantly, this study highlights the potential of using a multilineage approach when studying gene function during neural development in Drosophila. PMID:21524279

  19. NCBI nr-aa BLAST: CBRC-AGAM-07-0070 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-AGAM-07-0070 ref|YP_961710.1| multiple antibiotic resistance (MarC)-related pr...otein [Shewanella sp. W3-18-1] ref|ZP_01705111.1| multiple antibiotic resistance (MarC)-related proteins [Sh...ewanella putrefaciens 200] ref|YP_001181982.1| multiple antibiotic resistance (MarC)-related protein [Shewan...ella putrefaciens CN-32] gb|ABM23156.1| multiple antibiotic resistance (MarC)-rel...ated protein [Shewanella sp. W3-18-1] gb|EAY54633.1| multiple antibiotic resistance (MarC)-related proteins

  20. Multi-petal cyclamen flowers produced by AGAMOUS chimeric repressor expression

    OpenAIRE

    Yuri Tanaka; Yoshimi Oshima; Tomomichi Yamamura; Masao Sugiyama; Nobutaka Mitsuda; Norihiro Ohtsubo; Masaru Ohme-Takagi; Teruhiko Terakawa

    2013-01-01

    Cyclamen persicum (cyclamen) is a commercially valuable, winter-blooming perennial plant. We cloned two cyclamen orthologues of AGAMOUS (AG), CpAG1 and CpAG2, which are mainly expressed in the stamen and carpel, respectively. Cyclamen flowers have 5 petals, but expression of a chimeric repressor of CpAG1 (CpAG1-SRDX) caused stamens to convert into petals, resulting in a flower with 10 petals. By contrast, CpAG2-SRDX only caused incomplete formation of stamens and carpels. Expression in Arabid...

  1. NCBI nr-aa BLAST: CBRC-AGAM-01-0097 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-AGAM-01-0097 ref|ZP_00970175.1| COG2200: FOG: EAL domain [Pseudomonas aerugino...sa C3719] ref|ZP_01364785.1| hypothetical protein PaerPA_01001897 [Pseudomonas aeruginosa PACS2] ref|YP_7918...19.1| hypothetical protein PA14_45930 [Pseudomonas aeruginosa UCBPP-PA14] gb|ABJ10614.1| conserved hypotheti...cal protein [Pseudomonas aeruginosa UCBPP-PA14] gb|EAZ51974.1| conserved hypothetical protein [Pseudomonas aeruginosa C3719] ZP_00970175.1 4.6 37% ...

  2. NCBI nr-aa BLAST: CBRC-AGAM-07-0007 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-AGAM-07-0007 ref|NP_372811.1| similar to urea transporter [Staphylococcus aureus subsp. aureus... Mu50] ref|NP_375400.1| hypothetical protein SA2081 [Staphylococcus aureus subsp. aureus N31...5] ref|YP_001247667.1| Urea transporter [Staphylococcus aureus subsp. aureus JH9] ref|YP_001317466.1| Urea t...ransporter [Staphylococcus aureus subsp. aureus JH1] ref|YP_001442861.1| hypothet...ical protein SAHV_2271 [Staphylococcus aureus subsp. aureus Mu3] dbj|BAB43379.1| SA2081 [Staphylococcus aureus subsp. aureus

  3. Epicardial Lineages and Cardiac Repair

    Directory of Open Access Journals (Sweden)

    Manvendra K. Singh

    2013-08-01

    Full Text Available The death of cardiac myocytes resulting from myocardial infarction is a major cause of heart failure worldwide. Effective therapies for regenerating lost cardiac myocytes are lacking. Recently, the epicardium has been implicated as a source of inflammatory cytokines, growth factors and progenitor cells that modulate the response to myocardial injury. During embryonic development, epicardially-derived cells have the potential to differentiate into multiple cardiac lineages, including fibroblasts, vascular smooth muscle and potentially other cell types. In the healthy adult heart, epicardial cells are thought to be generally quiescent. However, injury of the adult heart results in reactivation of a developmental gene program in the epicardium, which leads to increased epicardial cell proliferation and differentiation of epicardium-derived cells (EPDCs into various cardiac lineages. Recent work suggests that epicardial reactivation after injury is accompanied by, and contributes to, a robust inflammatory response. In this review, we describe the current status of research related to epicardial biology in cardiac development and regeneration, highlighting important recent discoveries and ongoing controversies.

  4. Lineage specific recombination and positive selection in coding and intragenic regions contributed to evolution of the main Listeria monocytogenes virulence gene cluster

    OpenAIRE

    Orsi, Renato H.; Maron, Steven B.; Nightingale, Kendra K.; Jerome, Morganne; Tabor, Helen; Wiedmann, Martin

    2008-01-01

    The major virulence cluster of Listeria monocytogenes harbors six virulence genes that encode proteins critical for the intracellular life cycle of this human and animal pathogen. In this study, we determined the sequence (8,709 nt) of the virulence gene cluster (including the six main virulence genes) in 40 L. monocytogenes isolates from different source populations (human clinical cases, animal clinical cases, foods, and natural environments). An alignment of the full length cluster as well...

  5. Xenopus Pax-2/5/8 orthologues: novel insights into Pax gene evolution and identification of Pax-8 as the earliest marker for otic and pronephric cell lineages.

    Science.gov (United States)

    Heller, N; Brändli, A W

    1999-01-01

    Pax genes are a family of transcription factors playing fundamental roles during organogenesis. We have recently demonstrated the expression of Pax-2 during Xenopus embryogenesis [Heller N, Brändli AW (1997): Mech Dev 69: 83-104]. Here we report the cloning and characterization of Xenopus Pax-5 and Pax-8, two orthologues of the Pax-2/5/8 gene family. Molecular phylogenetic analysis indicates that the amphibian Pax-2/5/8 genes are close relatives of their mammalian counterparts and that all vertebrate Pax-2/5/8 genes are derived from a single ancestral gene. Xenopus Pax-2/5/8 genes are expressed in spatially and temporally overlapping patterns during development of at least seven distinct tissues. Most strikingly, Xenopus Pax-8 was identified as the earliest marker of the prospective otic placode and of the intermediate mesoderm, indicating that Pax-8 may play a central role in auditory and excretory system development. Comparison of the expression patterns of fish, amphibian, and mammalian Pax-2/5/8 genes revealed that the tissue specificity of Pax-2/5/8 gene family expression is overall evolutionarily conserved. The expression domains of individual orthologues can however vary in a species-specific manner. For example, the thyroid glands of mammals express Pax-8, while in Xenopus Pax-2 is expressed instead. Our findings indicate that differential silencing of Pax-2/5/8 gene expression may have occurred after the different classes of vertebrates began to evolve separately. PMID:10322629

  6. Comparative genomic analysis reveals independent expansion of a lineage-specific gene family in vertebrates: The class II cytokine receptors and their ligands in mammals and fish

    Directory of Open Access Journals (Sweden)

    Mogensen Knud

    2003-07-01

    Full Text Available Abstract Background The high degree of sequence conservation between coding regions in fish and mammals can be exploited to identify genes in mammalian genomes by comparison with the sequence of similar genes in fish. Conversely, experimentally characterized mammalian genes may be used to annotate fish genomes. However, gene families that escape this principle include the rapidly diverging cytokines that regulate the immune system, and their receptors. A classic example is the class II helical cytokines (HCII including type I, type II and lambda interferons, IL10 related cytokines (IL10, IL19, IL20, IL22, IL24 and IL26 and their receptors (HCRII. Despite the report of a near complete pufferfish (Takifugu rubripes genome sequence, these genes remain undescribed in fish. Results We have used an original strategy based both on conserved amino acid sequence and gene structure to identify HCII and HCRII in the genome of another pufferfish, Tetraodon nigroviridis that is amenable to laboratory experiments. The 15 genes that were identified are highly divergent and include a single interferon molecule, three IL10 related cytokines and their potential receptors together with two Tissue Factor (TF. Some of these genes form tandem clusters on the Tetraodon genome. Their expression pattern was determined in different tissues. Most importantly, Tetraodon interferon was identified and we show that the recombinant protein can induce antiviral MX gene expression in Tetraodon primary kidney cells. Similar results were obtained in Zebrafish which has 7 MX genes. Conclusion We propose a scheme for the evolution of HCII and their receptors during the radiation of bony vertebrates and suggest that the diversification that played an important role in the fine-tuning of the ancestral mechanism for host defense against infections probably followed different pathways in amniotes and fish.

  7. Adeno-associated virus-mediated bone morphogenetic protein-7 gene transfer induces C2C12 cell differentiation into osteoblast lineage cells

    Institute of Scientific and Technical Information of China (English)

    Min YANG; Qing-jun MA; Geng-ting DANG; Kang-tao MA; Ping CHEN; Chun-yan ZHOU

    2005-01-01

    Aim: To investigate the effects of bone morphogenetic protein-7 (BMP7)-expressing recombinant adeno-associated virus (AAV) vector on the differentiation of C2C12 cells. Methods: AAV-BMP7 was packaged by infecting the stable cell clone BHK-21 (integrated with recombinant AAV vector plasmid pSNAV-BMP7)with recombinant herpes simplex virus type 1, which expresses AAV-2 Rep and Cap and possesses AAV packaging functions. Following infection with AAVBMP7 at multiplicities of infection of 1× 105 vector genomes per cell and subsequent culture, C2C12 cells were assessed qualitatively for BMP7 production, alkaline phosphatase activity, osteocalcin production and Cbfal and MyoD expression.Results: C2C 12 cells transduced with AAV-BMP7 could produce BMP7 protein until d 28. Alkaline phosphatase in the cultured C2C12 cell lysate was elevated.Secreted osteocalcin in the culture medium was detectable at d 12 and Cbfal mRNA expression level was upregulated, coinciding with downregulation of MyoD in a temporal manner. Conclusion: The present in vitro study demonstrated that AAV-BMP7 could infect and efficiently convert C2C12 cells from myoblasts into osteoblast lineage cells.

  8. Sequencing analysis of 20,000 full-length cDNA clones from cassava reveals lineage specific expansions in gene families related to stress response

    Science.gov (United States)

    Sakurai, Tetsuya; Plata, Germán; Rodríguez-Zapata, Fausto; Seki, Motoaki; Salcedo, Andrés; Toyoda, Atsushi; Ishiwata, Atsushi; Tohme, Joe; Sakaki, Yoshiyuki; Shinozaki, Kazuo; Ishitani, Manabu

    2007-01-01

    Background Cassava, an allotetraploid known for its remarkable tolerance to abiotic stresses is an important source of energy for humans and animals and a raw material for many industrial processes. A full-length cDNA library of cassava plants under normal, heat, drought, aluminum and post harvest physiological deterioration conditions was built; 19968 clones were sequence-characterized using expressed sequence tags (ESTs). Results The ESTs were assembled into 6355 contigs and 9026 singletons that were further grouped into 10577 scaffolds; we found 4621 new cassava sequences and 1521 sequences with no significant similarity to plant protein databases. Transcripts of 7796 distinct genes were captured and we were able to assign a functional classification to 78% of them while finding more than half of the enzymes annotated in metabolic pathways in Arabidopsis. The annotation of sequences that were not paired to transcripts of other species included many stress-related functional categories showing that our library is enriched with stress-induced genes. Finally, we detected 230 putative gene duplications that include key enzymes in reactive oxygen species signaling pathways and could play a role in cassava stress response features. Conclusion The cassava full-length cDNA library here presented contains transcripts of genes involved in stress response as well as genes important for different areas of cassava research. This library will be an important resource for gene discovery, characterization and cloning; in the near future it will aid the annotation of the cassava genome. PMID:18096061

  9. Identification of Photosynthesis-Associated C4 Candidate Genes through Comparative Leaf Gradient Transcriptome in Multiple Lineages of C3 and C4 Species.

    Science.gov (United States)

    Ding, Zehong; Weissmann, Sarit; Wang, Minghui; Du, Baijuan; Huang, Lei; Wang, Lin; Tu, Xiaoyu; Zhong, Silin; Myers, Christopher; Brutnell, Thomas P; Sun, Qi; Li, Pinghua

    2015-01-01

    Leaves of C4 crops usually have higher radiation, water and nitrogen use efficiencies compared to the C3 species. Engineering C4 traits into C3 crops has been proposed as one of the most promising ways to repeal the biomass yield ceiling. To better understand the function of C4 photosynthesis, and to identify candidate genes that are associated with the C4 pathways, a comparative transcription network analysis was conducted on leaf developmental gradients of three C4 species including maize, green foxtail and sorghum and one C3 species, rice. By combining the methods of gene co-expression and differentially co-expression networks, we identified a total of 128 C4 specific genes. Besides the classic C4 shuttle genes, a new set of genes associated with light reaction, starch and sucrose metabolism, metabolites transportation, as well as transcription regulation, were identified as involved in C4 photosynthesis. These findings will provide important insights into the differential gene regulation between C3 and C4 species, and a good genetic resource for establishing C4 pathways in C3 crops. PMID:26465154

  10. Identification of Photosynthesis-Associated C4 Candidate Genes through Comparative Leaf Gradient Transcriptome in Multiple Lineages of C3 and C4 Species.

    Directory of Open Access Journals (Sweden)

    Zehong Ding

    Full Text Available Leaves of C4 crops usually have higher radiation, water and nitrogen use efficiencies compared to the C3 species. Engineering C4 traits into C3 crops has been proposed as one of the most promising ways to repeal the biomass yield ceiling. To better understand the function of C4 photosynthesis, and to identify candidate genes that are associated with the C4 pathways, a comparative transcription network analysis was conducted on leaf developmental gradients of three C4 species including maize, green foxtail and sorghum and one C3 species, rice. By combining the methods of gene co-expression and differentially co-expression networks, we identified a total of 128 C4 specific genes. Besides the classic C4 shuttle genes, a new set of genes associated with light reaction, starch and sucrose metabolism, metabolites transportation, as well as transcription regulation, were identified as involved in C4 photosynthesis. These findings will provide important insights into the differential gene regulation between C3 and C4 species, and a good genetic resource for establishing C4 pathways in C3 crops.

  11. Sequencing analysis of 20,000 full-length cDNA clones from cassava reveals lineage specific expansions in gene families related to stress response

    Directory of Open Access Journals (Sweden)

    Sakaki Yoshiyuki

    2007-12-01

    Full Text Available Abstract Background Cassava, an allotetraploid known for its remarkable tolerance to abiotic stresses is an important source of energy for humans and animals and a raw material for many industrial processes. A full-length cDNA library of cassava plants under normal, heat, drought, aluminum and post harvest physiological deterioration conditions was built; 19968 clones were sequence-characterized using expressed sequence tags (ESTs. Results The ESTs were assembled into 6355 contigs and 9026 singletons that were further grouped into 10577 scaffolds; we found 4621 new cassava sequences and 1521 sequences with no significant similarity to plant protein databases. Transcripts of 7796 distinct genes were captured and we were able to assign a functional classification to 78% of them while finding more than half of the enzymes annotated in metabolic pathways in Arabidopsis. The annotation of sequences that were not paired to transcripts of other species included many stress-related functional categories showing that our library is enriched with stress-induced genes. Finally, we detected 230 putative gene duplications that include key enzymes in reactive oxygen species signaling pathways and could play a role in cassava stress response features. Conclusion The cassava full-length cDNA library here presented contains transcripts of genes involved in stress response as well as genes important for different areas of cassava research. This library will be an important resource for gene discovery, characterization and cloning; in the near future it will aid the annotation of the cassava genome.

  12. Differential Protein Network Analysis of the Immune Cell Lineage

    Directory of Open Access Journals (Sweden)

    Trevor Clancy

    2014-01-01

    Full Text Available Recently, the Immunological Genome Project (ImmGen completed the first phase of the goal to understand the molecular circuitry underlying the immune cell lineage in mice. That milestone resulted in the creation of the most comprehensive collection of gene expression profiles in the immune cell lineage in any model organism of human disease. There is now a requisite to examine this resource using bioinformatics integration with other molecular information, with the aim of gaining deeper insights into the underlying processes that characterize this immune cell lineage. We present here a bioinformatics approach to study differential protein interaction mechanisms across the entire immune cell lineage, achieved using affinity propagation applied to a protein interaction network similarity matrix. We demonstrate that the integration of protein interaction networks with the most comprehensive database of gene expression profiles of the immune cells can be used to generate hypotheses into the underlying mechanisms governing the differentiation and the differential functional activity across the immune cell lineage. This approach may not only serve as a hypothesis engine to derive understanding of differentiation and mechanisms across the immune cell lineage, but also help identify possible immune lineage specific and common lineage mechanism in the cells protein networks.

  13. 乙型流感病毒Victoria系和Yamagata系HA1基因的分子进化研究%Molecular evolution of two lineages related to influenza B virus based on HA1 gene

    Institute of Scientific and Technical Information of China (English)

    金青青; 茅海燕; 孙逸; 卢亦愚; 冯燕; 徐昌平; 莫世华

    2013-01-01

    目的 探讨乙型流感病毒两大谱系的进化特征和进化规律.方法 从GenBank数据库下载1940-2012年乙型流感病毒流行株共126条,采用贝叶斯-马尔科夫链-蒙特卡洛(Bayesian-MCMC)和分子钟方法,对乙型流感病毒的HA1基因进行系统发育学分析,计算乙型流感病毒两大谱系可能的起源时间与分化时间.结果 1978-2010年乙型流感病毒Victoria系与Yamagata系的aa平均差异率为5.4%~ 10.2%,两谱系的aa差异和组间遗传距离随时间推移呈逐渐增大的趋势.与Victoria系毒株相比,Yamagata系全部毒株的163位aa及部分毒株的166位aa缺失,但是这些年来的乙型流感病毒HA1基因除个别位点外,尚未受到明显的正向选择压力.每年乙型流感病毒HA1基因的碱基替换速率为2.138×10-3(95%HPD:1.833×10-3~2.437×10-3)替代/位点,推算乙型流感病毒Victoria系和Yamagata系的最近共同祖先出现在1971年(95%HPD:1969-1972年),两大谱系的分化时间点分别为1973年(95%HPD:1971-1974年)和1977年(95%HPD:1975-1978年).结论 乙型流感Victoria系和Yamagata系均较以往发生大的变异,且两大谱系的差异日趋增大,将来有可能分化为不同的亚型,在流感监测中应密切关注这一变化及其流行病学意义.%Objective To study the evolutionary characteristics and rules of two lineages on influenza B virus.Methods A total of 126 HA1 sequences of strains isolated during 1940 to 2012were downloaded from the GenBank.Time of the most recent common ancestor (TMRCA) and divergence of the two lineages were calculated based on the data from phylogenetic analysis of HA1gene,using Bayesian Markov Chain Monte Carlo (Bayesian-MCMC) and molecular clock method.Results The average amino acid variant ratios were ranged from 5.4% to 10.2% within the strains of influenza B virus isolated during 1978 to 2010.Compared with the Victoria-like strains,all Yamagatalike strains showed an amino acid deletion at

  14. Klumpfuss controls FMRFamide expression by enabling BMP signaling within the NB5-6 lineage

    OpenAIRE

    Losada-Perez, Maria; Gabilondo, Hugo; Molina, Isabel; Turiegano, Enrique; Torroja, Laura; Thor, Stefan; Benito-Sipos, Jonathan

    2013-01-01

    A number of transcription factors that are expressed within most, if not all, embryonic neuroblast (NB) lineages participate in neural subtype specification. Some have been extensively studied in several NB lineages (e.g. components of the temporal gene cascade) whereas others only within specific NB lineages. To what extent they function in other lineages remains unknown. Klumpfuss (Klu), the Drosophila ortholog of the mammalian Wilms tumor 1 (WT1) protein, is one such transcription factor. ...

  15. Dual roles of lineage restricted transcription factors: the case of MITF in melanocytes.

    Science.gov (United States)

    Levy, Carmit; Fisher, David E

    2011-01-01

    Microphthalmia-associated Transcription Factor, MITF, is a master regulator of melanocyte development, differentiation, migration, and survival.(1) A broad collection of studies have indicated that MITF directly regulates the transcription of genes involved in pigmentation, which are selective to the melanocyte lineage. In addition, MITF controls expression of genes which are expressed in multiple cell lineages, and may also play differential roles in activating vs. maintaining gene expression patterns. In this Point of View article, we discuss lineage restricted transcription factor activation of both tissue-specific and ubiquitously expressed genes using melanocytes and MITF as a model system that may eventually provide insights into such processes in multiple cell lineages.

  16. Diversity rankings among bacterial lineages in soil.

    Science.gov (United States)

    Youssef, Noha H; Elshahed, Mostafa S

    2009-03-01

    We used rarefaction curve analysis and diversity ordering-based approaches to rank the 11 most frequently encountered bacterial lineages in soil according to diversity in 5 previously reported 16S rRNA gene clone libraries derived from agricultural, undisturbed tall grass prairie and forest soils (n=26,140, 28 328, 31 818, 13 001 and 53 533). The Planctomycetes, Firmicutes and the delta-Proteobacteria were consistently ranked among the most diverse lineages in all data sets, whereas the Verrucomicrobia, Gemmatimonadetes and beta-Proteobacteria were consistently ranked among the least diverse. On the other hand, the rankings of alpha-Proteobacteria, Acidobacteria, Actinobacteria, Bacteroidetes and Chloroflexi varied widely in different soil clone libraries. In general, lineages exhibiting largest differences in diversity rankings also exhibited the largest difference in relative abundance in the data sets examined. Within these lineages, a positive correlation between relative abundance and diversity was observed within the Acidobacteria, Actinobacteria and Chloroflexi, and a negative diversity-abundance correlation was observed within the Bacteroidetes. The ecological and evolutionary implications of these results are discussed. PMID:18987677

  17. Conditional Deletion of the Relaxin Receptor Gene in Cells of Smooth Muscle Lineage Affects Lower Reproductive Tract in Pregnant Mice1

    Science.gov (United States)

    Kaftanovskaya, Elena M.; Huang, Zaohua; Lopez, Carolina; Conrad, Kirk; Agoulnik, Alexander I.

    2015-01-01

    ABSTRACT Relaxin hormone secreted into the circulation during pregnancy was discovered through its effects on pubic symphysis relaxation and parturition. Genetic inactivation of the relaxin gene or its cognate relaxin family peptide receptor 1 (RXFP1) in mice caused failure of parturition and mammary nipple enlargement, as well as increased collagen fiber density in the cervix and vagina. However, the relaxin effect on discrete cells and tissues has yet to be determined. Using transgenic mice with a knockin LacZ reporter in the Rxfp1 allele, we showed strong expression of this gene in vaginal and cervical stromal cells, as well as pubic ligament cells. We produced a floxed Rxfp1 allele that was used in combination with the Tagln-cre transgene to generate mice with a smooth muscle-specific gene knockout. In pregnant females, the ROSA26 reporter activated by Tagln-cre was detected in smooth muscle cells of the cervix, vagina, uterine artery, and in cells of the pubic symphysis. In late pregnant females with conditional gene ablation, the length of pubic symphysis was significantly reduced compared with wild-type or heterozygous Rxfp1+/− females. Denser collagen content was revealed by Masson trichrome staining in reproductive tract organs, uterine artery, and pubic symphysis. The cervical and vaginal epithelium was less developed than in heterozygous or wild-type females, although nipple size was normal and the dams were able to nurse their pups. In summary, our data indicate that relaxin/RXFP1 signaling in smooth muscle cells is important for normal collagen turnover and relaxation of the pubic symphysis during pregnancy. PMID:25715795

  18. Conditional Deletion of the Relaxin Receptor Gene in Cells of Smooth Muscle Lineage Affects Lower Reproductive Tract in Pregnant Mice1

    OpenAIRE

    Kaftanovskaya, Elena M.; Huang, Zaohua; Lopez, Carolina; Conrad, Kirk; Agoulnik, Alexander I.

    2015-01-01

    Relaxin hormone secreted into the circulation during pregnancy was discovered through its effects on pubic symphysis relaxation and parturition. Genetic inactivation of the relaxin gene or its cognate relaxin family peptide receptor 1 (RXFP1) in mice caused failure of parturition and mammary nipple enlargement, as well as increased collagen fiber density in the cervix and vagina. However, the relaxin effect on discrete cells and tissues has yet to be determined. Using transgenic mice with a k...

  19. Expression of Genes Related to Germ Cell Lineage and Pluripotency in Single Cells and Colonies of Human Adult Germ Stem Cells.

    Science.gov (United States)

    Conrad, Sabine; Azizi, Hossein; Hatami, Maryam; Kubista, Mikael; Bonin, Michael; Hennenlotter, Jörg; Sievert, Karl-Dietrich; Skutella, Thomas

    2016-01-01

    The aim of this study was to elucidate the molecular status of single human adult germ stem cells (haGSCs) and haGSC colonies, which spontaneously developed from the CD49f MACS and matrix- (collagen-/laminin+ binding-) selected fraction of enriched spermatogonia. Single-cell transcriptional profiling by Fluidigm BioMark system of a long-term cultured haGSCs cluster in comparison to human embryonic stem cells (hESCs) and human fibroblasts (hFibs) revealed that haGSCs showed a characteristic germ- and pluripotency-associated gene expression profile with some similarities to hESCs and with a significant distinction from somatic hFibs. Genome-wide comparisons with microarray analysis confirmed that different haGSC colonies exhibited gene expression heterogeneity with more or less pluripotency. The results of this study confirm that haGSCs are adult stem cells with a specific molecular gene expression profile in vitro, related but not identical to true pluripotent stem cells. Under ES-cell conditions haGSC colonies could be selected and maintained in a partial pluripotent state at the molecular level, which may be related to their cell plasticity and potential to differentiate into cells of all germ layers. PMID:26649052

  20. Expression of Genes Related to Germ Cell Lineage and Pluripotency in Single Cells and Colonies of Human Adult Germ Stem Cells

    Directory of Open Access Journals (Sweden)

    Sabine Conrad

    2016-01-01

    Full Text Available The aim of this study was to elucidate the molecular status of single human adult germ stem cells (haGSCs and haGSC colonies, which spontaneously developed from the CD49f MACS and matrix- (collagen−/laminin+ binding- selected fraction of enriched spermatogonia. Single-cell transcriptional profiling by Fluidigm BioMark system of a long-term cultured haGSCs cluster in comparison to human embryonic stem cells (hESCs and human fibroblasts (hFibs revealed that haGSCs showed a characteristic germ- and pluripotency-associated gene expression profile with some similarities to hESCs and with a significant distinction from somatic hFibs. Genome-wide comparisons with microarray analysis confirmed that different haGSC colonies exhibited gene expression heterogeneity with more or less pluripotency. The results of this study confirm that haGSCs are adult stem cells with a specific molecular gene expression profile in vitro, related but not identical to true pluripotent stem cells. Under ES-cell conditions haGSC colonies could be selected and maintained in a partial pluripotent state at the molecular level, which may be related to their cell plasticity and potential to differentiate into cells of all germ layers.

  1. Phylogenetic analysis of AGAMOUS sequences reveals the origin of the diploid and tetraploid forms of self-pollinating wild buckwheat, Fagopyrum homotropicum Ohnishi.

    Science.gov (United States)

    Tomiyoshi, Mitsuyuki; Yasui, Yasuo; Ohsako, Takanori; Li, Cheng-Yun; Ohnishi, Ohmi

    2012-09-01

    Fagopyrum homotropicum Ohnishi is a self-pollinating wild buckwheat species indigenous to eastern Tibet and the Yunnan and Sichuan Provinces of China. It is useful breeding material for shifting cultivated buckwheat (F. esculentum ssp. esculentum Moench) from out-crossing to self-pollinating. Despite its importance as a genetic resource in buckwheat breeding, the genetic variation of F. homotropicum is poorly understood. In this study, we investigated the genetic variation and phylogenetic relationships of the diploid and tetraploid forms of F. homotropicum based on the nucleotide sequences of a nuclear gene, AGAMOUS (AG). Neighbor-joining analysis revealed that representative individuals clustered into three large groups (Group I, II and III). Each group contained diploid and tetraploid forms of F. homotropicum. We identified tetraploid plants that had two diverged AG sequences; one belonging to Group I and the other belonging to Group II, or one belonging to Group II and the other belonging to Group III. These results suggest that the tetraploid form originated from at least two hybridization events between deeply differentiated diploids. The results also imply that the genetic diversity contributed by tetraploidization of differentiated diploids may have allowed the distribution range of F. homotropicum to expand to the northern areas of China.

  2. Identification of Photosynthesis-Associated C4 Candidate Genes through Comparative Leaf Gradient Transcriptome in Multiple Lineages of C3 and C4 Species

    OpenAIRE

    Zehong Ding; Sarit Weissmann; Minghui Wang; Baijuan Du; Lei Huang; Lin Wang; Xiaoyu Tu; Silin Zhong; Christopher Myers; Brutnell, Thomas P.; Qi Sun; Pinghua Li

    2015-01-01

    Leaves of C4 crops usually have higher radiation, water and nitrogen use efficiencies compared to the C3 species. Engineering C4 traits into C3 crops has been proposed as one of the most promising ways to repeal the biomass yield ceiling. To better understand the function of C4 photosynthesis, and to identify candidate genes that are associated with the C4 pathways, a comparative transcription network analysis was conducted on leaf developmental gradients of three C4 species including maize, ...

  3. Impact of tamoxifen on adipocyte lineage tracing: Inducer of adipogenesis and prolonged nuclear translocation of Cre recombinase

    Directory of Open Access Journals (Sweden)

    Risheng Ye

    2015-11-01

    Conclusions: These findings highlight the potential for tamoxifen-induced adipogenesis, and the associated drawbacks of the use of tamoxifen in lineage tracing studies, explaining the discrepancy in lineage tracing results from different systems with temporal control of gene targeting.

  4. Expanding the Entamoeba Universe: New Hosts Yield Novel Ribosomal Lineages.

    Science.gov (United States)

    Jacob, Alison S; Busby, Eloise J; Levy, Abigail D; Komm, Natasha; Clark, C Graham

    2016-01-01

    Removing the requirement for cell culture has led to a substantial increase in the number of lineages of Entamoeba recognized as distinct. Surveying the range of potential host species for this parasite genus has barely been started and it is clear that additional sampling of the same host in different locations often identifies additional diversity. In this study, using small subunit ribosomal RNA gene sequencing, we identify four new lineages of Entamoeba, including the first report of Entamoeba from an elephant, and extend the host range of some previously described lineages. In addition, examination of microbiome data from a number of host animals suggests that substantial Entamoeba diversity remains to be uncovered.

  5. Evidence of two lineages of the symbiont 'Candidatus Erwinia dacicola' in Italian populations of Bactrocera oleae (Rossi) based on 16S rRNA gene sequences.

    Science.gov (United States)

    Savio, Claudia; Mazzon, Luca; Martinez-Sañudo, Isabel; Simonato, Mauro; Squartini, Andrea; Girolami, Vincenzo

    2012-01-01

    The close association between the olive fly Bactrocera oleae (Rossi) (Diptera: Tephritidae) and bacteria has been known for more than a century. Recently, the presence of a host-specific, hereditary, unculturable symbiotic bacterium, designated 'Candidatus Erwinia dacicola', has been described inside the cephalic organ of the fly, called the oesophageal bulb. In the present study, the 16S rRNA gene sequence variability of 'Ca. E. dacicola' was examined within and between 26 Italian olive fly populations sampled across areas where olive trees occur in the wild and areas where cultivated olive trees have been introduced through history. The bacterial contents of the oesophageal bulbs of 314 olive flies were analysed and a minimum of 781 bp of the 16S rRNA gene was sequenced. The corresponding host fly genotype was assessed by sequencing a 776 bp portion of the mitochondrial genome. Two 'Ca. E. dacicola' haplotypes were found (htA and htB), one being slightly more prevalent than the other (57%). The two haplotypes did not co-exist in the same individuals, as confirmed by cloning. Interestingly, the olive fly populations of the two main Italian islands, Sicily and Sardinia, appeared to be represented exclusively by the htB and htA haplotypes, respectively, while peninsular populations showed both bacterial haplotypes in different proportions. No significant correlation emerged between the two symbiont haplotypes and the 16 host fly haplotypes observed, suggesting evidence for a mixed model of vertical and horizontal transmission of the symbiont during the fly life cycle.

  6. Climate-driven range shifts explain the distribution of extant gene pools and predict future loss of unique lineages in a marine brown alga.

    Science.gov (United States)

    Assis, J; Serrão, E A; Claro, B; Perrin, C; Pearson, G A

    2014-06-01

    The climate-driven dynamics of species ranges is a critical research question in evolutionary ecology. We ask whether present intraspecific diversity is determined by the imprint of past climate. This is an ongoing debate requiring interdisciplinary examination of population genetic pools and persistence patterns across global ranges. Previously, contrasting inferences and predictions have resulted from distinct genomic coverage and/or geographical information. We aim to describe and explain the causes of geographical contrasts in genetic diversity and their consequences for the future baseline of the global genetic pool, by comparing present geographical distribution of genetic diversity and differentiation with predictive species distribution modelling (SDM) during past extremes, present time and future climate scenarios for a brown alga, Fucus vesiculosus. SDM showed that both atmospheric and oceanic variables shape the global distribution of intertidal species, revealing regions of persistence, extinction and expansion during glacial and postglacial periods. These explained the distribution and structure of present genetic diversity, consisting of differentiated genetic pools with maximal diversity in areas of long-term persistence. Most of the present species range comprises postglacial expansion zones and, in contrast to highly dispersive marine organisms, expansions involved only local fronts, leaving distinct genetic pools at rear edges. Besides unravelling a complex phylogeographical history and showing congruence between genetic diversity and persistent distribution zones, supporting the hypothesis of niche conservatism, range shifts and loss of unique genetic diversity at the rear edge were predicted for future climate scenarios, impoverishing the global gene pool. PMID:24766057

  7. Co-circulation of Peste-des-Petits-Ruminants Virus Asian lineage IV with Lineage II in Nigeria.

    Science.gov (United States)

    Woma, T Y; Adombi, C M; Yu, D; Qasim, A M M; Sabi, A A; Maurice, N A; Olaiya, O D; Loitsch, A; Bailey, D; Shamaki, D; Dundon, W G; Quan, M

    2016-06-01

    Peste-des-petits-ruminants (PPR), a major small ruminant transboundary animal disease, is endemic in Nigeria. Strains of the causal agent, peste-des-petits-ruminants virus (PPRV), have been differentiated into four genetically distinct lineages based on the partial sequence of the virus nucleoprotein (N) or fusion (F) genes. Peste-des-petits-ruminants virus strains that were identified initially in Africa were grouped into lineages I, II and III and viruses from Asia were classified as lineage IV and referred to as the Asian lineage. Many recent reports indicate that the Asian lineage is now also present in Africa. With this in mind, this study was conducted to reassess the epidemiology of PPRV in Nigeria. A total of 140 clinical samples from 16 sheep and 63 goats with symptoms suggestive of PPR were collected from different states of Nigeria during a four-year period (2010-2013). They were analysed by the amplification of fragments of the N gene. Results for 33 (42%) animals were positive. The phylogenetic analysis of the N gene sequences with those available in GenBank showed that viruses that were detected belong to both lineage II and IV. Based on an analysis of the N gene sequences, the lineage IV isolates grouped into two clades, one being predominant in the north-eastern part of the country and the other found primarily in the southern regions of the country. This study reports the presence of PPRV Asian lineage IV in Nigeria for the first time. PMID:26095085

  8. An Atlas of Type I MADS Box Gene Expression during Female Gametophyte and Seed Development in Arabidopsis[W].

    NARCIS (Netherlands)

    Bemer, M.; Heijmans, K.; Airoldi, C.A.; Davies, B.; Angenent, G.C.

    2010-01-01

    Members of the plant type I MADS domain subfamily have been reported to be involved in reproductive development in Arabidopsis (Arabidopsis thaliana). However, from the 61 type I genes in the Arabidopsis genome, only PHERES1, AGAMOUS-LIKE80 (AGL80), DIANA, AGL62, and AGL23 have been functionally cha

  9. The Revitalization of Women’s Entrepreneurship Spirit In Micro Enterprises With Islamic Microfinance Institution (IMI (Study on The Contribution of BMTs Agam Madani in Agam sub-province, West Sumatra

    Directory of Open Access Journals (Sweden)

    Hesi Eka Puteri

    2014-03-01

    Full Text Available Objective - The objective of this paper is to give an overview of the contribution of Islamic Microfinance Institutions (IMI in the process of empowerment of women microenterprises, and recommended a related policy.Method – This study is a field research in 2012, which focused in BMTs Agam Madani at Agam district. The data is sourced from the observation, documentation and questionnaires from 60 women micro-entrepreneurs samples who receive working capital financing. This paper uses simple regression model in order to observe relationship between working capital and the increasing of revenue. This model is to measure the amount of the multiplier effect in working capital-to increasing of revenue.Result – This paper found that IMI is a good model to develop society more prosperous by developing BMTs in each district. These BMT has thousands of micro enterprises member and could revitalized the spirit of entrepreneurship of minangkabau’s women. A research to 60 women’s micro entrepreneur samples showed the positive significant influence between lending to revenue. A multiplier effect equal to 0.068.The small number of multiplier effect implied that many factors determining their revenue, not lending only.Conclusion – This finding could explain that IMI could empower micro entrepreneur woman. This finding also recommend few strategies: 1 Revitalization of BMTs as micro catalyst by revitalization of structure of organization, products variation, human resource compentence, sharia monitoring, public cooperation and implementating local cultural value 2 Revitalization of government role as fasilitator, coordinator, initiator and mediator in developing micro sector. Keywords : Women’s Entrepreneurship, Micro Enterprises, Islamic Microfinance Institution, BMTs Agam Madani 

  10. ANALISIS EFEKTIFITAS PROGRAMPELATIHAN DIKLAT PIM III TERHADAP KOMPETENSI PEJABAT ESELON III DI PEMERINTAH KABUPATEN AGAM

    Directory of Open Access Journals (Sweden)

    Dina Amaluis

    2014-10-01

    Full Text Available In the management of Human Resources, there are several basic functions. The evaluation function is one of them, in addition to planning, organizing and execution. Training programs as one strategy of human resource development requires the evaluation function to determine the effectiveness of ProgramPelatihan.Program Training for Civil Servants aims to improve the ability to lead, work competence and performance. In this study, the training program is intended Leadership Training Level III. This study aims to measure the relationship to increased Competence Training Program. Respondents consisted of 96 graduates of Leadership Training Level III who currently holds the post of structural Echelon III in Agam district government (leader. The approach used is quantitative by distributing a questionnaire to all respondents. Training Program evaluation method using Kirkpatrick & Kirkpatrick. The analysis used is a simple correlation between variables see significant value. The result showed that the training program is significantly correlated to the increased competence. This means that any increase in the value of the variable training program will be followed by a rise in the value of the variable competence. From this research can be concluded that the organizers of the training program is necessary to conduct in-depth Training Needs Analysis

  11. A new loss-of-function allele 28y reveals a role of ARGONAUTE1 in limiting asymmetric division of stomatal lineage ground cell

    Institute of Scientific and Technical Information of China (English)

    Kezhen Yangy; Min Jiangy; Jie Le

    2014-01-01

    In Arabidopsis thaliana L., stomata are produced through a series of divisions including asymmetric and symmetric divisions. Asymmetric entry division of meristemoid mother cellproduces two daughter cells, the smal er meristemoid and the larger sister cell, a stomatal lineage ground cell(SLGC). Stomatal lineage ground cells can differentiate into epidermal pavement cells but have the potential to divide asymmetrical y, spacing divisions, to create satel ite meristemoids. Peptide ligands and TOO MANY MOUTHS (TMM) and ERECTA family receptors regulate the initiation of stomatal lineages, activity, and orientation of spacing divisions. Here, we reported that a natural mutant 28y displayed an increased stomatal density and index. Using map-based cloning, we identified mutation in ARGONAUTE1 (AGO1) as the cause of 28y phenotypes. Time-lapse tracing of stomatal lineage cells reveals that stomatal overproduction in 28y is caused by the excessive asymmetric spacing division of SLGCs.Further genetic results demonstrated that AGO1 acts down-stream of TMM and negatively regulates the SPCH transcripts, but in a brassinosteroid-independent manner. Upregulation of AGAMOUS-LIKE16 (AGL16) in 28y mutants suggests that AGO1 is required to restrict AGL16-mediated stomatal spacing divisions, an miRNA pathway in addition to ligand-receptor signaling modules.

  12. Mitochondrial evolution across lineages of the vampire barnacle Notochthamalus scabrosus.

    Science.gov (United States)

    Wares, John P

    2015-02-01

    Eight whole mitochondrial genomes from the barnacle Notochthamalus scabrosus, with one from the northern lineage and seven from the divergent southern lineage, are presented. The annotated and aligned data were analyzed for signals of non-neutral evolution. Overall, these data are consistent with purifying selection operating on the protein-coding regions of the mitochondrion. However, a notable region of nonsynonymous substitution at the 3' end of the ND2 gene region, along with unusual site frequency spectra in two other gene regions, was identified. PMID:24047186

  13. Single-cell analysis defines the divergence between the innate lymphoid cell lineage and lymphoid tissue-inducer cell lineage.

    Science.gov (United States)

    Ishizuka, Isabel E; Chea, Sylvestre; Gudjonson, Herman; Constantinides, Michael G; Dinner, Aaron R; Bendelac, Albert; Golub, Rachel

    2016-03-01

    The precise lineage relationship between innate lymphoid cells (ILCs) and lymphoid tissue-inducer (LTi) cells is poorly understood. Using single-cell multiplex transcriptional analysis of 100 lymphoid genes and single-cell cultures of fetal liver precursor cells, we identified the common proximal precursor to these lineages and found that its bifurcation was marked by differential induction of the transcription factors PLZF and TCF1. Acquisition of individual effector programs specific to the ILC subsets ILC1, ILC2 and ILC3 was initiated later, at the common ILC precursor stage, by transient expression of mixed ILC1, ILC2 and ILC3 transcriptional patterns, whereas, in contrast, the development of LTi cells did not go through multilineage priming. Our findings provide insight into the divergent mechanisms of the differentiation of the ILC lineage and LTi cell lineage and establish a high-resolution 'blueprint' of their development.

  14. Highly variable rates of genome rearrangements between hemiascomycetous yeast lineages.

    Directory of Open Access Journals (Sweden)

    2006-03-01

    Full Text Available Hemiascomycete yeasts cover an evolutionary span comparable to that of the entire phylum of chordates. Since this group currently contains the largest number of complete genome sequences it presents unique opportunities to understand the evolution of genome organization in eukaryotes. We inferred rates of genome instability on all branches of a phylogenetic tree for 11 species and calculated species-specific rates of genome rearrangements. We characterized all inversion events that occurred within synteny blocks between six representatives of the different lineages. We show that the rates of macro- and microrearrangements of gene order are correlated within individual lineages but are highly variable across different lineages. The most unstable genomes correspond to the pathogenic yeasts Candida albicans and Candida glabrata. Chromosomal maps have been intensively shuffled by numerous interchromosomal rearrangements, even between species that have retained a very high physical fraction of their genomes within small synteny blocks. Despite this intensive reshuffling of gene positions, essential genes, which cluster in low recombination regions in the genome of Saccharomyces cerevisiae, tend to remain syntenic during evolution. This work reveals that the high plasticity of eukaryotic genomes results from rearrangement rates that vary between lineages but also at different evolutionary times of a given lineage.

  15. Genome Diversity, Recombination, and Virulence across the Major Lineages of Paracoccidioides

    Science.gov (United States)

    Muñoz, José F.; Desjardins, Christopher A.; Gallo, Juan E.; Sykes, Sean; Sakthikumar, Sharadha; Misas, Elizabeth; Whiston, Emily A.; Bagagli, Eduardo; Soares, Celia M. A.; Teixeira, Marcus de M.; Taylor, John W.; Clay, Oliver K.; McEwen, Juan G.

    2016-01-01

    ABSTRACT The Paracoccidioides genus includes two species of thermally dimorphic fungi that cause paracoccidioidomycosis, a neglected health-threatening human systemic mycosis endemic to Latin America. To examine the genome evolution and the diversity of Paracoccidioides spp., we conducted whole-genome sequencing of 31 isolates representing the phylogenetic, geographic, and ecological breadth of the genus. These samples included clinical, environmental and laboratory reference strains of the S1, PS2, PS3, and PS4 lineages of P. brasiliensis and also isolates of Paracoccidioides lutzii species. We completed the first annotated genome assemblies for the PS3 and PS4 lineages and found that gene order was highly conserved across the major lineages, with only a few chromosomal rearrangements. Comparing whole-genome assemblies of the major lineages with single-nucleotide polymorphisms (SNPs) predicted from the remaining 26 isolates, we identified a deep split of the S1 lineage into two clades we named S1a and S1b. We found evidence for greater genetic exchange between the S1b lineage and all other lineages; this may reflect the broad geographic range of S1b, which is often sympatric with the remaining, largely geographically isolated lineages. In addition, we found evidence of positive selection for the GP43 and PGA1 antigen genes and genes coding for other secreted proteins and proteases and lineage-specific loss-of-function mutations in cell wall and protease genes; these together may contribute to virulence and host immune response variation among natural isolates of Paracoccidioides spp. These insights into the recent evolutionary events highlight important differences between the lineages that could impact the distribution, pathogenicity, and ecology of Paracoccidioides. IMPORTANCE Characterization of genetic differences between lineages of the dimorphic human-pathogenic fungus Paracoccidioides can identify changes linked to important phenotypes and guide the

  16. Phylogenetic analysis of P5 P-type ATPases, a eukaryotic lineage of secretory pathway pumps

    DEFF Research Database (Denmark)

    Møller, Annette; Asp, Torben; Holm, Preben Bach;

    2008-01-01

    Eukaryotes encompass a remarkable variety of organisms and unresolved lineages. Different phylogenetic analyses have lead to conflicting conclusions as to the origin and associations between lineages and species. In this work, we investigated evolutionary relationship of a family of cation pumps ...... far, while P5B ATPases appear to be lost in three eukaryotic lineages; excavates, entamoebas and land plants. A lineage-specific gene expansion of up to four different P5B ATPases is seen in animals....

  17. Incomplete Lineage Sorting: Consistent Phylogeny Estimation From Multiple Loci

    CERN Document Server

    Mossel, Elchanan

    2008-01-01

    We introduce a simple algorithm for reconstructing phylogenies from multiple gene trees in the presence of incomplete lineage sorting, that is, when the topology of the gene trees may differ from that of the species tree. We show that our technique is statistically consistent under standard stochastic assumptions, that is, it returns the correct tree given sufficiently many unlinked loci. We also show that it can tolerate moderate estimation errors.

  18. Role of LRF/Pokemon in lineage fate decisions

    OpenAIRE

    Lunardi, Andrea; Guarnerio, Jlenia; Wang, Guocan; Maeda, Takahiro; Pandolfi, Pier Paolo

    2013-01-01

    In the human genome, 43 different genes are found that encode proteins belonging to the family of the POK (poxvirus and zinc finger and Krüppel)/ZBTB (zinc finger and broad complex, tramtrack, and bric à brac) factors. Generally considered transcriptional repressors, several of these genes play fundamental roles in cell lineage fate decision in various tissues, programming specific tasks throughout the life of the organism. Here, we focus on functions of leukemia/lymphoma-related factor/POK e...

  19. Three reciprocally monophyletic mtDNA lineages elucidate the taxonomic status of Grant's gazelles

    DEFF Research Database (Denmark)

    Lorenzen, Eline Deidre; Arctander, Peter; Siegismund, Hans Redlef

    2008-01-01

    net nucleotide distances of 8-12%. The three lineages-notata, granti and petersii-grouped populations according to their geographic origin, encompassing populations in the north, southwest, and east, respectively. The mtDNA lineages reflected distinct evolutionary trajectories, and the data are...... discussed in reference to the four currently recognised subspecies. We suggest Grant's gazelles be raised to the superspecies Nanger (granti) comprising three taxonomic units corresponding to the three mtDNA lineages. There was no evidence of gene flow between the notata and granti lineages, despite their...

  20. Separate introns gained within short and long soluble peridinin-chlorophyll a-protein genes during radiation of Symbiodinium (Dinophyceae) clade A and B lineages - PLoS One

    Science.gov (United States)

    Here we document introns in two Symbiodinium clades that were most likely gained following divergence of this genus from other peridinin-containing dinoflagellate lineages. Soluble peridinin-chlorophyll a-proteins (sPCP) occur in short and long forms in different species, and all...

  1. Trophoblast lineage cells derived from human induced pluripotent stem cells

    Energy Technology Data Exchange (ETDEWEB)

    Chen, Ying, E-mail: ying.chen@hc.msu.edu [Department of Obstetrics, Gynecology and Reproductive Biology, Michigan State University, 333 Bostwick NE, Grand Rapids, MI 49503 (United States); Wang, Kai; Chandramouli, Gadisetti V.R. [Department of Obstetrics, Gynecology and Reproductive Biology, Michigan State University, 333 Bostwick NE, Grand Rapids, MI 49503 (United States); Knott, Jason G. [Developmental Epigenetics Laboratory, Department of Animal Science, Michigan State University (United States); Leach, Richard, E-mail: Richard.leach@hc.msu.edu [Department of Obstetrics, Gynecology and Reproductive Biology, Michigan State University, 333 Bostwick NE, Grand Rapids, MI 49503 (United States); Department of Obstetrics, Gynecology and Women’s Health, Spectrum Health Medical Group (United States)

    2013-07-12

    Highlights: •Epithelial-like phenotype of trophoblast lineage cells derived from human iPS cells. •Trophoblast lineage cells derived from human iPS cells exhibit trophoblast function. •Trophoblasts from iPS cells provides a proof-of-concept in regenerative medicine. -- Abstract: Background: During implantation, the blastocyst trophectoderm attaches to the endometrial epithelium and continues to differentiate into all trophoblast subtypes, which are the major components of a placenta. Aberrant trophoblast proliferation and differentiation are associated with placental diseases. However, due to ethical and practical issues, there is almost no available cell or tissue source to study the molecular mechanism of human trophoblast differentiation, which further becomes a barrier to the study of the pathogenesis of trophoblast-associated diseases of pregnancy. In this study, our goal was to generate a proof-of-concept model for deriving trophoblast lineage cells from induced pluripotency stem (iPS) cells from human fibroblasts. In future studies the generation of trophoblast lineage cells from iPS cells established from patient’s placenta will be extremely useful for studying the pathogenesis of individual trophoblast-associated diseases and for drug testing. Methods and results: Combining iPS cell technology with BMP4 induction, we derived trophoblast lineage cells from human iPS cells. The gene expression profile of these trophoblast lineage cells was distinct from fibroblasts and iPS cells. These cells expressed markers of human trophoblasts. Furthermore, when these cells were differentiated they exhibited invasive capacity and placental hormone secretive capacity, suggesting extravillous trophoblasts and syncytiotrophoblasts. Conclusion: Trophoblast lineage cells can be successfully derived from human iPS cells, which provide a proof-of-concept tool to recapitulate pathogenesis of patient placental trophoblasts in vitro.

  2. Trophoblast lineage cells derived from human induced pluripotent stem cells

    International Nuclear Information System (INIS)

    Highlights: •Epithelial-like phenotype of trophoblast lineage cells derived from human iPS cells. •Trophoblast lineage cells derived from human iPS cells exhibit trophoblast function. •Trophoblasts from iPS cells provides a proof-of-concept in regenerative medicine. -- Abstract: Background: During implantation, the blastocyst trophectoderm attaches to the endometrial epithelium and continues to differentiate into all trophoblast subtypes, which are the major components of a placenta. Aberrant trophoblast proliferation and differentiation are associated with placental diseases. However, due to ethical and practical issues, there is almost no available cell or tissue source to study the molecular mechanism of human trophoblast differentiation, which further becomes a barrier to the study of the pathogenesis of trophoblast-associated diseases of pregnancy. In this study, our goal was to generate a proof-of-concept model for deriving trophoblast lineage cells from induced pluripotency stem (iPS) cells from human fibroblasts. In future studies the generation of trophoblast lineage cells from iPS cells established from patient’s placenta will be extremely useful for studying the pathogenesis of individual trophoblast-associated diseases and for drug testing. Methods and results: Combining iPS cell technology with BMP4 induction, we derived trophoblast lineage cells from human iPS cells. The gene expression profile of these trophoblast lineage cells was distinct from fibroblasts and iPS cells. These cells expressed markers of human trophoblasts. Furthermore, when these cells were differentiated they exhibited invasive capacity and placental hormone secretive capacity, suggesting extravillous trophoblasts and syncytiotrophoblasts. Conclusion: Trophoblast lineage cells can be successfully derived from human iPS cells, which provide a proof-of-concept tool to recapitulate pathogenesis of patient placental trophoblasts in vitro

  3. Broad phylogenomic sampling and the sister lineage of land plants.

    Directory of Open Access Journals (Sweden)

    Ruth E Timme

    Full Text Available The tremendous diversity of land plants all descended from a single charophyte green alga that colonized the land somewhere between 430 and 470 million years ago. Six orders of charophyte green algae, in addition to embryophytes, comprise the Streptophyta s.l. Previous studies have focused on reconstructing the phylogeny of organisms tied to this key colonization event, but wildly conflicting results have sparked a contentious debate over which lineage gave rise to land plants. The dominant view has been that 'stoneworts,' or Charales, are the sister lineage, but an alternative hypothesis supports the Zygnematales (often referred to as "pond scum" as the sister lineage. In this paper, we provide a well-supported, 160-nuclear-gene phylogenomic analysis supporting the Zygnematales as the closest living relative to land plants. Our study makes two key contributions to the field: 1 the use of an unbiased method to collect a large set of orthologs from deeply diverging species and 2 the use of these data in determining the sister lineage to land plants. We anticipate this updated phylogeny not only will hugely impact lesson plans in introductory biology courses, but also will provide a solid phylogenetic tree for future green-lineage research, whether it be related to plants or green algae.

  4. Lineage-associated tracts defining the anatomy of the Drosophila first instar larval brain.

    Science.gov (United States)

    Hartenstein, Volker; Younossi-Hartenstein, Amelia; Lovick, Jennifer K; Kong, Angel; Omoto, Jaison J; Ngo, Kathy T; Viktorin, Gudrun

    2015-10-01

    Fixed lineages derived from unique, genetically specified neuroblasts form the anatomical building blocks of the Drosophila brain. Neurons belonging to the same lineage project their axons in a common tract, which is labeled by neuronal markers. In this paper, we present a detailed atlas of the lineage-associated tracts forming the brain of the early Drosophila larva, based on the use of global markers (anti-Neuroglian, anti-Neurotactin, inscuteable-Gal4>UAS-chRFP-Tub) and lineage-specific reporters. We describe 68 discrete fiber bundles that contain axons of one lineage or pairs/small sets of adjacent lineages. Bundles enter the neuropil at invariant locations, the lineage tract entry portals. Within the neuropil, these fiber bundles form larger fascicles that can be classified, by their main orientation, into longitudinal, transverse, and vertical (ascending/descending) fascicles. We present 3D digital models of lineage tract entry portals and neuropil fascicles, set into relationship to commonly used, easily recognizable reference structures such as the mushroom body, the antennal lobe, the optic lobe, and the Fasciclin II-positive fiber bundles that connect the brain and ventral nerve cord. Correspondences and differences between early larval tract anatomy and the previously described late larval and adult lineage patterns are highlighted. Our L1 neuro-anatomical atlas of lineages constitutes an essential step towards following morphologically defined lineages to the neuroblasts of the early embryo, which will ultimately make it possible to link the structure and connectivity of a lineage to the expression of genes in the particular neuroblast that gives rise to that lineage. Furthermore, the L1 atlas will be important for a host of ongoing work that attempts to reconstruct neuronal connectivity at the level of resolution of single neurons and their synapses. PMID:26141956

  5. Distinct populations of adipogenic and myogenic Myf5-lineage progenitors in white adipose tissues.

    Science.gov (United States)

    Shan, Tizhong; Liang, Xinrong; Bi, Pengpeng; Zhang, Pengpeng; Liu, Weiyi; Kuang, Shihuan

    2013-08-01

    Brown adipose tissues (BAT) are derived from a myogenic factor 5 (Myf5)-expressing cell lineage and white adipose tissues (WAT) predominantly arise from non-Myf5 lineages, although a subpopulation of adipocytes in some WAT depots can be derived from the Myf5 lineage. However, the functional implication of the Myf5- and non-Myf5-lineage cells in WAT is unclear. We found that the Myf5-lineage constitution in subcutaneous WAT depots is negatively correlated to the expression of classical BAT and newly defined beige/brite adipocyte-specific genes. Consistently, fluorescent-activated cell sorting (FACS)-purified Myf5-lineage adipo-progenitors give rise to adipocytes expressing lower levels of BAT-specific Ucp1, Prdm16, Cidea, and Ppargc1a genes and beige adipocyte-specific CD137, Tmem26, and Tbx1 genes compared with the non-Myf5-lineage adipocytes from the same depots. Ablation of the Myf5-lineage progenitors in WAT stromal vascular cell (SVC) cultures leads to increased expression of BAT and beige cell signature genes. Strikingly, the Myf5-lineage cells in WAT are heterogeneous and contain distinct adipogenic [stem cell antigen 1(Sca1)-positive] and myogenic (Sca1-negative) progenitors. The latter differentiate robustly into myofibers in vitro and in vivo, and they restore dystrophin expression after transplantation into mdx mouse, a model for Duchenne muscular dystrophy. These results demonstrate the heterogeneity and functional differences of the Myf5- and non-Myf5-lineage cells in the white adipose tissue.

  6. Phylogenetic lineages in the Botryosphaeriaceae.

    Science.gov (United States)

    Crous, Pedro W; Slippers, Bernard; Wingfield, Michael J; Rheeder, John; Marasas, Walter F O; Philips, Alan J L; Alves, Artur; Burgess, Treena; Barber, Paul; Groenewald, Johannes Z

    2006-01-01

    Botryosphaeria is a species-rich genus with a cosmopolitan distribution, commonly associated with dieback and cankers of woody plants. As many as 18 anamorph genera have been associated with Botryosphaeria, most of which have been reduced to synonymy under Diplodia (conidia mostly ovoid, pigmented, thick-walled), or Fusicoccum (conidia mostly fusoid, hyaline, thin-walled). However, there are numerous conidial anamorphs having morphological characteristics intermediate between Diplodia and Fusicoccum, and there are several records of species outside the Botryosphaeriaceae that have anamorphs apparently typical of Botryosphaeria s.str. Recent studies have also linked Botryosphaeria to species with pigmented, septate ascospores, and Dothiorella anamorphs, or Fusicoccum anamorphs with Dichomera synanamorphs. The aim of this study was to employ DNA sequence data of the 28S rDNA to resolve apparent lineages within the Botryosphaeriaceae. From these data, 12 clades are recognised. Two of these lineages clustered outside the Botryosphaeriaceae, namely Diplodia-like anamorphs occurring on maize, which are best accommodated in Stenocarpella (Diaporthales), as well as an unresolved clade including species of Camarosporium/Microdiplodia. We recognise 10 lineages within the Botryosphaeriaceae, including an unresolved clade (Diplodia/Lasiodiplodia/Tiarosporella), Botryosphaeria s.str. (Fusicoccum anamorphs), Macrophomina, Neoscytalidium gen. nov., Dothidotthia (Dothiorella anamorphs), Neofusicoccum gen. nov. (Botryosphaeria-like teleomorphs, Dichomera-like synanamorphs), Pseudofusicoccum gen. nov., Saccharata (Fusicoccum- and Diplodia-like synanamorphs), "Botryosphaeria" quercuum (Diplodia-like anamorph), and Guignardia (Phyllosticta anamorphs). Separate teleomorph and anamorph names are not provided for newly introduced genera, even where both morphs are known. The taxonomy of some clades and isolates (e.g. B. mamane) remains unresolved due to the absence of ex-type cultures

  7. Origins, admixture and founder lineages in European Roma.

    Science.gov (United States)

    Martínez-Cruz, Begoña; Mendizabal, Isabel; Harmant, Christine; de Pablo, Rosario; Ioana, Mihai; Angelicheva, Dora; Kouvatsi, Anastasia; Makukh, Halyna; Netea, Mihai G; Pamjav, Horolma; Zalán, Andrea; Tournev, Ivailo; Marushiakova, Elena; Popov, Vesselin; Bertranpetit, Jaume; Kalaydjieva, Luba; Quintana-Murci, Lluis; Comas, David

    2016-06-01

    The Roma, also known as 'Gypsies', represent the largest and the most widespread ethnic minority of Europe. There is increasing evidence, based on linguistic, anthropological and genetic data, to suggest that they originated from the Indian subcontinent, with subsequent bottlenecks and undetermined gene flow from/to hosting populations during their diaspora. Further support comes from the presence of Indian uniparentally inherited lineages, such as mitochondrial DNA M and Y-chromosome H haplogroups, in a significant number of Roma individuals. However, the limited resolution of most genetic studies so far, together with the restriction of the samples used, have prevented the detection of other non-Indian founder lineages that might have been present in the proto-Roma population. We performed a high-resolution study of the uniparental genomes of 753 Roma and 984 non-Roma hosting European individuals. Roma groups show lower genetic diversity and high heterogeneity compared with non-Roma samples as a result of lower effective population size and extensive drift, consistent with a series of bottlenecks during their diaspora. We found a set of founder lineages, present in the Roma and virtually absent in the non-Roma, for the maternal (H7, J1b3, J1c1, M18, M35b, M5a1, U3, and X2d) and paternal (I-P259, J-M92, and J-M67) genomes. This lineage classification allows us to identify extensive gene flow from non-Roma to Roma groups, whereas the opposite pattern, although not negligible, is substantially lower (up to 6.3%). Finally, the exact haplotype matching analysis of both uniparental lineages consistently points to a Northwestern origin of the proto-Roma population within the Indian subcontinent. PMID:26374132

  8. Newly discovered sister lineage sheds light on early ant evolution

    OpenAIRE

    Rabeling, Christian; Brown, Jeremy M.; Verhaagh, Manfred

    2008-01-01

    Ants are the world's most conspicuous and important eusocial insects and their diversity, abundance, and extreme behavioral specializations make them a model system for several disciplines within the biological sciences. Here, we report the discovery of a new ant that appears to represent the sister lineage to all extant ants (Hymenoptera: Formicidae). The phylogenetic position of this cryptic predator from the soils of the Amazon rainforest was inferred from several nuclear genes, sequenced ...

  9. Braveheart, a Long Noncoding RNA Required for Cardiovascular Lineage Commitment

    OpenAIRE

    Klattenhoff, Carla A.; Scheuermann, Johanna C.; Surface, Lauren E.; Bradley, Robert K.; Fields, Paul A.; Steinhauser, Matthew L.; Ding, Huiming; Torrey, Lillian; Haas, Simon; Abo, Ryan; Tabebordbar, Mohammadsharif; Lee, Richard T.; Burge, Christopher B.; Butty, Vincent; Boyer, Laurie

    2013-01-01

    Long noncoding RNAs (lncRNAs) are often expressed in a development-specific manner, yet little is known about their roles in lineage commitment. Here, we identified Braveheart (Bvht), a heart-associated lncRNA in mouse. Using multiple embryonic stem cell (ESC) differentiation strategies, we show that Bvht is required for progression of nascent mesoderm toward a cardiac fate. We find that Bvht is necessary for activation of a core cardiovascular gene network and functions upstream of mesoderm ...

  10. Role of LRF/Pokemon in lineage fate decisions.

    Science.gov (United States)

    Lunardi, Andrea; Guarnerio, Jlenia; Wang, Guocan; Maeda, Takahiro; Pandolfi, Pier Paolo

    2013-04-11

    In the human genome, 43 different genes are found that encode proteins belonging to the family of the POK (poxvirus and zinc finger and Krüppel)/ZBTB (zinc finger and broad complex, tramtrack, and bric à brac) factors. Generally considered transcriptional repressors, several of these genes play fundamental roles in cell lineage fate decision in various tissues, programming specific tasks throughout the life of the organism. Here, we focus on functions of leukemia/lymphoma-related factor/POK erythroid myeloid ontogenic factor, which is probably one of the most exciting and yet enigmatic members of the POK/ZBTB family. PMID:23396304

  11. Polycomb enables primitive endoderm lineage priming in embryonic stem cells

    Science.gov (United States)

    Illingworth, Robert S; Hölzenspies, Jurriaan J; Roske, Fabian V; Bickmore, Wendy A; Brickman, Joshua M

    2016-01-01

    Mouse embryonic stem cells (ESCs), like the blastocyst from which they are derived, contain precursors of the epiblast (Epi) and primitive endoderm (PrEn) lineages. While transient in vivo, these precursor populations readily interconvert in vitro. We show that altered transcription is the driver of these coordinated changes, known as lineage priming, in a process that exploits novel polycomb activities. We find that intragenic levels of the polycomb mark H3K27me3 anti-correlate with changes in transcription, irrespective of the gene’s developmental trajectory or identity as a polycomb target. In contrast, promoter proximal H3K27me3 is markedly higher for PrEn priming genes. Consequently, depletion of this modification stimulates the degree to which ESCs are primed towards PrEn when challenged to differentiate, but has little effect on gene expression in self-renewing ESC culture. These observations link polycomb with dynamic changes in transcription and stalled lineage commitment, allowing cells to explore alternative choices prior to a definitive decision. DOI: http://dx.doi.org/10.7554/eLife.14926.001 PMID:27723457

  12. Functional Characterization of DNA Methylation in the Oligodendrocyte Lineage

    Directory of Open Access Journals (Sweden)

    Sarah Moyon

    2016-04-01

    Full Text Available Oligodendrocytes derive from progenitors (OPCs through the interplay of epigenomic and transcriptional events. By integrating high-resolution methylomics, RNA-sequencing, and multiple transgenic lines, this study defines the role of DNMT1 in developmental myelination. We detected hypermethylation of genes related to cell cycle and neurogenesis during differentiation of OPCs, yet genetic ablation of Dnmt1 resulted in inefficient OPC expansion and severe hypomyelination associated with ataxia and tremors in mice. This phenotype was not caused by lineage switch or massive apoptosis but was characterized by a profound defect of differentiation associated with changes in exon-skipping and intron-retention splicing events and by the activation of an endoplasmic reticulum stress response. Therefore, loss of Dnmt1 in OPCs is not sufficient to induce a lineage switch but acts as an important determinant of the coordination between RNA splicing and protein synthesis necessary for myelin formation.

  13. Inferring duplications, losses, transfers and incomplete lineage sorting with nonbinary species trees

    OpenAIRE

    Stolzer, Maureen; Lai, Han; Xu, Minli; Sathaye, Deepa; Vernot, Benjamin; Durand, Dannie

    2012-01-01

    Motivation: Gene duplication (D), transfer (T), loss (L) and incomplete lineage sorting (I) are crucial to the evolution of gene families and the emergence of novel functions. The history of these events can be inferred via comparison of gene and species trees, a process called reconciliation, yet current reconciliation algorithms model only a subset of these evolutionary processes. Results: We present an algorithm to reconcile a binary gene tree with a nonbinary species tree under a DTLI par...

  14. Research progress of mixed lineage leukemia gene partial tandem duplication in acute myeloid leukemia%混合谱系白血病基因部分串联重复在急性髓细胞白血病中的研究进展

    Institute of Scientific and Technical Information of China (English)

    卞梅茹; 陈伟

    2015-01-01

    混合谱系白血病(MLL)基因位于第11号染色体长臂2区3带(11q23),其编码产物为具有3 969个氨基酸残基的核蛋白.MLL蛋白最具特征性的功能为通过调节Hox基因表达水平决定细胞存活.急性白血病可发生MLL基因重排,其中MLL基因部分串联重复(MLL-PTD)为MLL基因重排中最为常见的形式之一,主要存在于核型正常及具有第11号染色体三体的急性髓细胞白血病(AML)中.作者拟就MLL基因结构、功能、MLL-PTD在AML发生、发展中的作用机制,及其可作为AML潜在治疗靶点等方面进行综述.%Mixed lineage leukemia (MLL) gene locats at chromosome 11q23 and encodes nucleoprotein with 3 969 amino acid residues.The most characteristic function of MLL protein is that it can regulate the expression level of Hox gene to determine cell survival.Acute leukemia could occur MLL gene rearrangements,and the MLL gene partial tandem duplication (MLL-PTD) is one of the most common forms of MLL gene rearrangement in acute leukemia.MLL-PTD mainly exists in the acute myeloid leukemia (AMLD with normal karyotype or trisomy 11.This article reviews literarues on MLL gene structure,function,the mechanism of MLL-PTD in the occurrence and development of AML and potential therapeutic targets of AML.

  15. Genotypic lineages and restriction fragment length polymorphism of canine distemper virus isolates in Thailand.

    Science.gov (United States)

    Radtanakatikanon, Araya; Keawcharoen, Juthatip; Charoenvisal, Na Taya; Poovorawan, Yong; Prompetchara, Eakachai; Yamaguchi, Ryoji; Techangamsuwan, Somporn

    2013-09-27

    Canine distemper virus (CDV) is known to cause multisystemic disease in all families of terrestrial carnivores. Attenuated live vaccines have been used to control CDV in a variety of species for many decades, yet a number of CDV infections in vaccinated dogs are still observed. The aims of this study were to investigate the genetic diversity of CDV lineages based on phosphoprotein (P), hemagglutinin (H) and fusion protein (F) genes and to develop the restriction fragment length polymorphism (RFLP) technique for effective differentiation among individual wild-type and vaccine lineages in Thailand. Four commercial vaccine products, thirteen conjunctival swabs and various tissues from 9 necropsied dogs suspected of having CDV infections were included. Virus isolation was performed using Vero cell expressing canine signaling lymphocyte activation molecules (Vero-DST cells). Reverse-transcription polymerase chain reaction (RT-PCR) on 3 gene regions from the dog derived specimens and the vaccines were carried out, then RFLP analysis upon F-gene amplified fragments was developed. Nucleotide sequence and phylogenetic analysis were compared with other CDV lineages in Genbank. Phylogenetic relationships revealed that CDV field isolates were separated from the vaccine lineage and could be divided into two clusters; one of which belonged to the Asia-1 lineage and another, not related to any previous recognized lineages was proposed as 'Asia-4'. RFLP patterns demonstrating concordance with phylogenetic trees of the distemper virus allowed for differentiation between the Asia-1, Asia-4 and vaccine lineages. Thus, RFLP technique is able to effectively distinguish individual wild-type canine distemper virus from vaccine lineages in Thailand.

  16. An analysis of correspondence between unique rabies virus variants and divergent big brown bat (Eptesicus fuscus) mitochondrial DNA lineages

    Science.gov (United States)

    Neubaum, M.A.; Shankar, V.; Douglas, M.R.; Douglas, M.E.; O'Shea, T.J.; Rupprecht, C.E.

    2008-01-01

    The literature supports that unique rabies virus (RABV) variants are often compartmentalized in different species of bats. In Colorado, two divergent mtDNA lineages of big brown bats (Eptesicus fuscus) co-occur. RABV associated with this species also segregates into two clades. We hypothesized that unique RABV variants might be associated with mtDNA lineages of Colorado big brown bats. DNA was extracted from brain tissue of rabid big brown bats, the ND2 gene was amplified to determine mtDNA lineage, and the lineage was compared to a previously derived phylogenetic analysis of the RABV N gene. No correspondence was found between host bat lineage and RABV variant. ?? 2008 Springer-Verlag.

  17. Evolution of a reassortant North American gull influenza virus lineage: drift, shift and stability

    Science.gov (United States)

    Hall, Jeffrey S.; TeSlaa, Joshua L.; Nashold, Sean W.; Halpin, Rebecca A.; Stockwell, Timothy; Wentworth, David E.; Dugan, Vivien; Ip, Hon S.

    2013-01-01

    Background: The role of gulls in the ecology of avian influenza (AI) is different than that of waterfowl. Different constellations of subtypes circulate within the two groups of birds and AI viruses isolated from North American gulls frequently possess reassortant genomes with genetic elements from both North America and Eurasian lineages. A 2008 isolate from a Newfoundland Great Black-backed Gull contained a mix of North American waterfowl, North American gull and Eurasian lineage genes. Methods: We isolated, sequenced and phylogenetically compared avian influenza viruses from 2009 Canadian wild birds. Results: We analyzed six 2009 virus isolates from Canada and found the same phylogenetic lineage had persisted over a larger geographic area, with an expanded host range that included dabbling and diving ducks as well as gulls. All of the 2009 virus isolates contained an internal protein coding set of genes of the same Eurasian lineage genes except PB1 that was from a North American lineage, and these genes continued to evolve by genetic drift. We show evidence that the 2008 Great Black-backed Gull virus was derived from this lineage with a reassortment of a North American PA gene into the more stable core set of internal protein coding genes that has circulated in avian populations for at least 2 years. From this core, the surface glycoprotein genes have switched several times creating H13N6, H13N2, and H16N3 subtypes. These gene segments were from North American lineages except for the H16 and N3 vRNAs. Conclusions: This process appears similar to genetic shifts seen with swine influenza where a stable "triple reassortant internal gene" core has circulated in swine populations with genetic shifts occurring with hemaggluttinin and neuraminidase proteins getting periodically switched. Thus gulls may serve as genetic mixing vessels for different lineages of avian influenza, similar to the role of swine with regards to human influenza. These findings illustrate the

  18. Lineage Selection and the Maintenance of Sex.

    Directory of Open Access Journals (Sweden)

    Damien M de Vienne

    Full Text Available Sex predominates in eukaryotes, despite its short-term disadvantage when compared to asexuality. Myriad models have suggested that short-term advantages of sex may be sufficient to counterbalance its twofold costs. However, despite decades of experimental work seeking such evidence, no evolutionary mechanism has yet achieved broad recognition as explanation for the maintenance of sex. We explore here, through lineage-selection models, the conditions favouring the maintenance of sex. In the first model, we allowed the rate of transition to asexuality to evolve, to determine whether lineage selection favoured species with the strongest constraints preventing the loss of sex. In the second model, we simulated more explicitly the mechanisms underlying the higher extinction rates of asexual lineages than of their sexual counterparts. We linked extinction rates to the ecological and/or genetic features of lineages, thereby providing a formalisation of the only figure included in Darwin's "The origin of species". Our results reinforce the view that the long-term advantages of sex and lineage selection may provide the most satisfactory explanations for the maintenance of sex in eukaryotes, which is still poorly recognized, and provide figures and a simulation website for training and educational purposes. Short-term benefits may play a role, but it is also essential to take into account the selection of lineages for a thorough understanding of the maintenance of sex.

  19. Postembryonic lineages of the Drosophila brain: II. Identification of lineage projection patterns based on MARCM clones

    OpenAIRE

    Wong, Darren C.; Lovick, Jennifer K.; Ngo, Kathy T.; Borisuthirattana, Wichanee; Omoto, Jaison J.; Hartenstein, Volker

    2013-01-01

    The Drosophila central brain is largely composed of lineages, units of sibling neurons derived from a single progenitor cell or neuroblast. During the early embryonic period neuroblast generate the primary neurons that constitute the larval brain. Neuroblasts reactivate in the larva, adding to their lineages a large number of secondary neurons which, according to previous studies in which selected lineages were labeled by stably expressed markers, differentiate during metamorphosis, sending t...

  20. Constrained body shape among highly genetically divergent allopatric lineages of the supralittoral isopod Ligia occidentalis (Oniscidea).

    Science.gov (United States)

    Santamaria, Carlos A; Mateos, Mariana; DeWitt, Thomas J; Hurtado, Luis A

    2016-03-01

    Multiple highly divergent lineages have been identified within Ligia occidentalis sensu lato, a rocky supralittoral isopod distributed along a ~3000 km latitudinal gradient that encompasses several proposed marine biogeographic provinces and ecoregions in the eastern Pacific. Highly divergent lineages have nonoverlapping geographic distributions, with distributional limits that generally correspond with sharp environmental changes. Crossbreeding experiments suggest postmating reproductive barriers exist among some of them, and surveys of mitochondrial and nuclear gene markers do not show evidence of hybridization. Populations are highly isolated, some of which appear to be very small; thus, the effects of drift are expected to reduce the efficiency of selection. Large genetic divergences among lineages, marked environmental differences in their ranges, reproductive isolation, and/or high isolation of populations may have resulted in morphological differences in L. occidentalis, not detected yet by traditional taxonomy. We used landmark-based geometric morphometric analyses to test for differences in body shape among highly divergent lineages of L. occidentalis, and among populations within these lineages. We analyzed a total of 492 individuals from 53 coastal localities from the southern California Bight to Central Mexico, including the Gulf of California. We conducted discriminant function analyses (DFAs) on body shape morphometrics to assess morphological variation among genetically differentiated lineages and their populations. We also tested for associations between phylogeny and morphological variation, and whether genetic divergence is correlated to multivariate morphological divergence. We detected significant differences in body shape among highly divergent lineages, and among populations within these lineages. Nonetheless, neither lineages nor populations can be discriminated on the basis of body shape, because correct classification rates of cross

  1. Testing for intraspecific postzygotic isolation between cryptic lineages of Pseudacris crucifer.

    Science.gov (United States)

    Stewart, Kathryn A; Lougheed, Stephen C

    2013-11-01

    Phenotypically cryptic lineages appear common in nature, yet little is known about the mechanisms that initiate and/or maintain barriers to gene flow, or how secondary contact between them might influence evolutionary trajectories. The consequences of such contact between diverging lineages depend on hybrid fitness, highlighting the potential for postzygotic isolating barriers to play a role in the origins of biological species. Previous research shows that two cryptic, deeply diverged intraspecific mitochondrial lineages of a North American chorus frog, the spring peeper (Pseudacris crucifer), meet in secondary contact in Southwestern Ontario, Canada. Our study quantified hatching success, tadpole survival, size at metamorphosis, and development time for experimentally generated pure lineage and hybrid tadpoles. Results suggest that lineages differ in tadpole survival and that F1 hybrids may have equal fitness and higher than average mass at metamorphosis compared with pure parental crosses. These findings imply hybrid early life viability may not be the pivotal reproductive isolation barrier helping to maintain lineage boundaries. However, we observed instances of tadpole gigantism, failure to metamorphose, and bent tails in some tadpoles from hybrid families. We also speculate and provide some evidence that apparent advantages or similarities of hybrids compared with pure lineage tadpoles may disappear when tadpoles are raised with competitors of different genetic makeup. This pilot study implies that ecological context and consideration of extrinsic factors may be a key to revealing mechanisms causing negative hybrid fitness during early life stages, a provocative avenue for future investigations on barriers to gene flow among these intraspecific lineages. PMID:24363891

  2. Postembryonic lineages of the Drosophila brain: I. Development of the lineage-associated fiber tracts.

    Science.gov (United States)

    Lovick, Jennifer K; Ngo, Kathy T; Omoto, Jaison J; Wong, Darren C; Nguyen, Joseph D; Hartenstein, Volker

    2013-12-15

    Neurons of the Drosophila central brain fall into approximately 100 paired groups, termed lineages. Each lineage is derived from a single asymmetrically-dividing neuroblast. Embryonic neuroblasts produce 1,500 primary neurons (per hemisphere) that make up the larval CNS followed by a second mitotic period in the larva that generates approximately 10,000 secondary, adult-specific neurons. Clonal analyses based on previous works using lineage-specific Gal4 drivers have established that such lineages form highly invariant morphological units. All neurons of a lineage project as one or a few axon tracts (secondary axon tracts, SATs) with characteristic trajectories, thereby representing unique hallmarks. In the neuropil, SATs assemble into larger fiber bundles (fascicles) which interconnect different neuropil compartments. We have analyzed the SATs and fascicles formed by lineages during larval, pupal, and adult stages using antibodies against membrane molecules (Neurotactin/Neuroglian) and synaptic proteins (Bruchpilot/N-Cadherin). The use of these markers allows one to identify fiber bundles of the adult brain and associate them with SATs and fascicles of the larval brain. This work lays the foundation for assigning the lineage identity of GFP-labeled MARCM clones on the basis of their close association with specific SATs and neuropil fascicles, as described in the accompanying paper (Wong et al., 2013. Postembryonic lineages of the Drosophila brain: II. Identification of lineage projection patterns based on MARCM clones. Submitted.). PMID:23880429

  3. RT-PCR ANALYSIS OF E2A-PBX1, TEL-AML1, BCR-ABL AND MLL-AF4 FUSION GENE TRANSCRIPTS IN B-LINEAGE ACUTE LYMPHOBLASTIC LEUKEMIA

    Directory of Open Access Journals (Sweden)

    Iuliu-Cristian Ivanov

    2013-11-01

    Full Text Available Acute lymphoblastic leukemia represents a heterogeneous group of hematological malignancies, defined by clonal proliferation of lymphoid cells. Immunophenotyping by flow cytometry and molecular analysis for the detection of genetic anomalies are clinical standard procedures for diagnosis, sub-classification and post-therapeutic evaluation. Samples from 105 patients diagnosed with acute lymphoblastic leukemia were immunophenotyped at diagnosis and were investigated by molecular analysis in order to identify the occurrence of four fusion genes: MLL-AF4, TEL-AML-1, BCR-ABL-p190, E2A-PBX-1. There were no associations found between the immunophenotype and the presence of any fusion genes evaluated. Both methods in combination remain a prerequisite for an improved subclassification of hematological malignancies, therapeutic decision, and evaluation of treatment response.

  4. A continuum of cell states spans pluripotency and lineage commitment in human embryonic stem cells.

    Directory of Open Access Journals (Sweden)

    Shelley R Hough

    Full Text Available BACKGROUND: Commitment in embryonic stem cells is often depicted as a binary choice between alternate cell states, pluripotency and specification to a particular germ layer or extraembryonic lineage. However, close examination of human ES cell cultures has revealed significant heterogeneity in the stem cell compartment. METHODOLOGY/PRINCIPAL FINDINGS: We isolated subpopulations of embryonic stem cells using surface markers, then examined their expression of pluripotency genes and lineage specific transcription factors at the single cell level, and tested their ability to regenerate colonies of stem cells. Transcript analysis of single embryonic stem cells showed that there is a gradient and a hierarchy of expression of pluripotency genes in the population. Even cells at the top of the hierarchy generally express only a subset of the stem cell genes studied. Many cells co-express pluripotency and lineage specific genes. Cells along the continuum show a progressively decreasing likelihood of self renewal as their expression of stem cell surface markers and pluripotency genes wanes. Most cells that are positive for stem cell surface markers express Oct-4, but only those towards the top of the hierarchy express the nodal receptor TDGF-1 and the growth factor GDF3. SIGNIFICANCE: These findings on gene expression in single embryonic stem cells are in concert with recent studies of early mammalian development, which reveal molecular heterogeneity and a stochasticity of gene expression in blastomeres. Our work indicates that only a small fraction of the population resides at the top of the hierarchy, that lineage priming (co-expression of stem cell and lineage specific genes characterizes pluripotent stem cell populations, and that extrinsic signaling pathways are upstream of transcription factor networks that control pluripotency.

  5. Genome analyses of an aggressive and invasive lineage of the Irish potato famine pathogen.

    Directory of Open Access Journals (Sweden)

    David E L Cooke

    Full Text Available Pest and pathogen losses jeopardise global food security and ever since the 19(th century Irish famine, potato late blight has exemplified this threat. The causal oomycete pathogen, Phytophthora infestans, undergoes major population shifts in agricultural systems via the successive emergence and migration of asexual lineages. The phenotypic and genotypic bases of these selective sweeps are largely unknown but management strategies need to adapt to reflect the changing pathogen population. Here, we used molecular markers to document the emergence of a lineage, termed 13_A2, in the European P. infestans population, and its rapid displacement of other lineages to exceed 75% of the pathogen population across Great Britain in less than three years. We show that isolates of the 13_A2 lineage are among the most aggressive on cultivated potatoes, outcompete other aggressive lineages in the field, and overcome previously effective forms of plant host resistance. Genome analyses of a 13_A2 isolate revealed extensive genetic and expression polymorphisms particularly in effector genes. Copy number variations, gene gains and losses, amino-acid replacements and changes in expression patterns of disease effector genes within the 13_A2 isolate likely contribute to enhanced virulence and aggressiveness to drive this population displacement. Importantly, 13_A2 isolates carry intact and in planta induced Avrblb1, Avrblb2 and Avrvnt1 effector genes that trigger resistance in potato lines carrying the corresponding R immune receptor genes Rpi-blb1, Rpi-blb2, and Rpi-vnt1.1. These findings point towards a strategy for deploying genetic resistance to mitigate the impact of the 13_A2 lineage and illustrate how pathogen population monitoring, combined with genome analysis, informs the management of devastating disease epidemics.

  6. GENOMIC INSIGHTS INTO EVOLUTIONARY RELATIONSHIPS AMONG HETEROKONT LINEAGES EMPHASIZING THE PHAEOPHYCEAE(1).

    Science.gov (United States)

    Phillips, Naomi; Calhoun, Samantha; Moustafa, Ahmed; Bhattacharya, Debashish; Braun, Edward L

    2008-02-01

    Heterokonts comprise a large and diverse group of organisms unified by the heterokont biflagellate condition. Monophyly of many of these lineages is well established, but evolutionary relationships among the various lineages remain elusive. Among these lineages, the brown algae (Phaeophyceae) are a monophyletic, taxonomically diverse, and ecologically critical group common to marine environments. Despite their biological and scientific importance, consensus regarding brown algal phylogeny and taxonomic relationships is missing. Our long-term research goal is to produce a well-resolved taxon-rich phylogeny of the class to assess evolutionary patterns and taxonomic relationships among brown algal lineages and their relationship to other closely related heterokont groups. To accomplish this goal and augment existing loci for phaeophycean-wide systematic studies, we generated expressed sequence tags (ESTs) from several major brown algal lineages and from the heterokont lineage representing the closest sister group to brown algae. To date, we have successfully constructed cDNA libraries for two lineages (Choristocarpus tenellus Zanardini and Schizocladia ischiensis E. C. Henry, Okuda et H. Kawai) and in the library test phase obtained up to 1,600 ESTs per organism. Annotation results showed a gene discovery rate of 45%-50% for each library revealing 500-700 unique genes from each organism. We have identified several potential genes for phylogenetic inference and used these loci for preliminary molecular clock analyses. Our molecular clock analysis suggests that the basal divergence in brown algae occurred around the time of the pennate-centric diatom divergence. Here we report this analysis and other uses of ESTs in brown algal phylogenomics and the utility of these data for resolving the phylogeny of this group.

  7. The Korarchaeota: Archaeal orphans representing an ancestral lineage of life

    Energy Technology Data Exchange (ETDEWEB)

    Elkins, James G.; Kunin, Victor; Anderson, Iain; Barry, Kerrie; Goltsman, Eugene; Lapidus, Alla; Hedlund, Brian; Hugenholtz, Phil; Kyrpides, Nikos; Graham, David; Keller, Martin; Wanner, Gerhard; Richardson, Paul; Stetter, Karl O.

    2007-05-01

    Based on conserved cellular properties, all life on Earth can be grouped into different phyla which belong to the primary domains Bacteria, Archaea, and Eukarya. However, tracing back their evolutionary relationships has been impeded by horizontal gene transfer and gene loss. Within the Archaea, the kingdoms Crenarchaeota and Euryarchaeota exhibit a profound divergence. In order to elucidate the evolution of these two major kingdoms, representatives of more deeply diverged lineages would be required. Based on their environmental small subunit ribosomal (ss RNA) sequences, the Korarchaeota had been originally suggested to have an ancestral relationship to all known Archaea although this assessment has been refuted. Here we describe the cultivation and initial characterization of the first member of the Korarchaeota, highly unusual, ultrathin filamentous cells about 0.16 {micro}m in diameter. A complete genome sequence obtained from enrichment cultures revealed an unprecedented combination of signature genes which were thought to be characteristic of either the Crenarchaeota, Euryarchaeota, or Eukarya. Cell division appears to be mediated through a FtsZ-dependent mechanism which is highly conserved throughout the Bacteria and Euryarchaeota. An rpb8 subunit of the DNA-dependent RNA polymerase was identified which is absent from other Archaea and has been described as a eukaryotic signature gene. In addition, the representative organism possesses a ribosome structure typical for members of the Crenarchaeota. Based on its gene complement, this lineage likely diverged near the separation of the two major kingdoms of Archaea. Further investigations of these unique organisms may shed additional light onto the evolution of extant life.

  8. 3T3-L1 adipocytes display phenotypic characteristics of multiple adipocyte lineages

    Science.gov (United States)

    Morrison, Shona; McGee, Sean L

    2015-01-01

    Differentiated 3T3-L1 adipocytes are a widely used in vitro model of white adipocytes. In addition to classical white and brown adipocytes that are derived from different cell lineages, beige adipocytes have also been identified, which have characteristics of both white and brown adipocytes. Here we show that 3T3-L1 adipocytes display features of multiple adipocytes lineages. While the gene expression profile and basal bioenergetics of 3T3-L1 adipocytes was typical of white adipocytes, they responded acutely to catecholamines by increasing oxygen consumption in an UCP1-dependent manner, and by increasing the expression of genes enriched in brown but not beige adipocytes. Chronic exposure to catecholamines exacerbated this phenotype. However, a beige adipocyte differentiation procedure did not induce a beige adipocyte phenotype in 3T3-L1 fibroblasts. These multiple lineage features should be considered when interpreting data from experiments utilizing 3T3-L1 adipocytes. PMID:26451286

  9. Determining Lineage Pathways from Cellular Barcoding Experiments

    Directory of Open Access Journals (Sweden)

    Leïla Perié

    2014-02-01

    Full Text Available Cellular barcoding and other single-cell lineage-tracing strategies form experimental methodologies for analysis of in vivo cell fate that have been instrumental in several significant recent discoveries. Due to the highly nonlinear nature of proliferation and differentiation, interrogation of the resulting data for evaluation of potential lineage pathways requires a new quantitative framework complete with appropriate statistical tests. Here, we develop such a framework, illustrating its utility by analyzing data from barcoded multipotent cells of the blood system. This application demonstrates that the data require additional paths beyond those found in the classical model, which leads us to propose that hematopoietic differentiation follows a loss of potential mechanism and to suggest further experiments to test this deduction. Our quantitative framework can evaluate the compatibility of lineage trees with barcoded data from any proliferating and differentiating cell system.

  10. Two evolutionary lineages: Machiavellian and Bohrian intelligence

    CERN Document Server

    Skopec, Robert

    2007-01-01

    Two evolutionary lineages: Machiavellian and Bohrian intelligence Mutation and natural selection are the two most basic processes of evolution, yet the study of their interplay remains a challenge for theoretical and empirical research. Darwinian evolution favors genotypes with high replication rates, a process called survival of the fittest representing lineage of the Machiavellian inteligence. According to quasi-species theory, selection favors the cloud of genotypes, interconnected by mutation, whose average replication rate is highest: mutation acts as a selective agent to shape the entire genome so that is robust with respect to mutation. Thus survival of the flattest and inventivest representing lineage of the Bohrian intelligence at high mutation rates. Quasi-species theory predicts that, under appropriate conditions (high mutation pressure), such a mutation can be fixed in an evolving population, despite its lower replication rate.

  11. SIRPA, VCAM1 and CD34 identify discrete lineages during early human cardiovascular development

    Directory of Open Access Journals (Sweden)

    Rhys J.P. Skelton

    2014-07-01

    Full Text Available The study of human cardiogenesis would benefit from a detailed cell lineage fate map akin to that established for the haematopoietic lineages. Here we sought to define cell lineage relationships based on the expression of NKX2-5 and the cell surface markers VCAM1, SIRPA and CD34 during human cardiovascular development. Expression of NKX2-5GFP was used to identify cardiac progenitors and cardiomyocytes generated during the differentiation of NKX2-5GFP/w human embryonic stem cells (hESCs. Cardiovascular cell lineages sub-fractionated on the basis of SIRPA, VCAM1 and CD34 expression were assayed for differentiation potential and gene expression. The NKX2-5posCD34pos population gave rise to endothelial cells that rapidly lost NKX2-5 expression in culture. Conversely, NKX2-5 expression was maintained in myocardial committed cells, which progressed from being NKX2-5posSIRPApos to NKX2-5posSIRPAposVCAM1pos. Up-regulation of VCAM1 was accompanied by the expression of myofilament markers and reduced clonal capacity, implying a restriction of cell fate potential. Combinatorial expression of NKX2-5, SIRPA, VCAM1 and CD34 can be used to define discrete stages of cardiovascular cell lineage differentiation. These markers identify specific stages of cardiomyocyte and endothelial lineage commitment and, thus provide a scaffold for establishing a fate map of early human cardiogenesis.

  12. Telonemia, a new protist phylum with affinity to chromist lineages

    DEFF Research Database (Denmark)

    Shalchian-Tabrizi, K.; Eikrem, W.; Klaveness, D.;

    2006-01-01

    , such as the alveolates and heterokonts. Using the same approach on coastal samples, we have identified a novel group of protist small subunit (SSU) rDNA sequences that do not correspond to any phylogenetic group previously identified. Comparison with other sequences obtained from cultures of heterotrophic protists...... showed that the environmental sequences grouped together with Telonema, a genus known since 1913 but of uncertain taxonomic affinity. Phylogenetic analyses using four genes (SSU, Hsp90, alpha-tubulin and beta-tubulin), and accounting for gamma- and covarion-distributed substitution rates, revealed...... Telonema as a distinct group of species branching off close to chromist lineages. Consistent with these gene trees, Telonema possesses ultrastructures revealing both the distinctness of the group and the evolutionary affinity to chromist groups. Altogether, the data suggest that Telonema constitutes a new...

  13. Patterns of growth and tract formation during the early development of secondary lineages in the Drosophila larval brain.

    Science.gov (United States)

    Lovick, Jennifer K; Kong, Angel; Omoto, Jaison J; Ngo, Kathy T; Younossi-Hartenstein, Amelia; Hartenstein, Volker

    2016-04-01

    The Drosophila brain consists of a relatively small number of invariant, genetically determined lineages which provide a model to study the relationship between gene function and neuronal architecture. In following this long-term goal, we reconstruct the morphology (projection pattern and connectivity) and gene expression patterns of brain lineages throughout development. In this article, we focus on the secondary phase of lineage morphogenesis, from the reactivation of neuroblast proliferation in the first larval instar to the time when proliferation ends and secondary axon tracts have fully extended in the late third larval instar. We have reconstructed the location and projection of secondary lineages at close (4 h) intervals and produced a detailed map in the form of confocal z-projections and digital three-dimensional models of all lineages at successive larval stages. Based on these reconstructions, we could compare the spatio-temporal pattern of axon formation and morphogenetic movements of different lineages in normal brain development. In addition to wild type, we reconstructed lineage morphology in two mutant conditions. (1) Expressing the construct UAS-p35 which rescues programmed cell death we could systematically determine which lineages normally lose hemilineages to apoptosis. (2) so-Gal4-driven expression of dominant-negative EGFR ablated the optic lobe, which allowed us to conclude that the global centrifugal movement normally affecting the cell bodies of lateral lineages in the late larva is causally related to the expansion of the optic lobe, and that the central pattern of axonal projections of these lineages is independent of the presence or absence of the optic lobe. PMID:26178322

  14. Lineage-affiliated transcription factors bind the Gata3 Tce1 enhancer to mediate lineage-specific programs

    Science.gov (United States)

    Ohmura, Sakie; Mizuno, Seiya; Oishi, Hisashi; Ku, Chia-Jui; Hermann, Mary; Hosoya, Tomonori; Takahashi, Satoru; Engel, James Douglas

    2016-01-01

    The transcription factor GATA3 is essential for the genesis and maturation of the T cell lineage, and GATA3 dysregulation has pathological consequences. Previous studies have shown that GATA3 function in T cell development is regulated by multiple signaling pathways and that the Notch nuclear effector, RBP-J, binds specifically to the Gata3 promoter. We previously identified a T cell–specific Gata3 enhancer (Tce1) lying 280 kb downstream from the structural gene and demonstrated in transgenic mice that Tce1 promoted T lymphocyte–specific transcription of reporter genes throughout T cell development; however, it was not clear if Tce1 is required for Gata3 transcription in vivo. Here, we determined that the canonical Gata3 promoter is insufficient for Gata3 transcriptional activation in T cells in vivo, precluding the possibility that promoter binding by a host of previously implicated transcription factors alone is responsible for Gata3 expression in T cells. Instead, we demonstrated that multiple lineage-affiliated transcription factors bind to Tce1 and that this enhancer confers T lymphocyte–specific Gata3 activation in vivo, as targeted deletion of Tce1 in a mouse model abrogated critical functions of this T cell–regulatory element. Together, our data show that Tce1 is both necessary and sufficient for critical aspects of Gata3 T cell–specific transcriptional activity. PMID:26808502

  15. Lineage-affiliated transcription factors bind the Gata3 Tce1 enhancer to mediate lineage-specific programs.

    Science.gov (United States)

    Ohmura, Sakie; Mizuno, Seiya; Oishi, Hisashi; Ku, Chia-Jui; Hermann, Mary; Hosoya, Tomonori; Takahashi, Satoru; Engel, James Douglas

    2016-03-01

    The transcription factor GATA3 is essential for the genesis and maturation of the T cell lineage, and GATA3 dysregulation has pathological consequences. Previous studies have shown that GATA3 function in T cell development is regulated by multiple signaling pathways and that the Notch nuclear effector, RBP-J, binds specifically to the Gata3 promoter. We previously identified a T cell-specific Gata3 enhancer (Tce1) lying 280 kb downstream from the structural gene and demonstrated in transgenic mice that Tce1 promoted T lymphocyte-specific transcription of reporter genes throughout T cell development; however, it was not clear if Tce1 is required for Gata3 transcription in vivo. Here, we determined that the canonical Gata3 promoter is insufficient for Gata3 transcriptional activation in T cells in vivo, precluding the possibility that promoter binding by a host of previously implicated transcription factors alone is responsible for Gata3 expression in T cells. Instead, we demonstrated that multiple lineage-affiliated transcription factors bind to Tce1 and that this enhancer confers T lymphocyte-specific Gata3 activation in vivo, as targeted deletion of Tce1 in a mouse model abrogated critical functions of this T cell-regulatory element. Together, our data show that Tce1 is both necessary and sufficient for critical aspects of Gata3 T cell-specific transcriptional activity.

  16. Combinatorial decoding of the invariant C. elegans embryonic lineage in space and time.

    Science.gov (United States)

    Zacharias, Amanda L; Murray, John Isaac

    2016-04-01

    Understanding how a single cell, the zygote, can divide and differentiate to produce the diverse animal cell types is a central goal of developmental biology research. The model organism Caenorhabditis elegans provides a system that enables a truly comprehensive understanding of this process across all cells. Its invariant cell lineage makes it possible to identify all of the cells in each individual and compare them across organisms. Recently developed methods automate the process of cell identification, allowing high-throughput gene expression characterization and phenotyping at single cell resolution. In this Review, we summarize the sequences of events that pattern the lineage including establishment of founder cell identity, the signaling pathways that diversify embryonic fate, and the regulators involved in patterning within these founder lineages before cells adopt their terminal fates. We focus on insights that have emerged from automated approaches to lineage tracking, including insights into mechanisms of robustness, context-specific regulation of gene expression, and temporal coordination of differentiation. We suggest a model by which lineage history produces a combinatorial code of transcription factors that act, often redundantly, to ensure terminal fate.

  17. MLL-AF9-mediated immortalization of human hematopoietic cells along different lineages changes during ontogeny

    NARCIS (Netherlands)

    Horton, S J; Jaques, J; Woolthuis, C; van Dijk, J; Mesuraca, M; Huls, G; Morrone, G; Vellenga, E; Schuringa, J J

    2013-01-01

    The MLL-AF9 fusion gene is associated with aggressive leukemias of both the myeloid and lymphoid lineage in infants, whereas in adults, this translocation is mainly associated with acute myeloid leukemia. These observations suggest that differences exist between fetal and adult tissues in terms of t

  18. MLL-AF9-mediated immortalization of human hematopoietic cells along different lineages changes during ontogeny.

    NARCIS (Netherlands)

    Horton, S.J.; Jaques, J.; Woolthuis, C.; Dijk, J. van; Mesuraca, M.; Huls, G.A.; Morrone, G.; Vellenga, E.; Schuringa, J.J.

    2013-01-01

    The MLL-AF9 fusion gene is associated with aggressive leukemias of both the myeloid and lymphoid lineage in infants, whereas in adults, this translocation is mainly associated with acute myeloid leukemia. These observations suggest that differences exist between fetal and adult tissues in terms of t

  19. Expression of P190 and P210 BCR/ABL1 in normal human CD34(+) cells induces similar gene expression profiles and results in a STAT5-dependent expansion of the erythroid lineage

    DEFF Research Database (Denmark)

    Järås, Marcus; Johnels, Petra; Agerstam, Helena;

    2009-01-01

    and systematically compared the effects of retroviral P190 BCR/ABL1 and P210 BCR/ABL1 expression on cell proliferation, differentiation, and global gene expression in human CD34(+) cells from cord blood. RESULTS: Expression of either P190 BCR/ABL1 or P210 BCR/ABL1 resulted in expansion of erythroid cells...... and stimulated erythropoietin-independent burst-forming unit-erythroid colony formation. By using a lentiviral anti-signal transducer and activator of transcription 5 (STAT5) short-hairpin RNA, we found that both P190 BCR/ABL1- and P210 BCR/ABL1-induced erythroid cell expansion were STAT5-dependent. Under...... that the early cellular and transcriptional effects of P190 BCR/ABL1 and P210 BCR/ABL1 expression are very similar when they are expressed in the same human progenitor cell population, and that STAT5 is an important regulator of BCR/ABL1-induced erythroid cell expansion....

  20. Genetic variation between Schistosoma japonicum lineages from lake and mountainous regions in China revealed by resequencing whole genomes.

    Science.gov (United States)

    Yin, Mingbo; Liu, Xiao; Xu, Bin; Huang, Jian; Zheng, Qi; Yang, Zhong; Feng, Zheng; Han, Ze-Guang; Hu, Wei

    2016-09-01

    Schistosoma infection is a major cause of morbidity and mortality worldwide. Schistosomiasis japonica is endemic in mainland China along the Yangtze River, typically distributed in two geographical categories of lake and mountainous regions. Study on schistosome genetic diversity is of interest in respect of understanding parasite biology and transmission, and formulating control strategy. Certain genetic variations may be associated with adaptations to different ecological habitats. The aim of this study is to gain insight into Schistosoma japonicum genetic variation, evolutionary origin and associated causes of different geographic lineages through examining homozygous Single Nucleotide Polymorphisms (SNPs) based on resequenced genome data. We collected S. japonicum samples from four sites, three in the lake regions (LR) of mid-east (Guichi and Tonglin in Anhui province, Laogang in Hunan province) and one in mountainous region (MR) (Xichang in Sichuan province) of south-west of China, resequenced their genomes using Next Generation Sequencing (NGS) technology, and made use of the available database of S. japonicum draft genomic sequence as a reference in genome mapping. A total of 14,575 SNPs from 2059 genes were identified in the four lineages. Phylogenetic analysis confirmed significant genetic variation exhibited between the different geographical lineages, and further revealed that the MR Xichang lineage is phylogenetically closer to LR Guich lineage than to other two LR lineages, and the MR lineage might be evolved from LR lineages. More than two thirds of detected SNPs were nonsynonymous; functional annotation of the SNP-containing genes showed that they are involved mainly in biological processes such as signaling and response to stimuli. Notably, unique nonsynonymous SNP variations were detected in 66 genes of MR lineage, inferring possible genetic adaption to mountainous ecological condition. PMID:27207135

  1. Lineage-specific evolution of Methylthioalkylmalate synthases (MAMs involved in glucosinolates biosynthesis

    Directory of Open Access Journals (Sweden)

    Jifang eZhang

    2015-02-01

    Full Text Available Methylthioalkylmalate synthases (MAMs encoded by MAM genes are central to the diversification of the glucosinolates, which are important secondary metabolites in Brassicaceae species. However, the evolutionary pathway of MAM genes is poorly understood. We analyzed the phylogenetic and synteny relationships of MAM genes from 13 sequenced Brassicaceae species. Based on these analyses, we propose that the syntenic loci of MAM genes, which underwent frequent tandem duplications, divided into two independent lineage-specific evolution routes and were driven by positive selection after the divergence from Aethionema arabicum. In the lineage I species Capsella rubella, Camelina sativa, Arabidopsis lyrata, and A. thaliana, the MAM loci evolved three tandem genes encoding enzymes responsible for the biosynthesis of aliphatic glucosinolates with different carbon chain-lengths. In lineage II species, the MAM loci encode enzymes responsible for the biosynthesis of short-chain aliphatic glucosinolates. Our proposed model of the evolutionary pathway of MAM genes will be useful for understanding the specific function of these genes in Brassicaceae species.

  2. Postembryonic lineages of the Drosophila brain: II. Identification of lineage projection patterns based on MARCM clones.

    Science.gov (United States)

    Wong, Darren C; Lovick, Jennifer K; Ngo, Kathy T; Borisuthirattana, Wichanee; Omoto, Jaison J; Hartenstein, Volker

    2013-12-15

    The Drosophila central brain is largely composed of lineages, units of sibling neurons derived from a single progenitor cell or neuroblast. During the early embryonic period, neuroblasts generate the primary neurons that constitute the larval brain. Neuroblasts reactivate in the larva, adding to their lineages a large number of secondary neurons which, according to previous studies in which selected lineages were labeled by stably expressed markers, differentiate during metamorphosis, sending terminal axonal and dendritic branches into defined volumes of the brain neuropil. We call the overall projection pattern of neurons forming a given lineage the "projection envelope" of that lineage. By inducing MARCM clones at the early larval stage, we labeled the secondary progeny of each neuroblast. For the supraesophageal ganglion excluding mushroom body (the part of the brain investigated in the present work) we obtained 81 different types of clones. Based on the trajectory of their secondary axon tracts (described in the accompanying paper, Lovick et al., 2013), we assigned these clones to specific lineages defined in the larva. Since a labeled clone reveals all aspects (cell bodies, axon tracts, terminal arborization) of a lineage, we were able to describe projection envelopes for all secondary lineages of the supraesophageal ganglion. This work provides a framework by which the secondary neurons (forming the vast majority of adult brain neurons) can be assigned to genetically and developmentally defined groups. It also represents a step towards the goal to establish, for each lineage, the link between its mature anatomical and functional phenotype, and the genetic make-up of the neuroblast it descends from. PMID:23872236

  3. Determining lineage pathways from cellular barcoding experiments

    NARCIS (Netherlands)

    Perié, Leïla; Hodgkin, Philip D; Naik, Shalin H; Schumacher, Ton N; de Boer, Rob J; Duffy, Ken R

    2014-01-01

    Cellular barcoding and other single-cell lineage-tracing strategies form experimental methodologies for analysis of in vivo cell fate that have been instrumental in several significant recent discoveries. Due to the highly nonlinear nature of proliferation and differentiation, interrogation of the r

  4. Combined lineage mapping and fate specification profiling with NLOM-OCM using sub-10-fs pulses

    Science.gov (United States)

    Gibbs, H. C.; Dodson, C. R.; Bai, Y.; Lekven, A. C.; Yeh, A. T.

    2013-02-01

    We have developed a combined NLOM-OCM method using ultrashort sub-10-fs pulses to study cell lineages and their gene expression profiles in zebrafish. First, time-lapse NLOM is used to capture embryo morphology (broadly excited autofluorescence) and cell lineage dynamics (eGFP reporter). The embryo is then fixed and an in situ hybridization performed, depositing NBT/BCIP precipitate where a gene of interest is actively expressed. Combined NLOM-OCM is then used to capture the gene expression pattern with 3-D resolution and these two data sets acquired from the same embryo are merged using morphological landmarks. We have used this approach to study the dynamics of the wnt1 lineage at the midbrain-hindbrain boundary (MHB) in normal and in fgf8a(ace) morphant embryos. We show that with fgf8a knock-down, the MHB constriction begins to form but subsequent failure of the constriction causes the incorporation of a transient cerebellar structure into caudal tectum. Concomitantly, this morphological distortion in the dorsal MHB causes anterior displacement in a ventral subpopulation of the wnt1 lineage at the MHB. NLOM-OCM confirms the displaced wnt1 MHB lineage stops expressing the wnt1 reporter, and with further experiments we can investigate markers such as wnt4 or ascl1a, which have been shown to be expanded caudally in ace mutants, to understand the transformed molecular fate of this displaced tissue. We conclude this approach of co-registering dynamic lineage tracing and in situ hybridization data sets using morphological context will help shed light on developmental mechanisms by integrating established analysis techniques at the morphological, cellular, and molecular levels.

  5. Rewiring of human lung cell lineage and mitotic networks in lung adenocarcinomas

    OpenAIRE

    Kim, Il-Jin; Quigley, David; To, Minh D.; Pham, Patrick; Lin, Kevin; Jo, Brian; Jen, Kuang-Yu; Raz, Dan; Kim, Jae; Mao, Jian-Hua; Jablons, David; Balmain, Allan

    2013-01-01

    Analysis of gene expression patterns in normal tissues and their perturbations in tumors can help to identify the functional roles of oncogenes or tumor suppressors and identify potential new therapeutic targets. Here, gene expression correlation networks were derived from 92 normal human lung samples and patient-matched adenocarcinomas. The networks from normal lung show that NKX2-1 is linked to the alveolar type 2 lineage, and identify PEBP4 as a novel marker expressed in alveolar type 2 ce...

  6. Wnt Signaling Regulates the Lineage Differentiation Potential of Mouse Embryonic Stem Cells through Tcf3 Down-Regulation

    OpenAIRE

    Yaser Atlasi; Rubina Noori; Claudia Gaspar; Patrick Franken; Andrea Sacchetti; Haleh Rafati; Tokameh Mahmoudi; Charles Decraene; Calin, George A; Merrill, Bradley J.; Riccardo Fodde

    2013-01-01

    Canonical Wnt signaling plays a rate-limiting role in regulating self-renewal and differentiation in mouse embryonic stem cells (ESCs). We have previously shown that mutation in the Apc (adenomatous polyposis coli) tumor suppressor gene constitutively activates Wnt signaling in ESCs and inhibits their capacity to differentiate towards ecto-, meso-, and endodermal lineages. However, the underlying molecular and cellular mechanisms through which Wnt regulates lineage differentiation in mouse ES...

  7. Evolution of the primate lineage leading to modern humans: Phylogenetic and demographic inferences from DNA sequences

    OpenAIRE

    Takahata, Naoyuki; Satta, Yoko

    1997-01-01

    To date major divergences that occurred in the primate lineage leading to modern humans and to infer a demographic parameter (effective population size) of the ancestral lineage that existed at each divergence, a maximum likelihood method was applied to autosomal DNA sequence data currently available for pairs of orthologous genes between the human and each of the chimpanzee, gorilla, Old World monkey (OWM), and New World monkey (NWM). A statistical test is carried out to support the assumpti...

  8. Mitochondrial lineage sorting in action – historical biogeography of the Hyles euphorbiae complex (Sphingidae, Lepidoptera) in Italy

    OpenAIRE

    Mende, Michael; Hundsdörfer, Anna

    2013-01-01

    Background: Mitochondrial genes are among the most commonly used markers in studies of species’ phylogeography and to draw conclusions about taxonomy. The Hyles euphorbiae complex (HEC) comprises six distinct mitochondrial lineages in the Mediterranean region, of which one exhibits a cryptic disjunct distribution. The predominant mitochondrial lineage in most of Europe, euphorbiae, is also present on Malta; however, it is nowadays strangely absent from Southern Italy and Sicily, where it is r...

  9. Short communication. Occurrence of different Canine distemper virus lineages in Italian dogs

    Directory of Open Access Journals (Sweden)

    Andrea Balboni

    2014-09-01

    Full Text Available This study describes the sequence analysis of the H gene of 7 Canine distemper virus (CDV strains identified in dogs in Italy between years 2002-2012. The phylogenetic analysis showed that the CDV strains belonged to 2 clusters: 6 viruses were identified as Arctic‑like lineage and 1 as Europe 1 lineage. These data show a considerable prevalence of Arctic‑like‑CDVs in the analysed dogs. The dogs and the 3 viruses more recently identified showed 4 distinctive amino acid mutations compared to all other Arctic CDVs.

  10. 3T3-L1 adipocytes display phenotypic characteristics of multiple adipocyte lineages

    OpenAIRE

    Morrison, Shona; McGee, Sean L.

    2015-01-01

    Differentiated 3T3-L1 adipocytes are a widely used in vitro model of white adipocytes. In addition to classical white and brown adipocytes that are derived from different cell lineages, beige adipocytes have also been identified, which have characteristics of both white and brown adipocytes. Here we show that 3T3-L1 adipocytes display features of multiple adipocytes lineages. While the gene expression profile and basal bioenergetics of 3T3-L1 adipocytes was typical of white adipocytes, they r...

  11. From gene trees to species trees II: Species tree inference in the deep coalescence model

    OpenAIRE

    Zhang, Louxin

    2010-01-01

    When gene copies are sampled from various species, the resulting gene tree might disagree with the containing species tree. The primary causes of gene tree and species tree discord include lineage sorting, horizontal gene transfer, and gene duplication and loss. Each of these events yields a different parsimony criterion for inferring the (containing) species tree from gene trees. With lineage sorting, species tree inference is to find the tree minimizing extra gene lineages that had to coexi...

  12. T-lineage blast crisis of chronic myelogenous leukemia: simple record of 4 cases

    Directory of Open Access Journals (Sweden)

    Kartika W. Taroeno-Hariadi

    2005-09-01

    Full Text Available Blast crisis (BC transformation in chronic myelogenous leukemia (CML can involve each differentiation lineage of the hematopoietic system, i.e. granulocyte, monocyte, erythrocyte, megakaryocyte, and lymphocyte lineage. The lymphoid blast crisis (BC leukemia cells usually belong to B-lineage, commonly having the phenotype of Pre-B stage of the B-lineage, in which cell-surface immunoglobulin (sIg is not yet expressed. In contrast, T-lineage BC of CML is extremely rare. The objective of this study is to describe the fenotype, fusion transcript of bcr-abl, TdT, and cytoplasmic CD3 in T-lineage BC CML cases. Case report study. This report shows a simple summary of 4 cases of T-lineage BC of CML which have been collected in the phenotypic and genotypic analysis study for 17 years (1987-2004. In all cases, the chromosomal analysis revealed the presence of t(9;22(q34;q11 at presentation. Cell surface analysis were done at diagnosis. Cases’ mononuclear cells stored as 10% DMSO were retrieved to be performed reverse transcription (RT PCR BCR-ABL multiplex to demonstrate the presence of the fusion transcript of bcr-abl. RT-PCR was also performed for detecting the expression of cytoplasmic CD3ε and terminal deoxynucleotydil transferase (TdT. The results of cell surface antigen (CSA at presentation showed that 1 case was CD7+, CD5-, and CD2-; 1 case CD7+, CD5+, and CD2-; and 2 cases CD7+, CD5+ and CD2+ indicating that all these T-lineage BC of CML cells show the phenotype of pre-(pro- thymic stage phenotype. In the present study, two cases showed b2a2, one e1a2, and one negative bcr-abl transcript. The RT-PCR revealed the presence of CD3ε mRNA in all cases, and TdT mRNA in only one case. These results can constitute a basis for the future analysis of T-lineage BC of CML from now on. (Med J Indones 2005; 14: 184-9Keywords: chronic myelogenous leukemia (CML, blastic crisis (BC, T-lineage, bcr-abl fusion gene, CDε, TdT

  13. Bioinformatics Reveal Five Lineages of Oleosins and the Mechanism of Lineage Evolution Related to Structure/Function from Green Algae to Seed Plants.

    Science.gov (United States)

    Huang, Ming-Der; Huang, Anthony H C

    2015-09-01

    Plant cells contain subcellular lipid droplets with a triacylglycerol matrix enclosed by a layer of phospholipids and the small structural protein oleosin. Oleosins possess a conserved central hydrophobic hairpin of approximately 72 residues penetrating into the lipid droplet matrix and amphipathic amino- and carboxyl (C)-terminal peptides lying on the phospholipid surface. Bioinformatics of 1,000 oleosins of green algae and all plants emphasizing biological implications reveal five oleosin lineages: primitive (in green algae, mosses, and ferns), universal (U; all land plants), and three in specific organs or phylogenetic groups, termed seed low-molecular-weight (SL; seed plants), seed high-molecular-weight (SH; angiosperms), and tapetum (T; Brassicaceae) oleosins. Transition from one lineage to the next is depicted from lineage intermediates at junctions of phylogeny and organ distributions. Within a species, each lineage, except the T oleosin lineage, has one to four genes per haploid genome, only approximately two of which are active. Primitive oleosins already possess all the general characteristics of oleosins. U oleosins have C-terminal sequences as highly conserved as the hairpin sequences; thus, U oleosins including their C-terminal peptide exert indispensable, unknown functions. SL and SH oleosin transcripts in seeds are in an approximately 1:1 ratio, which suggests the occurrence of SL-SH oleosin dimers/multimers. T oleosins in Brassicaceae are encoded by rapidly evolved multitandem genes for alkane storage and transfer. Overall, oleosins have evolved to retain conserved hairpin structures but diversified for unique structures and functions in specific cells and plant families. Also, our studies reveal oleosin in avocado (Persea americana) mesocarp and no acyltransferase/lipase motifs in most oleosins.

  14. Bioinformatics Reveal Five Lineages of Oleosins and the Mechanism of Lineage Evolution Related to Structure/Function from Green Algae to Seed Plants1[OPEN

    Science.gov (United States)

    Huang, Ming-Der; Huang, Anthony H.C.

    2015-01-01

    Plant cells contain subcellular lipid droplets with a triacylglycerol matrix enclosed by a layer of phospholipids and the small structural protein oleosin. Oleosins possess a conserved central hydrophobic hairpin of approximately 72 residues penetrating into the lipid droplet matrix and amphipathic amino- and carboxyl (C)-terminal peptides lying on the phospholipid surface. Bioinformatics of 1,000 oleosins of green algae and all plants emphasizing biological implications reveal five oleosin lineages: primitive (in green algae, mosses, and ferns), universal (U; all land plants), and three in specific organs or phylogenetic groups, termed seed low-molecular-weight (SL; seed plants), seed high-molecular-weight (SH; angiosperms), and tapetum (T; Brassicaceae) oleosins. Transition from one lineage to the next is depicted from lineage intermediates at junctions of phylogeny and organ distributions. Within a species, each lineage, except the T oleosin lineage, has one to four genes per haploid genome, only approximately two of which are active. Primitive oleosins already possess all the general characteristics of oleosins. U oleosins have C-terminal sequences as highly conserved as the hairpin sequences; thus, U oleosins including their C-terminal peptide exert indispensable, unknown functions. SL and SH oleosin transcripts in seeds are in an approximately 1:1 ratio, which suggests the occurrence of SL-SH oleosin dimers/multimers. T oleosins in Brassicaceae are encoded by rapidly evolved multitandem genes for alkane storage and transfer. Overall, oleosins have evolved to retain conserved hairpin structures but diversified for unique structures and functions in specific cells and plant families. Also, our studies reveal oleosin in avocado (Persea americana) mesocarp and no acyltransferase/lipase motifs in most oleosins. PMID:26232488

  15. Bioinformatics Reveal Five Lineages of Oleosins and the Mechanism of Lineage Evolution Related to Structure/Function from Green Algae to Seed Plants.

    Science.gov (United States)

    Huang, Ming-Der; Huang, Anthony H C

    2015-09-01

    Plant cells contain subcellular lipid droplets with a triacylglycerol matrix enclosed by a layer of phospholipids and the small structural protein oleosin. Oleosins possess a conserved central hydrophobic hairpin of approximately 72 residues penetrating into the lipid droplet matrix and amphipathic amino- and carboxyl (C)-terminal peptides lying on the phospholipid surface. Bioinformatics of 1,000 oleosins of green algae and all plants emphasizing biological implications reveal five oleosin lineages: primitive (in green algae, mosses, and ferns), universal (U; all land plants), and three in specific organs or phylogenetic groups, termed seed low-molecular-weight (SL; seed plants), seed high-molecular-weight (SH; angiosperms), and tapetum (T; Brassicaceae) oleosins. Transition from one lineage to the next is depicted from lineage intermediates at junctions of phylogeny and organ distributions. Within a species, each lineage, except the T oleosin lineage, has one to four genes per haploid genome, only approximately two of which are active. Primitive oleosins already possess all the general characteristics of oleosins. U oleosins have C-terminal sequences as highly conserved as the hairpin sequences; thus, U oleosins including their C-terminal peptide exert indispensable, unknown functions. SL and SH oleosin transcripts in seeds are in an approximately 1:1 ratio, which suggests the occurrence of SL-SH oleosin dimers/multimers. T oleosins in Brassicaceae are encoded by rapidly evolved multitandem genes for alkane storage and transfer. Overall, oleosins have evolved to retain conserved hairpin structures but diversified for unique structures and functions in specific cells and plant families. Also, our studies reveal oleosin in avocado (Persea americana) mesocarp and no acyltransferase/lipase motifs in most oleosins. PMID:26232488

  16. Defining the Minimal Factors Required for Erythropoiesis through Direct Lineage Conversion

    Directory of Open Access Journals (Sweden)

    Sandra Capellera-Garcia

    2016-06-01

    Full Text Available Erythroid cell commitment and differentiation proceed through activation of a lineage-restricted transcriptional network orchestrated by a group of well characterized genes. However, the minimal set of factors necessary for instructing red blood cell (RBC development remains undefined. We employed a screen for transcription factors allowing direct lineage reprograming from fibroblasts to induced erythroid progenitors/precursors (iEPs. We show that Gata1, Tal1, Lmo2, and c-Myc (GTLM can rapidly convert murine and human fibroblasts directly to iEPs. The transcriptional signature of murine iEPs resembled mainly that of primitive erythroid progenitors in the yolk sac, whereas addition of Klf1 or Myb to the GTLM cocktail resulted in iEPs with a more adult-type globin expression pattern. Our results demonstrate that direct lineage conversion is a suitable platform for defining and studying the core factors inducing the different waves of erythroid development.

  17. Diverse inter-continental and host lineage reassortant avian influenza A viruses in pelagic seabirds.

    Science.gov (United States)

    Huang, Yanyan; Robertson, Gregory J; Ojkic, Davor; Whitney, Hugh; Lang, Andrew S

    2014-03-01

    Avian influenza A viruses (AIVs) often infect waterfowl, gulls and shorebirds, but other bird groups including pelagic seabirds also serve as hosts. In this study, we analyzed 21 AIVs found in two distant breeding colonies of Common Murre (Uria aalge) in Newfoundland and Labrador, Canada, during 2011. Phylogenetic analyses and genotype assignments were performed for the 21 Common Murre viruses together with all Common and Thick-billed Murre (Uria lomvia) AIV sequences available in public sequence databases. All fully characterized viruses from the Common Murres in 2011 were H1N2 subtype, but the genome sequences revealed greater diversity and the viruses belonged to four distinct genotypes. The four genotypes shared most segments in common, but reassortment was observed for PB2 and M segments. This provided direct genetic data of AIV diversification through segment reassortment during an outbreak of AIV infection in high-density breeding colonies. Analysis of the total collection of available murre viruses revealed a diverse collection of subtypes and gene lineages with high similarity to those found in viruses from waterfowl and gulls, and there was no indication of murre-specific AIV gene lineages. Overall, the virus gene pool in murres was predominantly made up of AIV lineages associated with waterfowl, but also featured considerable gull lineage genes and inter-continental reassortments. In particular, all but one of the 21 Common Murre viruses from 2011 in Newfoundland contained 1 or 2 Eurasian segments and 16 contained 1 gull lineage segment. This mosaic nature of characterized murre AIV genomes might reflect an under-recognized role of these pelagic seabirds in virus transmission across space and between bird host taxa. PMID:24462905

  18. Lineages of varicella-zoster virus

    OpenAIRE

    McGeoch, Duncan J.

    2009-01-01

    Relationships among varicella-zoster virus (VZV; Human herpesvirus 3) genome sequences were examined to evaluate descent of strains, structures of lineages and incidence of recombination events. Eighteen complete, published genome sequences were aligned and 494 single nucleotide polymorphisms (SNPs) extracted, each as two alleles. At 281 SNPs, a single sequence differed from all the others. Distributions of the remaining 213 SNPs indicated that the sequences fell into five groups, which coinc...

  19. Tracing lineages to uncover neuronal identity

    OpenAIRE

    Perlmann Thomas; Panman Lia

    2011-01-01

    Abstract Many previous studies have focused on understanding how midbrain dopamine neurons, which are implicated in many neurological conditions, are generated during embryogenesis. One of the remaining questions concerns how different dopamine neuron subtypes are specified. A recent paper in Neural Development has revealed features of a spatial and temporal lineage map that, together with other studies, begins to elucidate the developmental origin of distinct neuronal subtypes within the dev...

  20. Bazooka mediates secondary axon morphology in Drosophila brain lineages

    OpenAIRE

    Hartenstein Volker; Spindler Shana R

    2011-01-01

    Abstract In the Drosophila brain, neural lineages project bundled axon tracts into a central neuropile. Each lineage exhibits a stereotypical branching pattern and trajectory, which distinguish it from other lineages. In this study, we used a multilineage approach to explore the neural function of the Par-complex member Par3/Bazooka in vivo. Drosophila bazooka is expressed in post-mitotic neurons of the larval brain and localizes within neurons in a lineage-dependent manner. The fact that mul...

  1. CRX is a diagnostic marker of retinal and pineal lineage tumors.

    Directory of Open Access Journals (Sweden)

    Sandro Santagata

    Full Text Available BACKGROUND: CRX is a homeobox transcription factor whose expression and function is critical to maintain retinal and pineal lineage cells and their progenitors. To determine the biologic and diagnostic potential of CRX in human tumors of the retina and pineal, we examined its expression in multiple settings. METHODOLOGY/PRINCIPAL FINDINGS: Using situ hybridization and immunohistochemistry we show that Crx RNA and protein expression are exquisitely lineage restricted to retinal and pineal cells during normal mouse and human development. Gene expression profiling analysis of a wide range of human cancers and cancer cell lines also supports that CRX RNA is highly lineage restricted in cancer. Immunohistochemical analysis of 22 retinoblastomas and 13 pineal parenchymal tumors demonstrated strong expression of CRX in over 95% of these tumors. Importantly, CRX was not detected in the majority of tumors considered in the differential diagnosis of pineal region tumors (n = 78. The notable exception was medulloblastoma, 40% of which exhibited CRX expression in a heterogeneous pattern readily distinguished from that seen in retino-pineal tumors. CONCLUSIONS/SIGNIFICANCE: These findings describe new potential roles for CRX in human cancers and highlight the general utility of lineage restricted transcription factors in cancer biology. They also identify CRX as a sensitive and specific clinical marker and a potential lineage dependent therapeutic target in retinoblastoma and pineoblastoma.

  2. Evolution of dengue virus in Mexico is characterized by frequent lineage replacement.

    Science.gov (United States)

    Carrillo-Valenzo, Erik; Danis-Lozano, Rogelio; Velasco-Hernández, Jorge X; Sánchez-Burgos, Gilma; Alpuche, Celia; López, Irma; Rosales, Claudia; Baronti, Cécile; de Lamballerie, Xavier; Holmes, Edward C; Ramos-Castañeda, José

    2010-09-01

    Both dengue fever and its more serious clinical manifestation, dengue hemorrhagic fever, represent major public health concerns in the Americas. To understand the patterns and dynamics of virus transmission in Mexico, a country characterized by a marked increase in dengue incidence in recent years, we undertook a molecular evolutionary analysis of the largest sample of Mexican strains of dengue virus compiled to date. Our E gene data set comprises sequences sampled over a period of 27 years and representing all of the Mexican states that are endemic for dengue. Our phylogenetic analysis reveals that, for each of the four dengue viruses (DENV-1 to DENV-4), there have been multiple introductions of viral lineages in Mexico, with viruses similar to those observed throughout the Americas, but there has been strikingly little co-circulation. Rather, dengue virus evolution in Mexico is typified by frequent lineage replacement, such that only a single viral lineage dominates in a specific serotype at a specific time point. Most lineage replacement events involve members of the same viral genotype, although a replacement event involving different genotypes was observed with DENV-2, and viral lineages that are new to Mexico are described for DENV-1, DENV-3 and DENV-4. PMID:20549264

  3. A Molecular Assessment of Phylogenetic Relationships and LineageDiversification Within the Family Salamandridae (Amphibia, Caudata)

    Energy Technology Data Exchange (ETDEWEB)

    Weisrock, David W.; Papenfuss, Theodore J.; Macey, J. Robert; Litvinchuk, Spartak N.; Polymeni, Rosa; Ugurtas, Ismail H.; Zhao, Ermi; Larson, Allan

    2005-08-08

    Phylogenetic relationships among species of the salamanderfamily Salamandridae are investigated using nearly 3000 nucleotide basesof newly reported mitochondrial DNA sequence data from the mtDNA genicregion spanning the genes tRNALeu-COI. This study uses nearlycomprehensive species-level sampling to provide the first completephylogeny for the Salamandridae. Deep phylogenetic relationships amongthe three most divergent lineages in the family Salamandrina terdigitata,a clade comprising the "True" salamanders, and a clade comprising allnewts except S. terdigitata are difficult to resolve. However, mostrelationships within the latter two lineages are resolved with robustlevels of branch support. The genera Euproctus and Triturus arestatistically shown to be nonmonophyletic, instead each contains adiverse set of lineages positioned within the large newt clade. The genusParamesotriton is also resolve as a nonmonophyletic group, with the newlydescribed species P. laoensis constituting a divergent lineage placed ina sister position to clade containing all Pachytriton species and allremaining Paramesotriton species. Sequence divergences between P.laoensis and other Paramesotriton species are as great as those comparingP. laoensis and species of the genera Cynops and Pachytriton. Analyses oflineage diversification across the Salamandridae indicate that, despiteits exceptional diversity, lineage accumulation appears to have beenconstant across time, indicating that it does not represent a truespecies radiation.

  4. Avian Hemosporidian Parasite Lineages in Four Species of Free-ranging Migratory Waterbirds from Mongolia, 2008.

    Science.gov (United States)

    Seimon, Tracie A; Gilbert, Martin; Neabore, Scott; Hollinger, Charlotte; Tomaszewicz, Ania; Newton, Alisa; Chang, Tylis; McAloose, Denise

    2016-07-01

    Avian hemosporidian parasites have been detected in Asia, but little information is known about the hemosporidian parasite lineages that circulate in waterbirds that migrate along the East Asian and Central Asian migratory flyways to breed in Mongolia. To gather baseline data on hemosporidian parasite presence in Mongolian waterbirds, 151 blood-spot samples (81 hatch year [HY] and 70 after hatch year [AHY]) from Bar-headed Goose (Anser indicus), Ruddy Shelduck (Tadorna ferruginea), Great Cormorant ( Phalacrocorax carbo ), and Mongolian Gull (Larus mongolicus) were screened for three genera of apicomplexan parasites, Plasmodium, Haemoproteus, and Leucocytozoon, using nested PCR. Of these, 17 samples (11%, 95% confidence interval: 7.1-17.4%), representing all four species, were positive. We identified 10 species (six Plasmodium, one Haemoproteus, and three Leucocytozoon) through mitochondrial DNA sequencing of the cytochrome b gene and BLAST analysis. One lineage shared 100% nucleotide identity to a hemosporidian parasite lineage that has been previously identified as Plasmodium relictum (SGS1). Six lineages were found in AHY birds and five in HY birds, the latter confirming that infection with some of the identified hemosporidian parasites occurred on the breeding grounds. Our data provide important baseline information on hemosporidian parasite lineages found in AHY waterbirds that breed and migrate through Mongolia as well as in HY offspring. PMID:27243330

  5. The MADS domain protein DIANA together with AGAMOUS-LIKE80 to specify the central cell in Arabidopsis ovules

    NARCIS (Netherlands)

    Bemer, M.; Wolters-Arts, M.; Grossniklaus, U.; Angenent, G.C.

    2008-01-01

    MADS box genes in plants consist of MIKC-type and type I genes. While MIKC-type genes have been studied extensively, the functions of type I genes are still poorly understood. Evidence suggests that type I MADS box genes are involved in embryo sac and seed development. We investigated two independen

  6. Perkembangan Syarat Menggadai Tanah Harta Pusaka Tinggi Dalam Masyarakat Adat Minangkabau Di Kabupaten Agam Nagari Kamang Mudiak

    OpenAIRE

    Febriasi, Kikky

    2015-01-01

    Harta Pusaka Tinggi (high heritage) is all of the properties inherited to the daughters/nieces hereditarily based on maternal lineage, collective in nature and to be used for the prosperity of their family members. The land in this world will not increase but even decrease in line with the increasing breadth of territorial waters and the increasing population growth. Based on the background above, it is important to conduct a study on the development of terms and condition of m...

  7. Genome sequesnce of lineage III Listeria monocytogenes strain HCC23

    Science.gov (United States)

    More than 98% of reported human listeriosis cases are caused by Listeria monocytogenes serotypes within lineages I and II. Serotypes within lineage III (4a and 4c) are commonly isolated from environmental and food specimens. We report the first complete genome sequence of a lineage III isolate, HCC2...

  8. Lineage divergence detected in the malaria vector Anopheles marajoara (Diptera: Culicidae in Amazonian Brazil

    Directory of Open Access Journals (Sweden)

    Povoa Marinete M

    2010-10-01

    Full Text Available Abstract Background Cryptic species complexes are common among anophelines. Previous phylogenetic analysis based on the complete mtDNA COI gene sequences detected paraphyly in the Neotropical malaria vector Anopheles marajoara. The "Folmer region" detects a single taxon using a 3% divergence threshold. Methods To test the paraphyletic hypothesis and examine the utility of the Folmer region, genealogical trees based on a concatenated (white + 3' COI sequences dataset and pairwise differentiation of COI fragments were examined. The population structure and demographic history were based on partial COI sequences for 294 individuals from 14 localities in Amazonian Brazil. 109 individuals from 12 localities were sequenced for the nDNA white gene, and 57 individuals from 11 localities were sequenced for the ribosomal DNA (rDNA internal transcribed spacer 2 (ITS2. Results Distinct A. marajoara lineages were detected by combined genealogical analysis and were also supported among COI haplotypes using a median joining network and AMOVA, with time since divergence during the Pleistocene (COI sequences at the 3' end were more variable, demonstrating significant pairwise differentiation (3.82% compared to the more moderate 2.92% detected by the Folmer region. Lineage 1 was present in all localities, whereas lineage 2 was restricted mainly to the west. Mismatch distributions for both lineages were bimodal, likely due to multiple colonization events and spatial expansion (~798 - 81,045 ya. There appears to be gene flow within, not between lineages, and a partial barrier was detected near Rio Jari in Amapá state, separating western and eastern populations. In contrast, both nDNA data sets (white gene sequences with or without the retention of the 4th intron, and ITS2 sequences and length detected a single A. marajoara lineage. Conclusions Strong support for combined data with significant differentiation detected in the COI and absent in the nDNA suggest that

  9. Emergence of Lineage IV Peste des Petits Ruminants Virus in Ethiopia: Complete Genome Sequence of an Ethiopian Isolate 2010.

    Science.gov (United States)

    Muniraju, M; Mahapatra, M; Ayelet, G; Babu, A; Olivier, G; Munir, M; Libeau, G; Batten, C; Banyard, A C; Parida, S

    2016-08-01

    Isolates of peste des petits ruminants virus (PPRV) can be segregated genetically into four lineages. For decades, lineages I-III have been reported across Africa whilst lineage IV has predominantly circulated across Asia. However, the lineage distribution is currently changing in Africa. Importantly, full genome sequence data for African field isolates have been lacking. Here, we announce the first complete genome sequence of a field isolate of peste des petits ruminants virus (PPRV) from East Africa. This isolate was derived from the intestine of a goat suffering from severe clinical disease during the 2010 outbreak in Ethiopia. The full genome sequence of this isolate, PPRV Ethiopia/2010, clusters genetically with other lineage IV isolates of PPRV, sharing high levels of sequence identity across the genome. Further, we have carried out a phylogenetic analysis of all of the available African partial N gene and F gene PPRV sequences to investigate the epidemiology of PPRV with a focus on the emergence of different lineages of PPRV in Africa. PMID:25400010

  10. Mobile DNA can drive lineage extinction in prokaryotic populations.

    Science.gov (United States)

    Rankin, D J; Bichsel, M; Wagner, A

    2010-11-01

    Natural selection ultimately acts on genes and other DNA sequences. Adaptations that are good for the gene can have adverse effects at higher levels of organization, including the individual or the population. Mobile genetic elements illustrate this principle well, because they can self-replicate within a genome at a cost to their host. As they are costly and can be transmitted horizontally, mobile elements can be seen as genomic parasites. It has been suggested that mobile elements may cause the extinction of their host populations. In organisms with very large populations, such as most bacteria, individual selection is highly effective in purging genomes of deleterious elements, suggesting that extinction is unlikely. Here we investigate the conditions under which mobile DNA can drive bacterial lineages to extinction. We use a range of epidemiological and ecological models to show that harmful mobile DNA can invade, and drive populations to extinction, provided their transmission rate is high and that mobile element-induced mortality is not too high. Population extinction becomes more likely when there are more elements in the population. Even if elements are costly, extinction can still occur because of the combined effect of horizontal gene transfer, a mortality induced by mobile elements. Our study highlights the potential of mobile DNA to be selected at the population level, as well as at the individual level. PMID:20860700

  11. Influenza B vaccine lineage selection - An optimized trivalent vaccine

    OpenAIRE

    Moster?n H?pping, Ana; Fonville, Judith M; Russell, Colin A.; James, Sarah; Derek J Smith

    2016-01-01

    Highlights • Although it is not known which one of two influenza B lineages will circulate in any one season, only a representative virus of one of the two lineages is part of the trivalent seasonal influenza vaccine. • We describe three lineage selection strategies to choose which lineage to include in the seasonal vaccine, including the common strategy of using the last lineage that has been observed to dominate, and a new strategy which takes into account population immunity. • We show why...

  12. Molecular characterisation of dengue virus type 1 reveals lineage replacement during circulation in Brazilian territory

    Directory of Open Access Journals (Sweden)

    Adriana Ribeiro Carneiro

    2012-09-01

    Full Text Available Dengue fever is the most important arbovirus infection found in tropical regions around the world. Dispersal of the vector and an increase in migratory flow between countries have led to large epidemics and severe clinical outcomes, such as dengue haemorrhagic fever and dengue shock syndrome. This study analysed the genetic variability of the dengue virus serotype 1 (DENV-1 in Brazil with regard to the full-length structural genes C/prM/M/E among 34 strains isolated during epidemics that occurred in the country between 1994-2011. Virus phylogeny and time of divergence were also evaluated with only the E gene of the strains isolated from 1994-2008. An analysis of amino acid differences between these strains and the French Guiana strain (FGA/89 revealed the presence of important nonsynonymous substitutions in the amino acid sequences, including residues E297 (Met→Thr and E338 (Ser→Leu. A phylogenetic analysis of E proteins comparing the studied isolates and other strains selected from the GenBank database showed that the Brazilian DENV-1 strains since 1982 belonged to genotype V. This analysis also showed that different introductions of strains from the 1990s represented lineage replacement, with the identification of three lineages that cluster all isolates from the Americas. An analysis of the divergence time of DENV-1 indicated that the lineage circulating in Brazil emerged from an ancestral lineage that originated approximately 44.35 years ago.

  13. There is no fitness but fitness, and the lineage is its bearer.

    Science.gov (United States)

    Akçay, Erol; Van Cleve, Jeremy

    2016-02-01

    Inclusive fitness has been the cornerstone of social evolution theory for more than a half-century and has matured as a mathematical theory in the past 20 years. Yet surprisingly for a theory so central to an entire field, some of its connections to evolutionary theory more broadly remain contentious or underappreciated. In this paper, we aim to emphasize the connection between inclusive fitness and modern evolutionary theory through the following fact: inclusive fitness is simply classical Darwinian fitness, averaged over social, environmental and demographic states that members of a gene lineage experience. Therefore, inclusive fitness is neither a generalization of classical fitness, nor does it belong exclusively to the individual. Rather, the lineage perspective emphasizes that evolutionary success is determined by the effect of selection on all biological and environmental contexts that a lineage may experience. We argue that this understanding of inclusive fitness based on gene lineages provides the most illuminating and accurate picture and avoids pitfalls in interpretation and empirical applications of inclusive fitness theory.

  14. Molecular Cloning and Expression Analysis of a MADS-Box Gene (GbMADS2 from Ginkgo biloba

    Directory of Open Access Journals (Sweden)

    Xiaohui WANG

    2015-04-01

    Full Text Available As a kind of transcription factors gene family, MADS-box genes play an important role in plant development processes. To find genes involved in the floral transition of Ginkgo biloba, a MADS-box gene, designated as GbMADS2, was cloned from G. biloba based on EST sequences by RT-PCR. Sequence analysis results showed that the cDNA sequence of GbMADS2 contained a 663 bp length ORF encoding 221 amino acids protein, which displayed typical structure of plant MADS-box protein including MADS, I, and K domains and C terminus. The sequence of GbMADS2 protein was highly homologous to those of MADS-box proteins from other plant species with the highest homologous to AGAMOUS (CyAG from Cycas revoluta. The phylogenetic tree analysis revealed that GbMADS2 belonged to AGAMOUS clade genes. Real-time PCR analysis indicated that expression levels of GbMADS2 gene in female and male flower were significantly higher than those in root, stem, and leaves, and that GbMADS2 expression level increased along with time of flower development. The spatial and time-course expression profile of GbMADS2 implied that GbMADS2 might be involved in development of reproductive organs. The isolation and expression analysis of GbMADS2 provided basis for further studying the molecular mechanism of flower development in G. biloba.

  15. Downregulation of the transcription factor KLF4 is required for the lineage commitment of T cells

    Institute of Scientific and Technical Information of China (English)

    Xiaomin Wen; Haifeng Liu; Gang Xiao; Xiaolong Liu

    2011-01-01

    The roles of the reprogramming factors Oct4,Sox2,c-Myc and Klf4 in early T cell development are incompletely defined.Here,we show that Klf4 is the only reprogramming factor whose expression is downregulated when early thymic progenitors (ETPs) differentiate into T cells.Enforced expression of Klf4 in uncommitted progenitors severely impaired T cell development mainly at the DN2-to-DN3 transition when T cell lineage commitment occurs and affected the transcription of a variety of genes with crucial functions in early T cell development,including genes involved in microenvironmental signaling (IL-7Rα),Notch target genes (Deltexl),and essential T cell lineage regulatory or inhibitory genes (Bcllla,SpiB,and ldl).The survival of thymocytes and the rearrangement at the Tcrb locus were impaired in the presence of enforced Klf4 expression.The defects in the DN1-to-DN2 and DN2-to-DN3 transitions in Klf4 transgenic mice could not be rescued by the introduction of a TCR transgene,but was partially rescued by restoring the expression of IL-7Rα.Thus,our data indicate that the downregulation of Klf4 is a prerequisite for T cell lineage commitment.

  16. ETV6-RUNX1 Rearrangement in Tunisian Pediatric B-Lineage Acute Lymphoblastic Leukemia

    Directory of Open Access Journals (Sweden)

    Abir Gmidène

    2009-01-01

    Full Text Available In this study, Forty-one out of fifty-seven Tunisian children with B-lineage acute lymphoblastic leukemia (B-ALL, and without cytogenetically detectable recurrent abnormalities at the time of the diagnosis, were evaluated by fluorescence in situ hybridization (FISH for the t(12;21. This translocation leads ETV6-RUNX1 (previously TEL-AML1 fusion gene. 16 patients (28% had ETV6-RUNX1 rearrangement. In addition to this rearrangement, two cases showed a loss of the normal ETV6 allele, and three others showed an extra signal of the RUNX1 gene. Seven patients without ETV6-RUNX1 rearrangement showed extra signals of the RUNX1 gene. One out of the 7 patients was also associated with a t(3;12 identified by FISH. This is the first Tunisian study in which we report the incidence of t(12;21 among childhood B-lineage ALL and in which we have found multiple copies of RUNX1. Finally, our findings confirm that additional or secondary genetic changes are commonly encountered in pediatric B-lineage ALL with ETV6-RUNX1 gene fusion which is envisaged to play a pivotal role in disease progression.

  17. Tracing lineages to uncover neuronal identity

    Directory of Open Access Journals (Sweden)

    Perlmann Thomas

    2011-07-01

    Full Text Available Abstract Many previous studies have focused on understanding how midbrain dopamine neurons, which are implicated in many neurological conditions, are generated during embryogenesis. One of the remaining questions concerns how different dopamine neuron subtypes are specified. A recent paper in Neural Development has revealed features of a spatial and temporal lineage map that, together with other studies, begins to elucidate the developmental origin of distinct neuronal subtypes within the developing midbrain. See research article http://www.neuraldevelopment.com/content/6/1/29

  18. Lake Tanganyika--a 'melting pot' of ancient and young cichlid lineages (Teleostei: Cichlidae?

    Directory of Open Access Journals (Sweden)

    Juliane D Weiss

    Full Text Available A long history of research focused on the East Africa cichlid radiations (EAR revealed discrepancies between mtDNA and nuclear phylogenies, suggesting that interspecific hybridisation may have been significant during the radiation of these fishes. The approximately 250 cichlid species of Lake Tanganyika have their roots in a monophyletic African cichlid assemblage, but controversies remain about the precise phylogenetic origin and placement of different lineages and consequently about L. Tanganyika colonization scenarios. 3312 AFLP loci and the mitochondrial ND2 gene were genotyped for 91 species representing almost all major lacustrine and riverine haplotilapiine east African cichlid lineages with a focus on L. Tanganyika endemics. Explicitly testing for the possibility of ancient hybridisation events, a comprehensive phylogenetic network hypothesis is proposed for the origin and diversification of L. Tanganyika cichlids. Inference of discordant phylogenetic signal strongly suggests that the genomes of two endemic L. Tanganyika tribes, Eretmodini and Tropheini, are composed of an ancient mixture of riverine and lacustrine lineages. For the first time a strong monophyly signal of all non-haplochromine mouthbrooding species endemic to L. Tanganyika ("ancient mouthbrooders" was detected. Further, in the genomes of early diverging L. Tanganyika endemics Trematocarini, Bathybatini, Hemibatini and Boulengerochromis genetic components of other lineages belonging to the East African Radiation appear to be present. In combination with recent palaeo-geological results showing that tectonic activity in the L. Tanganyika region resulted in highly dynamic and heterogeneous landscape evolution over the Neogene and Pleistocene, the novel phylogenetic data render a single lacustrine basin as the geographical cradle of the endemic L. Tanganyika cichlid lineages unlikely. Instead a scenario of a pre-rift origin of several independent L. Tanganyika precursor

  19. Lake Tanganyika--a 'melting pot' of ancient and young cichlid lineages (Teleostei: Cichlidae)?

    Science.gov (United States)

    Weiss, Juliane D; Cotterill, Fenton P D; Schliewen, Ulrich K

    2015-01-01

    A long history of research focused on the East Africa cichlid radiations (EAR) revealed discrepancies between mtDNA and nuclear phylogenies, suggesting that interspecific hybridisation may have been significant during the radiation of these fishes. The approximately 250 cichlid species of Lake Tanganyika have their roots in a monophyletic African cichlid assemblage, but controversies remain about the precise phylogenetic origin and placement of different lineages and consequently about L. Tanganyika colonization scenarios. 3312 AFLP loci and the mitochondrial ND2 gene were genotyped for 91 species representing almost all major lacustrine and riverine haplotilapiine east African cichlid lineages with a focus on L. Tanganyika endemics. Explicitly testing for the possibility of ancient hybridisation events, a comprehensive phylogenetic network hypothesis is proposed for the origin and diversification of L. Tanganyika cichlids. Inference of discordant phylogenetic signal strongly suggests that the genomes of two endemic L. Tanganyika tribes, Eretmodini and Tropheini, are composed of an ancient mixture of riverine and lacustrine lineages. For the first time a strong monophyly signal of all non-haplochromine mouthbrooding species endemic to L. Tanganyika ("ancient mouthbrooders") was detected. Further, in the genomes of early diverging L. Tanganyika endemics Trematocarini, Bathybatini, Hemibatini and Boulengerochromis genetic components of other lineages belonging to the East African Radiation appear to be present. In combination with recent palaeo-geological results showing that tectonic activity in the L. Tanganyika region resulted in highly dynamic and heterogeneous landscape evolution over the Neogene and Pleistocene, the novel phylogenetic data render a single lacustrine basin as the geographical cradle of the endemic L. Tanganyika cichlid lineages unlikely. Instead a scenario of a pre-rift origin of several independent L. Tanganyika precursor lineages which

  20. Novel origins of lineage founder cells in the direct-developing sea urchin Heliocidaris erythrogramma.

    Science.gov (United States)

    Wray, G A; Raff, R A

    1990-09-01

    The lineage and fate of each blastomere in the 32-cell embryo of the direct-developing sea urchin Heliocidaris erythrogramma have been traced by microinjection of tetramethylrhodamine-dextran. The results reveal substantive evolutionary modifications of the ancestral cell lineage pattern of indirect sea urchin development. Significant among these modifications are changes in the time and order of cell lineage segregation: vegetal ectodermal founder cells consistently arise earlier than during indirect development, while internal founder cells generally segregate later and in a different sequence. Modifications have also arisen in proportions of the embryo fated to become various cell types and larval structures. Ectodermal fates, particularly vestibular ectoderm, comprise a greater proportion of the total cellular volume in H. erythrogramma. Among internal cell types, coelom consumes more and endoderm less of the remaining cellular volume than during indirect sea urchin development. Evolutionary modifications are also apparent in the positional origin of larval cell types and structures in H. erythrogramma. These include an apparent tilt in the axis of prospective cell fate relative to the animal-vegetal axis as defined by cleavage planes. Together these evolutionary changes in the cell lineage of H. erythrogramma produce an accelerated loss of dorsoventral symmetry in cell fate relative to indirect development. The extent and diversity of rearrangements in its cell lineage indicate that the non-feeding larva of H. erythrogramma is a highly modified, novel form rather than a degenerate pluteus larva. These same modifications underscore the evolutionarily flexible relationship between cell lineage, gene expression, and larval morphology in sea urchin development.

  1. Evolution of developmental roles of Pax2/5/8 paralogs after independent duplication in urochordate and vertebrate lineages

    OpenAIRE

    Cañestro Cristian; Bassham Susan; Postlethwait John H

    2008-01-01

    Abstract Background Gene duplication provides opportunities for lineage diversification and evolution of developmental novelties. Duplicated genes generally either disappear by accumulation of mutations (nonfunctionalization), or are preserved either by the origin of positively selected functions in one or both duplicates (neofunctionalization), or by the partitioning of original gene subfunctions between the duplicates (subfunctionalization). The Pax2/5/8 family of important developmental re...

  2. The influence of life-history strategy on genetic differentiation and lineage divergence in darters (Percidae: Etheostomatinae).

    Science.gov (United States)

    Fluker, Brook L; Kuhajda, Bernard R; Harris, Phillip M

    2014-11-01

    Recent studies determined that darters with specialized breeding strategies can exhibit deep lineage divergence over fine geographic scales without apparent physical barriers to gene flow. However, the extent to which intrinsic characteristics interact with extrinsic factors to influence population divergence and lineage diversification in darters is not well understood. This study employed comparative phylogeographic and population genetic methods to investigate the influence of life history on gene flow, dispersal ability, and lineage divergence in two sympatric sister darters with differing breeding strategies. Our results revealed highly disparate phylogeographic histories, patterns of genetic structure, and dispersal abilities between the two species suggesting that life history may contribute to lineage diversification in darters, especially by limiting dispersal among large river courses. Both species also showed striking differences in demographic history, indicating that extrinsic factors differentially affected each species during the Pleistocene. Collectively, our results indicate that intrinsic and extrinsic factors have influenced levels of gene flow among populations within both species examined. However, we suggest that life-history strategy may play a more important role in lineage diversification in darters than previously appreciated, a finding that has potentially important implications for understanding diversification of the rich North American freshwater fish fauna.

  3. Genetic Characterization of Zika Virus Strains: Geographic Expansion of the Asian Lineage

    OpenAIRE

    Haddow, Andrew D.; Amy J Schuh; Yasuda, Chadwick Y.; Kasper, Matthew R.; Vireak Heang; Rekol Huy; Hilda Guzman; Tesh, Robert B.; Weaver, Scott C.

    2012-01-01

    Background Zika virus (ZIKV) is a mosquito-borne flavivirus distributed throughout much of Africa and Asia. Infection with the virus may cause acute febrile illness that clinically resembles dengue fever. A recent study indicated the existence of three geographically distinct viral lineages; however this analysis utilized only a single viral gene. Although ZIKV has been known to circulate in both Africa and Asia since at least the 1950s, little is known about the genetic relationships between...

  4. Human Staphylococcus aureus lineages among Zoological Park residents in Greece

    Directory of Open Access Journals (Sweden)

    E. Drougka

    2015-10-01

    Full Text Available Staphylococcus aureus is a part of the microbiota flora in many animal species. The clonal spread of S. aureus among animals and personnel in a Zoological Park was investigated. Samples were collected from colonized and infected sites among 32 mammals, 11 birds and eight humans. The genes mecA, mecC, lukF/lukS-PV (encoding Panton-Valentine leukocidin, PVL and tst (toxic shock syndrome toxin-1 were investigated by PCR. Clones were defined by Multilocus Sequence Typing (MLST, spa type and Pulsed-Field Gel Electrophoresis (PFGE. Seven S. aureus isolates were recovered from four animals and one from an employee. All were mecA, mecC and tst–negative, whereas, one carried the PVL genes and was isolated from an infected Squirrel monkey. Clonal analysis revealed the occurrence of seven STs, eight PFGE and five spa types including ones of human origin. Even though a variety of genotypes were identified among S. aureus strains colonizing zoo park residents, our results indicate that colonization with human lineages has indeed occurred.

  5. Optical Imaging for Stem Cell Differentiation to Neuronal Lineage

    Energy Technology Data Exchange (ETDEWEB)

    Hwang, Do Won; Lee, Dong Soo [Seoul National Univ., Seoul (Korea, Republic of)

    2012-03-15

    In regenerative medicine, the prospect of stem cell therapy hold great promise for the recovery of injured tissues and effective treatment of intractable diseases. Tracking stem cell fate provides critical information to understand and evaluate the success of stem cell therapy. The recent emergence of in vivo noninvasive molecular imaging has enabled assessment of the behavior of grafted stem cells in living subjects. In this review, we provide an overview of current optical imaging strategies based on cell or tissue specific reporter gene expression and of in vivo methods to monitor stem cell differentiation into neuronal lineages. These methods use optical reporters either regulated by neuron-specific promoters or containing neuron-specific microRNA binding sites. Both systems revealed dramatic changes in optical reporter imaging signals in cells differentiating a yeast GAL4 amplification system or an engineering-enhanced luciferase reported gene. Furthermore, we propose an advanced imaging system to monitor neuronal differentiation during neurogenesis that uses in vivo multiplexed imaging techniques capable of detecting several targets simultaneously.

  6. Genetic investigation within Lactococcus garvieae revealed two genomic lineages.

    Science.gov (United States)

    Ferrario, Chiara; Ricci, Giovanni; Borgo, Francesca; Rollando, Alessandro; Fortina, Maria Grazia

    2012-07-01

    The diversity of a collection of 49 Lactococcus garvieae strains, including isolates of dairy, fish, meat, vegetable and cereal origin, was explored using a molecular polyphasic approach comprising PCR-ribotyping, REP and RAPD-PCR analyses and a multilocus restriction typing (MLRT) carried out on six partial genes (atpA, tuf, dltA, als, gapC, and galP). This approach allowed high-resolution cluster analysis in which two major groups were distinguishable: one group included dairy isolates, the other group meat isolates. Unexpectedly, of the 12 strains coming from fish, four grouped with dairy isolates, whereas the others with meat isolates. Likewise, strains isolated from vegetables allocated between the two main groups. These findings revealed high variability within the species at both gene and genome levels. The observed genetic heterogeneity among L. garvieae strains was not entirely coherent with the ecological niche of origin of the strains, but rather supports the idea of an early separation of L. garvieae population into two independent genomic lineages. PMID:22568590

  7. Gene

    Data.gov (United States)

    U.S. Department of Health & Human Services — Gene integrates information from a wide range of species. A record may include nomenclature, Reference Sequences (RefSeqs), maps, pathways, variations, phenotypes,...

  8. Long noncoding RNAs in neuronal-glial fate specification and oligodendrocyte lineage maturation

    Directory of Open Access Journals (Sweden)

    Gokhan Solen

    2010-02-01

    Full Text Available Abstract Background Long non-protein-coding RNAs (ncRNAs are emerging as important regulators of cellular differentiation and are widely expressed in the brain. Results Here we show that many long ncRNAs exhibit dynamic expression patterns during neuronal and oligodendrocyte (OL lineage specification, neuronal-glial fate transitions, and progressive stages of OL lineage elaboration including myelination. Consideration of the genomic context of these dynamically regulated ncRNAs showed they were part of complex transcriptional loci that encompass key neural developmental protein-coding genes, with which they exhibit concordant expression profiles as indicated by both microarray and in situ hybridization analyses. These included ncRNAs associated with differentiation-specific nuclear subdomains such as Gomafu and Neat1, and ncRNAs associated with developmental enhancers and genes encoding important transcription factors and homeotic proteins. We also observed changes in ncRNA expression profiles in response to treatment with trichostatin A, a histone deacetylase inhibitor that prevents the progression of OL progenitors into post-mitotic OLs by altering lineage-specific gene expression programs. Conclusion This is the first report of long ncRNA expression in neuronal and glial cell differentiation and of the modulation of ncRNA expression by modification of chromatin architecture. These observations explicitly link ncRNA dynamics to neural stem cell fate decisions, specification and epigenetic reprogramming and may have important implications for understanding and treating neuropsychiatric diseases.

  9. Comparing the Dictyostelium and Entamoeba genomes reveals an ancient split in the Conosa lineage.

    Directory of Open Access Journals (Sweden)

    Jie Song

    2005-12-01

    Full Text Available The Amoebozoa are a sister clade to the fungi and the animals, but are poorly sampled for completely sequenced genomes. The social amoeba Dictyostelium discoideum and amitochondriate pathogen Entamoeba histolytica are the first Amoebozoa with genomes completely sequenced. Both organisms are classified under the Conosa subphylum. To identify Amoebozoa-specific genomic elements, we compared these two genomes to each other and to other eukaryotic genomes. An expanded phylogenetic tree built from the complete predicted proteomes of 23 eukaryotes places the two amoebae in the same lineage, although the divergence is estimated to be greater than that between animals and fungi, and probably happened shortly after the Amoebozoa split from the opisthokont lineage. Most of the 1,500 orthologous gene families shared between the two amoebae are also shared with plant, animal, and fungal genomes. We found that only 42 gene families are distinct to the amoeba lineage; among these are a large number of proteins that contain repeats of the FNIP domain, and a putative transcription factor essential for proper cell type differentiation in D. discoideum. These Amoebozoa-specific genes may be useful in the design of novel diagnostics and therapies for amoebal pathologies.

  10. Isolation and characterization of koi herpesvirus (KHV) from Indonesia: identification of a new genetic lineage.

    Science.gov (United States)

    Sunarto, A; McColl, K A; Crane, M St J; Sumiati, T; Hyatt, A D; Barnes, A C; Walker, P J

    2011-02-01

    Koi herpesvirus (KHV) is the aetiological agent of an emerging disease (KHVD) associated with mass mortalities in koi and common carp and reported from at least 30 countries. We report the first isolation of KHV from koi and common carp in Indonesia and initial characterization of the isolates. Clinical signs, histopathology and virion morphology are similar to those of isolates from other countries. Phylogenetic analyses using the thymidine kinase gene amplified from each isolate and from carp tissue samples collected from KHVD outbreaks throughout Indonesia indicated that the Indonesian isolates are more closely related to the Asian than the European KHV lineage. Sequence analysis of two other variable regions between ORF29 and ORF31 (marker I) and near the start of ORF 133 (marker II) indicated that all Indonesian isolates displayed a marker I allele (I(++)) previously identified only in isolates of the Asian lineage. However, in the marker II region, all Indonesian isolates displayed the II(-) allele, which has been reported previously only amongst isolates of the European lineage, and nine of these displayed a mixed genotype (II(+)II(-)). The I(++)II(-) genotype has not been reported previously and appears to represent a new intermediate lineage that may have emerged in Indonesia.

  11. Feedback, Lineages and Self-Organizing Morphogenesis.

    Directory of Open Access Journals (Sweden)

    Sameeran Kunche

    2016-03-01

    Full Text Available Feedback regulation of cell lineage progression plays an important role in tissue size homeostasis, but whether such feedback also plays an important role in tissue morphogenesis has yet to be explored. Here we use mathematical modeling to show that a particular feedback architecture in which both positive and negative diffusible signals act on stem and/or progenitor cells leads to the appearance of bistable or bi-modal growth behaviors, ultrasensitivity to external growth cues, local growth-driven budding, self-sustaining elongation, and the triggering of self-organization in the form of lamellar fingers. Such behaviors arise not through regulation of cell cycle speeds, but through the control of stem or progenitor self-renewal. Even though the spatial patterns that arise in this setting are the result of interactions between diffusible factors with antagonistic effects, morphogenesis is not the consequence of Turing-type instabilities.

  12. Feedback, Lineages and Self-Organizing Morphogenesis.

    Science.gov (United States)

    Kunche, Sameeran; Yan, Huaming; Calof, Anne L; Lowengrub, John S; Lander, Arthur D

    2016-03-01

    Feedback regulation of cell lineage progression plays an important role in tissue size homeostasis, but whether such feedback also plays an important role in tissue morphogenesis has yet to be explored. Here we use mathematical modeling to show that a particular feedback architecture in which both positive and negative diffusible signals act on stem and/or progenitor cells leads to the appearance of bistable or bi-modal growth behaviors, ultrasensitivity to external growth cues, local growth-driven budding, self-sustaining elongation, and the triggering of self-organization in the form of lamellar fingers. Such behaviors arise not through regulation of cell cycle speeds, but through the control of stem or progenitor self-renewal. Even though the spatial patterns that arise in this setting are the result of interactions between diffusible factors with antagonistic effects, morphogenesis is not the consequence of Turing-type instabilities. PMID:26989903

  13. New native South American Y chromosome lineages.

    Science.gov (United States)

    Jota, Marilza S; Lacerda, Daniela R; Sandoval, José R; Vieira, Pedro Paulo R; Ohasi, Dominique; Santos-Júnior, José E; Acosta, Oscar; Cuellar, Cinthia; Revollo, Susana; Paz-Y-Miño, Cesar; Fujita, Ricardo; Vallejo, Gustavo A; Schurr, Theodore G; Tarazona-Santos, Eduardo M; Pena, Sergio Dj; Ayub, Qasim; Tyler-Smith, Chris; Santos, Fabrício R

    2016-07-01

    Many single-nucleotide polymorphisms (SNPs) in the non-recombining region of the human Y chromosome have been described in the last decade. High-coverage sequencing has helped to characterize new SNPs, which has in turn increased the level of detail in paternal phylogenies. However, these paternal lineages still provide insufficient information on population history and demography, especially for Native Americans. The present study aimed to identify informative paternal sublineages derived from the main founder lineage of the Americas-haplogroup Q-L54-in a sample of 1841 native South Americans. For this purpose, we used a Y-chromosomal genotyping multiplex platform and conventional genotyping methods to validate 34 new SNPs that were identified in the present study by sequencing, together with many Y-SNPs previously described in the literature. We updated the haplogroup Q phylogeny and identified two new Q-M3 and three new Q-L54*(xM3) sublineages defined by five informative SNPs, designated SA04, SA05, SA02, SA03 and SA29. Within the Q-M3, sublineage Q-SA04 was mostly found in individuals from ethnic groups belonging to the Tukanoan linguistic family in the northwest Amazon, whereas sublineage Q-SA05 was found in Peruvian and Bolivian Amazon ethnic groups. Within Q-L54*, the derived sublineages Q-SA03 and Q-SA02 were exclusively found among Coyaima individuals (Cariban linguistic family) from Colombia, while Q-SA29 was found only in Maxacali individuals (Jean linguistic family) from southeast Brazil. Furthermore, we validated the usefulness of several published SNPs among indigenous South Americans. This new Y chromosome haplogroup Q phylogeny offers an informative paternal genealogy to investigate the pre-Columbian history of South America.Journal of Human Genetics advance online publication, 31 March 2016; doi:10.1038/jhg.2016.26.

  14. New native South American Y chromosome lineages.

    Science.gov (United States)

    Jota, Marilza S; Lacerda, Daniela R; Sandoval, José R; Vieira, Pedro Paulo R; Ohasi, Dominique; Santos-Júnior, José E; Acosta, Oscar; Cuellar, Cinthia; Revollo, Susana; Paz-Y-Miño, Cesar; Fujita, Ricardo; Vallejo, Gustavo A; Schurr, Theodore G; Tarazona-Santos, Eduardo M; Pena, Sergio Dj; Ayub, Qasim; Tyler-Smith, Chris; Santos, Fabrício R

    2016-07-01

    Many single-nucleotide polymorphisms (SNPs) in the non-recombining region of the human Y chromosome have been described in the last decade. High-coverage sequencing has helped to characterize new SNPs, which has in turn increased the level of detail in paternal phylogenies. However, these paternal lineages still provide insufficient information on population history and demography, especially for Native Americans. The present study aimed to identify informative paternal sublineages derived from the main founder lineage of the Americas-haplogroup Q-L54-in a sample of 1841 native South Americans. For this purpose, we used a Y-chromosomal genotyping multiplex platform and conventional genotyping methods to validate 34 new SNPs that were identified in the present study by sequencing, together with many Y-SNPs previously described in the literature. We updated the haplogroup Q phylogeny and identified two new Q-M3 and three new Q-L54*(xM3) sublineages defined by five informative SNPs, designated SA04, SA05, SA02, SA03 and SA29. Within the Q-M3, sublineage Q-SA04 was mostly found in individuals from ethnic groups belonging to the Tukanoan linguistic family in the northwest Amazon, whereas sublineage Q-SA05 was found in Peruvian and Bolivian Amazon ethnic groups. Within Q-L54*, the derived sublineages Q-SA03 and Q-SA02 were exclusively found among Coyaima individuals (Cariban linguistic family) from Colombia, while Q-SA29 was found only in Maxacali individuals (Jean linguistic family) from southeast Brazil. Furthermore, we validated the usefulness of several published SNPs among indigenous South Americans. This new Y chromosome haplogroup Q phylogeny offers an informative paternal genealogy to investigate the pre-Columbian history of South America.Journal of Human Genetics advance online publication, 31 March 2016; doi:10.1038/jhg.2016.26. PMID:27030145

  15. Pancreatic cell tracing, lineage tagging and targeted genetic manipulations in multiple cell types using pancreatic ductal infusion of adeno-associated viral vectors and/or cell-tagging dyes.

    Science.gov (United States)

    Xiao, Xiangwei; Guo, Ping; Prasadan, Krishna; Shiota, Chiyo; Peirish, Lauren; Fischbach, Shane; Song, Zewen; Gaffar, Iljana; Wiersch, John; El-Gohary, Yousef; Husain, Sohail Z; Gittes, George K

    2014-12-01

    Genetic manipulations, with or without lineage tracing for specific pancreatic cell types, are very powerful tools for studying diabetes, pancreatitis and pancreatic cancer. Nevertheless, the use of Cre/loxP systems to conditionally activate or inactivate the expression of genes in a cell type- and/or temporal-specific manner is not applicable to cell tracing and/or gene manipulations in more than one lineage at a time. Here we report a technique that allows efficient delivery of dyes for cell tagging into the mouse pancreas through the duct system, and that also delivers viruses carrying transgenes or siRNA under a specific promoter. When this technique is applied in genetically modified mice, it enables the investigator to perform either double lineage tracing or cell lineage tracing combined with gene manipulation in a second lineage. The technique requires <40 min.

  16. The complete mitochondrial genome of the cryptic "lineage A" big-fin reef squid, Sepioteuthis lessoniana (Cephalopoda: Loliginidae) in Indo-West Pacific.

    Science.gov (United States)

    Hsiao, Chung-Der; Shen, Kang-Ning; Ching, Tzu-Yun; Wang, Ya-Hsien; Ye, Jeng-Jia; Tsai, Shiou-Yi; Wu, Shan-Chun; Chen, Ching-Hung; Wang, Chia-Hui

    2016-07-01

    In this study, the complete mitogenome sequence of the cryptic "lineage A" big-fin reef squid, Sepioteuthis lessoniana (Cephalopoda: Loliginidae) has been sequenced by the next-generation sequencing method. The assembled mitogenome consists of 16,605 bp, which includes 13 protein-coding genes, 22 transfer RNAs, and 2 ribosomal RNAs genes. The overall base composition of "lineage A" S. lessoniana is 37.5% for A, 17.4% for C, 9.1% for G, and 35.9% for T and shows 87% identities to "lineage C" S. lessoniana. It is also noticed by its high T + A content (73.4%), two non-coding regions with TA tandem repeats. The complete mitogenome of the cryptic "lineage A" S. lessoniana provides essential and important DNA molecular data for further phylogeography and evolutionary analysis for big-fin reef squid species complex. PMID:26016882

  17. Single cell lineage analysis of mouse embryonic stem cells at the exit from pluripotency

    Directory of Open Access Journals (Sweden)

    Jamie Trott

    2013-08-01

    Understanding how interactions between extracellular signalling pathways and transcription factor networks influence cellular decision making will be crucial for understanding mammalian embryogenesis and for generating specialised cell types in vitro. To this end, pluripotent mouse Embryonic Stem (mES cells have proven to be a useful model system. However, understanding how transcription factors and signalling pathways affect decisions made by individual cells is confounded by the fact that measurements are generally made on groups of cells, whilst individual mES cells differentiate at different rates and towards different lineages, even in conditions that favour a particular lineage. Here we have used single-cell measurements of transcription factor expression and Wnt/β-catenin signalling activity to investigate their effects on lineage commitment decisions made by individual cells. We find that pluripotent mES cells exhibit differing degrees of heterogeneity in their expression of important regulators from pluripotency, depending on the signalling environment to which they are exposed. As mES cells differentiate, downregulation of Nanog and Oct4 primes cells for neural commitment, whilst loss of Sox2 expression primes cells for primitive streak commitment. Furthermore, we find that Wnt signalling acts through Nanog to direct cells towards a primitive streak fate, but that transcriptionally active β-catenin is associated with both neural and primitive streak commitment. These observations confirm and extend previous suggestions that pluripotency genes influence lineage commitment and demonstrate how their dynamic expression affects the direction of lineage commitment, whilst illustrating two ways in which the Wnt signalling pathway acts on this network during cell fate assignment.

  18. Inferring duplications, losses, transfers and incomplete lineage sorting with nonbinary species trees

    Science.gov (United States)

    Stolzer, Maureen; Lai, Han; Xu, Minli; Sathaye, Deepa; Vernot, Benjamin; Durand, Dannie

    2012-01-01

    Motivation: Gene duplication (D), transfer (T), loss (L) and incomplete lineage sorting (I) are crucial to the evolution of gene families and the emergence of novel functions. The history of these events can be inferred via comparison of gene and species trees, a process called reconciliation, yet current reconciliation algorithms model only a subset of these evolutionary processes. Results: We present an algorithm to reconcile a binary gene tree with a nonbinary species tree under a DTLI parsimony criterion. This is the first reconciliation algorithm to capture all four evolutionary processes driving tree incongruence and the first to reconcile non-binary species trees with a transfer model. Our algorithm infers all optimal solutions and reports complete, temporally feasible event histories, giving the gene and species lineages in which each event occurred. It is fixed-parameter tractable, with polytime complexity when the maximum species outdegree is fixed. Application of our algorithms to prokaryotic and eukaryotic data show that use of an incomplete event model has substantial impact on the events inferred and resulting biological conclusions. Availability: Our algorithms have been implemented in Notung, a freely available phylogenetic reconciliation software package, available at http://www.cs.cmu.edu/~durand/Notung. Contact: mstolzer@andrew.cmu.edu PMID:22962460

  19. Integrin αv in the mechanical response of osteoblast lineage cells

    Energy Technology Data Exchange (ETDEWEB)

    Kaneko, Keiko [Department of Bone and Joint Disease, National Center for Geriatrics and Gerontology, Obu, Aichi 474-8511 (Japan); Ito, Masako [Medical Work-Life-Balance Center, Nagasaki University Hospital, Nagasaki 852-8501 (Japan); Naoe, Yoshinori [Department of Mechanism of Aging, National Center for Geriatrics and Gerontology, Obu, Aichi 474-8511 (Japan); Lacy-Hulbert, Adam [Department of Pediatrics, Massachusetts General Hospital, Boston, MA 02114 (United States); Ikeda, Kyoji, E-mail: kikeda@ncgg.go.jp [Department of Bone and Joint Disease, National Center for Geriatrics and Gerontology, Obu, Aichi 474-8511 (Japan)

    2014-05-02

    Highlights: • Deletion of integrin αv in osteoblast lineage results in an impaired SOST response to loading in vivo. • c-Src–p130Cas–JNK–YAP/TAZ is activated via integrin αv on osteoblasts in response to FSS. • Deletion of integrin αv in osteoblasts results in impaired responses to mechanical stimulation. • Integrin αv is a key component of the mechanosensing machinery in bone. - Abstract: Although osteoblast lineage cells, especially osteocytes, are thought to be a primary mechanosensory cell in bone, the identity of the mechano-receptor and downstream mechano-signaling pathways remain largely unknown. Here we show using osteoblastic cell model of mechanical stimulation with fluid shear stress that in the absence of integrin αv, phosphorylation of the Src substrate p130Cas and JNK was impaired, culminating in an inhibition of nuclear translocation of YAP/TAZ and subsequent transcriptional activation of target genes. Targeted deletion of the integrin αv in osteoblast lineage cells results in an attenuated response to mechanical loading in terms of Sost gene expression, indicative of a role for integrin αv in mechanoreception in vivo. Thus, integrin αv may be integral to a mechanosensing machinery in osteoblastic cells and involved in activation of a Src–JNK–YAP/TAZ pathway in response to mechanical stimulation.

  20. Introgression of mitochondrial DNA among lineages in a hybridogenetic ant.

    Science.gov (United States)

    Darras, Hugo; Aron, Serge

    2015-02-01

    We report a remarkable pattern of incongruence between nuclear and mitochondrial variations in a social insect, the desert ant Cataglyphis hispanica. This species reproduces by social hybridogenesis. In all populations, two distinct genetic lineages coexist; non-reproductive workers develop from hybrid crosses between the lineages, whereas reproductive offspring (males and new queens) are typically produced asexually by parthenogenesis. Genetic analyses based on nuclear markers revealed that the two lineages remain highly differentiated despite constant hybridization for worker production. Here, we show that, in contrast with nuclear DNA, mitochondrial DNA (mtDNA) does not recover the two lineages as monophyletic. Rather, mitochondrial haplotypes cluster according to their geographical origin. We argue that this cytonuclear incongruence stems from introgression of mtDNA among lineages, and review the mechanisms likely to explain this pattern under social hybridogenesis.

  1. H3K27me3 Does Not Orchestrate the Expression of Lineage-Specific Markers in hESC-Derived Hepatocytes In Vitro.

    Science.gov (United States)

    Vanhove, Jolien; Pistoni, Mariaelena; Welters, Marc; Eggermont, Kristel; Vanslembrouck, Veerle; Helsen, Nicky; Boon, Ruben; Najimi, Mustapha; Sokal, Etienne; Collas, Philippe; Voncken, J Willem; Verfaillie, Catherine M

    2016-08-01

    Although pluripotent stem cells can be differentiated into the hepatocyte lineages, such cells retain an immature phenotype. As the chromatin state of regulatory regions controls spatiotemporal gene expression during development, we evaluated changes in epigenetic histone marks in lineage-specific genes throughout in vitro hepatocyte differentiation from human embryonic stem cells (hESCs). Active acetylation and methylation marks at promoters and enhancers correlated with progressive changes in gene expression. However, repression-associated H3K27me3 marks at these control regions showed an inverse correlation with gene repression during transition from hepatic endoderm to a hepatocyte-like state. Inhibitor of Enhancer of Zeste Homolog 2 (EZH2) reduced H3K27me3 decoration but did not improve hepatocyte maturation. Thus, H3K27me3 at regulatory regions does not regulate transcription and appears dispensable for hepatocyte lineage differentiation of hESCs in vitro. PMID:27477635

  2. [Dipetalonema lineage. New attempt at classification].

    Science.gov (United States)

    Chabaud, A G; Bain, O

    1976-01-01

    Through comparing the morphological evolution to the host range and the geographical distribution we can suggest Dipetalonema sensu-largo may be interpreted as a gondwanian lineage which may have evolved after the three main austral continents drifted apart. Therefore, we propose the following systematic splitting: --Sprattia n.gen., type species: S. venacavincola parasite of Australian Marsupials, which may be related to Litomosa; --Breinlia Yorke and Maplestone, 1926, and Breinlia (Johnstonema) (Yeh, 1957), parasite of Australian Marsupials; --Skrjabinofilaria (Travassos, 1925), parasite of American Marsupials; --Macdonaldius (Khanna, 1933), parasite of American Reptiles; --Dipetalonema (Orihelia) n.sub. gen., type species: D. (O.) anticlava, parasite of Dasypodidae; --Dipetalonema (Acanthocheilonema) (Cobbold, 1870), parasite of Insectivora, Carnivora, Pinnipedia, sometimes Rodents; --Dipetalonema (Molinema) (Freitas and Lent, 1939), parasite of Caviomorpha and Beavers; --Dipetalonema (Loxodontofilaria) (Berghe and Gillain, 1939), parasite of Ethiopian Ungulates; --Dipetalonema (Chenofilaria) (Kou, 1958), parasite of Asiatic Pholidota and Australian Marsupials; --Dipetalonema (Dipetalonema) (Diesing, 1861), parasite of American Primates; --Monanema Anteson, 1968, parasite of Rodents other than Cariomorpha; --Ackertia (Vaz, 1934), parasite of Caviomorpha; --Tetrapetalonema (Sandnema) n.sub.gen., type species: T. (S.) digitata, parasite of Asiatic Insectivora and Primates; --Tetrapetalonema (Tetrapetalonema) (Faust, 1935), parasite of Tupaidae, Platyrhinii, and, sometimes, American Rodents and Carnivora; --Tetrapetalonema (Esslingeria) n. sub.gen., type species: T. (E.) perstans, parasite of African African Anthropoidea and Humans; --Filarissima (Chabaud, 1974), parasite of Caviomorpha.

  3. Micromere lineages in the glossiphoniid leech Helobdella

    Science.gov (United States)

    Huang, Francoise Z.; Kang, Dongmin; Ramirez-Weber, Felipe-Andres; Bissen, Shirley T.; Weisblat, David A.

    2002-01-01

    In leech embryos, segmental mesoderm and ectoderm arise from teloblasts by lineages that are already relatively well characterized. Here, we present data concerning the early divisions and the definitive fate maps of the micromeres, a group of 25 small cells that arise during the modified spiral cleavage in leech (Helobdella robusta) and contribute to most of the nonsegmental tissues of the adult. Three noteworthy results of this work are as follows. (1) The c"' and dm' clones (3d and 3c in traditional nomenclature) give rise to a hitherto undescribed network of fibers that run from one end of the embryo to the other. (2) The clones of micromeres b" and b"' (2b and 3b in traditional nomenclature) die in normal development; the b" clone can be rescued to assume the normal c" fate if micromere c" or its clone are ablated in early development. (3) Two qualitative differences in micromere fates are seen between H. robusta (Sacramento) and another Helobdella sp. (Galt). First, in Helobdella sp. (Galt), the clone of micromere b" does not normally die, and contributes a subset of the cells arising exclusively from c" in H. robusta (Sacramento). Second, in Helobdella sp. (Galt), micromere c"' makes no definitive contribution, whereas micromere dm' gives rise to cells equivalent to those arising from c"' and dm' in H. robusta (Sacramento).

  4. Potential for Chemolithoautotrophy Among Ubiquitous Bacteria Lineages in the Dark Ocean

    Science.gov (United States)

    Swan, Brandon K.; Martinez-Garcia, Manuel; Preston, Christina M.; Sczyrba, Alexander; Woyke, Tanja; Lamy, Dominique; Reinthaler, Thomas; Poulton, Nicole J.; Masland, E. Dashiell P.; Gomez, Monica Lluesma; Sieracki, Michael E.; DeLong, Edward F.; Herndl, Gerhard J.; Stepanauskas, Ramunas

    2011-09-01

    Recent studies suggest that unidentified prokaryotes fix inorganic carbon at globally significant rates in the immense dark ocean. Using single-cell sorting and whole-genome amplification of prokaryotes from two subtropical gyres, we obtained genomic DNA from 738 cells representing most cosmopolitan lineages. Multiple cells of Deltaproteobacteria cluster SAR324, Gammaproteobacteria clusters ARCTIC96BD-19 and Agg47, and some Oceanospirillales from the lower mesopelagic contained ribulose-1,5-bisphosphate carboxylase-oxygenase and sulfur oxidation genes. These results corroborated community DNA and RNA profiling from diverse geographic regions. The SAR324 genomes also suggested C1 metabolism and a particle-associated life-style. Microautoradiography and fluorescence in situ hybridization confirmed bicarbonate uptake and particle association of SAR324 cells. Our study suggests potential chemolithoautotrophy in several uncultured Proteobacteria lineages that are ubiquitous in the dark oxygenated ocean and provides new perspective on carbon cycling in the ocean’s largest habitat.

  5. The mitochondrial genomes of three lineages of Asian yellow pond turtle, Mauremys mutica.

    Science.gov (United States)

    Zhao, Jian; Li, Wei; Zhang, Dandan; Wen, Ping; Zhu, Xinping

    2016-07-01

    The complete mitochondrial genomes of three lineages (N, TW and S) of Mauremys mutica are determined in this study. The total lengths of the mitogenomes were 16,758 bp for N, 16 500bp for TW, and 16 494bp for S. The nucleotide composition was 26.3-27% for T, 26.2-26.8% for C, and 33.8-33.9% for A. The genomes encoded 37 genes typically found in other vertebrates. Three CSBs were identified, and the CSB1 were variable. A long tandem repeats of (TTATTATA) 30 were found in the control region of N mitogenome, but none in TW and S lineage. These sequences would be useful for the phylogenetic and conservation studies of Asian endangered turtles. PMID:26061338

  6. A New Miocene-Divergent Lineage of Old World Racer Snake from India.

    Directory of Open Access Journals (Sweden)

    Zeeshan A Mirza

    Full Text Available A distinctive early Miocene-divergent lineage of Old world racer snakes is described as a new genus and species based on three specimens collected from the western Indian state of Gujarat. Wallaceophis gen. et. gujaratenesis sp. nov. is a members of a clade of old world racers. The monotypic genus represents a distinct lineage among old world racers is recovered as a sister taxa to Lytorhynchus based on ~3047bp of combined nuclear (cmos and mitochondrial molecular data (cytb, ND4, 12s, 16s. The snake is distinct morphologically in having a unique dorsal scale reduction formula not reported from any known colubrid snake genus. Uncorrected pairwise sequence divergence for nuclear gene cmos between Wallaceophis gen. et. gujaratenesis sp. nov. other members of the clade containing old world racers and whip snake is 21-36%.

  7. The F-box-containing protein UFO and AGAMOUS participate in antagonistic pathways governing early petal development in Arabidopsis

    OpenAIRE

    Durfee, Tim; Roe, Judith L.; Sessions, R. Allen; Inouye, Carla; Serikawa, Kyle; Feldmann, Kenneth A.; Weigel, Detlef; Zambryski, Patricia C.

    2003-01-01

    The UNUSUAL FLORAL ORGANS (UFO) gene is required for multiple processes in the developing Arabidopsis flower, including the proper patterning and identity of both petals and stamens. The gene encodes an F-box-containing protein, UFO, which interacts physically and genetically with the Skp1 homolog, ASK1. In this report, we describe four ufo alleles characterized by the absence of petals, which uncover another role for UFO in promoting second whorl development. This UFO...

  8. Description, molecular characterisation, diagnostics and life cycle of Plasmodium elongatum (lineage pERIRUB01), the virulent avian malaria parasite.

    Science.gov (United States)

    Palinauskas, Vaidas; Žiegytė, Rita; Iezhova, Tatjana A; Ilgūnas, Mikas; Bernotienė, Rasa; Valkiūnas, Gediminas

    2016-10-01

    Plasmodium elongatum causes severe avian malaria and is distributed worldwide. This parasite is of particular importance due to its ability to develop and cause lethal malaria not only in natural hosts, but also in non-adapted endemic birds such as the brown kiwi and different species of penguins. Information on vectors of this infection is available but is contradictory. PCR-based analysis indicated the possible existence of a cluster of closely related P. elongatum lineages which might differ in their ability to develop in certain mosquitoes and birds. This experimental study provides information about molecular and morphological characterisation of a virulent P. elongatum strain (lineage pERIRUB01) isolated from a naturally infected European robin, Erithacus rubecula. Phylogenetic analysis based on partial cytochrome b gene sequences showed that this parasite lineage is closely related to P. elongatum (lineage pGRW6). Blood stages of both parasite lineages are indistinguishable, indicating that they belong to the same species. Both pathogens develop in experimentally infected canaries, Serinus canaria, causing death of the hosts. In both these lineages, trophozoites and erythrocytic meronts develop in polychromatic erythrocytes and erythroblasts, gametocytes parasitize mature erythrocytes, exoerythrocytic stages develop in cells of the erythrocytic series in bone marrow and are occasionally reported in spleen and liver. Massive infestation of bone marrow cells is the main reason for bird mortality. We report here on syncytium-like remnants of tissue meronts, which slip out of the bone marrow into the peripheral circulation, providing evidence that the syncytia can be a template for PCR amplification. This finding contributes to better understanding positive PCR amplifications in birds when parasitemia is invisible and improved diagnostics of abortive haemosporidian infections. Sporogony of P. elongatum (pERIRUB01) completes the cycle and sporozoites develop in

  9. How old are the rove beetles (Insecta: Coleoptera: Staphylinidae) and their lineages? Seeking an answer with DNA.

    Science.gov (United States)

    Zhang, Xi; Zhou, Hong-Zhang

    2013-06-01

    The phylogeny and related evolutionary history of rove beetles (Coleoptera, Staphylinidae) remain unclear. This study provides phylogenetic analyses for the family based on three genes (mitochondrial COI, nuclear protein-coding wingless and a portion of the ribosomal 28S rDNA) including 2413 bp for 104 taxa representing most major staphylinid lineages. The subfamilies Oxyporinae, Paederinae, Steninae, and Proteininae are all well-supported clades, as evidenced by all three inference methods, namely maximum parsimony, Bayesian inference, and maximum likelihood. From fossils available for calibration, the divergence time of the main lineages in the family is estimated based on an uncorrelated lognormal relaxed molecular clock analysis method. The molecular clock analysis suggests that the family Staphylinidae dates from approximately the Early Triassic epoch and the most lineages of the family started to radiate from the Late Jurassic to the Early Paleogene.

  10. Lineage-specific expression of bestrophin-2 and bestrophin-4 in human intestinal epithelial cells.

    Directory of Open Access Journals (Sweden)

    Go Ito

    Full Text Available Intestinal epithelial cells (IECs regulate the absorption and secretion of anions, such as HCO3(- or Cl(-. Bestrophin genes represent a newly identified group of calcium-activated Cl(- channels (CaCCs. Studies have suggested that, among the four human bestrophin-family genes, bestrophin-2 (BEST2 and bestrophin-4 (BEST4 might be expressed within the intestinal tissue. Consistently, a study showed that BEST2 is expressed by human colonic goblet cells. However, their precise expression pattern along the gastrointestinal tract, or the lineage specificity of the cells expressing these genes, remains largely unknown. Here, we show that BEST2 and BEST4 are expressed in vivo, each in a distinct, lineage-specific manner, in human IECs. While BEST2 was expressed exclusively in colonic goblet cells, BEST4 was expressed in the absorptive cells of both the small intestine and the colon. In addition, we found that BEST2 expression is significantly down-regulated in the active lesions of ulcerative colitis, where goblet cells were depleted, suggesting that BEST2 expression is restricted to goblet cells under both normal and pathologic conditions. Consistently, the induction of goblet cell differentiation by a Notch inhibitor, LY411575, significantly up-regulated the expression of not BEST4 but BEST2 in MUC2-positive HT-29 cells. Conversely, the induction of absorptive cell differentiation up-regulated the expression of BEST4 in villin-positive Caco-2 cells. In addition, we found that the up- or down-regulation of Notch activity leads to the preferential expression of either BEST4 or BEST2, respectively, in LS174T cells. These results collectively confirmed that BEST2 and BEST4 could be added to the lineage-specific genes of humans IECs due to their abilities to clearly identify goblet cells of colonic origin and a distinct subset of absorptive cells, respectively.

  11. Instruction of hematopoietic lineage choice by cytokine signaling

    Energy Technology Data Exchange (ETDEWEB)

    Endele, Max; Etzrodt, Martin; Schroeder, Timm, E-mail: timm.schroeder@bsse.ethz.ch

    2014-12-10

    Hematopoiesis is the cumulative consequence of finely tuned signaling pathways activated through extrinsic factors, such as local niche signals and systemic hematopoietic cytokines. Whether extrinsic factors actively instruct the lineage choice of hematopoietic stem and progenitor cells or are only selectively allowing survival and proliferation of already intrinsically lineage-committed cells has been debated over decades. Recent results demonstrated that cytokines can instruct lineage choice. However, the precise function of individual cytokine-triggered signaling molecules in inducing cellular events like proliferation, lineage choice, and differentiation remains largely elusive. Signal transduction pathways activated by different cytokine receptors are highly overlapping, but support the production of distinct hematopoietic lineages. Cellular context, signaling dynamics, and the crosstalk of different signaling pathways determine the cellular response of a given extrinsic signal. New tools to manipulate and continuously quantify signaling events at the single cell level are therefore required to thoroughly interrogate how dynamic signaling networks yield a specific cellular response. - Highlights: • Recent studies provided definite proof for lineage-instructive action of cytokines. • Signaling pathways involved in hematopoietic lineage instruction remain elusive. • New tools are emerging to quantitatively study dynamic signaling networks over time.

  12. Stat3 inhibition in neural lineage cells.

    Science.gov (United States)

    Chiba, Tomohiro; Mack, Laura; Delis, Natalia; Brill, Boris; Groner, Bernd

    2012-06-01

    Abstract Deregulation of signal transducer and activator of transcription 3 (Stat3) is attracting attentions in neurological disorders of elderly populations, e.g., Stat3 is inactivated in hippocampal neurons of Alzheimer's disease (AD) brains, whereas it is often constitutively activated in glioblastoma multiforme (GBM), correlating with poor prognosis. Stat3-inhibiting drugs have been intensively developed for chemotherapy based on the fact that GBM, in many cases, are "addicted" to Stat3 activation. Stat3 inhibitors, however, potentially have unfavorable side effects on postmitotic neurons, normal permanent residents in the central nervous system. It is, therefore, of great importance to address detailed cellular responses of neural lineage cells including normal neurons, astrocytes, and neuronal/glial cancer cell lines to several classes of Stat3 inhibitors focusing on their effective concentrations. Here, we picked up five human and mouse cancer cell lines (Neuro-2a and SH-SY5Y neuroblastoma cell lines and Tu-9648, U-87MG, and U-373MG glioblastoma cell lines) and treated with various Stat3 inhibitors. Among them, Stattic, FLLL31, and resveratrol potently suppressed P-Stat3 and cell viability in all the tested cell lines. Stat3 knockdown or expression of dominant-negative Stat3 further sensitized cells to the inhibitors. Expression of familial AD-related mutant amyloid precursor protein sensitized neuronal cells, not glial cells, to Stat3 inhibitors by reducing P-Stat3 levels. Primary neurons and astrocytes also responded to Stat3 inhibitors with similar sensitivities to those observed in cancer cell lines. Thus, Stat3 inhibitors should be carefully targeted to GBM cells to avoid potential neurotoxicity leading to AD-like neuropsychiatric dysfunctions. PMID:25436682

  13. Phylogeography of the tropical planktonic foraminifera lineage globigerinella reveals isolation inconsistent with passive dispersal by ocean currents.

    Directory of Open Access Journals (Sweden)

    Agnes K M Weiner

    Full Text Available Morphologically defined species of marine plankton often harbor a considerable level of cryptic diversity. Since many morphospecies show cosmopolitan distribution, an understanding of biogeographic and evolutionary processes at the level of genetic diversity requires global sampling. We use a database of 387 single-specimen sequences of the SSU rDNA of the planktonic foraminifera Globigerinella as a model to assess the biogeographic and phylogenetic distributions of cryptic diversity in marine microplankton on a global scale. Our data confirm the existence of multiple, well isolated genetic lineages. An analysis of their abundance and distribution indicates that our sampling is likely to approximate the actual total diversity. Unexpectedly, we observe an uneven allocation of cryptic diversity among the phylogenetic lineages. We show that this pattern is neither an artifact of sampling intensity nor a function of lineage age. Instead, we argue that it reflects an ongoing speciation process in one of the three major lineages. Surprisingly, four of the six genetic types in the hyperdiverse lineage are biogeographically restricted to the Indopacific. Their mutual co-occurrence and their hierarchical phylogenetic structure provide no evidence for an origin through sudden habitat fragmentation and their limitation to the Indopacific challenges the view of a global gene flow within the warm-water provinces. This phenomenon shows that passive dispersal is not sufficient to describe the distribution of plankton diversity. Rather, these organisms show differentiated distribution patterns shaped by species interactions and reflecting phylogenetic contingency with unique histories of diversification rates.

  14. Fast and scalable inference of multi-sample cancer lineages.

    KAUST Repository

    Popic, Victoria

    2015-05-06

    Somatic variants can be used as lineage markers for the phylogenetic reconstruction of cancer evolution. Since somatic phylogenetics is complicated by sample heterogeneity, novel specialized tree-building methods are required for cancer phylogeny reconstruction. We present LICHeE (Lineage Inference for Cancer Heterogeneity and Evolution), a novel method that automates the phylogenetic inference of cancer progression from multiple somatic samples. LICHeE uses variant allele frequencies of somatic single nucleotide variants obtained by deep sequencing to reconstruct multi-sample cell lineage trees and infer the subclonal composition of the samples. LICHeE is open source and available at http://viq854.github.io/lichee .

  15. The origin of widespread species in a poor dispersing lineage (diving beetle genus Deronectes)

    Science.gov (United States)

    García-Vázquez, David

    2016-01-01

    In most lineages, most species have restricted geographic ranges, with only few reaching widespread distributions. How these widespread species reached their current ranges is an intriguing biogeographic and evolutionary question, especially in groups known to be poor dispersers. We reconstructed the biogeographic and temporal origin of the widespread species in a lineage with particularly poor dispersal capabilities, the diving beetle genus Deronectes (Dytiscidae). Most of the ca. 60 described species of Deronectes have narrow ranges in the Mediterranean area, with only four species with widespread European distributions. We sequenced four mitochondrial and two nuclear genes of 297 specimens of 109 different populations covering the entire distribution of the four lineages of Deronectes, including widespread species. Using Bayesian probabilities with an a priori evolutionary rate, we performed (1) a global phylogeny/phylogeography to estimate the relationships of the main lineages within each group and root them, and (2) demographic analyses of the best population coalescent model for each species group, including a reconstruction of the geographical history estimated from the distribution of the sampled localities. We also selected 56 specimens to test for the presence of Wolbachia, a maternally transmitted parasite that can alter the patterns of mtDNA variability. All species of the four studied groups originated in the southern Mediterranean peninsulas and were estimated to be of Pleistocene origin. In three of the four widespread species, the central and northern European populations were nested within those in the northern areas of the Anatolian, Balkan and Iberian peninsulas respectively, suggesting a range expansion at the edge of the southern refugia. In the Mediterranean peninsulas the widespread European species were replaced by vicariant taxa of recent origin. The fourth species (D. moestus) was proven to be a composite of unrecognised lineages with

  16. Sympatric speciation: perfume preferences of orchid bee lineages.

    Science.gov (United States)

    Jackson, Duncan E

    2008-12-01

    Female attraction to an environmentally derived mating signal released by male orchid bees may be tightly linked to shared olfactory preferences of both sexes. A change in perfume preference may have led to divergence of two morphologically distinct lineages.

  17. Genetic lineage tracing defines myofibroblast origin and function in the injured heart.

    Science.gov (United States)

    Kanisicak, Onur; Khalil, Hadi; Ivey, Malina J; Karch, Jason; Maliken, Bryan D; Correll, Robert N; Brody, Matthew J; J Lin, Suh-Chin; Aronow, Bruce J; Tallquist, Michelle D; Molkentin, Jeffery D

    2016-01-01

    Cardiac fibroblasts convert to myofibroblasts with injury to mediate healing after acute myocardial infarction (MI) and to mediate long-standing fibrosis with chronic disease. Myofibroblasts remain a poorly defined cell type in terms of their origins and functional effects in vivo. Here we generate Postn (periostin) gene-targeted mice containing a tamoxifen-inducible Cre for cellular lineage-tracing analysis. This Postn allele identifies essentially all myofibroblasts within the heart and multiple other tissues. Lineage tracing with four additional Cre-expressing mouse lines shows that periostin-expressing myofibroblasts in the heart derive from tissue-resident fibroblasts of the Tcf21 lineage, but not endothelial, immune/myeloid or smooth muscle cells. Deletion of periostin(+) myofibroblasts reduces collagen production and scar formation after MI. Periostin-traced myofibroblasts also revert back to a less-activated state upon injury resolution. Our results define the myofibroblast as a periostin-expressing cell type necessary for adaptive healing and fibrosis in the heart, which arises from Tcf21(+) tissue-resident fibroblasts. PMID:27447449

  18. Chloroplast phylogenomic analyses reveal the deepest-branching lineage of the Chlorophyta, Palmophyllophyceae class. nov.

    Science.gov (United States)

    Leliaert, Frederik; Tronholm, Ana; Lemieux, Claude; Turmel, Monique; DePriest, Michael S; Bhattacharya, Debashish; Karol, Kenneth G; Fredericq, Suzanne; Zechman, Frederick W; Lopez-Bautista, Juan M

    2016-01-01

    The green plants (Viridiplantae) are an ancient group of eukaryotes comprising two main clades: the Chlorophyta, which includes a wide diversity of green algae, and the Streptophyta, which consists of freshwater green algae and the land plants. The early-diverging lineages of the Viridiplantae comprise unicellular algae, and multicellularity has evolved independently in the two clades. Recent molecular data have revealed an unrecognized early-diverging lineage of green plants, the Palmophyllales, with a unique form of multicellularity, and typically found in deep water. The phylogenetic position of this enigmatic group, however, remained uncertain. Here we elucidate the evolutionary affinity of the Palmophyllales using chloroplast genomic, and nuclear rDNA data. Phylogenetic analyses firmly place the palmophyllalean Verdigellas peltata along with species of Prasinococcales (prasinophyte clade VI) in the deepest-branching clade of the Chlorophyta. The small, compact and intronless chloroplast genome (cpDNA) of V. peltata shows striking similarities in gene content and organization with the cpDNAs of Prasinococcales and the streptophyte Mesostigma viride, indicating that cpDNA architecture has been extremely well conserved in these deep-branching lineages of green plants. The phylogenetic distinctness of the Palmophyllales-Prasinococcales clade, characterized by unique ultrastructural features, warrants recognition of a new class of green plants, Palmophyllophyceae class. nov. PMID:27157793

  19. Lineage mapping identifies molecular and architectural similarities between the larval and adult Drosophila central nervous system

    Science.gov (United States)

    Lacin, Haluk; Truman, James W

    2016-01-01

    Neurogenesis in Drosophila occurs in two phases, embryonic and post-embryonic, in which the same set of neuroblasts give rise to the distinct larval and adult nervous systems, respectively. Here, we identified the embryonic neuroblast origin of the adult neuronal lineages in the ventral nervous system via lineage-specific GAL4 lines and molecular markers. Our lineage mapping revealed that neurons born late in the embryonic phase show axonal morphology and transcription factor profiles that are similar to the neurons born post-embryonically from the same neuroblast. Moreover, we identified three thorax-specific neuroblasts not previously characterized and show that HOX genes confine them to the thoracic segments. Two of these, NB2-3 and NB3-4, generate leg motor neurons. The other neuroblast is novel and appears to have arisen recently during insect evolution. Our findings provide a comprehensive view of neurogenesis and show how proliferation of individual neuroblasts is dictated by temporal and spatial cues. DOI: http://dx.doi.org/10.7554/eLife.13399.001 PMID:26975248

  20. Regulation of neuronal lineage decisions by the HES-related bHLH protein REF-1.

    Science.gov (United States)

    Lanjuin, Anne; Claggett, Julia; Shibuya, Mayumi; Hunter, Craig P; Sengupta, Piali

    2006-02-01

    Members of the HES subfamily of bHLH proteins play crucial roles in neural patterning via repression of neurogenesis. In C. elegans, loss-of-function mutations in ref-1, a distant nematode-specific member of this subfamily, were previously shown to cause ectopic neurogenesis from postembryonic lineages. However, while the vast majority of the nervous system in C. elegans is generated embryonically, the role of REF-1 in regulating these neural lineage decisions is unknown. Here, we show that mutations in ref-1 result in the generation of multiple ectopic neuron types derived from an embryonic neuroblast. In wild-type animals, neurons derived from this sublineage are present in a left/right symmetrical manner. However, in ref-1 mutants, while the ectopically generated neurons exhibit gene expression profiles characteristic of neurons on the left, they are present only on the right side. REF-1 functions in a Notch-independent manner to regulate this ectopic lineage decision. We also demonstrate that loss of REF-1 function results in defective differentiation of an embryonically generated serotonergic neuron type. These results indicate that REF-1 functions in both Notch-dependent and independent pathways to regulate multiple developmental decisions in different neuronal sublineages.